1O8DA

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 5mm ca2+
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 134
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8dA00
2VBMA 1HG8A 1GQ8A 2PECA 4HWVA 3EQOA 1NHCA 4MR0A 4I84A 4W8SA 3VSVA 1KCDA 3VMWA 1KTWA 4XLAA 4XLFA 4XLEA 3JURA 4U49A 1KCCA 2EWEA 1K5CA 4XONA 1O8LA 4W8RA 1PLUA 1RMGA 1VBLA 3ZPPA 3T9GA 4XLCA 1IDKA 1O8IA 4YZQA 3B4NA 2Z8GA 5C1EA 2QX3A 4XKVA 2NTPA 4NK6A 3VMVA 4OZZA 2O1DA 2O04A 2INVA 1IB4A 2INUA 3GQ9A 4OJPA 4Z03A 2O0WA 2VJJA 3VSTA 1O8DA 2NSTA 4OJOA 2X3HA 4XMYA 4YZAA 2O0VA 2VJIA 3LMWA 4W8TA 4Z06A 3GRHA 3KRGA 1DBOA 1WMRA 1PXZA 3ZSCA 5C1CA 4YELA 4YZXA 1BHEA 4U4BA 2PYHA 1XG2A 3WWGA 4XORA 3VSUA 4XNFA 1O8EA 4EW9A 4C2LA 1BN8A 1H80A 4XR6A 4PMHA 2ODLA 2X6XA 2UVEA 4XN0A 1QJVA 4OJ5A 4Z05A 1OFMA 1O8FA 4MXNA 2IQ7A 4XM3A 2X6YA 1O8KA 3FY3A 1X0CA 1RU4A 4OJLA 1IDJA 1OGOX 3GQ8A 4XQFA 3EQNA 2PYGA 2NT9A 2NTBA 4XN3A 1O8JA 1O8GA 1OFLA 1OOCA 4OZYA 1AIRA 4XKWA 3UW0A 4W8QA 1O8MA 2NT6A 2NZMA 3GQAA 2VBKA 1O8HA 1CZFA 1JRGA 4OJ6A 2X6WA 1O88A 3SUCA 2O17A 1RWRA 4YZ0A 4XOPA 2UVFA 1QCXA 2X85A 1JTAA 2VBEA 2QY1A 4XL9A 4YEJA 4AVZA 2BSPA 1IA5A 3B8YA 2QXZA 4NK8A 1PE9A 1OGMX 3B90A 1EE6A 4XOTA 2NSPA 2NTQA 1DBGA 3GQ7A 4XLHA 4URRA 5AMVA
chains in the Genus database with same CATH superfamily
2VBMA 1HG8A 2J8KA 1GQ8A 2PECA 4HWVA 1TSPA 3EQOA 3N90A 3PSZA 1NHCA 1QA1A 4MR0A 4I84A 4W8SA 3VSVA 1KCDA 3VMWA 1KTWA 5JLVC 1WXRA 4XLAA 4JRAC 1K4ZA 4XLFA 3H09A 2XTYA 3JURA 4U49A 4XLEA 4YDTA 1KCCA 2EWEA 2BX6A 4XONA 2XTXA 1O8LA 4W8RA 1K5CA 1PLUA 1RMGA 1VBLA 4YC5A 1HF2A 3ZPPA 3T9GA 4XLCA 2O6WA 1IDKA 1O8IA 1OFEA 4YZQA 3ML3A 3B4NA 2Z8GA 3BH6B 5C1EA 4YFOA 1DABA 3NAWA 3PSSA 2QX3A 4XKVA 2NTPA 4NK6A 3VMVA 4OZZA 2O1DA 1EA0A 3PETA 3DU1X 1L1IA 2O04A 1TYVA 3BH7B 1KQ5A 2VFMA 4OM9A 2INVA 3LYCA 1EZGA 1IB4A 2INUA 3GQ9A 4OJPA 2BM6A 1OFDA 4Z03A 2O0WA 2VJJA 2W7ZA 1O8DA 2NSTA 4V02C 3VSTA 3LJYA 4OJOA 2X3HA 4XMYA 4YZAA 2O0VA 2VJIA 3LMWA 3P4GA 4W8TA 