1O8KA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 20mm ca2+
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8kA00
3T9GA 4OJPA 4URRA 2QX3A 3VMWA 4OZZA 2INVA 3VSVA 2NT9A 1KCCA 1O8EA 1K5CA 2VBMA 2EWEA 3GRHA 1AIRA 1RWRA 3EQOA 1RU4A 2X6XA 4OJ5A 4XKVA 1GQ8A 2X6WA 2NTQA 2VJIA 4XLFA 1H80A 2O04A 5C1CA 4XLAA 4Z06A 4MXNA 2NSPA 4W8TA 1O88A 2QY1A 2X6YA 3EQNA 4OJ6A 2O1DA 2BSPA 2VBEA 1JRGA 2X85A 1RMGA 1O8LA 4YZQA 4XNFA 4NK6A 4I84A 4XLHA 4W8QA 3GQAA 4XOPA 1O8GA 4XM3A 4AVZA 4W8SA 4XR6A 2VBKA 2PECA 4XOTA 4Z03A 1OFMA 4XONA 1IA5A 4XLCA 1O8JA 3VSUA 1DBGA 1DBOA 3GQ9A 1QJVA 3VMVA 1PLUA 2NTBA 1O8DA 1KCDA 4Z05A 2INUA 3GQ7A 3ZSCA 1IDKA 4YZAA 1KTWA 4OJLA 1OFLA 1OGMX 1O8FA 4XORA 1O8KA 1EE6A 4OZYA 4W8RA 3B8YA 4XL9A 2NSTA 1PE9A 4C2LA 3WWGA 1IDJA 1XG2A 3FY3A 2UVEA 1PXZA 5C1EA 2QXZA 1QCXA 4XN0A 1HG8A 1OGOX 4XQFA 2UVFA 3B4NA 2NT6A 2O0VA 4U4BA 4XMYA 1WMRA 1CZFA 1JTAA 1X0CA 1NHCA 1BHEA 2PYGA 4NK8A 2O0WA 4PMHA 3SUCA 3VSTA 2VJJA 3LMWA 2NZMA 5AMVA 1BN8A 4YZ0A 4YZXA 1O8IA 2ODLA 1VBLA 2Z8GA 4MR0A 4OJOA 2O17A 4U49A 3ZPPA 1O8MA 3B90A 3GQ8A 3UW0A 4YEJA 1IB4A 4EW9A 3KRGA 4YELA 2NTPA 4XN3A 1O8HA 4XKWA 2IQ7A 2PYHA 1OOCA 4XLEA 4HWVA 3JURA 2X3HA
chains in the Genus database with same CATH superfamily
3ML3A 1LM1A 3T9GA 4OJPA 4URRA 2QX3A 3VMWA 2YUHA 4OZZA 2INVA 3BH6B 3H09A 3VSVA 2NT9A 1KCCA 1O8EA 1K5CA 2VBMA 2EWEA 3GRHA 1AIRA 1RWRA 1OFDA 1RU4A 2XTYA 3EQOA 4JRAC 3RIQA 3PSZA 2X6XA 4OJ5A 4XKVA 4YEIA 1GQ8A 2X6WA 2BM4A 2NTQA 1DABA 2VJIA 4XLFA 1H80A 2G0YA 2O04A 5DNSA 5C1CA 3AK5A 4XLAA 3LYCA 3SZEA 4Z06A 4MXNA 2NSPA 2J8IA 1O88A 4HWVA 1EZGA 2QY1A 4W8TA 2XT4A 2X6YA 3EQNA 4OJ6A 2O1DA 1KQ5A 4KH3A 2BSPA 4OM9A 2VBEA 1JRGA 2X85A 1RMGA 4YZQA 4XNFA 4YC5A 4NK6A 4I84A 4XLHA 2VFOA 4W8QA 3GQAA 4XOPA 3N6ZA 1O8GA 3DU1X 3SQVA 4XM3A 4AVZA 4W8SA 4XR6A 2VBKA 2PECA 