1O7ZA

Crystal structure of ip-10 t-form
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
CTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Oligomeric Forms of the Ip-10/Cxcl10 Chemokine
pubmed doi rcsb
molecule tags Chemokine
molecule keywords SMALL INDUCIBLE CYTOKINE B10
total genus 9
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1o7zA00
5CMDA 1WTVA 1A15A 1EOTA 3P7JA 3UI2A 2MGSA 5E4WC 2KOLA 1WTOA 1DOLA 4IUTA 2KUMA 2B2YC 1HUNA 2NWGA 3TN2A 2X6GA 2Q8TA 1X32A 1U4LA 1BO0A 2L12A 4HCSA 3TZDA 2B2VA 2IL8A 2NZ1D 1EIHA 2MJ8A 1G2SA 1KNAA 2B2WC 2BDNA 5T1GA 1NAPA 1GUWA 1VMPA 1NCVA 3I90A 2K01A 1WD1A 1PFMA 2FJ2A 2X6LA 3QO2A 4RA8A 2JYOA 2D9UA 2SDFA 5EPLA 1U4PA 4IURA 4RWSC 1JE4A 2L1BA 5EJWA 2B2UA 3IFDA 1PFNA 1AP0A 2DY8A 4NW2A 4R9WA 3I8ZA 5CBAE 1U4MA 2MPMA 3FPUB 1MI2A 1CA6A 3DEOA 1ILPA 1U4RA 2JP1A 1MGSA 1B2TA 1WVLA 1QE6A 5T1IA 2L4NA 1DOKA 1CA5A 1SSOA 3KBXA 1G91A 1NR4A 2EE1A 4CJ1B 2KEDA 1E0BA 3SVMA 2FFKB 1O7YA 2HDMA 3R93A 5CORA 2H1EA 4HSVA 4U68A 1HHVA 1B53A 2K04A 4X3KA 4ZKBB 1AZQA 1HFGA 1BNZA 2EOTA 1B3AA 2B2YA 2K03A 2DY7A 3DM1A 3F2UA 1AZPA 5EPJA 1RODA 4IUVA 1EIGA 5CBEE 2KECA 1ESRA 1SDFA 4UAIA 2HCIA 3LWEA 1O80A 2KVMA 4X3TA 4XDXA 4CJ0B 3FDTA 1WTWA 3I91A 1BF4A 1HRJA 4ZLTF 2N88A 5JJZA 1J8IA 1ML0D 1PFBA 3IL8A 4MHEA 2J7ZA 5COYA 5DNFA 2RSNA 2EPBA 1B4OA 4X3UA 5D65A 5EKIA 1XYIA 2HUGA 1SAPA 4HEDA 1WTPA 1HA6A 1F9RA 1LV9A 1ZXTA 1DONA 4QUFA 1RJTA 1IKMA 4OIKA 1EQTA 1F9PA 2X69A 4R8IA 1EL0A 1X3PA 1B50A 3N52A 4OIJA 4O42A 1IKLA 2N55A 5EPKA 3I3CA 4ZKCB 1BBXC 2M2LA 1RTNA 1DOMA 1M8AA 2VXWA 2B2TA 2RA4A 1CM9A 4RAUC 2B2VC 2XIWA 3DEPA 4X3SA 5D14A 1ICWA 3D6WA 4CJ2C 1Q3LA 2RSOA 3MTSA 1WTQA 2FHTA 4IUPA 2B2TC 1RTOA 5EQ0A 2MP1A 3H91A 3MWYW 1ILQA 2B2WA 2HCCA 1QNKA 1S4ZA 2FMMA 4XT1B 5E4XA 1WD0A 1G2TA 3G7LA 2K1BA 4LMQD 2B2UC 1F9SA 4XT3B 1HUMA 5AFWA 1NR2A 1MSHA 4ZAIA 1O7ZA 1IL8A 2CVRA 1PLFA 1QG7A 4HAEA 1HFNA 1WTXA 2L11A 1VMCA 3GV3A 2K05A 4IUUA 2Q8RE 1MSGA 1G6ZA 1XX8A 2FINB 3Q6SA 4DN4M 1X3QA 1JICA 4IUQA 2L9HA 1C8CA 3KUPA 3GV6A 2RVLA 1PDQA 4ZK9B 3HP3A 2NYZD 3ONAB 1DZ1A 1J9OA 2R3ZA 1TVXA 2HDLA 2KEEA 1WTRA 1KNEA 2K28A 4QUCA 1RHPA 1F9QA 4MN3A 1F2LA
chains in the Genus database with same CATH superfamily
1K3BC 1Y1WH 4J15A 4YY3L 1U0LA 3L9AX 4OONA 2MFIA 2PQAA 4DR5L 3MAQA 3TZDA 1BBWA 4GN4B 5KYIA 1S5DD 2KBNA 3HKZB 3CMAA 4K0KL 4DUZL 2HIVA 4XYOA 2J0TD 3GTLH 1PFMA 2JYOA 2D9UA 2NVTH 1JJ2A 3WWVA 4L5SA 1XWEA 1MBYA 4GNXA 2F0JA 3A8IE 4AYBB 1ESFA 2DY8A 3OSOA 5ELFA 1VF7A 1VQDA 1PH2A 4K2KA 4TVAB 1X55A 5KNCA 1WVLA 1G91A 4A3BB 1SSOA 4KHZA 2VQFL 4JI8L 1BXTA 4MNOA 2F0UA 3NBHB 1LTID 1Q81C 1IW7D 3E0EA 3T13A 1KRTA 1QNUA 1K8AC 3HOWG 3I70A 3MHBA 3NTIA 1AEXA 4FF1A 4H0LC 4GKKQ 1B7YB 5CBEE 2F0IA 3S1NB 3NELA 1GUGA 4JYAL 2PI2A 3NTKA 1TR5A 2NTSA 5IWAQ 1GM5A 1HNWQ 4MHEA 1H9KA 5DNFA 4DR7Q 1II3A 3I4MH 2Z4HA 5LMNL 4R8IA 4UDUC 1D5MC 3NQIA 5I9OA 4DV1L 4FDBA 4GZYC 3GO5A 3ICEA 4A3LH 2AQ1B 5ELEA 1CT1D 4KHPL 4LFAQ 3MC0B 5FOBB 1DM0B 5JEAH 4A3JH 4A3JB 4P75A 2D2CC 1FJGQ 5ELDA 1KL9A 5M3FG 3KDFA 1XNQL 3BDOA 2RCFA 2UU9Q 4A93B 2OWOA 1PRTB 3UDFA 4JI5L 4FF4A 3Q0AA 4Q5VA 4BA1I 1G6ZA 1XX8A 1IBKQ 4X6AH 1ENAA 2QCPX 1YHAA 4JG2A 2RDGA 4ZK9B 5IE8A 1VQ6A 3HP3A 5JVH3 1Y1WG 1IBML 4MIUA 5FLXL 1D5XC 4LW1A 2ZM6L 1F2LA 1TU2B 4G7OC 3FPPA 3HOWB 5LMUL 2Z9HA 1XJVA 2PO4A 4O0AA 2Y0SG 3H0GB 1G8ZD 1XTCD 4DK1A 2RHSB 4KN7C 1V1PA 2EZVA 3QOLA 1A6XA 2IW3A 2ICIA 4B9XA 2K01A 2P5ZX 1I5FA 4J8QA 1QUQB 3A56A 2HD3A 2XVSA 3T1YQ 3VA7A 2RDHA 2PCFB 3DXJC 5GROA 1AP0A 2VW9A 1BBUA 4LF9Q 3CRKC 1KXLA 3OTOQ 1IBLL 1B1ZA 4G7HC 5JEAG 1YIJA 1LM0A 4B3SQ 1K28A 4CJ1B 1JB7A 1SYFA 1GVPA 1RL2A 3CRLC 4HJ8A 4LUVA 1D2BA 5M3FB 2TSSA 3NUCA 1UE6A 2QGQA 5HURA 1V1OA 4UAIA 3K0XA 4CKEA 4C3JG 5JJIA 3FDTA 3J81j 1OXTA 4DR3Q 3I4MG 3R2IA 1BF4A 1PYSB 3NTHA 5IGBA 3WOFA 2CCZA 1UWVA 1QUQA 2UUAL 3HOZH 4NXNQ 1N33L 4H7BA 1JJCB 1QZHA 2VY3A 4DV5Q 1HZBA 3K5NA 1TWAH 1ENFA 1EL0A 4UPAA 1QZGA 4X66Q 1U9RA 2A68C 4DR1L 5IYDG 2UXCL 3P1HA 2RDFA 2PW5A 1YEZA 2M2LA 4DR4L 2B2TA 3RZOB 4ZQ3A 2K14A 3G4SA 1OXSC 5EKKA 1GHKA 4WJWA 2Z6KC 3KF8A 5C4ZA 1STEA 3FEWX 4DAMA 4HSPA 1PZJD 3L2PA 3J80E 3AU7A 1E3PA 2FMMA 2B2UC 4XT3B 3TRZA 4J1MA 5BN3A 4IO9A 2PQEA 2DJGC 1A62A 3LX0A 3PUZA 3KBGA 3G71A 3UE1A 1XMQQ 1CK1A 4C3HB 2XGTA 3GV6A 3I4OA 2SNSA 3A55A 4ZCKA 2NYZD 1RF2D 1TVXA 2L15A 2DGYA 1SE3A 1LT6D 1NY4A 1C48A 3PUVA 1JQYD 2F0EA 1MJEA 1WTOA 1DOLA 3DWPA 4DAPA 1FD7D 1N32Q 2YYZA 1SNDA 2F3IA 2G9HD 2B8FA 1G2SA 1B9MA 2D5DA 4RCOA 3GTJB 1EYGA 1VQHA 2A19A 2E2IH 2XWBB 1WD1A 2F4VQ 3PSIA 3SK8A 4CDEC 4X62Q 1Q1EA 2LS01 4I7ZC 3IFDA 1O7IA 2C5CA 4B08A 1K0RA 2EJFC 1I50H 4K14A 2R7ZH 3KOJA 1X9NA 1QE6A 3MXGA 5T1IA 1IYJB 2KA7A 3H3VC 1NR4A 4B3ML 1R4QB 3PIP3 1NSNS 4ZYSA 2UUBL 1HPCA 3HOXH 4QIWB 1Y8NB 3VA5A 1GJXA 3E0JA 2IJ0A 5FO8B 4WJ3M 4GOPA 3F2UA 2LXKA 1N36L 1FVIA 2KHIA 3HOZG 5GADC 3R3OA 5JJZA 2E2DC 1YHBA 4JI7L 3I4NB 2VUMG 2R92G 3OMGA 4A3DB 1NTGA 1A2TA 3TEHB 1GUSA 3VR3A 3Q23A 1IKLA 5EPKA 5KEEA 1TIID 1EYCA 1KHIA 4KV6A 2XSCA 3R2TA 1PRTD 1X65A 5FLXc 1SR3A 1JCKB 4X3SA 2HHHQ 3RUZA 1PRTC 3PMFA 1LUZA 5M3MG 5C4XB 3KK7A 3RN5A 3OWEB 1QNKA 1TWAB 1PFSA 1TT2A 1CI3M 1UNSA 4YCUA 5GAEC 3F2BA 4YHHL 1PZKD 4CHTB 3ZJYC 2WB1G 2IPKD 1V1QA 2VZAA 4DV5L 1EU3A 2TMPA 3ONAB 3VR4A 4IALA 2R3ZA 4NXNL 2A6EC 2AQ2B 1DD2A 1VQ9A 1TXYA 4NDXA 2MGSA 2MUYA 5E4WC 2KOLA 2WACA 3IKJA 3MXNB 4KTAA 2AMCB 1HUNA 3I55A 4Z9CB 2AUJD 3K0YA 1BO0A 2B63H 3J7YW 2ZT9C 4KHVA 4A3LG 2JA5H 1NCVA 5IODA 5IGGA 4JW0A 5A2QE 4L5RC 3A8JE 3SGIA 2GN5A 2A6ED 3HOUG 2JA7B 2ZXOA 2F0WA 3CQZH 4M8AA 2JA6H 1FNWA 4OGQC 3ULJA 4HMJA 4UY8C 1N36Q 3DEOA 2JP1A 3P75A 1MGSA 1SEBD 3K80C 4YWMA 3SVMA 2IY5B 1V8QA 3HOYH 1IYVA 3LGJA 1CTMA 4Y7NH 3I4NG 4AYBE 1IL2A 1WCMG 2IHFA 2K03A 3KLRA 1KTKA 2F0FA 4CGYB 2GA4B 3LWEA 2CH4W 1LTTD 2R92H 2Q2UA 4P2CB 2F0LA 1HJPA 1YNXA 2C9OA 5C4HA 2G5DA 3I7FA 2EJGC 1SAPA 1DONA 1UEAB 5C5MA 5CC4A 2CWPA 3M4YA 1LTLA 3A5UA 4IN3A 2PZUA 1CQFA 4FVMA 3W1GA 1DJRD 2XIWA 5IYBH 4LF5Q 4FYDA 5CYUA 2OCEA 1EZ6A 4E6IA 2JK8A 2K6AA 2OT2A 3PUWA 3H91A 2R61A 4L63B 4QL5A 3ZYYX 4KKSA 4KLKA 3CQZB 4KY7A 1SYBA 4F88A 2UXBQ 3RLOA 2UXDL 3G7LA 4KHPQ 1J5EL 3PUXA 4JBKA 1NR2A 1PXUA 5IIFA 3E5SA 1JOKA 1TWHB 1JMCA 4IPCA 3CCQA 4IUUA 5KIXA 2Y0SB 4I65A 5IY0A 3KUPA 1Q7YC 2RVLA 3KLSX 2EYJA 3RNUA 1VQJA 2A69D 1LO5D 2XN9C 5DLQE 1HNWL 5EAYA 3DMUA 1ZKOA 3J81L 4C3HG 3S16B 2B63G 3NQTA 3A74A 4Q0FA 3HKZG 1VQOA 4LF8Q 3KDFB 3OPOA 4DV2L 4A3IH 3SXHA 3K6OA 4PNYA 1EFID 4DGZA 3LWUA 1Q46A 2VQEL 4LWCA 3ERSX 1DGSA 5L37A 3MXUA 1U4PA 4IURA 4F7XA 3QJYA 3TBIB 2JA8B 1SYEA 5M3MB 5E7NA 4PQXA 4J6HA 2QA4A 4R9WA 2R93B 5FLXE 4PMBA 1HNXL 4GN3B 1M90C 4DA2A 1FL0A 5D3DA 2B63B 3ND8A 2F0PA 4K2LA 1HHVA 1B53A 3Q22A 5CGKA 3F1ZA 1VQ7A 4PZ7A 1SNCA 2K50A 1E1OA 2JEBI 3JAME 3EQLC 3EVQA 4AIMA 3T1HQ 3WOEA 2HCIA 3OTOL 1O80A 1Y14B 2R6GA 4XDXA 1IBLQ 4LFCQ 3M4OH 1MIUA 3V2TA 1FR3A 2I5HA 3PO2H 1OXUA 5COYA 4TRDA 1CHQD 1WI5A 5IP9H 2JEAI 1UE1A 1ZXTA 3S1MB 4GN5A 2O4XA 3VDYA 4QQBX 1B50A 5BR8Q 5C0XJ 1F2ZA 2ZTDA 2BH2A 3TP5A 1I50B 1VCIA 2B2TC 2JA8H 1VQIA 3MWYW 4ZUJA 1QVGA 3SK6A 3NWSA 2NN6H 5E3FA 5J39A 1GD7A 1RCVD 4A3CH 2A68D 4BWGB 1QG7A 1YJWA 1IBKL 1HA5A 1PTOH 1VQCA 4KKTA 2D0PA 2HHHL 1XTDA 1FGBD 3M7GA 5ISRA 2NB0A 3J7A5 5JPMC 2HDLA 4QUCA 2PNHA 4BBSG 1NMGA 3CU7A 1W3SA 1HR0L 3GTQH 2I46A 2QDLA 3JAMi 4GOPB 1A3TA 5IGCA 2RHQB 1MKHA 2R93G 1X6OA 4A76A 3I90A 2X6LA 2Z4IA 3TDQA 4JV5L 4P74A 3S2HH 4EQPA 1NNXA 4IUNA 3T16A 3CCVA 4L5QA 5C6AA 5BN4A 4HJAA 4NW2A 2SNMA 2YU9B 1R9TH 4YWKA 3MEFA 3SDZA 3U9SA 2LMCB 5C4JB 2XWJB 2A74C 4A3CG 1YJ9A 4DK3C 2ES2A 4JC0A 4DV0Q 3HKSA 4DK6C 2F4VL 3PO2G 1N34Q 4M1UB 2KCNA 3FP9A 4EQ5A 2UUCL 3A7AB 4RG1A 2EVBA 1HRJA 2EYLA 2A6HD 4QGUA 1VQNA 1VF5C 2V4DA 2GVAA 4QIWE 4NP5A 4L8JA 1B4OA 4X3UA 1N32L 4OWTB 1WTPA 3K5MA 2MNAA 4LUZA 3N52A 2RQXA 3OW2A 1EOVA 1STNA 2IX3A 3QWNA 4LF6Q 1OO9B 2E5LL 2BOSA 4FF2A 4EQOA 1GHJA 1CM9A 2B2VC 4AYBG 5IYCG 5D14A 3MFGA 1XMQL 5EKLA 4NXMQ 2I5MX 2F0OA 1ILQA 3BZKA 4XT1B 2CQOA 4ZAIA 4NMZA 4HAEA 1WTXA 3ULLA 4DUYQ 1WCMH 3GTOH 1JOOA 3GTOB 3GTGB 1MSGA 4K6LA 4LJZC 5GQOA 5AJ3L 3S14H 2K5WA 1I6HH 5IT9L 4JI1L 3UDXA 3CPFA 3DWAA 2KEEA 3OW7A 1RHPA 1SRUA 1EQRA 3PO3B 1EWIA 3Q8DA 4JOIA 4JI2Q 4IFDH 2NWGA 1TWCH 4QF4A 2BE5C 3MFYA 5C3EB 1EEID 5C3WA 1JORA 2IL8A 1EQQA 1QVFA 3NWTA 5T1GA 3T4AC 1NAPA 3TP7A 2K7VA 1XMOL 1FNVA 2NZHA 4JI3L 2N78A 2FJ2A 4RA8A 4XYQA 5EPLA 5DM73 3BVMA 5EJWA 2PYKA 4AQYQ 5JJKA 4BY7B 5M5WB 4KY6A 3DHQA 2QF7A 2OQKA 4C2MB 4CDCC 5CBAE 3G6EA 3HOVG 1E2VA 3M4QA 2M00A 1ILPA 1RKNA 1U4RA 3LNNA 2ZXPA 1H9MA 4YCVA 4LF7Q 1E0BA 1I4HA 3MZ5A 