1O8DA

Pectate lyase c from erwinia chrysanthemi at ph 11.2 with 5mm ca2+
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 134
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8dA00
1IDJA 2NT9A 1HG8A 1JTAA 1O8DA 1PXZA 1O88A 2VBMA 3VMVA 2VBKA 4OJOA 2Z8GA 3GQ7A 1X0CA 2X6YA 2INUA 4W8TA 1EE6A 2NTPA 1OFLA 1OGOX 4XMYA 2X6XA 3GQAA 1O8LA 3VMWA 4YZQA 4MR0A 4AVZA 1O8JA 2BSPA 4XR6A 1NHCA 1O8MA 3WWGA 4XONA 4XNFA 1K5CA 2UVEA 1IDKA 4YZAA 2NTQA 2IQ7A 1AIRA 4MXNA 4EW9A 2NT6A 1OFMA 1IB4A 2O1DA 4Z03A 1DBOA 2NSPA 1CZFA 3B8YA 4XN3A 4W8QA 1RMGA 1QCXA 3VSVA 2NZMA 2X6WA 3VSTA 2INVA 4Z06A 4XKWA 4OJPA 4HWVA 5C1CA 1KCCA 2O04A 1O8GA 2NSTA 3GQ8A 3T9GA 3JURA 3GRHA 2VJJA 3SUCA 1JRGA 3FY3A 4OJLA 2QX3A 4W8RA 1O8FA 4OJ5A 4XQFA 4Z05A 1OOCA 1QJVA 1O8EA 4OZYA 4XOPA 4XKVA 1PLUA 1O8HA 2O17A 1BN8A 4XLEA 3KRGA 2VBEA 2NTBA 4U49A 4U4BA 3EQNA 4XM3A 1DBGA 3UW0A 4NK8A 4YEJA 2UVFA 2PECA 1RU4A 1KTWA 4PMHA 1XG2A 1WMRA 2VJIA 4NK6A 4XL9A 4YZ0A 1OGMX 1RWRA 2X3HA 3B4NA 2O0WA 1GQ8A 4OJ6A 2ODLA 5C1EA 4URRA 4XOTA 2QXZA 4YELA 1VBLA 4XLHA 4XORA 3ZSCA 4XN0A 3B90A 1O8IA 1O8KA 3LMWA 5AMVA 3ZPPA 4XLCA 2QY1A 4W8SA 3EQOA 4C2LA 1KCDA 4OZZA 3VSUA 1PE9A 3GQ9A 1BHEA 2EWEA 2PYGA 4I84A 4XLAA 4YZXA 1IA5A 2PYHA 1H80A 2X85A 2O0VA 4XLFA
chains in the Genus database with same CATH superfamily
1IDJA 2NT9A 1HG8A 1JTAA 1O8DA 1PXZA 3NAWA 1O88A 2VBMA 4OPWA 3VMVA 2BX6A 2VBKA 3BH6B 4YDTA 1TYUA 1HF2A 4OJOA 2Z8GA 3SYJA 3GQ7A 3H09A 1QA3A 1X0CA 2X6YA 2BM6A 2INUA 2QYUA 4W8TA 1EE6A 2NTPA 4YCQA 1OFLA 1OGOX 1CLWA 4XMYA 2X6XA 4YFOA 3GQAA 1O8LA 1QRCA 4YZQA 4MR0A 3VMWA 4AVZA 1DABA 1O8JA 2XT2A 1EZGA 2BSPA 2G0YA 4XR6A 1O8MA 1NHCA 1TYVA 3WWGA 3LYCA 4XONA 1LM1A 4XNFA 2XTYA 1K5CA 2UVEA 1IDKA 4YZAA 2XC1A 2NTQA 5JMCB 2IQ7A 1AIRA 4MXNA 4EW9A 1TYWA 2NT6A 1OFMA 1KQ5A 2O1DA 4Z03A 1IB4A 1DBOA 2NSPA 2VFPA 1CZFA 3B8YA 2XTWA 4XN3A 4W8QA 1RMGA 1QCXA 2F3LA 3LJYA 3VSVA 2BM5A 2NZMA 2X6WA 3VSTA 2INVA 4Z06A 4XKWA 4YEIA 4OJPA 4HWVA 5C1CA 1LLZA 