1L1IA 2BM7A 4XOTA 1QA1A 4Z03A 1OFMA 1LLZA 4XONA 2VFPA 4YFOA 2X3HA 1K8FA 2BM6A 2QYUA 5JLVC 2BX6A 4XLCA 1IA5A 1O8JA 3VSUA 1DBGA 1DBOA 3P4GA 1TYUA 2V5IA 3GQ9A 1QJVA 3SYJA 3VMVA 1K4ZA 1PLUA 2NTBA 1O8DA 1KCDA 3JX8A 4Z05A 2INUA 3GQ7A 4V02C 3ZSCA 1IDKA 4YZAA 2W7ZA 1TYWA 1KTWA 4OJLA 1EA0A 1OFLA 1OGMX 1O8FA 4XORA 1O8KA 1EE6A 1TYVA 4OZYA 4W8RA 2XC1A 3B8YA 4XL9A 2B0RA 2NSTA 1PE9A 4C2LA 1TSPA 3WWGA 1QQ1A 1IDJA 1XG2A 2F3LA 3FY3A 1LLWA 2IOUG 1PXZA 2UVEA 4OPWA 5C1EA 2QXZA 3SY2A 3TH0A 1QCXA 4XN0A 1HG8A 1TYXA 1OGOX 2QZAA 4XQFA 2UVFA 2VFQA 3B4NA 4YCQA 2NT6A 5JMCB 2O0VA 4U4BA 4XMYA 1WMRA 2O6WA 1CZFA 1JTAA 1X0CA 4YDTA 1BHEA 1NHCA 2VFMA 3PETA 2PYGA 4NK8A 1CLWA 2O0WA 2XTWA 4PMHA 2VJJA 3SUCA 3LMWA 3VSTA 2NZMA 3N90A 5AMVA 1QA3A 1QA2A 1BN8A 4YZ0A 4YZXA 1O8IA 2ODLA 1VBLA 2Z8GA 1WXRA 3NAWA 4MR0A 4OJOA 2O17A 2VFNA 4U49A 3ZPPA 1O8MA 2XTXA 3B90A 1QRCA 1QRBA 2BM5A 1HF2A 2J8KA 3GQ8A 3UW0A 3BH7B 4YEJA 4EW9A 3KRGA 1OFEA 1IB4A 4YELA 2NTPA 4XN3A 1O8HA 4XKWA 3LJYA 2IQ7A 2PYHA 1OOCA 3NB2A 4XLEA 2XT2A 3PSSA 3JURA 1O8LA
chains in the Genus database with same CATH topology
3T9GA 4OJPA 4URRA 2QX3A 3VMWA 4OZZA 2INVA 3VSVA 2NT9A 1KCCA 1O8EA 1K5CA 2VBMA 2EWEA 3GRHA 1AIRA 1RWRA 3EQOA 1RU4A 2X6XA 4OJ5A 4XKVA 1GQ8A 2X6WA 2NTQA 2VJIA 4XLFA 1H80A 2O04A 5C1CA 4XLAA 4Z06A 4MXNA 2NSPA 4W8TA 1O88A 2QY1A 2X6YA 3EQNA 4OJ6A 2O1DA 2BSPA 2VBEA 1JRGA 2X85A 1RMGA 1O8LA 4YZQA 4XNFA 4NK6A 4I84A 4XLHA 4W8QA 3GQAA 4XOPA 1O8GA 4XM3A 4AVZA 4W8SA 4XR6A 2VBKA 2PECA 4XOTA 4Z03A 1OFMA 4XONA 1IA5A 4XLCA 1O8JA 3VSUA 1DBGA 1DBOA 3GQ9A 1QJVA 3VMVA 1PLUA 2NTBA 1O8DA 1KCDA 4Z05A 2INUA 3GQ7A 3ZSCA 1IDKA 4YZAA 1KTWA 4OJLA 1OFLA 1OGMX 1O8FA 4XORA 1O8KA 1EE6A 4OZYA 4W8RA 3B8YA 4XL9A 2NSTA 1PE9A 4C2LA 3WWGA 1IDJA 1XG2A 3FY3A 2UVEA 1PXZA 5C1EA 2QXZA 1QCXA 4XN0A 1HG8A 1OGOX 4XQFA 2UVFA 