2QDBA 2E8GA 2RKSA 4NB3A 1XMOQ 3OIPA 1W6KA 1CKNB 5HY6A 2B2YA 3DM1A 4A3MH 1L1OA 3BDCA 5EPJA 1RODA 1SDFA 4KKUA 1HH2P 1CKNA 1S3OA 2L55A 5M5YB 3VR5A 5JVG3 3PF5A 2UUBQ 3I91A 4Y7NB 3PQIA 3NK9A 3I73A 5EBCA 2JSOA 4KD3A 5EKIA 1B44D 3KF8B 1LTSD 2R7ZB 5ELOA 4QUFA 2RCNA 4KJOA 1Y1VH 1KIXA 4OL7A 1KDBA 3BG3A 3X3NA 1XPOA 2VUMB 5I2YA 1PYWD 1ET6A 3H0GH 1OXVA 1JR0D 5C4XG 1STAA 2B3GA 3D6WA 2FMCA 1PHJA 4PMCA 2EQSA 1D7QA 3EN2A 5EQ0A 3K5LA 1W2BA 1CZWA 3Q24A 5M3MH 1K83B 1B70B 1TWFB 1XNQQ 2F0TA 1CSPA 2E2HH 5K36H 4UP9A 3ULPA 1H95A 1HQRD 1TS4A 4LF6L 4YIJA 2E2JB 2VNUD 1G6PA 2KHSA 3PIOA 2F0VA 2Z8LA 1K3RA 3VR2A 1IZ6A 1DZ1A 3PO2B 4H44C 5IGEA 5NUCA 1KNEA 3DM3A 4JI0L 4DV1Q 3IFTA 3AEVA 5LMNQ 2EY1A 3D3RA 5M5XH 4BY1H 1BCPD 2B2YC 1V9PA 2JA5G 3S14B 3I72A 1X32A 1D1KA 1KNAA 1LACA 1GUWA 1Q1BA 5CV9A 1DCZA 3K8AA 3NEMA 2F0GA 3URYA 2VB3X 1PH9A 1I6HB 4ODGA 4DR6L 2A6HC 4IJHA 1HZCA 5HGQA 1ASYA 2IWHA 3E3XA 3SR1A 2Q8IB 3KJPA 3I8ZA 4DKAC 4EQNA 3RD4A 1WJJA 4JI8Q 2PZWA 3X3MA 1B2TA 2KENA 2QEXA 1VQ4A 1O78A 5G3LD 1HTLD 4R8NA 2EE1A 3A54A 2MQHA 5KNBA 4V190 3H3VI 4BBRH 1O7YA 2HDMA 2O2LD 1CKOA 1PTOC 1EY8A 1S5FD 4HMIA 4MTNA 1HFGA 1I4PA 3AQQA 1PH7A 4ZUIA 4BBSH 2KECA 1Y1WB 1K8GA 1XNRL 2MHVA 2ZJRA 4B3SL 4CBVA 3NBIA 3K59A 1JWSD 1T9HA 4LF9L 3KFUA 3R8BA 1IKMA 1L1OB 1D1IA 1X3EA 3AFPA 3I3CA 3H09A 5C4XH 3WDNA 3UDIA 1BBXC 4UHVA 1M8AA 3UE0A 4CDDC 2FHTA 1EQVA 4IUPA 5IP7H 5J22A 3CCUA 1ZYRC 2EYOA 1S4ZA 4GS3A 1WCMB 2CKZB 1I3QB 3PF4A 2OQ0A 5K36G 2ENBA 2RBMA 2AHOB 2EY5A 2CW0C 2Z1CA 2L11A 1ZEQX 4RGNA 4H02A 2FINB 5BR8L 4X64Q 3GP7A 3U50C 2NTTA 1YHQA 4XIGS 1VQKA 4OO1I 3MVVA 3S1NH 2L9HA 1H9JA 1YI2A 1Y8PB 1VQAA 1U5KA 4BY1G 3GDEA 2N3SA 3BYYB 3CD6A 5CMDA 4JBMA 4DNRB 5FLMH 4L6TB 3V96A 3EA6A 4IPDA 2Q8TA 4DV7Q 1LABA 1U4LA 3T53B 1EIHA 3M85A 1D8LA 1PH8A 2DUDA 1VMPA 5M5WH 3J81c 4QMGA 3BZDB 3D31A 4P73A 3C46A 3M3YH 2PPBC 5M3FH 1Z47A 5DAUA 1Q8KA 2UUCQ 1VQGA 3FVQA 3HOYB 4R4OA 1HTPA 4DNIA 3RLFA 4KK7A 1YNND 1CA6A 2PW7A 1N34L 3S1MH 4K6DA 1G51A 1JWMD 1CHPD 3TQYA 2RF4A 4EVOA 3GTPH 1NBWA 3C2PA 5EGTA 1R9TB 3F2DA 1LT5D 1T5EA 2ID0A 5C0XH 2VQEQ 4B3TL 1B3AA 3V05A 3CW2C 4B3TQ 3K7AH 4HTHA 2VL6A 2KVMA 2BA0A 5C0XI 5LL6S 1WTWA 4FXKC 3CC4A 4APVA 3W2DA 1L0YB 1KAAA 2VQFQ 1FGUA 2J7ZA 3TZUA 2MO0A 1HCZA 1RIPA 1XYIA 4ZRZA 1LV9A 3D8GA 3S1RH 1SROA 1AH9A 1EYAA 4ILWA 1GKHA 1Y69U 5FKAC 4A3BG 4ZKCB 1RDPD 1AE2A 4IPHA 3DWQA 5C3XA 1PMRA 5H1SE 1WTHA 3A0JA 4DUZQ 1LTRD 2E2JH 1VQEA 1SJHD 2ATWA 2NN6G 3HOUB 4K5XA 1LTBD 4X65Q 4OEMB 4OO1H 4JBJA 4WORA 3TS0A 1JB3A 1KLUD 5CV7A 1PH6A 4A3FB 4A3FH 5LHY1 2CQAA 4F8MA 2K05A 3GTJH 2NBFA 3D0FA 3Q6SA 1JICA 4IUQA 4RGMA 3HOYG 1IYUA 5C44B 3TREA 5A2QL 4RHRA 3KF6A 4X64L 3KLWA 2ZJPA 1B9NA 2F0DA 2E2IB 4C3IG 4DV6L 2YU9H 1F9QA 5JJLA 3AMUA 1Y1VB 1RD9D 2K5QA 1S5CD 4QCLA 1YNNC 2WAQE 3HZXA 5CV8A 4PMWA 2B2WC 4L5TA 2G9DA 1F77A 2HQEA 2WB1E 4ULLA 2V1CC 5IT9E 4OX9Q 4DAYB 3O13A 2R93H 5IOCA 2CWAA 2ICEC 1O7LA 3H6MA 1BVSA 2F0HA 3FKIH 1SMYD 2F0MA 2B2UA 3P20A 4JVZA 4IQZA 2HT1A 3OMCA 1SYCA 2A5HA 5F2DA 3S24A 3T1HL 2ZTCA 1EIYB 3KYHC 1EWCA 3R93A 1XNRQ 4TQUS 3W1BA 4BA2I 1LLRD 5JEAJ 4HSVA 2F1MA 3M4OB 3M3YB 4AQYL 1AZQA 1A3VA 2DY7A 1WFQA 4KN4C 3UDGA 2PI2E 1KC8C 4CJ0B 4DV3L 2D0OA 1VQMA 1I4RA 1HQMC 5HGTA 2N88A 4LUOA 4FXDA 2N49A 1SJED 4KJNA 3QIAA 4K5VA 4A3IB 1P8LA 4JI2L 4DAYA 1AE3A 1RJTA 1EQTA 3VYSA 2X69A 4XQNA 3S16H 1TY0A 2VUMH 4GNXC 3NBHA 1EY6A 1X3GA 3BVGA 4OXPA 1PYBA 4DV2Q 3VYTA 4FNFA 3HOVB 4JI1Q 1H9SB 1EY4A 4P71A 1I3QH 1SE8A 1H9RA 3DEPA 4NPSA 1Y8OB 4JBWA 1EWHA 2F4IA 4RCNA 1Q3LA 2JA7G 4B3RQ 1EUJA 1S5BD 3QB3A 3CCEA 1Q86C 2CFMA 5KNDA 4Y52H 1N8RC 2K1BA 3HOXG 4GKJL 2E76C 2ASBA 1SNPA 1QJOA 4RKLA 4BS9A 3C1FA 2JA5B 2BH8A 1BCPB 1UE7A 3QOJA 3CCJA 3CC2A 1YVCA 1EYDA 1X3QA 5M9OA 5I9PA 1I94L 2Q2TA 4C2MH 3K5OA 2JA9A 1RTOA 1L2FA 3GTMB 4IFDG 1DYQA 2K4KA 3U4ZA 3GTLB 2Z0SA 1KABA 4IOAA 1SLJA 3J7AV 1PTOF 3PO3G 2BDNA 2JQOA 1PA6A 2ALYB 4KY5A 3QO2A 3L7ZC 2IHEA 4RWSC 4B3MQ 4DV0L 3HOVH 2LY7A 4RMFA 3HFZB 3BYTB 1G291 1Z9FA 2O5JC 2JA6G 2WIIB 4A3GB 4GLXA 5CR3A 1CA5A 1X56A 1VQ5A 4JI4L 3CCMA 1VQBA 1SFOH 3EBEA 1BNZA 2K04A 4ZKBB 3S1RB 1C7YA 2Y0SE 1SMXA 4EX5A 1AZPA 2B39A 4IUVA 3I4NH 3I4MB 1CSQA 1TS3A 4LF4L 1F2YA 4LF7L 3BS1A 1GO3E 1E22A 2XRSD 3IL8A 3JAMc 4OWXB 4DXGA 1QWYA 1Q12A 2WAQB 4G4KA 2HUGA 1HA6A 5ELNA 2C35B 4XTCS 4O1NA 1YITA 4C56C 1DOMA 1KLGD 1EY9A 2BDOA 1ZYRD 2ZTEA 4RAUC 1E2WA 2JA7H 2E74C 3W5OA 4A3MB 5K5PA 3H15A 2EYPA 4V0BA 1HR0W 4QJFA 2MP1A 4A93H 2GVBA 3NHHA 2K32A 1WD0A 5E4XA 4EGVA 5FO9B 1CFMA 4WRDA 3TS2A 1ASZA 1HUMA 1IL8A 5C0XG 2NVQB 1PLFA 2KCCA 3KJOA 4HIKA 1ONLA 3S2DH 2R7ZG 2L0CA 1MD2D 3RR5A 1AW7A 2R92B 4RKBA 4CKCA 5C4JH 3FRPB 2NVQH 2KCMA 1OXXK 5AJ3Q 4F87A 4C3JB 4XQQA 5A35A 2UUAQ 4DUYL 1WYDA 3A7LA 4GLVB 1STYA 3UI2A 4B9WA 1KRSA 3CKIB 3FKIB 4DR3L 4IUTA 4JPBW 4DV4L 3PO3H 1PTOD 3TN2A 4RFBA 3ER0A 4C3HH 3K57A 3S1QH 3EIVA 4NXML 1SNQA 1BCPF 4LFCL 4DR2L 2JA6B 2H5XA 1UUPA 5DM63 2SDFA 3STBD 2E5LQ 5I6YA 3CHBD 3J80c 4DU9A 1PH4A 2EY2A 4OHJA 3J7AF 5IYCH 3ND9A 1U4MA 1MI2A 1GUTA 4BBRG 1TWHH 1UE5A 2K5DA 2WV6D 1DOKA 1YZ6A 4JI6Q 4A93G 4OX9L 4C1NK 4U68A 3E9HA 2WAQG 1BQQT 3BU2A 4IZ8A 4JI4Q 3CC7A 3E9IA 3GTPB 1LT3D 2A1AA 2NUCA 2K52A 1ESRA 3HOZB 4HIDA 3BDLA 1BUVT 2OTJA 1C4QA 4K8JA 1ML0D 3MEHA 2J4XA 3MXNA 2JE6I 4CKBA 1PZID 2ZM6Q 4FP5D 1CZGA 4PV1C 5JPNC 1VS0A 2ZJQA 4YWLA 4OELB 3K81C 1TQOA 4JV5Q 5FJ8G 4QY7A 1JWUD 1CUKA 5KGUA 5CV6A 1SBBB 3W3AA 1W6JA 4A4IA 4A3KH 1TWFH 3CAMA 1ICWA 4JCVE 4O2DA 3G48A 2SEBD 5TSSA 1B8AA 1J5EQ 2F3VA 2UXDQ 1EEFD 2UXBL 4A3DG 3QR8A 1BCPC 4FXGC 5I4DA 1GUNA 3CP0A 1TS2A 3RN2A 4LF5L 3TSSA 4GKJQ 1BDOA 1SXTA 4G7ZC 4JK1C 2EYFA 5I6WA 2K75A 1WTRA 2K28A 4DR7L 1VQLA 1EY5A 2A73B 1PH1A 4R4IA 3PV0A 1EY7A 1OTCA 2A69C 3HKZE 5M5YH 1LTGD 1X3FA 3MA2B 4HR7B 3SHLA 2KUMA 3GQBA 2F03A 5IYDH 1E2ZA 5FLMG 3CF5A 3IRBA 3H3VH 2QEJC 4GKKL 1NMFA 3U58A 3OOCA 5ELCA 4A3GG 2KHJA 1YNJC 2AWNA 1Y1VG 4GLAC 5GAHC 1A3UA 4HN7A 5I2XA 4BXXH 2H4OA 4YCWA 2L1BA 2JA8G 3RZOH 2JJQA 2Z6BA 4A75A 1TY2A 1PFNA 1YBYA 1XXGA 4DK0A 2MPMA 1K9MC 2E2HB 2O5IC 2IX0A 4I7AA 2NVXB 2FXQA 3KBXA 1K83H 2B8GA 2K5VA 1H9SA 1I4GA 1SYDA 1L1OC 1LT4D 1ICFB 3S1QB 1VQPA 4A3DH 1BKBA 1KD1C 3J80i 1SE4A 3T51B 3I56A 4DR5Q 3C3LA 3AB9A 1K8MA 4R1JA 3GTKB 4DR2Q 5DEHA 1FNUA 2F0SA 1HZ9A 1J8IA 1HNXQ 4HCEA 3T1YL 3CCLA 3GTQB 3D4DA 3QG1A 2CH4A 2F0QA 4DV4Q 1F9RA 2HIXA 2EDGA 1J6QA 1F9PA 5FJ8H 4UP7A 1YNJD 5D3IB 2PMZE 3CXCA 4A3IG 3HG9A 1JT8A 4ID6A 1JE5A 3H94A 4A3JG 3HGBA 4A3BH 1P16A 4OO1G 4LAAA 2XNAC 4JOIC 4DFAA 1WTQA 4BY7G 1QOHA 1PH5A 4LF8L 3DUZA 1EFWA 2EXDA 2EYHA 1G2TA 2JXMB 1XPUA 5AFWA 4LNQA 4PG3A 2NVYH 1TWGH 3VYRA 1PVOA 3IAYA 1VMCA 1PTOB 2EJMA 4LK1C 4FO2A 4POGA 2B29A 1A0IA 5KYLA 1TWCB 3T56B 4BBRB 5C3EH 1C9OA 1XPRA 2NVYB 2K5HA 4PZ8A 3STBC 2UU9L 2QW7A 3VYUA 1J9OA 3VR6A 1FJGL 1LYLA 3PIO3 3I4LA 3F8TA 1CQVA 2PQAB 1A15A 4LFAL 2WB1B 1A63A 2K33A 2QILA 2HQLA 4ME3A 2X6GA 2M9VA 4H13C 3S9WA 4HCSA 2B2VA 2NZ1D 4MTKA 4C1NI 2MJ8A 4BXXG 5IGDA 2DJFC 1T5XD 2NN6I 3FKIG 2QKIC 1SNOA 3S2HB 1I4XA 2PNRC 1VDZA 5M5XB 4BY1B 1QILA 2R7DA 5IWAL 3NENA 4QB4A 1PV4A 4JYAQ 3BVZA 2WKCA 1KAWA 2L4NA 1M1KC 4DR6Q 3J80L 2F3WA 3EFXD 4R4TA 4KMUC 2IX1A 3RMHA 4MZ9A 3OHXC 3U4VA 4HIMA 3S2DB 1E24A 1R4PB 1TS5A 4C3JH 2EY6A 1MHWC 1ENCA 4IFDJ 3OYYA 4HJ7A 4A3MG 2A8VA 1Z6HA 4N9TA 4K8IA 3OWFA 4JI6L 1PRTF 3PCOB 3SE0A 3J7ZC 2NVXH 3J81i 4GNXB 4O42A 2N55A 4ABNA 3CCSA 4RGOS 4HJ5A 1I6VC 4K0KQ 1GOZA 3K58A 1RTNA 3NE5B 3HOUH 3K7UC 2VXWA 2RA4A 5J1ZA 4BY7H 1EIFA 3G6JB 5LL6X 5IT9c 1BR9A 5J3BA 2KJXA 3GTMH 4P72A 3MTSA 2BCOA 3GTKH 1SN8A 2HCCA 2VS1A 4LMQD 3CPWA 3N6RA 4HIOA 1O7ZA 1ET9A 3ITPA 3U9OA 1D5ZC 2L5TA 1V43A 2WKDA 5G3LF 1C0AA 3GTGH 2LXJA 2OTLA 2BE5D 2XRQD 4DN4M 1HNZL 2PZTA 1STGA 1I4QA 3S17B 1HXYD 1EZ8A 2F52A 5GAGC 5C44H 1PDQA 3HOWH 2OEOA 1KDCA 3L0OA 1Q8IA 1X54A 5JOBA 1GUOA 2Q8RE 4YHHQ 4DR1Q 4TKOB 1SFOB 1WOCA 5CV4A 1WTVA 2DNCA 2KCTA 2LSSA 1N33Q 4RHSA 3FHWA 1QVCA 1AFPA 3H0GG 4DF7A 1M4VA 1E1TA 3I2ZA 2BA1A 4DAVA 3S15H 2WP8J 1CKMA 1S5ED 1B3QA 1V1PB 4KI0A 3MXPA 4XQJA 1N9WA 3JC66 5E1FA 3J81E 2EYMA 3FPUB 3NPPA 5LMNW 4JI7Q 1HZAA 3BZCA 3TP6A 5FK9C 2CW0D 4S3SA 4WFN3 4ME5A 4LF4Q 4A3FG 3TP8A 3GD7A 3D4WA 4X3KA 4N8X1 1D6EC 2EOTA 2MO1A 1S72A 2YTVA 4OWWB 1F2MA 1STBA 5C5LA 4C3IB 4IFDI 2XTIA 1EIGA 3S17H 1A2UA 4X3TA 4LFBL 1K0SA 3L3OC 5C44G 1JOQA 4ZLTF 3OIQA 2RSNA 4C3IH 5JAVA 3K7AB 5D65A 2AWOA 4IJLA 5CV5A 2F0NA 4WJ4A 1LTAD 2AKWB 4A3GH 3KF6B 1IHZA 3SK4A 4DV6Q 4X62L 4A3EG 4PZ6A 1TWGB 3JAML 1IBMQ 4IPGA 4DXFA 3CMEA 2KQ3A 3RLNA 3M9BA 1PH3A 4R4QA 2RSOA 4JI5Q 4JI0Q 3PGZA 2B2WA 2DN8A 4KD4A 2N8NA 1IW7C 1HFNA 3KLSA 4X65L 1QCBD 3HRZC 3C1EA 2AUKA 2I5LX 4K5WA 3PUYA 1I94Q 1C8CA 3RZDB 4UP8A 2I07B 3AYHB 5IP9G 1S40A 3SK5A 1EOTA 3P7JA 4DPGA 2SOBA 2I0QA 3F2CA 3HEJA 2YV5A 3A8KE 3D6CA 2LFNA 4GOPC 1BOSA 2L12A 1E7ZA 4B3RL 3NSWA 2OF1A 4POFA 1JJGA 3EROA 3ERQA 4N8FA 1EY0A 1K73C 1FYCA 3DLLA 1MJCA 1NE3A 4DR4Q 5EBDA 5IP7G 4A3EH 1JE4A 1VQ8A 2UXCQ 4RH6A 4X66L 1L0XB 3D4RA 3NXWA 1A8VA 4LFBQ 1YJNA 2EXZA 5IGFA 1UEBA 4A3EB 1SYGA 1KDAA 3HS0C 3S15B 2KEDA 4CDFC 4U673 3B6YA 2FFKB 5C3EG 1QB5D 4DV3Q 3HOXB 5CORA 4NKLA 2H1EA 3E6ZX 3TMEA 1DXMA 2CHBD 1Q82C 3EJIA 4HJ9A 4BBSB 4DNTB 4A3KB 3BJUA 2D62A 5BN5A 1K8OA 1HR0Q 5FO7B 4IOCA 1AN8A 1SMYC 1NJIC 1PFBA 4DV7L 4R4CA 1STHA 2YTYA 2EPBA 1IXRA 1VQFA 3NP8A 4HEDA 2NVTB 3RZDH 2YTXA 2NZOA 2OXPA 3SEBA 4OIKA 5KRUA 4YY3Q 1Q90A 2F0KA 1JC7A 1X3PA 4JI3Q 4OIJA 2EIFA 1Z7TA 2AQ3B 2WFWA 2JN4A 2E75C 4TSSA 3M7NA 2Q2IA 3M4PA 4CJ2C 2LKVA 1GXDC 5IYBG 4XXEA 4A3KG 1KQSA 1EU4A 1SE2A 2PMZB 3PIPA 2Z6KA 5LMUQ 1NUCA 1F9SA 1MSHA 2VB2X 2ZXRA 2CVRA 4G57A 1TKWB 3AFQA 1HNZQ 3GV3A 1UAPA 3A5ZB 4N9PA 3CCRA 2IT1A 2WINB 2R7FA 5ELBA 2K5NA 4RGTA 4FF3A 4ALPA 2DNEA 3FMCA 1SNMA 2Q2HA 1L0WA 4MN3A 4AH6A