4Z06A 3SZEA 3GRHA 3KRGA 1DBOA 1WMRA 1PXZA 3ZSCA 5C1CA 3RIQA 4YELA 4YZXA 1BHEA 4U4BA 2PYHA 1XG2A 3WWGA 4XORA 3VSUA 4XNFA 1O8EA 4EW9A 4C2LA 1BN8A 3JX8A 3TH0A 1H80A 4XR6A 1QRCA 4PMHA 2ODLA 2X6XA 2XT2A 2UVEA 4KH3A 4XN0A 1QJVA 1QA2A 4OJ5A 4Z05A 3SY2A 1OFMA 2G0YA 1O8FA 4MXNA 2IQ7A 1LLZA 2B0RA 4XM3A 4YEIA 1TYWA 3SYJA 2X6YA 1O8KA 3FY3A 3NB2A 1X0CA 1TYXA 1RU4A 5DNSA 1LM1A 4OJLA 1IDJA 2BM5A 2QZAA 1OGOX 3GQ8A 2VFPA 4XQFA 3EQNA 4YCQA 2PYGA 2NT9A 2NTBA 4OPWA 4XN3A 2V5IA 1LLWA 1O8JA 1O8GA 2VFQA 1OFLA 1OOCA 2BM4A 2XT4A 4OZYA 2VFNA 1AIRA 5JMCB 4XKWA 2BM7A 3UW0A 1QQ1A 4W8QA 1O8MA 2NT6A 2NZMA 3GQAA 2VBKA 1O8HA 1CZFA 1JRGA 4OJ6A 2X6WA 1O88A 3SQVA 3SUCA 2J8IA 2O17A 1RWRA 1K8FA 1TYUA 4XOPA 4YZ0A 3AK5A 2UVFA 1QRBA 1QCXA 2X85A 1JTAA 2VBEA 2QY1A 4XL9A 4YEJA 4AVZA 2BSPA 1IA5A 2XC1A 2QYUA 2YUHA 3B8YA 2QXZA 1QA3A 2XTWA 4NK8A 1PE9A 1OGMX 2IOUG 3B90A 2F3LA 1EE6A 4XOTA 2NSPA 2NTQA 3N6ZA 1DBGA 3GQ7A 4XLHA 4URRA 5AMVA 2VFOA 1CLWA
chains in the Genus database with same CATH topology
2VBMA 1HG8A 1GQ8A 2PECA 4HWVA 3EQOA 1NHCA 4MR0A 4I84A 4W8SA 3VSVA 1KCDA 3VMWA 1KTWA 4XLAA 4XLFA 4XLEA 3JURA 4U49A 1KCCA 2EWEA 1K5CA 4XONA 1O8LA 4W8RA 1PLUA 1RMGA 1VBLA 3ZPPA 3T9GA 4XLCA 1IDKA 1O8IA 4YZQA 3B4NA 2Z8GA 5C1EA 2QX3A 4XKVA 2NTPA 4NK6A 3VMVA 4OZZA 2O1DA 2O04A 2INVA 1IB4A 2INUA 3GQ9A 4OJPA 4Z03A 2O0WA 2VJJA 3VSTA 1O8DA 2NSTA 4OJOA 2X3HA 4XMYA 4YZAA 2O0VA 2VJIA 3LMWA 4W8TA 4Z06A 3GRHA 3KRGA 1DBOA 1WMRA 1PXZA 3ZSCA 5C1CA 4YELA 4YZXA 1BHEA 4U4BA 2PYHA 1XG2A 3WWGA 4XORA 3VSUA 4XNFA 1O8EA 4EW9A 4C2LA 1BN8A 1H80A 4XR6A 4PMHA 2ODLA 2X6XA 2UVEA 4XN0A 1QJVA 4OJ5A 4Z05A 1OFMA 1O8FA 4MXNA 2IQ7A 4XM3A 2X6YA 1O8KA 3FY3A 1X0CA 1RU4A 4OJLA 1IDJA 1OGOX 3GQ8A 4XQFA 3EQNA 2PYGA 2NT9A 2NTBA 4XN3A 1O8JA 1O8GA 1OFLA 1OOCA 4OZYA 1AIRA 4XKWA 3UW0A 4W8QA 1O8MA 2NT6A 2NZMA 3GQAA 2VBKA 1O8HA 1CZFA 1JRGA 4OJ6A 2X6WA 1O88A 3SUCA 2O17A 1RWRA 4YZ0A 4XOPA 2UVFA 1QCXA 2X85A 1JTAA 2VBEA 2QY1A 4XL9A 4YEJA 4AVZA 2BSPA 