1KCCA 2O04A 1O8GA 2NSTA 1QQ1A 2J8IA 3GQ8A 3T9GA 3JURA 2BM4A 3GRHA 2VJJA 5JLVC 2V5IA 3SUCA 1JRGA 2VFMA 3FY3A 4OJLA 4YC5A 3SQVA 3SZEA 1QA1A 2QX3A 4W8RA 1O8FA 4OJ5A 4XQFA 4Z05A 1OOCA 1QJVA 3N6ZA 1O8EA 3DU1X 4OZYA 4XKVA 4XOPA 3SY2A 1PLUA 1OFDA 1O8HA 1QRBA 2O17A 3BH7B 3AK5A 3PSZA 1BN8A 4XLEA 3KRGA 2QZAA 2VBEA 4OM9A 2NTBA 1OFEA 2XT4A 3EQNA 4U49A 2BM7A 4U4BA 4V02C 4XM3A 1DBGA 3UW0A 3PSSA 4NK8A 4YEJA 2UVFA 1QA2A 2PECA 1RU4A 4JRAC 2B0RA 1KTWA 4PMHA 1XG2A 1WMRA 2VJIA 3P4GA 4NK6A 4XL9A 4YZ0A 1WXRA 1L1IA 2VFOA 1OGMX 1RWRA 2X3HA 3B4NA 2O0WA 1GQ8A 2XTXA 4OJ6A 3ML3A 2ODLA 5C1EA 2IOUG 1K4ZA 2YUHA 4URRA 4XOTA 3TH0A 2QXZA 4YELA 1VBLA 4XLHA 4XORA 3ZSCA 1LLWA 4XN0A 3B90A 1O8IA 3N90A 1K8FA 1O8KA 3LMWA 3RIQA 5AMVA 3ZPPA 1TYXA 4XLCA 2QY1A 4W8SA 3EQOA 2W7ZA 3NB2A 3PETA 4KH3A 4C2LA 2J8KA 4OZZA 1KCDA 3VSUA 1PE9A 3GQ9A 1BHEA 2VFNA 2EWEA 2PYGA 2VFQA 2O6WA 4I84A 4XLAA 4YZXA 1EA0A 1IA5A 2PYHA 1H80A 2X85A 5DNSA 2O0VA 4XLFA 3JX8A 1TSPA
chains in the Genus database with same CATH topology
1IDJA 2NT9A 1HG8A 1JTAA 1O8DA 1PXZA 1O88A 2VBMA 3VMVA 2VBKA 4OJOA 2Z8GA 3GQ7A 1X0CA 2X6YA 2INUA 4W8TA 1EE6A 2NTPA 1OFLA 1OGOX 4XMYA 2X6XA 3GQAA 1O8LA 3VMWA 4YZQA 4MR0A 4AVZA 1O8JA 2BSPA 4XR6A 1NHCA 1O8MA 3WWGA 4XONA 4XNFA 1K5CA 2UVEA 1IDKA 4YZAA 2NTQA 2IQ7A 1AIRA 4MXNA 4EW9A 2NT6A 1OFMA 1IB4A 2O1DA 4Z03A 1DBOA 2NSPA 1CZFA 3B8YA 4XN3A 4W8QA 1RMGA 1QCXA 3VSVA 2NZMA 2X6WA 3VSTA 2INVA 4Z06A 4XKWA 4OJPA 4HWVA 5C1CA 1KCCA 2O04A 1O8GA 2NSTA 3GQ8A 3T9GA 3JURA 3GRHA 2VJJA 3SUCA 1JRGA 3FY3A 4OJLA 2QX3A 4W8RA 1O8FA 4OJ5A 4XQFA 4Z05A 1OOCA 1QJVA 1O8EA 4OZYA 4XOPA 4XKVA 1PLUA 1O8HA 2O17A 1BN8A 4XLEA 3KRGA 2VBEA 2NTBA 4U49A 4U4BA 3EQNA 4XM3A 1DBGA 3UW0A 4NK8A 4YEJA 2UVFA 2PECA 1RU4A 1KTWA 4PMHA 1XG2A 1WMRA 2VJIA 4NK6A 4XL9A 4YZ0A 1OGMX 1RWRA 2X3HA 3B4NA 2O0WA 1GQ8A 4OJ6A 2ODLA 5C1EA 4URRA 4XOTA 2QXZA 4YELA 1VBLA 4XLHA 4XORA 3ZSCA 4XN0A 3B90A 1O8IA 1O8KA 3LMWA 5AMVA 3ZPPA 4XLCA 2QY1A 4W8SA 3EQOA 4C2LA 1KCDA 