chains in the Genus database with same CATH topology
3L9AX 3MAQA 3TZDA 5KYIA 1S5DD 3HKZB 4XYOA 2J0TD 1PFMA 2JYOA 2D9UA 1XWEA 1MBYA 2F0JA 3A8IE 4AYBB 1ESFA 2DY8A 3OSOA 5ELFA 1VF7A 4K2KA 5KNCA 1WVLA 1G91A 4A3BB 1SSOA 4KHZA 1BXTA 2F0UA 1LTID 1IW7D 3T13A 1QNUA 3I70A 3MHBA 3NTIA 1AEXA 4FF1A 4H0LC 5CBEE 2F0IA 3S1NB 1GUGA 3NTKA 1TR5A 2NTSA 4MHEA 1H9KA 5DNFA 1II3A 2Z4HA 4R8IA 4UDUC 1D5MC 3NQIA 5I9OA 4GZYC 3GO5A 2AQ1B 5ELEA 1CT1D 3MC0B 5FOBB 1DM0B 5JEAH 4A3JB 2D2CC 5ELDA 3BDOA 4A93B 1PRTB 4FF4A 3Q0AA 4Q5VA 4BA1I 1G6ZA 1XX8A 1ENAA 2QCPX 2RDGA 4ZK9B 3HP3A 5JVH3 4MIUA 5FLXL 1D5XC 1TU2B 1F2LA 4G7OC 3FPPA 3HOWB 2PO4A 3H0GB 1G8ZD 1XTCD 4DK1A 4KN7C 1V1PA 2EZVA 3QOLA 1A6XA 2IW3A 2ICIA 4B9XA 2K01A 4J8QA 3A56A 2XVSA 3VA7A 2RDHA 2PCFB 3DXJC 1AP0A 3CRKC 1B1ZA 4G7HC 5JEAG 4CJ1B 1SYFA 3CRLC 1D2BA 5M3FB 2TSSA 3NUCA 5HURA 1V1OA 4UAIA 4CKEA 4C3JG 3FDTA 1OXTA 3R2IA 1BF4A 3NTHA 5IGBA 3WOFA 4H7BA 3K5NA 1ENFA 1EL0A 1U9RA 2A68C 3P1HA 2RDFA 2PW5A 2M2LA 2B2TA 3RZOB 4ZQ3A 1OXSC 5EKKA 1GHKA 4WJWA 3KF8A 5C4ZA 1STEA 3FEWX 4HSPA 1PZJD 3J80E 3AU7A 2FMMA 2B2UC 4XT3B 4J1MA 5BN3A 2PQEA 3LX0A 3PUZA 3KBGA 1CK1A 4C3HB 3GV6A 2SNSA 3A55A 2NYZD 1RF2D 1TVXA 1SE3A 1LT6D 1C48A 3PUVA 1JQYD 2F0EA 1WTOA 1DOLA 3DWPA 4DAPA 1FD7D 2YYZA 1SNDA 2G9HD 2B8FA 1G2SA 1B9MA 2D5DA 4RCOA 3GTJB 2XWBB 1WD1A 3SK8A 1Q1EA 2LS01 4I7ZC 3IFDA 2C5CA 4B08A 2EJFC 4K14A 1QE6A 3MXGA 5T1IA 2KA7A 3H3VC 1NR4A 1R4QB 3PIP3 1NSNS 4ZYSA 1HPCA 4QIWB 1Y8NB 3VA5A 1GJXA 3E0JA 2IJ0A 5FO8B 3F2UA 3R3OA 5JJZA 2E2DC 3I4NB 3OMGA 4A3DB 1A2TA 1GUSA 3VR3A 3Q23A 1IKLA 5EPKA 5KEEA 1TIID 1EYCA 4KV6A 2XSCA 3R2TA 1PRTD 1JCKB 4X3SA 3RUZA 1PRTC 3PMFA 5C4XB 3KK7A 3OWEB 1QNKA 1TWAB 1TT2A 1CI3M 1UNSA 1PZKD 4CHTB 2IPKD 1EU3A 2TMPA 3ONAB 3VR4A 4IALA 2R3ZA 2A6EC 2AQ2B 1DD2A 4NDXA 2MGSA 2MUYA 5E4WC 2KOLA 2WACA 3IKJA 4KTAA 1HUNA 4Z9CB 2AUJD 3K0YA 1BO0A 3J7YW 2ZT9C 4KHVA 1NCVA 5IODA 5IGGA 5A2QE 3A8JE 2A6ED 2JA7B 2ZXOA 2F0WA 4M8AA 1FNWA 4OGQC 4HMJA 3DEOA 2JP1A 3P75A 1MGSA 1SEBD 3SVMA 1V8QA 1IYVA 1CTMA 2K03A 3KLRA 1KTKA 2F0FA 4CGYB 2GA4B 3LWEA 1LTTD 4P2CB 2F0LA 2C9OA 5C4HA 2EJGC 1SAPA 1DONA 1UEAB 5C5MA 5CC4A 3M4YA 4IN3A 2PZUA 1CQFA 4FVMA 1DJRD 2XIWA 4FYDA 5CYUA 1EZ6A 4E6IA 2K6AA 2OT2A 3PUWA 3H91A 2R61A 4L63B 3ZYYX 4KKSA 4KY7A 1SYBA 3CQZB 4F88A 3G7LA 3PUXA 1NR2A 1PXUA 5IIFA 3E5SA 1JOKA 1TWHB 4IUUA 5KIXA 2Y0SB 4I65A 3KUPA 2RVLA 3KLSX 2EYJA 2A69D 1LO5D 2XN9C 3DMUA 1ZKOA 3J81L 4C3HG 3S16B 3NQTA 4Q0FA 3OPOA 3SXHA 3K6OA 4PNYA 1EFID 4DGZA 3LWUA 3MXUA 1U4PA 4IURA 4F7XA 3QJYA 3TBIB 2JA8B 1SYEA 5M3MB 4PQXA 4J6HA 4R9WA 2R93B 5FLXE 4PMBA 4DA2A 5D3DA 2B63B 3ND8A 2F0PA 4K2LA 1HHVA 1B53A 3Q22A 5CGKA 1SNCA 2JEBI 3JAME 3EQLC 3EVQA 3WOEA 2HCIA 1O80A 2R6GA 4XDXA 3V2TA 1FR3A 1OXUA 5COYA 4TRDA 1CHQD 2JEAI 1ZXTA 3S1MB 2O4XA 1B50A 5C0XJ 1F2ZA 3TP5A 1I50B 1VCIA 2B2TC 3MWYW 4ZUJA 3SK6A 3NWSA 2NN6H 5E3FA 5J39A 1RCVD 2A68D 4BWGB 1QG7A 1HA5A 1PTOH 4KKTA 1FGBD 3M7GA 5ISRA 2NB0A 5JPMC 2HDLA 4QUCA 3CU7A 2I46A 1A3TA 5IGCA 3I90A 2X6LA 2Z4IA 3TDQA 4EQPA 4IUNA 3T16A 5C6AA 5BN4A 4NW2A 2SNMA 2YU9B 3SDZA 3U9SA 2LMCB 5C4JB 2XWJB 2A74C 4M1UB 2KCNA 3A7AB 2EVBA 1HRJA 2EYLA 2A6HD 1VF5C 2V4DA 4NP5A 4L8JA 1B4OA 4X3UA 1WTPA 3K5MA 3N52A 2RQXA 1STNA 2IX3A 3QWNA 1OO9B 2BOSA 4FF2A 4EQOA 1GHJA 1CM9A 2B2VC 5D14A 3MFGA 5EKLA 2F0OA 1ILQA 4XT1B 4ZAIA 4NMZA 4HAEA 1WTXA 1JOOA 3GTOB 3GTGB 1MSGA 4K6LA 4LJZC 2K5WA 5IT9L 3DWAA 2KEEA 3OW7A 1RHPA 3PO3B 4IFDH 2NWGA 4QF4A 5C3EB 2BE5C 3MFYA 1EEID 5C3WA 1JORA 2IL8A 3NWTA 5T1GA 3T4AC 1NAPA 3TP7A 2K7VA 1FNVA 2FJ2A 4RA8A 4XYQA 5EPLA 5DM73 3BVMA 5EJWA 2PYKA 4BY7B 5M5WB 3DHQA 4KY6A 2QF7A 4C2MB 5CBAE 1E2VA 2M00A 1ILPA 1RKNA 1U4RA 3LNNA 2ZXPA 1H9MA 1E0BA 1I4HA 3MZ5A 2QDBA 2RKSA 3OIPA 1W6KA 2B2YA 3DM1A 3BDCA 5EPJA 1RODA 1SDFA 4KKUA 2L55A 5M5YB 3VR5A 5JVG3 3I91A 4Y7NB 3NK9A 3I73A 5EBCA 2JSOA 4KD3A 5EKIA 1B44D 1LTSD 2R7ZB 4QUFA 4KJOA 4OL7A 1KDBA 3BG3A 3X3NA 2VUMB 5I2YA 1PYWD 1ET6A 1OXVA 1JR0D 1STAA 3D6WA 2FMCA 4PMCA 5EQ0A 3K5LA 1CZWA 3Q24A 1K83B 1TWFB 2F0TA 5K36H 1HQRD 1TS4A 4YIJA 2E2JB 2VNUD 2KHSA 2F0VA 2Z8LA 3VR2A 1DZ1A 3PO2B 4H44C 5IGEA 5NUCA 1KNEA 3IFTA 2EY1A 3D3RA 1BCPD 2B2YC 3S14B 3I72A 1X32A 1D1KA 1KNAA 1LACA 1GUWA 1Q1BA 5CV9A 1DCZA 2F0GA 3URYA 2VB3X 1I6HB 4ODGA 2A6HC 2IWHA 3SR1A 2Q8IB 3I8ZA 4EQNA 3RD4A 2PZWA 3X3MA 1B2TA 1O78A 5G3LD 1HTLD 4R8NA 2EE1A 3A54A 5KNBA 4V190 1O7YA 2HDMA 2O2LD 1PTOC 1EY8A 1S5FD 4HMIA 1HFGA 1I4PA 4ZUIA 2KECA 1Y1WB 2MHVA 4CBVA 3NBIA 3K59A 1JWSD 3R8BA 1IKMA 1D1IA 3I3CA 3H09A 3WDNA 1BBXC 1M8AA 2FHTA 1EQVA 4IUPA 5J22A 1ZYRC 2EYOA 1S4ZA 1WCMB 5K36G 1I3QB 2ENBA 2RBMA 2EY5A 2CW0C 2Z1CA 2L11A 1ZEQX 4RGNA 2FINB 3GP7A 2NTTA 4XIGS 4OO1I 3MVVA 2L9HA 1H9JA 1Y8PB 3BYYB 5CMDA 4DNRB 4L6TB 3V96A 3EA6A 2Q8TA 1LABA 1U4LA 3T53B 1EIHA 3M85A 1VMPA 4QMGA 3BZDB 3D31A 3C46A 2PPBC 1Z47A 5DAUA 3HOYB 3FVQA 1HTPA 3RLFA 4KK7A 1YNND 1CA6A 2PW7A 4K6DA 1JWMD 1CHPD 4EVOA 3C2PA 5EGTA 1R9TB 1LT5D 1T5EA 2ID0A 5C0XH 1B3AA 3V05A 4HTHA 2KVMA 2BA0A 5C0XI 5LL6S 1WTWA 4FXKC 3W2DA 1L0YB 1KAAA 2J7ZA 3TZUA 1HCZA 1XYIA 4ZRZA 1LV9A 3D8GA 1EYAA 4ILWA 1Y69U 5FKAC 4ZKCB 1RDPD 3DWQA 5C3XA 1PMRA 1LTRD 1SJHD 2NN6G 3HOUB 4K5XA 1LTBD 4OO1H 4WORA 1JB3A 1KLUD 5CV7A 4A3FB 5LHY1 2CQAA 4F8MA 2K05A 2NBFA 3Q6SA 1JICA 4IUQA 4RGMA 1IYUA 5C44B 5A2QL 4RHRA 1B9NA 2F0DA 2E2IB 4C3IG 1F9QA 3AMUA 1Y1VB 1RD9D 2K5QA 1S5CD 4QCLA 1YNNC 3HZXA 5CV8A 4PMWA 2B2WC 2G9DA 1F77A 2HQEA 4ULLA 5IT9E 3O13A 5IOCA 2ICEC 1O7LA 3H6MA 2F0HA 1SMYD 2F0MA 2B2UA 3P20A 4IQZA 3OMCA 1SYCA 2A5HA 5F2DA 1EWCA 3R93A 4TQUS 4BA2I 1LLRD 5JEAJ 4HSVA 2F1MA 3M4OB 3M3YB 1AZQA 1A3VA 2DY7A 4KN4C 4CJ0B 1I4RA 1HQMC 5HGTA 2N88A 4FXDA 1SJED 4KJNA 3QIAA 4K5VA 4A3IB 4DAYA 1RJTA 1EQTA 3VYSA 2X69A 4XQNA 1TY0A 3NBHA 1EY6A 3BVGA 3VYTA 4FNFA 3HOVB 1H9SB 1EY4A 3DEPA 1H9RA 1Y8OB 4JBWA 1EWHA 2F4IA 4RCNA 1Q3LA 1S5BD 3QB3A 5KNDA 2K1BA 2E76C 1SNPA 1QJOA 4RKLA 4BS9A 3C1FA 2JA5B 1BCPB 3QOJA 1EYDA 1X3QA 5M9OA 5I9PA 3K5OA 1RTOA 3GTMB 4IFDG 1DYQA 3GTLB 1KABA 3J7AV 1PTOF 2BDNA 4KY5A 3QO2A 3L7ZC 4RWSC 2LY7A 3BYTB 1G291 2O5JC 2WIIB 4A3GB 5CR3A 1CA5A 1BNZA 3S1RB 2K04A 4ZKBB 1AZPA 2B39A 4IUVA 3I4MB 1TS3A 1F2YA 3BS1A 2XRSD 3IL8A 4DXGA 1QWYA 1Q12A 2WAQB 4G4KA 2HUGA 1HA6A 4XTCS 4O1NA 4C56C 1DOMA 1KLGD 1EY9A 2BDOA 1ZYRD 4RAUC 1E2WA 2E74C 4A3MB 5K5PA 2EYPA 4V0BA 2MP1A 3NHHA 2K32A 1WD0A 5E4XA 4EGVA 5FO9B 1CFMA 4WRDA 1HUMA 1IL8A 5C0XG 2NVQB 1PLFA 2KCCA 1ONLA 2L0CA 1MD2D 2R92B 1AW7A 4RKBA 4CKCA 3FRPB 1OXXK 4F87A 4C3JB 4XQQA 5A35A 3A7LA 1STYA 3UI2A 4B9WA 3CKIB 3FKIB 4IUTA 1PTOD 3TN2A 4RFBA 3K57A 1SNQA 1BCPF 2JA6B 1UUPA 5DM63 2SDFA 5I6YA 3CHBD 4DU9A 2EY2A 4OHJA 3J7AF 3ND9A 1U4MA 1MI2A 1GUTA 2K5DA 2WV6D 1DOKA 4C1NK 4U68A 4IZ8A 1BQQT 3GTPB 1LT3D 2NUCA 1ESRA 3HOZB 3BDLA 1BUVT 1C4QA 4K8JA 1ML0D 3MEHA 2J4XA 3MXNA 2JE6I 4CKBA 1PZID 4FP5D 1CZGA 4PV1C 5JPNC 1TQOA 1JWUD 5KGUA 5CV6A 1SBBB 3W3AA 1W6JA 1ICWA 2SEBD 5TSSA 2F3VA 1EEFD 1BCPC 4FXGC 5I4DA 1GUNA 1TS2A 3TSSA 1BDOA 1SXTA 4G7ZC 4JK1C 2EYFA 5I6WA 1WTRA 2K28A 1EY5A 2A73B 3PV0A 1EY7A 2A69C 1LTGD 3MA2B 4HR7B 3SHLA 2KUMA 3GQBA 2F03A 1E2ZA 2QEJC 3OOCA 5ELCA 1YNJC 2AWNA 1A3UA 4HN7A 5I2XA 2H4OA 2L1BA 1TY2A 1PFNA 1XXGA 4DK0A 2MPMA 2E2HB 2O5IC 2IX0A 2NVXB 3KBXA 2B8GA 1H9SA 1I4GA 1SYDA 1LT4D 3S1QB 1SE4A 3T51B 3C3LA 3AB9A 1K8MA 3GTKB 5DEHA 1FNUA 2F0SA 1J8IA 4HCEA 3GTQB 3D4DA 3QG1A 2F0QA 1F9RA 2EDGA 1F9PA 1YNJD 5D3IB 3HG9A 