1IA5A 3B8YA 2QXZA 4NK8A 1PE9A 1OGMX 3B90A 1EE6A 4XOTA 2NSPA 2NTQA 1DBGA 3GQ7A 4XLHA 4URRA 5AMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBM A;  1HG8 A;  1GQ8 A;  2PEC A;  4HWV A;  3EQO A;  1NHC A;  4MR0 A;  4I84 A;  4W8S A;  3VSV A;  1KCD A;  3VMW A;  1KTW A;  4XLA A;  4XLF A;  4XLE A;  3JUR A;  4U49 A;  1KCC A;  2EWE A;  1K5C A;  4XON A;  1O8L A;  4W8R A;  1PLU A;  1RMG A;  1VBL A;  3ZPP A;  3T9G A;  4XLC A;  1IDK A;  1O8I A;  4YZQ A;  3B4N A;  2Z8G A;  5C1E A;  2QX3 A;  4XKV A;  2NTP A;  4NK6 A;  3VMV A;  4OZZ A;  2O1D A;  2O04 A;  2INV A;  1IB4 A;  2INU A;  3GQ9 A;  4OJP A;  4Z03 A;  2O0W A;  2VJJ A;  3VST A;  1O8D A;  2NST A;  4OJO A;  2X3H A;  4XMY A;  4YZA A;  2O0V A;  2VJI A;  3LMW A;  4W8T A;  4Z06 A;  3GRH A;  3KRG A;  1DBO A;  1WMR A;  1PXZ A;  3ZSC A;  5C1C A;  4YEL A;  4YZX A;  1BHE A;  4U4B A;  2PYH A;  1XG2 A;  3WWG A;  4XOR A;  3VSU A;  4XNF A;  1O8E A;  4EW9 A;  4C2L A;  1BN8 A;  1H80 A;  4XR6 A;  4PMH A;  2ODL A;  2X6X A;  2UVE A;  4XN0 A;  1QJV A;  4OJ5 A;  4Z05 A;  1OFM A;  1O8F A;  4MXN A;  2IQ7 A;  4XM3 A;  2X6Y A;  1O8K A;  3FY3 A;  1X0C A;  1RU4 A;  4OJL A;  1IDJ A;  1OGO X;  3GQ8 A;  4XQF A;  3EQN A;  2PYG A;  2NT9 A;  2NTB A;  4XN3 A;  1O8J A;  1O8G A;  1OFL A;  1OOC A;  4OZY A;  1AIR A;  4XKW A;  3UW0 A;  4W8Q A;  1O8M A;  2NT6 A;  2NZM A;  3GQA A;  2VBK A;  1O8H A;  1CZF A;  1JRG A;  4OJ6 A;  2X6W A;  1O88 A;  3SUC A;  2O17 A;  1RWR A;  4YZ0 A;  4XOP A;  2UVF A;  1QCX A;  2X85 A;  1JTA A;  2VBE A;  2QY1 A;  4XL9 A;  4YEJ A;  4AVZ A;  2BSP A;  1IA5 A;  3B8Y A;  2QXZ A;  4NK8 A;  1PE9 A;  1OGM X;  3B90 A;  1EE6 A;  4XOT A;  2NSP A;  2NTQ A;  1DBG A;  3GQ7 A;  4XLH A;  4URR A;  5AMV A; 
#chains in the Genus database with same CATH topology