4OZZA 3VSUA 1PE9A 3GQ9A 1BHEA 2EWEA 2PYGA 4I84A 4XLAA 4YZXA 1IA5A 2PYHA 1H80A 2X85A 2O0VA 4XLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDJ A;  2NT9 A;  1HG8 A;  1JTA A;  1O8D A;  1PXZ A;  1O88 A;  2VBM A;  3VMV A;  2VBK A;  4OJO A;  2Z8G A;  3GQ7 A;  1X0C A;  2X6Y A;  2INU A;  4W8T A;  1EE6 A;  2NTP A;  1OFL A;  1OGO X;  4XMY A;  2X6X A;  3GQA A;  1O8L A;  3VMW A;  4YZQ A;  4MR0 A;  4AVZ A;  1O8J A;  2BSP A;  4XR6 A;  1NHC A;  1O8M A;  3WWG A;  4XON A;  4XNF A;  1K5C A;  2UVE A;  1IDK A;  4YZA A;  2NTQ A;  2IQ7 A;  1AIR A;  4MXN A;  4EW9 A;  2NT6 A;  1OFM A;  1IB4 A;  2O1D A;  4Z03 A;  1DBO A;  2NSP A;  1CZF A;  3B8Y A;  4XN3 A;  4W8Q A;  1RMG A;  1QCX A;  3VSV A;  2NZM A;  2X6W A;  3VST A;  2INV A;  4Z06 A;  4XKW A;  4OJP A;  4HWV A;  5C1C A;  1KCC A;  2O04 A;  1O8G A;  2NST A;  3GQ8 A;  3T9G A;  3JUR A;  3GRH A;  2VJJ A;  3SUC A;  1JRG A;  3FY3 A;  4OJL A;  2QX3 A;  4W8R A;  1O8F A;  4OJ5 A;  4XQF A;  4Z05 A;  1OOC A;  1QJV A;  1O8E A;  4OZY A;  4XOP A;  4XKV A;  1PLU A;  1O8H A;  2O17 A;  1BN8 A;  4XLE A;  3KRG A;  2VBE A;  2NTB A;  4U49 A;  4U4B A;  3EQN A;  4XM3 A;  1DBG A;  3UW0 A;  4NK8 A;  4YEJ A;  2UVF A;  2PEC A;  1RU4 A;  1KTW A;  4PMH A;  1XG2 A;  1WMR A;  2VJI A;  4NK6 A;  4XL9 A;  4YZ0 A;  1OGM X;  1RWR A;  2X3H A;  3B4N A;  2O0W A;  1GQ8 A;  4OJ6 A;  2ODL A;  5C1E A;  4URR A;  4XOT A;  2QXZ A;  4YEL A;  1VBL A;  4XLH A;  4XOR A;  3ZSC A;  4XN0 A;  3B90 A;  1O8I A;  1O8K A;  3LMW A;  5AMV A;  3ZPP A;  4XLC A;  2QY1 A;  4W8S A;  3EQO A;  4C2L A;  1KCD A;  4OZZ A;  3VSU A;  1PE9 A;  3GQ9 A;  1BHE A;  2EWE A;  2PYG A;  4I84 A;  4XLA A;  4YZX A;  1IA5 A;  2PYH A;  1H80 A;  2X85 A;  2O0V A;  4XLF A; 
#chains in the Genus database with same CATH topology