4ID6A 3H94A 3HGBA 4OO1G 4LAAA 2XNAC 4DFAA 1WTQA 1QOHA 3DUZA 2EYHA 1G2TA 2JXMB 5AFWA 3VYRA 3IAYA 1VMCA 1PTOB 2EJMA 4LK1C 4FO2A 5KYLA 1TWCB 3T56B 4BBRB 2NVYB 3VYUA 1J9OA 3VR6A 3PIO3 3I4LA 1CQVA 1A15A 2WB1B 2K33A 2QILA 2X6GA 2M9VA 4H13C 3S9WA 4HCSA 2B2VA 2NZ1D 4C1NI 2MJ8A 5IGDA 1T5XD 2NN6I 2QKIC 1SNOA 3S2HB 1I4XA 2PNRC 1VDZA 5M5XB 4BY1B 1QILA 4QB4A 3BVZA 2WKCA 2L4NA 3J80L 2F3WA 3EFXD 4KMUC 2IX1A 3RMHA 3OHXC 3S2DB 1R4PB 1TS5A 2EY6A 1ENCA 4IFDJ 1Z6HA 4N9TA 4K8IA 3OWFA 1PRTF 3SE0A 4O42A 2N55A 4ABNA 4RGOS 1I6VC 1GOZA 3K58A 1RTNA 3NE5B 2VXWA 2RA4A 5J1ZA 3G6JB 5LL6X 1BR9A 2KJXA 3MTSA 2BCOA 2HCCA 4LMQD 3N6RA 1O7ZA 1ET9A 3ITPA 3U9OA 1D5ZC 2L5TA 1V43A 2WKDA 5G3LF 2BE5D 2XRQD 4DN4M 2PZTA 1STGA 1I4QA 3S17B 1HXYD 1EZ8A 1PDQA 2OEOA 1KDCA 1Q8IA 5JOBA 1GUOA 2Q8RE 4TKOB 1SFOB 5CV4A 1WTVA 2DNCA 4RHSA 1AFPA 4DF7A 1M4VA 2BA1A 4DAVA 2WP8J 1S5ED 1V1PB 4KI0A 3MXPA 4XQJA 5E1FA 3J81E 2EYMA 3FPUB 3NPPA 3TP6A 5FK9C 2CW0D 4S3SA 4WFN3 4ME5A 3TP8A 3D4WA 3GD7A 4X3KA 1D6EC 2EOTA 1F2MA 1STBA 5C5LA 4C3IB 4IFDI 1EIGA 1A2UA 4X3TA 3L3OC 1JOQA 4ZLTF 3OIQA 2RSNA 5JAVA 3K7AB 5D65A 2AWOA 5CV5A 2F0NA 1LTAD 1IHZA 3SK4A 1TWGB 3JAML 4DXFA 2KQ3A 2RSOA 2B2WA 2DN8A 4KD4A 1IW7C 1HFNA 3KLSA 1QCBD 3HRZC 3C1EA 2AUKA 4K5WA 3PUYA 1C8CA 3RZDB 2I07B 3SK5A 1EOTA 3P7JA 2SOBA 3HEJA 3A8KE 3D6CA 2LFNA 1BOSA 2L12A 3NSWA 2OF1A 3EROA 3ERQA 1EY0A 1FYCA 5EBDA 1JE4A 4RH6A 1L0XB 3D4RA 3NXWA 2EXZA 5IGFA 4A3EB 1SYGA 1KDAA 3HS0C 3S15B 2KEDA 4U673 2FFKB 1QB5D 3HOXB 5CORA 2H1EA 4NKLA 3E6ZX 3TMEA 1DXMA 2CHBD 3EJIA 4BBSB 4DNTB 4A3KB 2D62A 5BN5A 1K8OA 5FO7B 1AN8A 1SMYC 1PFBA 1STHA 2EPBA 3NP8A 4HEDA 2NVTB 2OXPA 3SEBA 4OIKA 5KRUA 1Q90A 2F0KA 1JC7A 1X3PA 4OIJA 1Z7TA 2AQ3B 2E75C 4TSSA 3M7NA 4CJ2C 2LKVA 1GXDC 4XXEA 1EU4A 1SE2A 2PMZB 1NUCA 1F9SA 1MSHA 2VB2X 2ZXRA 2CVRA 4G57A 1TKWB 3GV3A 1UAPA 4N9PA 2IT1A 2WINB 5ELBA 4RGTA 4FF3A 2DNEA 3FMCA 1SNMA 4MN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMD A;  1WTV A;  1A15 A;  1EOT A;  3P7J A;  3UI2 A;  2MGS A;  5E4W C;  2KOL A;  1WTO A;  1DOL A;  4IUT A;  2KUM A;  2B2Y C;  1HUN A;  2NWG A;  3TN2 A;  2X6G A;  2Q8T A;  1X32 A;  1U4L A;  1BO0 A;  2L12 A;  4HCS A;  3TZD A;  2B2V A;  2IL8 A;  2NZ1 D;  1EIH A;  2MJ8 A;  1G2S A;  1KNA A;  2B2W C;  2BDN A;  5T1G A;  1NAP A;  1GUW A;  1VMP A;  1NCV A;  3I90 A;  2K01 A;  1WD1 A;  1PFM A;  2FJ2 A;  2X6L A;  3QO2 A;  4RA8 A;  2JYO A;  2D9U A;  2SDF A;  5EPL A;  1U4P A;  4IUR A;  4RWS C;  1JE4 A;  2L1B A;  5EJW A;  2B2U A;  3IFD A;  1PFN A;  1AP0 A;  2DY8 A;  4NW2 A;  4R9W A;  3I8Z A;  5CBA E;  1U4M A;  2MPM A;  3FPU B;  1MI2 A;  1CA6 A;  3DEO A;  1ILP A;  1U4R A;  2JP1 A;  1MGS A;  1B2T A;  1WVL A;  1QE6 A;  5T1I A;  2L4N A;  1DOK A;  1CA5 A;  1SSO A;  3KBX A;  1G91 A;  1NR4 A;  2EE1 A;  4CJ1 B;  2KED A;  1E0B A;  3SVM A;  2FFK B;  1O7Y A;  2HDM A;  3R93 A;  5COR A;  2H1E A;  4HSV A;  4U68 A;  1HHV A;  1B53 A;  2K04 A;  4X3K A;  4ZKB B;  1AZQ A;  1HFG A;  1BNZ A;  2EOT A;  1B3A A;  2B2Y A;  2K03 A;  2DY7 A;  3DM1 A;  3F2U A;  1AZP A;  5EPJ A;  1ROD A;  4IUV A;  1EIG A;  5CBE E;  2KEC A;  1ESR A;  1SDF A;  4UAI A;  2HCI A;  3LWE A;  1O80 A;  2KVM A;  4X3T A;  4XDX A;  4CJ0 B;  3FDT A;  1WTW A;  3I91 A;  1BF4 A;  1HRJ A;  4ZLT F;  2N88 A;  5JJZ A;  1J8I A;  1ML0 D;  1PFB A;  3IL8 A;  4MHE A;  2J7Z A;  5COY A;  5DNF A;  2RSN A;  2EPB A;  1B4O A;  4X3U A;  5D65 A;  5EKI A;  1XYI A;  2HUG A;  1SAP A;  4HED A;  1WTP A;  1HA6 A;  1F9R A;  1LV9 A;  1ZXT A;  1DON A;  4QUF A;  1RJT A;  1IKM A;  4OIK A;  1EQT A;  1F9P A;  2X69 A;  4R8I A;  1EL0 A;  1X3P A;  1B50 A;  3N52 A;  4OIJ A;  4O42 A;  1IKL A;  2N55 A;  5EPK A;  3I3C A;  4ZKC B;  1BBX C;  2M2L A;  1RTN A;  1DOM A;  1M8A A;  2VXW A;  2B2T A;  2RA4 A;  1CM9 A;  4RAU C;  2B2V C;  2XIW A;  3DEP A;  4X3S A;  5D14 A;  1ICW A;  3D6W A;  4CJ2 C;  1Q3L A;  2RSO A;  3MTS A;  1WTQ A;  2FHT A;  4IUP A;  2B2T C;  1RTO A;  5EQ0 A;  2MP1 A;  3H91 A;  3MWY W;  1ILQ A;  2B2W A;  2HCC A;  1QNK A;  1S4Z A;  2FMM A;  4XT1 B;  5E4X A;  1WD0 A;  1G2T A;  3G7L A;  2K1B A;  4LMQ D;  2B2U C;  1F9S A;  4XT3 B;  1HUM A;  5AFW A;  1NR2 A;  1MSH A;  4ZAI A;  1O7Z A;  1IL8 A;  2CVR A;  1PLF A;  1QG7 A;  4HAE A;  1HFN A;  1WTX A;  2L11 A;  1VMC A;  3GV3 A;  2K05 A;  4IUU A;  2Q8R E;  1MSG A;  1G6Z A;  1XX8 A;  2FIN B;  3Q6S A;  4DN4 M;  1X3Q A;  1JIC A;  4IUQ A;  2L9H A;  1C8C A;  3KUP A;  3GV6 A;  2RVL A;  1PDQ A;  4ZK9 B;  3HP3 A;  2NYZ D;  3ONA B;  1DZ1 A;  1J9O A;  2R3Z A;  1TVX A;  2HDL A;  2KEE A;  1WTR A;  1KNE A;  2K28 A;  4QUC A;  1RHP A;  1F9Q A;  4MN3 A;  1F2L A; 
#chains in the Genus database with same CATH topology
 1K3B C;  1Y1W H;  4J15 A;  4YY3 L;  1U0L A;  3L9A X;  4OON A;  2MFI A;  2PQA A;  4DR5 L;  3MAQ A;  3TZD A;  1BBW A;  4GN4 B;  5KYI A;  1S5D D;  2KBN A;  3HKZ B;  3CMA A;  4K0K L;  4DUZ L;  2HIV A;  4XYO A;  2J0T D;  3GTL H;  1PFM A;  2JYO A;  2D9U A;  2NVT H;  1JJ2 A;  3WWV A;  4L5S A;  1XWE A;  1MBY A;  4GNX A;  2F0J A;  3A8I E;  4AYB B;  1ESF A;  2DY8 A;  3OSO A;  5ELF A;  1VF7 A;  1VQD A;  1PH2 A;  4K2K A;  4TVA B;  1X55 A;  5KNC A;  1WVL A;  1G91 A;  4A3B B;  1SSO A;  4KHZ A;  2VQF L;  4JI8 L;  1BXT A;  4MNO A;  2F0U A;  3NBH B;  1LTI D;  1Q81 C;  1IW7 D;  3E0E A;  3T13 A;  1KRT A;  1QNU A;  1K8A C;  3HOW G;  3I70 A;  3MHB A;  3NTI A;  1AEX A;  4FF1 A;  4H0L C;  4GKK Q;  1B7Y B;  5CBE E;  2F0I A;  3S1N B;  3NEL A;  1GUG A;  4JYA L;  2PI2 A;  3NTK A;  1TR5 A;  2NTS A;  5IWA Q;  1GM5 A;  1HNW Q;  4MHE A;  1H9K A;  5DNF A;  4DR7 Q;  1II3 A;  3I4M H;  2Z4H A;  5LMN L;  4R8I A;  4UDU C;  1D5M C;  3NQI A;  5I9O A;  4DV1 L;  4FDB A;  4GZY C;  3GO5 A;  3ICE A;  4A3L H;  2AQ1 B;  5ELE A;  1CT1 D;  4KHP L;  4LFA Q;  3MC0 B;  5FOB B;  1DM0 B;  5JEA H;  4A3J H;  4A3J B;  4P75 A;  2D2C C;  1FJG Q;  5ELD A;  1KL9 A;  5M3F G;  3KDF A;  1XNQ L;  3BDO A;  2RCF A;  2UU9 Q;  4A93 B;  2OWO A;  1PRT B;  3UDF A;  4JI5 L;  4FF4 A;  3Q0A A;  4Q5V A;  4BA1 I;  1G6Z A;  1XX8 A;  1IBK Q;  4X6A H;  1ENA A;  2QCP X;  1YHA A;  4JG2 A;  2RDG A;  4ZK9 B;  5IE8 A;  1VQ6 A;  3HP3 A;  5JVH 3;  1Y1W G;  1IBM L;  4MIU A;  5FLX L;  1D5X C;  4LW1 A;  2ZM6 L;  1F2L A;  1TU2 B;  4G7O C;  3FPP A;  3HOW B;  5LMU L;  2Z9H A;  1XJV A;  2PO4 A;  4O0A A;  2Y0S G;  3H0G B;  1G8Z D;  1XTC D;  4DK1 A;  2RHS B;  4KN7 C;  1V1P A;  2EZV A;  3QOL A;  1A6X A;  2IW3 A;  2ICI A;  4B9X A;  2K01 A;  2P5Z X;  1I5F A;  4J8Q A;  1QUQ B;  3A56 A;  2HD3 A;  2XVS A;  3T1Y Q;  3VA7 A;  2RDH A;  2PCF B;  3DXJ C;  5GRO A;  1AP0 A;  2VW9 A;  1BBU A;  4LF9 Q;  3CRK C;  1KXL A;  3OTO Q;  1IBL L;  1B1Z A;  4G7H C;  5JEA G;  1YIJ A;  1LM0 A;  4B3S Q;  1K28 A;  4CJ1 B;  1JB7 A;  1SYF A;  1GVP A;  1RL2 A;  3CRL C;  4HJ8 A;  4LUV A;  1D2B A;  5M3F B;  2TSS A;  3NUC A;  1UE6 A;  2QGQ A;  5HUR A;  1V1O A;  4UAI A;  3K0X A;  4CKE A;  4C3J G;  5JJI A;  3FDT A;  3J81 j;  1OXT A;  4DR3 Q;  3I4M G;  3R2I A;  1BF4 A;  1PYS B;  3NTH A;  5IGB A;  3WOF A;  2CCZ A;  1UWV A;  1QUQ A;  2UUA L;  3HOZ H;  4NXN Q;  1N33 L;  4H7B A;  1JJC B;  1QZH A;  2VY3 A;  4DV5 Q;  1HZB A;  3K5N A;  1TWA H;  1ENF A;  1EL0 A;  4UPA A;  1QZG A;  4X66 Q;  1U9R A;  2A68 C;  4DR1 L;  5IYD G;  2UXC L;  3P1H A;  2RDF A;  2PW5 A;  1YEZ A;  2M2L A;  4DR4 L;  2B2T A;  3RZO B;  4ZQ3 A;  2K14 A;  3G4S A;  1OXS C;  5EKK A;  1GHK A;  4WJW A;  2Z6K C;  3KF8 A;  5C4Z A;  1STE A;  3FEW X;  4DAM A;  4HSP A;  1PZJ D;  3L2P A;  3J80 E;  3AU7 A;  1E3P A;  2FMM A;  2B2U C;  4XT3 B;  3TRZ A;  4J1M A;  5BN3 A;  4IO9 A;  2PQE A;  2DJG C;  1A62 A;  3LX0 A;  3PUZ A;  3KBG A;  3G71 A;  3UE1 A;  1XMQ Q;  1CK1 A;  4C3H B;  2XGT A;  3GV6 A;  3I4O A;  2SNS A;  3A55 A;  4ZCK A;  2NYZ D;  1RF2 D;  1TVX A;  2L15 A;  2DGY A;  1SE3 A;  1LT6 D;  1NY4 A;  1C48 A;  3PUV A;  1JQY D;  2F0E A;  1MJE A;  1WTO A;  1DOL A;  3DWP A;  4DAP A;  1FD7 D;  1N32 Q;  2YYZ A;  1SND A;  2F3I A;  2G9H D;  2B8F A;  1G2S A;  1B9M A;  2D5D A;  4RCO A;  3GTJ B;  1EYG A;  1VQH A;  2A19 A;  2E2I H;  2XWB B;  1WD1 A;  2F4V Q;  3PSI A;  3SK8 A;  4CDE C;  4X62 Q;  1Q1E A;  2LS0 1;  4I7Z C;  3IFD A;  1O7I A;  2C5C A;  4B08 A;  1K0R A;  2EJF C;  1I50 H;  4K14 A;  2R7Z H;  3KOJ A;  1X9N A;  1QE6 A;  3MXG A;  5T1I A;  1IYJ B;  2KA7 A;  3H3V C;  1NR4 A;  4B3M L;  1R4Q B;  3PIP 3;  1NSN S;  4ZYS A;  2UUB L;  1HPC A;  3HOX H;  4QIW B;  1Y8N B;  3VA5 A;  1GJX A;  3E0J A;  2IJ0 A;  5FO8 