 2VBM A;  1HG8 A;  2J8K A;  1GQ8 A;  2PEC A;  4HWV A;  1TSP A;  3EQO A;  3N90 A;  3PSZ A;  1NHC A;  1QA1 A;  4MR0 A;  4I84 A;  4W8S A;  3VSV A;  1KCD A;  3VMW A;  1KTW A;  5JLV C;  1WXR A;  4XLA A;  4JRA C;  1K4Z A;  4XLF A;  3H09 A;  2XTY A;  3JUR A;  4U49 A;  4XLE A;  4YDT A;  1KCC A;  2EWE A;  2BX6 A;  4XON A;  2XTX A;  1O8L A;  4W8R A;  1K5C A;  1PLU A;  1RMG A;  1VBL A;  4YC5 A;  1HF2 A;  3ZPP A;  3T9G A;  4XLC A;  2O6W A;  1IDK A;  1O8I A;  1OFE A;  4YZQ A;  3ML3 A;  3B4N A;  2Z8G A;  3BH6 B;  5C1E A;  4YFO A;  1DAB A;  3NAW A;  3PSS A;  2QX3 A;  4XKV A;  2NTP A;  4NK6 A;  3VMV A;  4OZZ A;  2O1D A;  1EA0 A;  3PET A;  3DU1 X;  1L1I A;  2O04 A;  1TYV A;  3BH7 B;  1KQ5 A;  2VFM A;  4OM9 A;  2INV A;  3LYC A;  1EZG A;  1IB4 A;  2INU A;  3GQ9 A;  4OJP A;  2BM6 A;  1OFD A;  4Z03 A;  2O0W A;  2VJJ A;  2W7Z A;  1O8D A;  2NST A;  4V02 C;  3VST A;  3LJY A;  4OJO A;  2X3H A;  4XMY A;  4YZA A;  2O0V A;  2VJI A;  3LMW A;  3P4G A;  4W8T A;  4Z06 A;  3SZE A;  3GRH A;  3KRG A;  1DBO A;  1WMR A;  1PXZ A;  3ZSC A;  5C1C A;  3RIQ A;  4YEL A;  4YZX A;  1BHE A;  4U4B A;  2PYH A;  1XG2 A;  3WWG A;  4XOR A;  3VSU A;  4XNF A;  1O8E A;  4EW9 A;  4C2L A;  1BN8 A;  3JX8 A;  3TH0 A;  1H80 A;  4XR6 A;  1QRC A;  4PMH A;  2ODL A;  2X6X A;  2XT2 A;  2UVE A;  4KH3 A;  4XN0 A;  1QJV A;  1QA2 A;  4OJ5 A;  4Z05 A;  3SY2 A;  1OFM A;  2G0Y A;  1O8F A;  4MXN A;  2IQ7 A;  1LLZ A;  2B0R A;  4XM3 A;  4YEI A;  1TYW A;  3SYJ A;  2X6Y A;  1O8K A;  3FY3 A;  3NB2 A;  1X0C A;  1TYX A;  1RU4 A;  5DNS A;  1LM1 A;  4OJL A;  1IDJ A;  2BM5 A;  2QZA A;  1OGO X;  3GQ8 A;  2VFP A;  4XQF A;  3EQN A;  4YCQ A;  2PYG A;  2NT9 A;  2NTB A;  4OPW A;  4XN3 A;  2V5I A;  1LLW A;  1O8J A;  1O8G A;  2VFQ A;  1OFL A;  1OOC A;  2BM4 A;  2XT4 A;  4OZY A;  2VFN A;  1AIR A;  5JMC B;  4XKW A;  2BM7 A;  3UW0 A;  1QQ1 A;  4W8Q A;  1O8M A;  2NT6 A;  2NZM A;  3GQA A;  2VBK A;  1O8H A;  1CZF A;  1JRG A;  4OJ6 A;  2X6W A;  1O88 A;  3SQV A;  3SUC A;  2J8I A;  2O17 A;  1RWR A;  1K8F A;  1TYU A;  4XOP A;  4YZ0 A;  3AK5 A;  2UVF A;  1QRB A;  1QCX A;  2X85 A;  1JTA A;  2VBE A;  2QY1 A;  4XL9 A;  4YEJ A;  4AVZ A;  2BSP A;  1IA5 A;  2XC1 A;  2QYU A;  2YUH A;  3B8Y A;  2QXZ A;  1QA3 A;  2XTW A;  4NK8 A;  1PE9 A;  1OGM X;  2IOU G;  3B90 A;  2F3L A;  1EE6 A;  4XOT A;  2NSP A;  2NTQ A;  3N6Z A;  1DBG A;  3GQ7 A;  4XLH A;  4URR A;  5AMV A;  2VFO A;  1CLW A; 