 1IDJ A;  2NT9 A;  1HG8 A;  1JTA A;  1O8D A;  1PXZ A;  3NAW A;  1O88 A;  2VBM A;  4OPW A;  3VMV A;  2BX6 A;  2VBK A;  3BH6 B;  4YDT A;  1TYU A;  1HF2 A;  4OJO A;  2Z8G A;  3SYJ A;  3GQ7 A;  3H09 A;  1QA3 A;  1X0C A;  2X6Y A;  2BM6 A;  2INU A;  2QYU A;  4W8T A;  1EE6 A;  2NTP A;  4YCQ A;  1OFL A;  1OGO X;  1CLW A;  4XMY A;  2X6X A;  4YFO A;  3GQA A;  1O8L A;  1QRC A;  4YZQ A;  4MR0 A;  3VMW A;  4AVZ A;  1DAB A;  1O8J A;  2XT2 A;  1EZG A;  2BSP A;  2G0Y A;  4XR6 A;  1O8M A;  1NHC A;  1TYV A;  3WWG A;  3LYC A;  4XON A;  1LM1 A;  4XNF A;  2XTY A;  1K5C A;  2UVE A;  1IDK A;  4YZA A;  2XC1 A;  2NTQ A;  5JMC B;  2IQ7 A;  1AIR A;  4MXN A;  4EW9 A;  1TYW A;  2NT6 A;  1OFM A;  1KQ5 A;  2O1D A;  4Z03 A;  1IB4 A;  1DBO A;  2NSP A;  2VFP A;  1CZF A;  3B8Y A;  2XTW A;  4XN3 A;  4W8Q A;  1RMG A;  1QCX A;  2F3L A;  3LJY A;  3VSV A;  2BM5 A;  2NZM A;  2X6W A;  3VST A;  2INV A;  4Z06 A;  4XKW A;  4YEI A;  4OJP A;  4HWV A;  5C1C A;  1LLZ A;  1KCC A;  2O04 A;  1O8G A;  2NST A;  1QQ1 A;  2J8I A;  3GQ8 A;  3T9G A;  3JUR A;  2BM4 A;  3GRH A;  2VJJ A;  5JLV C;  2V5I A;  3SUC A;  1JRG A;  2VFM A;  3FY3 A;  4OJL A;  4YC5 A;  3SQV A;  3SZE A;  1QA1 A;  2QX3 A;  4W8R A;  1O8F A;  4OJ5 A;  4XQF A;  4Z05 A;  1OOC A;  1QJV A;  3N6Z A;  1O8E A;  3DU1 X;  4OZY A;  4XKV A;  4XOP A;  3SY2 A;  1PLU A;  1OFD A;  1O8H A;  1QRB A;  2O17 A;  3BH7 B;  3AK5 A;  3PSZ A;  1BN8 A;  4XLE A;  3KRG A;  2QZA A;  2VBE A;  4OM9 A;  2NTB A;  1OFE A;  2XT4 A;  3EQN A;  4U49 A;  2BM7 A;  4U4B A;  4V02 C;  4XM3 A;  1DBG A;  3UW0 A;  3PSS A;  4NK8 A;  4YEJ A;  2UVF A;  1QA2 A;  2PEC A;  1RU4 A;  4JRA C;  2B0R A;  1KTW A;  4PMH A;  1XG2 A;  1WMR A;  2VJI A;  3P4G A;  4NK6 A;  4XL9 A;  4YZ0 A;  1WXR A;  1L1I A;  2VFO A;  1OGM X;  1RWR A;  2X3H A;  3B4N A;  2O0W A;  1GQ8 A;  2XTX A;  4OJ6 A;  3ML3 A;  2ODL A;  5C1E A;  2IOU G;  1K4Z A;  2YUH A;  4URR A;  4XOT A;  3TH0 A;  2QXZ A;  4YEL A;  1VBL A;  4XLH A;  4XOR A;  3ZSC A;  1LLW A;  4XN0 A;  3B90 A;  1O8I A;  3N90 A;  1K8F A;  1O8K A;  3LMW A;  3RIQ A;  5AMV A;  3ZPP A;  1TYX A;  4XLC A;  2QY1 A;  4W8S A;  3EQO A;  2W7Z A;  3NB2 A;  3PET A;  4KH3 A;  4C2L A;  2J8K A;  4OZZ A;  1KCD A;  3VSU A;  1PE9 A;  3GQ9 A;  1BHE A;  2VFN A;  2EWE A;  2PYG A;  2VFQ A;  2O6W A;  4I84 A;  4XLA A;  4YZX A;  1EA0 A;  1IA5 A;  2PYH A;  1H80 A;  2X85 A;  5DNS A;  2O0V A;  4XLF A;  3JX8 A;  1TSP A; 