B;  4WJ3 M;  4GOP A;  3F2U A;  2LXK A;  1N36 L;  1FVI A;  2KHI A;  3HOZ G;  5GAD C;  3R3O A;  5JJZ A;  2E2D C;  1YHB A;  4JI7 L;  3I4N B;  2VUM G;  2R92 G;  3OMG A;  4A3D B;  1NTG A;  1A2T A;  3TEH B;  1GUS A;  3VR3 A;  3Q23 A;  1IKL A;  5EPK A;  5KEE A;  1TII D;  1EYC A;  1KHI A;  4KV6 A;  2XSC A;  3R2T A;  1PRT D;  1X65 A;  5FLX c;  1SR3 A;  1JCK B;  4X3S A;  2HHH Q;  3RUZ A;  1PRT C;  3PMF A;  1LUZ A;  5M3M G;  5C4X B;  3KK7 A;  3RN5 A;  3OWE B;  1QNK A;  1TWA B;  1PFS A;  1TT2 A;  1CI3 M;  1UNS A;  4YCU A;  5GAE C;  3F2B A;  4YHH L;  1PZK D;  4CHT B;  3ZJY C;  2WB1 G;  2IPK D;  1V1Q A;  2VZA A;  4DV5 L;  1EU3 A;  2TMP A;  3ONA B;  3VR4 A;  4IAL A;  2R3Z A;  4NXN L;  2A6E C;  2AQ2 B;  1DD2 A;  1VQ9 A;  1TXY A;  4NDX A;  2MGS A;  2MUY A;  5E4W C;  2KOL A;  2WAC A;  3IKJ A;  3MXN B;  4KTA A;  2AMC B;  1HUN A;  3I55 A;  4Z9C B;  2AUJ D;  3K0Y A;  1BO0 A;  2B63 H;  3J7Y W;  2ZT9 C;  4KHV A;  4A3L G;  2JA5 H;  1NCV A;  5IOD A;  5IGG A;  4JW0 A;  5A2Q E;  4L5R C;  3A8J E;  3SGI A;  2GN5 A;  2A6E D;  3HOU G;  2JA7 B;  2ZXO A;  2F0W A;  3CQZ H;  4M8A A;  2JA6 H;  1FNW A;  4OGQ C;  3ULJ A;  4HMJ A;  4UY8 C;  1N36 Q;  3DEO A;  2JP1 A;  3P75 A;  1MGS A;  1SEB D;  3K80 C;  4YWM A;  3SVM A;  2IY5 B;  1V8Q A;  3HOY H;  1IYV A;  3LGJ A;  1CTM A;  4Y7N H;  3I4N G;  4AYB E;  1IL2 A;  1WCM G;  2IHF A;  2K03 A;  3KLR A;  1KTK A;  2F0F A;  4CGY B;  2GA4 B;  3LWE A;  2CH4 W;  1LTT D;  2R92 H;  2Q2U A;  4P2C B;  2F0L A;  1HJP A;  1YNX A;  2C9O A;  5C4H A;  2G5D A;  3I7F A;  2EJG C;  1SAP A;  1DON A;  1UEA B;  5C5M A;  5CC4 A;  2CWP A;  3M4Y A;  1LTL A;  3A5U A;  4IN3 A;  2PZU A;  1CQF A;  4FVM A;  3W1G A;  1DJR D;  2XIW A;  5IYB H;  4LF5 Q;  4FYD A;  5CYU A;  2OCE A;  1EZ6 A;  4E6I A;  2JK8 A;  2K6A A;  2OT2 A;  3PUW A;  3H91 A;  2R61 A;  4L63 B;  4QL5 A;  3ZYY X;  4KKS A;  4KLK A;  3CQZ B;  4KY7 A;  1SYB A;  4F88 A;  2UXB Q;  3RLO A;  2UXD L;  3G7L A;  4KHP Q;  1J5E L;  3PUX A;  4JBK A;  1NR2 A;  1PXU A;  5IIF A;  3E5S A;  1JOK A;  1TWH B;  1JMC A;  4IPC A;  3CCQ A;  4IUU A;  5KIX A;  2Y0S B;  4I65 A;  5IY0 A;  3KUP A;  1Q7Y C;  2RVL A;  3KLS X;  2EYJ A;  3RNU A;  1VQJ A;  2A69 D;  1LO5 D;  2XN9 C;  5DLQ E;  1HNW L;  5EAY A;  3DMU A;  1ZKO A;  3J81 L;  4C3H G;  3S16 B;  2B63 G;  3NQT A;  3A74 A;  4Q0F A;  3HKZ G;  1VQO A;  4LF8 Q;  3KDF B;  3OPO A;  4DV2 L;  4A3I H;  3SXH A;  3K6O A;  4PNY A;  1EFI D;  4DGZ A;  3LWU A;  1Q46 A;  2VQE L;  4LWC A;  3ERS X;  1DGS A;  5L37 A;  3MXU A;  1U4P A;  4IUR A;  4F7X A;  3QJY A;  3TBI B;  2JA8 B;  1SYE A;  5M3M B;  5E7N A;  4PQX A;  4J6H A;  2QA4 A;  4R9W A;  2R93 B;  5FLX E;  4PMB A;  1HNX L;  4GN3 B;  1M90 C;  4DA2 A;  1FL0 A;  5D3D A;  2B63 B;  3ND8 A;  2F0P A;  4K2L A;  1HHV A;  1B53 A;  3Q22 A;  5CGK A;  3F1Z A;  1VQ7 A;  4PZ7 A;  1SNC A;  2K50 A;  1E1O A;  2JEB I;  3JAM E;  3EQL C;  3EVQ A;  4AIM A;  3T1H Q;  3WOE A;  2HCI A;  3OTO L;  1O80 A;  1Y14 B;  2R6G A;  4XDX A;  1IBL Q;  4LFC Q;  3M4O H;  1MIU A;  3V2T A;  1FR3 A;  2I5H A;  3PO2 H;  1OXU A;  5COY A;  4TRD A;  1CHQ D;  1WI5 A;  5IP9 H;  2JEA I;  1UE1 A;  1ZXT A;  3S1M B;  4GN5 A;  2O4X A;  3VDY A;  4QQB X;  1B50 A;  5BR8 Q;  5C0X J;  1F2Z A;  2ZTD A;  2BH2 A;  3TP5 A;  1I50 B;  1VCI A;  2B2T C;  2JA8 H;  1VQI A;  3MWY W;  4ZUJ A;  1QVG A;  3SK6 A;  3NWS A;  2NN6 H;  5E3F A;  5J39 A;  1GD7 A;  1RCV D;  4A3C H;  2A68 D;  4BWG B;  1QG7 A;  1YJW A;  1IBK L;  1HA5 A;  1PTO H;  1VQC A;  4KKT A;  2D0P A;  2HHH L;  1XTD A;  1FGB D;  3M7G A;  5ISR A;  2NB0 A;  3J7A 5;  5JPM C;  2HDL A;  4QUC A;  2PNH A;  4BBS G;  1NMG A;  3CU7 A;  1W3S A;  1HR0 L;  3GTQ H;  2I46 A;  2QDL A;  3JAM i;  4GOP B;  1A3T A;  5IGC A;  2RHQ B;  1MKH A;  2R93 G;  1X6O A;  4A76 A;  3I90 A;  2X6L A;  2Z4I A;  3TDQ A;  4JV5 L;  4P74 A;  3S2H H;  4EQP A;  1NNX A;  4IUN A;  3T16 A;  3CCV A;  4L5Q A;  5C6A A;  5BN4 A;  4HJA A;  4NW2 A;  2SNM A;  2YU9 B;  1R9T H;  4YWK A;  3MEF A;  3SDZ A;  3U9S A;  2LMC B;  5C4J B;  2XWJ B;  2A74 C;  4A3C G;  1YJ9 A;  4DK3 C;  2ES2 A;  4JC0 A;  4DV0 Q;  3HKS A;  4DK6 C;  2F4V L;  3PO2 G;  1N34 Q;  4M1U B;  2KCN A;  3FP9 A;  4EQ5 A;  2UUC L;  3A7A B;  4RG1 A;  2EVB A;  1HRJ A;  2EYL A;  2A6H D;  4QGU A;  1VQN A;  1VF5 C;  2V4D A;  2GVA A;  4QIW E;  4NP5 A;  4L8J A;  1B4O A;  4X3U A;  1N32 L;  4OWT B;  1WTP A;  3K5M A;  2MNA A;  4LUZ A;  3N52 A;  2RQX A;  3OW2 A;  1EOV A;  1STN A;  2IX3 A;  3QWN A;  4LF6 Q;  1OO9 B;  2E5L L;  2BOS A;  4FF2 A;  4EQO A;  1GHJ A;  1CM9 A;  2B2V C;  4AYB G;  5IYC G;  5D14 A;  3MFG A;  1XMQ L;  5EKL A;  4NXM Q;  2I5M X;  2F0O A;  1ILQ A;  3BZK A;  4XT1 B;  2CQO A;  4ZAI A;  4NMZ A;  4HAE A;  1WTX A;  3ULL A;  4DUY Q;  1WCM H;  3GTO H;  1JOO A;  3GTO B;  3GTG B;  1MSG A;  4K6L A;  4LJZ C;  5GQO A;  5AJ3 L;  3S14 H;  2K5W A;  1I6H H;  5IT9 L;  4JI1 L;  3UDX A;  3CPF A;  3DWA A;  2KEE A;  3OW7 A;  1RHP A;  1SRU A;  1EQR A;  3PO3 B;  1EWI A;  3Q8D A;  4JOI A;  4JI2 Q;  4IFD H;  2NWG A;  1TWC H;  4QF4 A;  2BE5 C;  3MFY A;  5C3E B;  1EEI D;  5C3W A;  1JOR A;  2IL8 A;  1EQQ A;  1QVF A;  3NWT A;  5T1G A;  3T4A C;  1NAP A;  3TP7 A;  2K7V A;  1XMO L;  1FNV A;  2NZH A;  4JI3 L;  2N78 A;  2FJ2 A;  4RA8 A;  4XYQ A;  5EPL A;  5DM7 3;  3BVM A;  5EJW A;  2PYK A;  4AQY Q;  5JJK A;  4BY7 B;  5M5W B;  4KY6 A;  3DHQ A;  2QF7 A;  2OQK A;  4C2M B;  4CDC C;  5CBA E;  3G6E A;  3HOV G;  1E2V A;  3M4Q A;  2M00 A;  1ILP A;  1RKN A;  1U4R A;  3LNN A;  2ZXP A;  1H9M A;  4YCV A;  4LF7 Q;  1E0B A;  1I4H A;  3MZ5 A;  2QDB A;  2E8G A;  2RKS A;  4NB3 A;  1XMO Q;  3OIP A;  1W6K A;  1CKN B;  5HY6 A;  2B2Y A;  3DM1 A;  4A3M H;  1L1O A;  3BDC A;  5EPJ A;  1ROD A;  1SDF A;  4KKU A;  1HH2 P;  1CKN A;  1S3O A;  2L55 A;  5M5Y B;  3VR5 A;  5JVG 3;  3PF5 A;  2UUB Q;  3I91 A;  4Y7N B;  3PQI A;  3NK9 A;  3I73 A;  5EBC A;  2JSO A;  4KD3 A;  5EKI A;  1B44 D;  3KF8 B;  1LTS D;  2R7Z B;  5ELO A;  4QUF A;  2RCN A;  4KJO A;  1Y1V H;  1KIX A;  4OL7 A;  1KDB A;  3BG3 A;  3X3N A;  1XPO A;  2VUM B;  5I2Y A;  1PYW D;  1ET6 A;  3H0G H;  1OXV A;  1JR0 D;  5C4X G;  1STA A;  2B3G A;  3D6W A;  2FMC A;  1PHJ A;  4PMC A;  2EQS A;  1D7Q A;  3EN2 A;  5EQ0 A;  3K5L A;  1W2B A;  1CZW A;  3Q24 A;  5M3M H;  1K83 B;  1B70 B;  1TWF B;  1XNQ Q;  2F0T A;  1CSP A;  2E2H H;  5K36 H;  4UP9 A;  3ULP A;  1H95 A;  1HQR D;  1TS4 A;  4LF6 L;  4YIJ A;  2E2J B;  2VNU D;  1G6P A;  2KHS A;  3PIO A;  2F0V A;  2Z8L A;  1K3R A;  3VR2 A;  1IZ6 A;  1DZ1 A;  3PO2 B;  4H44 C;  5IGE A;  5NUC A;  1KNE A;  3DM3 A;  4JI0 L;  4DV1 Q;  3IFT A;  3AEV A;  5LMN Q;  2EY1 A;  3D3R A;  5M5X H;  4BY1 H;  1BCP D;  2B2Y C;  1V9P A;  2JA5 G;  3S14 B;  3I72 A;  1X32 A;  1D1K A;  1KNA A;  1LAC A;  1GUW A;  1Q1B A;  5CV9 A;  1DCZ A;  3K8A A;  3NEM A;  2F0G A;  3URY A;  2VB3 X;  1PH9 A;  1I6H B;  4ODG A;  4DR6 L;  2A6H C;  4IJH A;  1HZC A;  5HGQ A;  1ASY A;  2IWH A;  3E3X A;  3SR1 A;  2Q8I B;  3KJP A;  3I8Z A;  4DKA C;  4EQN A;  3RD4 A;  1WJJ A;  4JI8 Q;  2PZW A;  3X3M A;  1B2T A;  2KEN A;  2QEX A;  1VQ4 A;  1O78 A;  5G3L D;  1HTL D;  4R8N A;  2EE1 A;  3A54 A;  2MQH A;  5KNB A;  4V19 0;  3H3V I;  4BBR H;  1O7Y A;  2HDM A;  2O2L D;  1CKO A;  1PTO C;  1EY8 A;  1S5F D;  4HMI A;  4MTN A;  1HFG A;  1I4P A;  3AQQ A;  1PH7 A;  4ZUI A;  4BBS H;  2KEC A;  1Y1W B;  1K8G A;  1XNR L;  2MHV A;  2ZJR A;  4B3S L;  4CBV A;  3NBI A;  3K59 A;  1JWS D;  1T9H A;  4LF9 L;  3KFU A;  3R8B A;  1IKM A;  1L1O B;  1D1I A;  1X3E A;  3AFP A;  3I3C A;  3H09 A;  5C4X H;  3WDN A;  3UDI A;  1BBX C;  4UHV A;  1M8A A;  3UE0 A;  4CDD C;  2FHT A;  1EQV A;  4IUP A;  5IP7 H;  5J22 A;  3CCU A;  1ZYR C;  2EYO A;  1S4Z A;  4GS3 A;  1WCM B;  2CKZ B;  1I3Q B;  3PF4 A;  2OQ0 A;  5K36 G;  2ENB A;  2RBM A;  2AHO B;  2EY5 A;  2CW0 C;  2Z1C A;  2L11 A;  1ZEQ X;  4RGN A;  4H02 A;  2FIN B;  5BR8 L;  4X64 Q;  3GP7 A;  3U50 C;  2NTT A;  1YHQ A;  4XIG S;  1VQK A;  4OO1 I;  3MVV A;  3S1N H;  2L9H A;  1H9J A;  1YI2 A;  1Y8P B;  1VQA A;  1U5K A;  4BY1 G;  3GDE A;  2N3S A;  3BYY B;  3CD6 A;  5CMD A;  4JBM A;  4DNR B;  5FLM H;  4L6T B;  3V96 A;  3EA6 A;  4IPD A;  2Q8T A;  4DV7 Q;  1LAB A;  1U4L A;  3T53 B;  1EIH A;  3M85 A;  1D8L A;  1PH8 A;  2DUD A;  1VMP A;  5M5W H;  3J81 c;  4QMG A;  3BZD B;  3D31 A;  4P73 A;  3C46 A;  3M3Y H;  2PPB C;  5M3F H;  1Z47 A;  5DAU A;  1Q8K A;  2UUC Q;  1VQG A;  3FVQ A;  3HOY B;  4R4O A;  1HTP A;  