#chains in the Genus database with same CATH homology
 2VBM A;  1HG8 A;  1GQ8 A;  2PEC A;  4HWV A;  3EQO A;  1NHC A;  4MR0 A;  4I84 A;  4W8S A;  3VSV A;  1KCD A;  3VMW A;  1KTW A;  4XLA A;  4XLF A;  4XLE A;  3JUR A;  4U49 A;  1KCC A;  2EWE A;  1K5C A;  4XON A;  1O8L A;  4W8R A;  1PLU A;  1RMG A;  1VBL A;  3ZPP A;  3T9G A;  4XLC A;  1IDK A;  1O8I A;  4YZQ A;  3B4N A;  2Z8G A;  5C1E A;  2QX3 A;  4XKV A;  2NTP A;  4NK6 A;  3VMV A;  4OZZ A;  2O1D A;  2O04 A;  2INV A;  1IB4 A;  2INU A;  3GQ9 A;  4OJP A;  4Z03 A;  2O0W A;  2VJJ A;  3VST A;  1O8D A;  2NST A;  4OJO A;  2X3H A;  4XMY A;  4YZA A;  2O0V A;  2VJI A;  3LMW A;  4W8T A;  4Z06 A;  3GRH A;  3KRG A;  1DBO A;  1WMR A;  1PXZ A;  3ZSC A;  5C1C A;  4YEL A;  4YZX A;  1BHE A;  4U4B A;  2PYH A;  1XG2 A;  3WWG A;  4XOR A;  3VSU A;  4XNF A;  1O8E A;  4EW9 A;  4C2L A;  1BN8 A;  1H80 A;  4XR6 A;  4PMH A;  2ODL A;  2X6X A;  2UVE A;  4XN0 A;  1QJV A;  4OJ5 A;  4Z05 A;  1OFM A;  1O8F A;  4MXN A;  2IQ7 A;  4XM3 A;  2X6Y A;  1O8K A;  3FY3 A;  1X0C A;  1RU4 A;  4OJL A;  1IDJ A;  1OGO X;  3GQ8 A;  4XQF A;  3EQN A;  2PYG A;  2NT9 A;  2NTB A;  4XN3 A;  1O8J A;  1O8G A;  1OFL A;  1OOC A;  4OZY A;  1AIR A;  4XKW A;  3UW0 A;  4W8Q A;  1O8M A;  2NT6 A;  2NZM A;  3GQA A;  2VBK A;  1O8H A;  1CZF A;  1JRG A;  4OJ6 A;  2X6W A;  1O88 A;  3SUC A;  2O17 A;  1RWR A;  4YZ0 A;  4XOP A;  2UVF A;  1QCX A;  2X85 A;  1JTA A;  2VBE A;  2QY1 A;  4XL9 A;  4YEJ A;  4AVZ A;  2BSP A;  1IA5 A;  3B8Y A;  2QXZ A;  4NK8 A;  1PE9 A;  1OGM X;  3B90 A;  1EE6 A;  4XOT A;  2NSP A;  2NTQ A;  1DBG A;  3GQ7 A;  4XLH A;  4URR A;  5AMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...