#chains in the Genus database with same CATH homology
 1IDJ A;  2NT9 A;  1HG8 A;  1JTA A;  1O8D A;  1PXZ A;  1O88 A;  2VBM A;  3VMV A;  2VBK A;  4OJO A;  2Z8G A;  3GQ7 A;  1X0C A;  2X6Y A;  2INU A;  4W8T A;  1EE6 A;  2NTP A;  1OFL A;  1OGO X;  4XMY A;  2X6X A;  3GQA A;  1O8L A;  3VMW A;  4YZQ A;  4MR0 A;  4AVZ A;  1O8J A;  2BSP A;  4XR6 A;  1NHC A;  1O8M A;  3WWG A;  4XON A;  4XNF A;  1K5C A;  2UVE A;  1IDK A;  4YZA A;  2NTQ A;  2IQ7 A;  1AIR A;  4MXN A;  4EW9 A;  2NT6 A;  1OFM A;  1IB4 A;  2O1D A;  4Z03 A;  1DBO A;  2NSP A;  1CZF A;  3B8Y A;  4XN3 A;  4W8Q A;  1RMG A;  1QCX A;  3VSV A;  2NZM A;  2X6W A;  3VST A;  2INV A;  4Z06 A;  4XKW A;  4OJP A;  4HWV A;  5C1C A;  1KCC A;  2O04 A;  1O8G A;  2NST A;  3GQ8 A;  3T9G A;  3JUR A;  3GRH A;  2VJJ A;  3SUC A;  1JRG A;  3FY3 A;  4OJL A;  2QX3 A;  4W8R A;  1O8F A;  4OJ5 A;  4XQF A;  4Z05 A;  1OOC A;  1QJV A;  1O8E A;  4OZY A;  4XOP A;  4XKV A;  1PLU A;  1O8H A;  2O17 A;  1BN8 A;  4XLE A;  3KRG A;  2VBE A;  2NTB A;  4U49 A;  4U4B A;  3EQN A;  4XM3 A;  1DBG A;  3UW0 A;  4NK8 A;  4YEJ A;  2UVF A;  2PEC A;  1RU4 A;  1KTW A;  4PMH A;  1XG2 A;  1WMR A;  2VJI A;  4NK6 A;  4XL9 A;  4YZ0 A;  1OGM X;  1RWR A;  2X3H A;  3B4N A;  2O0W A;  1GQ8 A;  4OJ6 A;  2ODL A;  5C1E A;  4URR A;  4XOT A;  2QXZ A;  4YEL A;  1VBL A;  4XLH A;  4XOR A;  3ZSC A;  4XN0 A;  3B90 A;  1O8I A;  1O8K A;  3LMW A;  5AMV A;  3ZPP A;  4XLC A;  2QY1 A;  4W8S A;  3EQO A;  4C2L A;  1KCD A;  4OZZ A;  3VSU A;  1PE9 A;  3GQ9 A;  1BHE A;  2EWE A;  2PYG A;  4I84 A;  4XLA A;  4YZX A;  1IA5 A;  2PYH A;  1H80 A;  2X85 A;  2O0V A;  4XLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...