4DNI A;  3RLF A;  4KK7 A;  1YNN D;  1CA6 A;  2PW7 A;  1N34 L;  3S1M H;  4K6D A;  1G51 A;  1JWM D;  1CHP D;  3TQY A;  2RF4 A;  4EVO A;  3GTP H;  1NBW A;  3C2P A;  5EGT A;  1R9T B;  3F2D A;  1LT5 D;  1T5E A;  2ID0 A;  5C0X H;  2VQE Q;  4B3T L;  1B3A A;  3V05 A;  3CW2 C;  4B3T Q;  3K7A H;  4HTH A;  2VL6 A;  2KVM A;  2BA0 A;  5C0X I;  5LL6 S;  1WTW A;  4FXK C;  3CC4 A;  4APV A;  3W2D A;  1L0Y B;  1KAA A;  2VQF Q;  1FGU A;  2J7Z A;  3TZU A;  2MO0 A;  1HCZ A;  1RIP A;  1XYI A;  4ZRZ A;  1LV9 A;  3D8G A;  3S1R H;  1SRO A;  1AH9 A;  1EYA A;  4ILW A;  1GKH A;  1Y69 U;  5FKA C;  4A3B G;  4ZKC B;  1RDP D;  1AE2 A;  4IPH A;  3DWQ A;  5C3X A;  1PMR A;  5H1S E;  1WTH A;  3A0J A;  4DUZ Q;  1LTR D;  2E2J H;  1VQE A;  1SJH D;  2ATW A;  2NN6 G;  3HOU B;  4K5X A;  1LTB D;  4X65 Q;  4OEM B;  4OO1 H;  4JBJ A;  4WOR A;  3TS0 A;  1JB3 A;  1KLU D;  5CV7 A;  1PH6 A;  4A3F B;  4A3F H;  5LHY 1;  2CQA A;  4F8M A;  2K05 A;  3GTJ H;  2NBF A;  3D0F A;  3Q6S A;  1JIC A;  4IUQ A;  4RGM A;  3HOY G;  1IYU A;  5C44 B;  3TRE A;  5A2Q L;  4RHR A;  3KF6 A;  4X64 L;  3KLW A;  2ZJP A;  1B9N A;  2F0D A;  2E2I B;  4C3I G;  4DV6 L;  2YU9 H;  1F9Q A;  5JJL A;  3AMU A;  1Y1V B;  1RD9 D;  2K5Q A;  1S5C D;  4QCL A;  1YNN C;  2WAQ E;  3HZX A;  5CV8 A;  4PMW A;  2B2W C;  4L5T A;  2G9D A;  1F77 A;  2HQE A;  2WB1 E;  4ULL A;  2V1C C;  5IT9 E;  4OX9 Q;  4DAY B;  3O13 A;  2R93 H;  5IOC A;  2CWA A;  2ICE C;  1O7L A;  3H6M A;  1BVS A;  2F0H A;  3FKI H;  1SMY D;  2F0M A;  2B2U A;  3P20 A;  4JVZ A;  4IQZ A;  2HT1 A;  3OMC A;  1SYC A;  2A5H A;  5F2D A;  3S24 A;  3T1H L;  2ZTC A;  1EIY B;  3KYH C;  1EWC A;  3R93 A;  1XNR Q;  4TQU S;  3W1B A;  4BA2 I;  1LLR D;  5JEA J;  4HSV A;  2F1M A;  3M4O B;  3M3Y B;  4AQY L;  1AZQ A;  1A3V A;  2DY7 A;  1WFQ A;  4KN4 C;  3UDG A;  2PI2 E;  1KC8 C;  4CJ0 B;  4DV3 L;  2D0O A;  1VQM A;  1I4R A;  1HQM C;  5HGT A;  2N88 A;  4LUO A;  4FXD A;  2N49 A;  1SJE D;  4KJN A;  3QIA A;  4K5V A;  4A3I B;  1P8L A;  4JI2 L;  4DAY A;  1AE3 A;  1RJT A;  1EQT A;  3VYS A;  2X69 A;  4XQN A;  3S16 H;  1TY0 A;  2VUM H;  4GNX C;  3NBH A;  1EY6 A;  1X3G A;  3BVG A;  4OXP A;  1PYB A;  4DV2 Q;  3VYT A;  4FNF A;  3HOV B;  4JI1 Q;  1H9S B;  1EY4 A;  4P71 A;  1I3Q H;  1SE8 A;  1H9R A;  3DEP A;  4NPS A;  1Y8O B;  4JBW A;  1EWH A;  2F4I A;  4RCN A;  1Q3L A;  2JA7 G;  4B3R Q;  1EUJ A;  1S5B D;  3QB3 A;  3CCE A;  1Q86 C;  2CFM A;  5KND A;  4Y52 H;  1N8R C;  2K1B A;  3HOX G;  4GKJ L;  2E76 C;  2ASB A;  1SNP A;  1QJO A;  4RKL A;  4BS9 A;  3C1F A;  2JA5 B;  2BH8 A;  1BCP B;  1UE7 A;  3QOJ A;  3CCJ A;  3CC2 A;  1YVC A;  1EYD A;  1X3Q A;  5M9O A;  5I9P A;  1I94 L;  2Q2T A;  4C2M H;  3K5O A;  2JA9 A;  1RTO A;  1L2F A;  3GTM B;  4IFD G;  1DYQ A;  2K4K A;  3U4Z A;  3GTL B;  2Z0S A;  1KAB A;  4IOA A;  1SLJ A;  3J7A V;  1PTO F;  3PO3 G;  2BDN A;  2JQO A;  1PA6 A;  2ALY B;  4KY5 A;  3QO2 A;  3L7Z C;  2IHE A;  4RWS C;  4B3M Q;  4DV0 L;  3HOV H;  2LY7 A;  4RMF A;  3HFZ B;  3BYT B;  1G29 1;  1Z9F A;  2O5J C;  2JA6 G;  2WII B;  4A3G B;  4GLX A;  5CR3 A;  1CA5 A;  1X56 A;  1VQ5 A;  4JI4 L;  3CCM A;  1VQB A;  1SFO H;  3EBE A;  1BNZ A;  2K04 A;  4ZKB B;  3S1R B;  1C7Y A;  2Y0S E;  1SMX A;  4EX5 A;  1AZP A;  2B39 A;  4IUV A;  3I4N H;  3I4M B;  1CSQ A;  1TS3 A;  4LF4 L;  1F2Y A;  4LF7 L;  3BS1 A;  1GO3 E;  1E22 A;  2XRS D;  3IL8 A;  3JAM c;  4OWX B;  4DXG A;  1QWY A;  1Q12 A;  2WAQ B;  4G4K A;  2HUG A;  1HA6 A;  5ELN A;  2C35 B;  4XTC S;  4O1N A;  1YIT A;  4C56 C;  1DOM A;  1KLG D;  1EY9 A;  2BDO A;  1ZYR D;  2ZTE A;  4RAU C;  1E2W A;  2JA7 H;  2E74 C;  3W5O A;  4A3M B;  5K5P A;  3H15 A;  2EYP A;  4V0B A;  1HR0 W;  4QJF A;  2MP1 A;  4A93 H;  2GVB A;  3NHH A;  2K32 A;  1WD0 A;  5E4X A;  4EGV A;  5FO9 B;  1CFM A;  4WRD A;  3TS2 A;  1ASZ A;  1HUM A;  1IL8 A;  5C0X G;  2NVQ B;  1PLF A;  2KCC A;  3KJO A;  4HIK A;  1ONL A;  3S2D H;  2R7Z G;  2L0C A;  1MD2 D;  3RR5 A;  1AW7 A;  2R92 B;  4RKB A;  4CKC A;  5C4J H;  3FRP B;  2NVQ H;  2KCM A;  1OXX K;  5AJ3 Q;  4F87 A;  4C3J B;  4XQQ A;  5A35 A;  2UUA Q;  4DUY L;  1WYD A;  3A7L A;  4GLV B;  1STY A;  3UI2 A;  4B9W A;  1KRS A;  3CKI B;  3FKI B;  4DR3 L;  4IUT A;  4JPB W;  4DV4 L;  3PO3 H;  1PTO D;  3TN2 A;  4RFB A;  3ER0 A;  4C3H H;  3K57 A;  3S1Q H;  3EIV A;  4NXM L;  1SNQ A;  1BCP F;  4LFC L;  4DR2 L;  2JA6 B;  2H5X A;  1UUP A;  5DM6 3;  2SDF A;  3STB D;  2E5L Q;  5I6Y A;  3CHB D;  3J80 c;  4DU9 A;  1PH4 A;  2EY2 A;  4OHJ A;  3J7A F;  5IYC H;  3ND9 A;  1U4M A;  1MI2 A;  1GUT A;  4BBR G;  1TWH H;  1UE5 A;  2K5D A;  2WV6 D;  1DOK A;  1YZ6 A;  4JI6 Q;  4A93 G;  4OX9 L;  4C1N K;  4U68 A;  3E9H A;  2WAQ G;  1BQQ T;  3BU2 A;  4IZ8 A;  4JI4 Q;  3CC7 A;  3E9I A;  3GTP B;  1LT3 D;  2A1A A;  2NUC A;  2K52 A;  1ESR A;  3HOZ B;  4HID A;  3BDL A;  1BUV T;  2OTJ A;  1C4Q A;  4K8J A;  1ML0 D;  3MEH A;  2J4X A;  3MXN A;  2JE6 I;  4CKB A;  1PZI D;  2ZM6 Q;  4FP5 D;  1CZG A;  4PV1 C;  5JPN C;  1VS0 A;  2ZJQ A;  4YWL A;  4OEL B;  3K81 C;  1TQO A;  4JV5 Q;  5FJ8 G;  4QY7 A;  1JWU D;  1CUK A;  5KGU A;  5CV6 A;  1SBB B;  3W3A A;  1W6J A;  4A4I A;  4A3K H;  1TWF H;  3CAM A;  1ICW A;  4JCV E;  4O2D A;  3G48 A;  2SEB D;  5TSS A;  1B8A A;  1J5E Q;  2F3V A;  2UXD Q;  1EEF D;  2UXB L;  4A3D G;  3QR8 A;  1BCP C;  4FXG C;  5I4D A;  1GUN A;  3CP0 A;  1TS2 A;  3RN2 A;  4LF5 L;  3TSS A;  4GKJ Q;  1BDO A;  1SXT A;  4G7Z C;  4JK1 C;  2EYF A;  5I6W A;  2K75 A;  1WTR A;  2K28 A;  4DR7 L;  1VQL A;  1EY5 A;  2A73 B;  1PH1 A;  4R4I A;  3PV0 A;  1EY7 A;  1OTC A;  2A69 C;  3HKZ E;  5M5Y H;  1LTG D;  1X3F A;  3MA2 B;  4HR7 B;  3SHL A;  2KUM A;  3GQB A;  2F03 A;  5IYD H;  1E2Z A;  5FLM G;  3CF5 A;  3IRB A;  3H3V H;  2QEJ C;  4GKK L;  1NMF A;  3U58 A;  3OOC A;  5ELC A;  4A3G G;  2KHJ A;  1YNJ C;  2AWN A;  1Y1V G;  4GLA C;  5GAH C;  1A3U A;  4HN7 A;  5I2X A;  4BXX H;  2H4O A;  4YCW A;  2L1B A;  2JA8 G;  3RZO H;  2JJQ A;  2Z6B A;  4A75 A;  1TY2 A;  1PFN A;  1YBY A;  1XXG A;  4DK0 A;  2MPM A;  1K9M C;  2E2H B;  2O5I C;  2IX0 A;  4I7A A;  2NVX B;  2FXQ A;  3KBX A;  1K83 H;  2B8G A;  2K5V A;  1H9S A;  1I4G A;  1SYD A;  1L1O C;  1LT4 D;  1ICF B;  3S1Q B;  1VQP A;  4A3D H;  1BKB A;  1KD1 C;  3J80 i;  1SE4 A;  3T51 B;  3I56 A;  4DR5 Q;  3C3L A;  3AB9 A;  1K8M A;  4R1J A;  3GTK B;  4DR2 Q;  5DEH A;  1FNU A;  2F0S A;  1HZ9 A;  1J8I A;  1HNX Q;  4HCE A;  3T1Y L;  3CCL A;  3GTQ B;  3D4D A;  3QG1 A;  2CH4 A;  2F0Q A;  4DV4 Q;  1F9R A;  2HIX A;  2EDG A;  1J6Q A;  1F9P A;  5FJ8 H;  4UP7 A;  1YNJ D;  5D3I B;  2PMZ E;  3CXC A;  4A3I G;  3HG9 A;  1JT8 A;  4ID6 A;  1JE5 A;  3H94 A;  4A3J G;  3HGB A;  4A3B H;  1P16 A;  4OO1 G;  4LAA A;  2XNA C;  4JOI C;  4DFA A;  1WTQ A;  4BY7 G;  1QOH A;  1PH5 A;  4LF8 L;  3DUZ A;  1EFW A;  2EXD A;  2EYH A;  1G2T A;  2JXM B;  1XPU A;  5AFW A;  4LNQ A;  4PG3 A;  2NVY H;  1TWG H;  3VYR A;  1PVO A;  3IAY A;  1VMC A;  1PTO B;  2EJM A;  4LK1 C;  4FO2 A;  4POG A;  2B29 A;  1A0I A;  5KYL A;  1TWC B;  3T56 B;  4BBR B;  5C3E H;  1C9O A;  1XPR A;  2NVY B;  2K5H A;  4PZ8 A;  3STB C;  2UU9 L;  2QW7 A;  3VYU A;  1J9O A;  3VR6 A;  1FJG L;  1LYL A;  3PIO 3;  3I4L A;  3F8T A;  1CQV A;  2PQA B;  1A15 A;  4LFA L;  2WB1 B;  1A63 A;  2K33 A;  2QIL A;  2HQL A;  4ME3 A;  2X6G A;  2M9V A;  4H13 C;  3S9W A;  4HCS A;  2B2V A;  2NZ1 D;  4MTK A;  4C1N I;  2MJ8 A;  4BXX G;  5IGD A;  2DJF C;  1T5X D;  2NN6 I;  3FKI G;  2QKI C;  1SNO A;  3S2H B;  1I4X A;  2PNR C;  1VDZ A;  5M5X B;  4BY1 B;  1QIL A;  2R7D A;  5IWA L;  3NEN A;  4QB4 A;  1PV4 A;  4JYA Q;  3BVZ A;  2WKC A;  1KAW A;  2L4N A;  1M1K C;  4DR6 Q;  3J80 L;  2F3W A;  3EFX D;  4R4T A;  4KMU C;  2IX1 A;  3RMH A;  4MZ9 A;  3OHX C;  3U4V A;  4HIM A;  3S2D B;  1E24 A;  1R4P B;  1TS5 A;  4C3J H;  2EY6 A;  1MHW C;  1ENC A;  4IFD J;  3OYY A;  4HJ7 A;  4A3M G;  2A8V A;  1Z6H A;  4N9T A;  4K8I A;  3OWF A;  4JI6 L;  1PRT F;  3PCO B;  3SE0 A;  3J7Z C;  2NVX H;  3J81 i;  4GNX B;  4O42 A;  2N55 A;  4ABN A;  3CCS A;  4RGO S;  4HJ5 A;  1I6V C;  4K0K Q;  1GOZ A;  3K58 A;  1RTN A;  3NE5 B;  3HOU H;  3K7U C;  2VXW A;  2RA4 A;  5J1Z A;  4BY7 H;  1EIF A;  3G6J B;  5LL6 X;  5IT9 c;  1BR9 A;  5J3B A;  2KJX A;  3GTM H;  4P72 A;  3MTS A;  2BCO A;  3GTK H;  1SN8 A;  2HCC A;  2VS1 A;  4LMQ D;  3CPW A;  3N6R A;  4HIO A;  1O7Z A;  1ET9 A;  3ITP A;  3U9O A;  1D5Z C;  2L5T A;  1V43 A;  2WKD A;  5G3L F;  1C0A A;  3GTG H;  2LXJ A;  2OTL A;  2BE5 D;  2XRQ D;  4DN4 M;  1HNZ L;  2PZT A;  1STG A;  1I4Q A;  3S17 B;  1HXY D;  1EZ8 A;  2F52 A;  5GAG C;  5C44 H;  1PDQ A;  3HOW H;  2OEO A;  1KDC A;  3L0O A;  1Q8I A;  1X54 A;  5JOB A;  1GUO A;  2Q8R E;  4YHH Q;  4DR1 Q;  4TKO B;  1SFO B;  1WOC A;  5CV4 A;  1WTV A;  2DNC A;  2KCT A;  2LSS A;  1N33 Q;  4RHS A;  3FHW A;  1QVC A;  1AFP A;  3H0G G;  4DF7 A;  1M4V A;  1E1T A;  3I2Z A;  2BA1 A;  4DAV A;  3S15 H;  2WP8 J;  1CKM A;  1S5E D;  1B3Q A;  1V1P B;  4KI0 A;  3MXP A;  4XQJ A;  1N9W A;  3JC6 6;  5E1F A;  3J81 E;  2EYM A;  3FPU B;  3NPP A;  5LMN W;  4JI7 Q;  1HZA A;  3BZC A;  3TP6 A;  5FK9 C;  2CW0 D;  4S3S A;  4WFN 3;  4ME5 A;  4LF4 Q;  4A3F G;  3TP8 A;  3GD7 A;  3D4W A;  4X3K A;  4N8X 1;  1D6E C;  2EOT A;  2MO1 A;  1S72 A;  2YTV A;  4OWW B;  1F2M A;  1STB A;  5C5L A;  4C3I B;  4IFD I;  2XTI A;  1EIG A;  3S17 H;  1A2U A;  4X3T A;  4LFB L;  1K0S A;  3L3O C;  5C44 G;  1JOQ A;  4ZLT F;  3OIQ A;  2RSN A;  4C3I H;  5JAV A;  3K7A B;  5D65 A;  2AWO A;  4IJL A;  5CV5 A;  2F0N A;  4WJ4 A;  1LTA D;  2AKW B;  4A3G H;  3KF6 B;  1IHZ A;  3SK4 A;  4DV6 Q;  4X62 L;  4A3E G;  4PZ6 A;  1TWG B;  3JAM L;  1IBM Q;  4IPG A;  4DXF A;  3CME A;  2KQ3 A;  3RLN A;  3M9B A;  1PH3 A;  4R4Q A;  2RSO A;  4JI5 Q;  4JI0 Q;  3PGZ A;  2B2W A;  2DN8 A;  4KD4 A;  2N8N A;  1IW7 C;  1HFN A;  3KLS A;  4X65 L;  1QCB D;  3HRZ C;  3C1E A;  2AUK A;  2I5L X;  4K5W A;  3PUY A;  1I94 Q;  1C8C A;  3RZD B;  4UP8 A;  2I07 B;  3AYH B;  5IP9 G;  1S40 A;  3SK5 A;  1EOT A;  3P7J A;  4DPG A;  2SOB A;  2I0Q A;  3F2C A;  3HEJ A;  2YV5 A;  3A8K E;  3D6C A;  2LFN A;  4GOP C;  1BOS A;  2L12 A;  1E7Z A;  4B3R L;  3NSW A;  2OF1 A;  4POF A;  1JJG A;  3ERO A;  3ERQ A;  4N8F A;  1EY0 A;  1K73 C;  1FYC A;  3DLL A;  1MJC A;  1NE3 A;  4DR4 Q;  5EBD A;  5IP7 G;  4A3E H;  1JE4 A;  1VQ8 A;  2UXC Q;  4RH6 A;  4X66 L;  1L0X B;  3D4R A;  3NXW A;  1A8V A;  4LFB Q;  1YJN A;  2EXZ A;  5IGF A;  1UEB A;  4A3E B;  1SYG A;  1KDA A;  3HS0 C;  3S15 B;  2KED A;  4CDF C;  4U67 3;  3B6Y A;  2FFK B;  5C3E G;  1QB5 D;  4DV3 Q;  3HOX B;  5COR A;  4NKL A;  2H1E A;  3E6Z X;  3TME A;  1DXM A;  2CHB D;  1Q82 C;  3EJI A;  4HJ9 A;  4BBS B;  4DNT B;  4A3K B;  3BJU A;  2D62 A;  5BN5 A;  1K8O A;  1HR0 Q;  5FO7 B;  4IOC A;  1AN8 A;  1SMY C;  1NJI C;  1PFB A;  4DV7 L;  4R4C A;  1STH A;  2YTY A;  2EPB A;  1IXR A;  1VQF A;  3NP8 A;  4HED A;  2NVT B;  3RZD H;  2YTX A;  2NZO A;  2OXP A;  3SEB A;  4OIK A;  5KRU A;  4YY3 Q;  1Q90 A;  2F0K A;  1JC7 A;  1X3P A;  4JI3 Q;  4OIJ A;  2EIF A;  1Z7T A;  2AQ3 B;  2WFW A;  2JN4 A;  2E75 C;  4TSS A;  3M7N A;  2Q2I A;  3M4P A;  4CJ2 C;  2LKV A;  1GXD C;  5IYB G;  4XXE A;  4A3K G;  1KQS A;  1EU4 A;  1SE2 A;  2PMZ B;  3PIP A;  2Z6K A;  5LMU Q;  1NUC A;  1F9S A;  1MSH A;  2VB2 X;  2ZXR A;  2CVR A;  4G57 A;  1TKW B;  3AFQ A;  1HNZ Q;  3GV3 A;  1UAP A;  3A5Z B;  4N9P A;  3CCR A;  2IT1 A;  2WIN B;  2R7F A;  5ELB A;  2K5N A;  4RGT A;  4FF3 A;  4ALP A;  2DNE A;  3FMC A;  1SNM A;  2Q2H A;  1L0W A;  4MN3 A;  4AH6 A; 
#chains in the Genus database with same CATH homology
 3L9A X;  3MAQ A;  3TZD A;  5KYI A;  1S5D D;  3HKZ B;  4XYO A;  2J0T D;  1PFM A;  2JYO A;  2D9U A;  1XWE A;  1MBY A;  2F0J A;  3A8I E;  4AYB B;  1ESF A;  2DY8 A;  3OSO A;  5ELF A;  1VF7 A;  4K2K A;  5KNC A;  1WVL A;  1G91 A;  4A3B B;  1SSO A;  4KHZ A;  1BXT A;  2F0U A;  1LTI D;  1IW7 D;  3T13 A;  1QNU A;  3I70 A;  3MHB A;  3NTI A;  1AEX A;  4FF1 A;  4H0L C;  5CBE E;  2F0I A;  3S1N B;  1GUG A;  3NTK A;  1TR5 A;  2NTS A;  4MHE A;  1H9K A;  5DNF A;  1II3 A;  2Z4H A;  4R8I A;  4UDU C;  1D5M C;  3NQI A;  5I9O A;  4GZY C;  3GO5 A;  2AQ1 B;  5ELE A;  1CT1 D;  3MC0 B;  5FOB B;  1DM0 B;  5JEA H;  4A3J B;  2D2C C;  5ELD A;  3BDO A;  4A93 B;  1PRT B;  4FF4 A;  3Q0A A;  4Q5V A;  4BA1 I;  1G6Z A;  1XX8 A;  1ENA A;  2QCP X;  2RDG A;  4ZK9 B;  3HP3 A;  5JVH 3;  4MIU A;  5FLX L;  1D5X C;  1TU2 B;  1F2L A;  4G7O C;  3FPP A;  3HOW B;  2PO4 A;  3H0G B;  1G8Z D;  1XTC D;  4DK1 A;  4KN7 C;  1V1P A;  2EZV A;  3QOL A;  1A6X A;  2IW3 A;  2ICI A;  4B9X A;  2K01 A;  4J8Q A;  3A56 A;  2XVS A;  3VA7 A;  2RDH A;  2PCF B;  3DXJ C;  1AP0 A;  3CRK C;  1B1Z A;  4G7H C;  5JEA G;  4CJ1 B;  1SYF A;  3CRL C;  1D2B A;  5M3F B;  2TSS A;  3NUC A;  5HUR A;  1V1O A;  4UAI A;  4CKE A;  4C3J G;  3FDT A;  1OXT A;  3R2I A;  1BF4 A;  3NTH A;  5IGB A;  3WOF A;  4H7B A;  3K5N A;  1ENF A;  1EL0 A;  1U9R A;  2A68 C;  3P1H A;  2RDF A;  2PW5 A;  2M2L A;  2B2T A;  3RZO B;  4ZQ3 A;  1OXS C;  5EKK A;  1GHK A;  4WJW A;  3KF8 A;  5C4Z A;  1STE A;  3FEW X;  4HSP A;  1PZJ D;  3J80 E;  3AU7 A;  2FMM A;  2B2U C;  4XT3 B;  4J1M A;  5BN3 A;  2PQE A;  3LX0 A;  3PUZ A;  3KBG A;  1CK1 A;  4C3H B;  3GV6 A;  2SNS A;  3A55 A;  2NYZ D;  1RF2 D;  1TVX A;  1SE3 A;  1LT6 D;  1C48 A;  3PUV A;  1JQY D;  2F0E A;  1WTO A;  1DOL A;  3DWP A;  4DAP A;  1FD7 D;  2YYZ A;  1SND A;  2G9H D;  2B8F A;  1G2S A;  1B9M A;  2D5D A;  4RCO A;  3GTJ B;  2XWB B;  1WD1 A;  3SK8 A;  1Q1E A;  2LS0 1;  4I7Z C;  3IFD A;  2C5C A;  4B08 A;  2EJF C;  4K14 A;  1QE6 A;  3MXG A;  5T1I A;  2KA7 A;  3H3V C;  1NR4 A;  1R4Q B;  3PIP 3;  1NSN S;  4ZYS A;  1HPC A;  4QIW B;  1Y8N B;  3VA5 A;  1GJX A;  3E0J A;  2IJ0 A;  5FO8 B;  3F2U A;  3R3O A;  5JJZ A;  2E2D C;  3I4N B;  3OMG A;  4A3D B;  1A2T A;  1GUS A;  3VR3 A;  3Q23 A;  1IKL A;  5EPK A;  5KEE A;  1TII D;  1EYC A;  4KV6 A;  2XSC A;  3R2T A;  1PRT D;  1JCK B;  4X3S A;  3RUZ A;  1PRT C;  3PMF A;  5C4X B;  3KK7 A;  3OWE B;  1QNK A;  1TWA B;  1TT2 A;  1CI3 M;  1UNS A;  1PZK D;  4CHT B;  2IPK D;  1EU3 A;  2TMP A;  3ONA B;  3VR4 A;  4IAL A;  2R3Z A;  2A6E C;  2AQ2 B;  1DD2 A;  4NDX A;  2MGS A;  2MUY A;  5E4W C;  2KOL A;  2WAC A;  3IKJ A;  4KTA A;  1HUN A;  4Z9C B;  2AUJ D;  3K0Y A;  1BO0 A;  3J7Y W;  2ZT9 C;  4KHV A;  1NCV A;  5IOD A;  5IGG A;  5A2Q E;  3A8J E;  2A6E D;  2JA7 B;  2ZXO A;  2F0W A;  4M8A A;  1FNW A;  4OGQ C;  4HMJ A;  3DEO A;  2JP1 A;  3P75 A;  1MGS A;  1SEB D;  3SVM A;  1V8Q A;  1IYV A;  1CTM A;  2K03 A;  3KLR A;  1KTK A;  2F0F A;  4CGY B;  2GA4 B;  3LWE A;  1LTT D;  4P2C B;  2F0L A;  2C9O A;  5C4H A;  2EJG C;  1SAP A;  1DON A;  1UEA B;  5C5M A;  5CC4 A;  3M4Y A;  4IN3 A;  2PZU A;  1CQF A;  4FVM A;  1DJR D;  2XIW A;  4FYD A;  5CYU A;  1EZ6 A;  4E6I A;  2K6A A;  2OT2 A;  3PUW A;  3H91 A;  2R61 A;  4L63 B;  3ZYY X;  4KKS A;  4KY7 A;  1SYB A;  3CQZ B;  4F88 A;  3G7L A;  3PUX A;  1NR2 A;  1PXU A;  5IIF A;  3E5S A;  1JOK A;  1TWH B;  4IUU A;  5KIX A;  2Y0S B;  4I65 A;  3KUP A;  2RVL A;  3KLS X;  2EYJ A;  2A69 D;  1LO5 D;  2XN9 C;  3DMU A;  1ZKO A;  3J81 L;  4C3H G;  3S16 B;  3NQT A;  4Q0F A;  3OPO A;  3SXH A;  3K6O A;  4PNY A;  1EFI D;  4DGZ A;  3LWU A;  3MXU A;  1U4P A;  4IUR A;  4F7X A;  3QJY A;  3TBI B;  2JA8 B;  1SYE A;  5M3M B;  4PQX A;  4J6H A;  4R9W A;  2R93 B;  5FLX E;  4PMB A;  4DA2 A;  5D3D A;  2B63 B;  3ND8 A;  2F0P A;  4K2L A;  1HHV A;  1B53 A;  3Q22 A;  5CGK A;  1SNC A;  2JEB I;  3JAM E;  3EQL C;  3EVQ A;  3WOE A;  2HCI A;  1O80 A;  2R6G A;  4XDX A;  3V2T A;  1FR3 A;  1OXU A;  5COY A;  4TRD A;  1CHQ D;  2JEA I;  1ZXT A;  3S1M B;  2O4X A;  1B50 A;  5C0X J;  1F2Z A;  3TP5 A;  1I50 B;  1VCI A;  2B2T C;  3MWY W;  4ZUJ A;  3SK6 A;  3NWS A;  2NN6 H;  5E3F A;  5J39 A;  1RCV D;  2A68 D;  4BWG B;  1QG7 A;  1HA5 A;  1PTO H;  4KKT A;  1FGB D;  3M7G A;  5ISR A;  2NB0 A;  5JPM C;  2HDL A;  4QUC A;  3CU7 A;  2I46 A;  1A3T A;  5IGC A;  3I90 A;  2X6L A;  2Z4I A;  3TDQ A;  4EQP A;  4IUN A;  3T16 A;  5C6A A;  5BN4 A;  4NW2 A;  2SNM A;  2YU9 B;  3SDZ A;  3U9S A;  2LMC B;  5C4J B;  2XWJ B;  2A74 C;  4M1U B;  2KCN A;  3A7A B;  2EVB A;  1HRJ A;  2EYL A;  2A6H D;  1VF5 C;  2V4D A;  4NP5 A;  4L8J A;  1B4O A;  4X3U A;  1WTP A;  3K5M A;  3N52 A;  2RQX A;  1STN A;  2IX3 A;  3QWN A;  1OO9 B;  2BOS A;  4FF2 A;  4EQO A;  1GHJ A;  1CM9 A;  2B2V C;  5D14 A;  3MFG A;  5EKL A;  2F0O A;  1ILQ A;  4XT1 B;  4ZAI A;  4NMZ A;  4HAE A;  1WTX A;  1JOO A;  3GTO B;  3GTG B;  1MSG A;  4K6L A;  4LJZ C;  2K5W A;  5IT9 L;  3DWA A;  2KEE A;  3OW7 A;  1RHP A;  3PO3 B;  4IFD H;  2NWG A;  4QF4 A;  5C3E B;  2BE5 C;  3MFY A;  1EEI D;  5C3W A;  1JOR A;  2IL8 A;  3NWT A;  5T1G A;  3T4A C;  1NAP A;  3TP7 A;  2K7V A;  1FNV A;  2FJ2 A;  4RA8 A;  4XYQ A;  5EPL A;  5DM7 3;  3BVM A;  5EJW A;  2PYK A;  4BY7 B;  5M5W B;  3DHQ A;  4KY6 A;  2QF7 A;  4C2M B;  5CBA E;  1E2V A;  2M00 A;  1ILP A;  1RKN A;  1U4R A;  3LNN A;  2ZXP A;  1H9M A;  1E0B A;  1I4H A;  3MZ5 A;  2QDB A;  2RKS A;  3OIP A;  1W6K A;  2B2Y A;  3DM1 A;  3BDC A;  5EPJ A;  1ROD A;  1SDF A;  4KKU A;  2L55 A;  5M5Y B;  3VR5 A;  5JVG 3;  3I91 A;  4Y7N B;  3NK9 A;  3I73 A;  5EBC A;  2JSO A;  4KD3 A;  5EKI A;  1B44 D;  1LTS D;  2R7Z B;  4QUF A;  4KJO A;  4OL7 A;  1KDB A;  3BG3 A;  3X3N A;  2VUM B;  5I2Y A;  1PYW D;  1ET6 A;  1OXV A;  1JR0 D;  1STA A;  3D6W A;  2FMC A;  4PMC A;  5EQ0 A;  3K5L A;  1CZW A;  3Q24 A;  1K83 B;  1TWF B;  2F0T A;  5K36 H;  1HQR D;  1TS4 A;  4YIJ A;  2E2J B;  2VNU D;  2KHS A;  2F0V A;  2Z8L A;  3VR2 A;  1DZ1 A;  3PO2 B;  4H44 C;  5IGE A;  5NUC A;  1KNE A;  3IFT A;  2EY1 A;  3D3R A;  1BCP D;  2B2Y C;  3S14 B;  3I72 A;  1X32 A;  1D1K A;  1KNA A;  1LAC A;  1GUW A;  1Q1B A;  5CV9 A;  1DCZ A;  2F0G A;  3URY A;  2VB3 X;  1I6H B;  4ODG A;  2A6H C;  2IWH A;  3SR1 A;  2Q8I B;  3I8Z A;  4EQN A;  3RD4 A;  2PZW A;  3X3M A;  1B2T A;  1O78 A;  5G3L D;  1HTL D;  4R8N A;  2EE1 A;  3A54 A;  5KNB A;  4V19 0;  1O7Y A;  2HDM A;  2O2L D;  1PTO C;  1EY8 A;  1S5F D;  4HMI A;  1HFG A;  1I4P A;  4ZUI A;  2KEC A;  1Y1W B;  2MHV A;  4CBV A;  3NBI A;  3K59 A;  1JWS D;  3R8B A;  1IKM A;  1D1I A;  3I3C A;  3H09 A;  3WDN A;  1BBX C;  1M8A A;  2FHT A;  1EQV A;  4IUP A;  5J22 A;  1ZYR C;  2EYO A;  1S4Z A;  1WCM B;  5K36 G;  1I3Q B;  2ENB A;  2RBM A;  2EY5 A;  2CW0 C;  2Z1C A;  2L11 A;  1ZEQ X;  4RGN A;  2FIN B;  3GP7 A;  2NTT A;  4XIG S;  4OO1 I;  3MVV A;  2L9H A;  1H9J A;  1Y8P B;  3BYY B;  5CMD A;  4DNR B;  4L6T B;  3V96 A;  3EA6 A;  2Q8T A;  1LAB A;  1U4L A;  3T53 B;  1EIH A;  3M85 A;  1VMP A;  4QMG A;  3BZD B;  3D31 A;  3C46 A;  2PPB C;  1Z47 A;  5DAU A;  3HOY B;  3FVQ A;  1HTP A;  3RLF A;  4KK7 A;  1YNN D;  1CA6 A;  2PW7 A;  4K6D A;  1JWM D;  1CHP D;  4EVO A;  3C2P A;  5EGT A;  1R9T B;  1LT5 D;  1T5E A;  2ID0 A;  5C0X H;  1B3A A;  3V05 A;  4HTH A;  2KVM A;  2BA0 A;  5C0X I;  5LL6 S;  1WTW A;  4FXK C;  3W2D A;  1L0Y B;  1KAA A;  2J7Z A;  3TZU A;  1HCZ A;  1XYI A;  4ZRZ A;  1LV9 A;  3D8G A;  1EYA A;  4ILW A;  1Y69 U;  5FKA C;  4ZKC B;  1RDP D;  3DWQ A;  5C3X A;  1PMR A;  1LTR D;  1SJH D;  2NN6 G;  3HOU B;  4K5X A;  1LTB D;  4OO1 H;  4WOR A;  1JB3 A;  1KLU D;  5CV7 A;  4A3F B;  5LHY 1;  2CQA A;  4F8M A;  2K05 A;  2NBF A;  3Q6S A;  1JIC A;  4IUQ A;  4RGM A;  1IYU A;  5C44 B;  5A2Q L;  4RHR A;  1B9N A;  2F0D A;  2E2I B;  4C3I G;  1F9Q A;  3AMU A;  1Y1V B;  1RD9 D;  2K5Q A;  1S5C D;  4QCL A;  1YNN C;  3HZX A;  5CV8 A;  4PMW A;  2B2W C;  2G9D A;  1F77 A;  2HQE A;  4ULL A;  5IT9 E;  3O13 A;  5IOC A;  2ICE C;  1O7L A;  3H6M A;  2F0H A;  1SMY D;  2F0M A;  2B2U A;  3P20 A;  4IQZ A;  3OMC A;  1SYC A;  2A5H A;  5F2D A;  1EWC A;  3R93 A;  4TQU S;  4BA2 I;  1LLR D;  5JEA J;  4HSV A;  2F1M A;  3M4O B;  3M3Y B;  1AZQ A;  1A3V A;  2DY7 A;  4KN4 C;  4CJ0 B;  1I4R A;  1HQM C;  5HGT A;  2N88 A;  4FXD A;  1SJE D;  4KJN A;  3QIA A;  4K5V A;  4A3I B;  4DAY A;  1RJT A;  1EQT A;  3VYS A;  2X69 A;  4XQN A;  1TY0 A;  3NBH A;  1EY6 A;  3BVG A;  3VYT A;  4FNF A;  3HOV B;  1H9S B;  1EY4 A;  3DEP A;  1H9R A;  1Y8O B;  4JBW A;  1EWH A;  2F4I A;  4RCN A;  1Q3L A;  1S5B D;  3QB3 A;  5KND A;  2K1B A;  2E76 C;  1SNP A;  1QJO A;  4RKL A;  4BS9 A;  3C1F A;  2JA5 B;  1BCP B;  3QOJ A;  1EYD A;  1X3Q A;  5M9O A;  5I9P A;  3K5O A;  1RTO A;  3GTM B;  4IFD G;  1DYQ A;  3GTL B;  1KAB A;  3J7A V;  1PTO F;  2BDN A;  4KY5 A;  3QO2 A;  3L7Z C;  4RWS C;  2LY7 A;  3BYT B;  1G29 1;  2O5J C;  2WII B;  4A3G B;  5CR3 A;  1CA5 A;  1BNZ A;  3S1R B;  2K04 A;  4ZKB B;  1AZP A;  2B39 A;  4IUV A;  3I4M B;  1TS3 A;  1F2Y A;  3BS1 A;  2XRS D;  3IL8 A;  4DXG A;  1QWY A;  1Q12 A;  2WAQ B;  4G4K A;  2HUG A;  1HA6 A;  4XTC S;  4O1N A;  4C56 C;  1DOM A;  1KLG D;  1EY9 A;  2BDO A;  1ZYR D;  4RAU C;  1E2W A;  2E74 C;  4A3M B;  5K5P A;  2EYP A;  4V0B A;  2MP1 A;  3NHH A;  2K32 A;  1WD0 A;  5E4X A;  4EGV A;  5FO9 B;  1CFM A;  4WRD A;  1HUM A;  1IL8 A;  5C0X G;  2NVQ B;  1PLF A;  2KCC A;  1ONL A;  2L0C A;  1MD2 D;  2R92 B;  1AW7 A;  4RKB A;  4CKC A;  3FRP B;  1OXX K;  4F87 A;  4C3J B;  4XQQ A;  5A35 A;  3A7L A;  1STY A;  3UI2 A;  4B9W A;  3CKI B;  3FKI B;  4IUT A;  1PTO D;  3TN2 A;  4RFB A;  3K57 A;  1SNQ A;  1BCP F;  2JA6 B;  1UUP A;  5DM6 3;  2SDF A;  5I6Y A;  3CHB D;  4DU9 A;  2EY2 A;  4OHJ A;  3J7A F;  3ND9 A;  1U4M A;  1MI2 A;  1GUT A;  2K5D A;  2WV6 D;  1DOK A;  4C1N K;  4U68 A;  4IZ8 A;  1BQQ T;  3GTP B;  1LT3 D;  2NUC A;  1ESR A;  3HOZ B;  3BDL A;  1BUV T;  1C4Q A;  4K8J A;  1ML0 D;  3MEH A;  2J4X A;  3MXN A;  2JE6 I;  4CKB A;  1PZI D;  4FP5 D;  1CZG A;  4PV1 C;  5JPN C;  1TQO A;  1JWU D;  5KGU A;  5CV6 A;  1SBB B;  3W3A A;  1W6J A;  1ICW A;  2SEB D;  5TSS A;  2F3V A;  1EEF D;  1BCP C;  4FXG C;  5I4D A;  1GUN A;  1TS2 A;  3TSS A;  1BDO A;  1SXT A;  4G7Z C;  4JK1 C;  2EYF A;  5I6W A;  1WTR A;  2K28 A;  1EY5 A;  2A73 B;  3PV0 A;  1EY7 A;  2A69 C;  1LTG D;  3MA2 B;  4HR7 B;  3SHL A;  2KUM A;  3GQB A;  2F03 A;  1E2Z A;  2QEJ C;  3OOC A;  5ELC A;  1YNJ C;  2AWN A;  1A3U A;  4HN7 A;  5I2X A;  2H4O A;  2L1B A;  1TY2 A;  1PFN A;  1XXG A;  4DK0 A;  2MPM A;  2E2H B;  2O5I C;  2IX0 A;  2NVX B;  3KBX A;  2B8G A;  1H9S A;  1I4G A;  1SYD A;  1LT4 D;  3S1Q B;  1SE4 A;  3T51 B;  3C3L A;  3AB9 A;  1K8M A;  3GTK B;  5DEH A;  1FNU A;  2F0S A;  1J8I A;  4HCE A;  3GTQ B;  3D4D A;  3QG1 A;  2F0Q A;  1F9R A;  2EDG A;  1F9P A;  1YNJ D;  5D3I B;  3HG9 A;  4ID6 A;  3H94 A;  3HGB A;  4OO1 G;  4LAA A;  2XNA C;  4DFA A;  1WTQ A;  1QOH A;  3DUZ A;  2EYH A;  1G2T A;  2JXM B;  5AFW A;  3VYR A;  3IAY A;  1VMC A;  1PTO B;  2EJM A;  4LK1 C;  4FO2 A;  5KYL A;  1TWC B;  3T56 B;  4BBR B;  2NVY B;  3VYU A;  1J9O A;  3VR6 A;  3PIO 3;  3I4L A;  1CQV A;  1A15 A;  2WB1 B;  2K33 A;  2QIL A;  2X6G A;  2M9V A;  4H13 C;  3S9W A;  4HCS A;  2B2V A;  2NZ1 D;  4C1N I;  2MJ8 A;  5IGD A;  1T5X D;  2NN6 I;  2QKI C;  1SNO A;  3S2H B;  1I4X A;  2PNR C;  1VDZ A;  5M5X B;  4BY1 B;  1QIL A;  4QB4 A;  3BVZ A;  2WKC A;  2L4N A;  3J80 L;  2F3W A;  3EFX D;  4KMU C;  2IX1 A;  3RMH A;  3OHX C;  3S2D B;  1R4P B;  1TS5 A;  2EY6 A;  1ENC A;  4IFD J;  1Z6H A;  4N9T A;  4K8I A;  3OWF A;  1PRT F;  3SE0 A;  4O42 A;  2N55 A;  4ABN A;  4RGO S;  1I6V C;  1GOZ A;  3K58 A;  1RTN A;  3NE5 B;  2VXW A;  2RA4 A;  5J1Z A;  3G6J B;  5LL6 X;  1BR9 A;  2KJX A;  3MTS A;  2BCO A;  2HCC A;  4LMQ D;  3N6R A;  1O7Z A;  1ET9 A;  3ITP A;  3U9O A;  1D5Z C;  2L5T A;  1V43 A;  2WKD A;  5G3L F;  2BE5 D;  2XRQ D;  4DN4 M;  2PZT A;  1STG A;  1I4Q A;  3S17 B;  1HXY D;  1EZ8 A;  1PDQ A;  2OEO A;  1KDC A;  1Q8I A;  5JOB A;  1GUO A;  2Q8R E;  4TKO B;  1SFO B;  5CV4 A;  1WTV A;  2DNC A;  4RHS A;  1AFP A;  4DF7 A;  1M4V A;  2BA1 A;  4DAV A;  2WP8 J;  1S5E D;  1V1P B;  4KI0 A;  3MXP A;  4XQJ A;  5E1F A;  3J81 E;  2EYM A;  3FPU B;  3NPP A;  3TP6 A;  5FK9 C;  2CW0 D;  4S3S A;  4WFN 3;  4ME5 A;  3TP8 A;  3D4W A;  3GD7 A;  4X3K A;  1D6E C;  2EOT A;  1F2M A;  1STB A;  5C5L A;  4C3I B;  4IFD I;  1EIG A;  1A2U A;  4X3T A;  3L3O C;  1JOQ A;  4ZLT F;  3OIQ A;  2RSN A;  5JAV A;  3K7A B;  5D65 A;  2AWO A;  5CV5 A;  2F0N A;  1LTA D;  1IHZ A;  3SK4 A;  1TWG B;  3JAM L;  4DXF A;  2KQ3 A;  2RSO A;  2B2W A;  2DN8 A;  4KD4 A;  1IW7 C;  1HFN A;  3KLS A;  1QCB D;  3HRZ C;  3C1E A;  2AUK A;  4K5W A;  3PUY A;  1C8C A;  3RZD B;  2I07 B;  3SK5 A;  1EOT A;  3P7J A;  2SOB A;  3HEJ A;  3A8K E;  3D6C A;  2LFN A;  1BOS A;  2L12 A;  3NSW A;  2OF1 A;  3ERO A;  3ERQ A;  1EY0 A;  1FYC A;  5EBD A;  1JE4 A;  4RH6 A;  1L0X B;  3D4R A;  3NXW A;  2EXZ A;  5IGF A;  4A3E B;  1SYG A;  1KDA A;  3HS0 C;  3S15 B;  2KED A;  4U67 3;  2FFK B;  1QB5 D;  3HOX B;  5COR A;  2H1E A;  4NKL A;  3E6Z X;  3TME A;  1DXM A;  2CHB D;  3EJI A;  4BBS B;  4DNT B;  4A3K B;  2D62 A;  5BN5 A;  1K8O A;  5FO7 B;  1AN8 A;  1SMY C;  1PFB A;  1STH A;  2EPB A;  3NP8 A;  4HED A;  2NVT B;  2OXP A;  3SEB A;  4OIK A;  5KRU A;  1Q90 A;  2F0K A;  1JC7 A;  1X3P A;  4OIJ A;  1Z7T A;  2AQ3 B;  2E75 C;  4TSS A;  3M7N A;  4CJ2 C;  2LKV A;  1GXD C;  4XXE A;  1EU4 A;  1SE2 A;  2PMZ B;  1NUC A;  1F9S A;  1MSH A;  2VB2 X;  2ZXR A;  2CVR A;  4G57 A;  1TKW B;  3GV3 A;  1UAP A;  4N9P A;  2IT1 A;  2WIN B;  5ELB A;  4RGT A;  4FF3 A;  2DNE A;  3FMC A;  1SNM A;  4MN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...