3B4NA 2NT6A 2O0VA 4U4BA 4XMYA 1WMRA 1CZFA 1JTAA 1X0CA 1NHCA 1BHEA 2PYGA 4NK8A 2O0WA 4PMHA 3SUCA 3VSTA 2VJJA 3LMWA 2NZMA 5AMVA 1BN8A 4YZ0A 4YZXA 1O8IA 2ODLA 1VBLA 2Z8GA 4MR0A 4OJOA 2O17A 4U49A 3ZPPA 1O8MA 3B90A 3GQ8A 3UW0A 4YEJA 1IB4A 4EW9A 3KRGA 4YELA 2NTPA 4XN3A 1O8HA 4XKWA 2IQ7A 2PYHA 1OOCA 4XLEA 4HWVA 3JURA 2X3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9G A;  4OJP A;  4URR A;  2QX3 A;  3VMW A;  4OZZ A;  2INV A;  3VSV A;  2NT9 A;  1KCC A;  1O8E A;  1K5C A;  2VBM A;  2EWE A;  3GRH A;  1AIR A;  1RWR A;  3EQO A;  1RU4 A;  2X6X A;  4OJ5 A;  4XKV A;  1GQ8 A;  2X6W A;  2NTQ A;  2VJI A;  4XLF A;  1H80 A;  2O04 A;  5C1C A;  4XLA A;  4Z06 A;  4MXN A;  2NSP A;  4W8T A;  1O88 A;  2QY1 A;  2X6Y A;  3EQN A;  4OJ6 A;  2O1D A;  2BSP A;  2VBE A;  1JRG A;  2X85 A;  1RMG A;  1O8L A;  4YZQ A;  4XNF A;  4NK6 A;  4I84 A;  4XLH A;  4W8Q A;  3GQA A;  4XOP A;  1O8G A;  4XM3 A;  4AVZ A;  4W8S A;  4XR6 A;  2VBK A;  2PEC A;  4XOT A;  4Z03 A;  1OFM A;  4XON A;  1IA5 A;  4XLC A;  1O8J A;  3VSU A;  1DBG A;  1DBO A;  3GQ9 A;  1QJV A;  3VMV A;  1PLU A;  2NTB A;  1O8D A;  1KCD A;  4Z05 A;  2INU A;  3GQ7 A;  3ZSC A;  1IDK A;  4YZA A;  1KTW A;  4OJL A;  1OFL A;  1OGM X;  1O8F A;  4XOR A;  1O8K A;  1EE6 A;  4OZY A;  4W8R A;  3B8Y A;  4XL9 A;  2NST A;  1PE9 A;  4C2L A;  3WWG A;  1IDJ A;  1XG2 A;  3FY3 A;  2UVE A;  1PXZ A;  5C1E A;  2QXZ A;  1QCX A;  4XN0 A;  1HG8 A;  1OGO X;  4XQF A;  2UVF A;  3B4N A;  2NT6 A;  2O0V A;  4U4B A;  4XMY A;  1WMR A;  1CZF A;  1JTA A;  1X0C A;  1NHC A;  1BHE A;  2PYG A;  4NK8 A;  2O0W A;  4PMH A;  3SUC A;  3VST A;  2VJJ A;  3LMW A;  2NZM A;  5AMV A;  1BN8 A;  4YZ0 A;  4YZX A;  1O8I A;  2ODL A;  1VBL A;  2Z8G A;  4MR0 A;  4OJO A;  2O17 A;  4U49 A;  3ZPP A;  1O8M A;  3B90 A;  3GQ8 A;  3UW0 A;  4YEJ A;  1IB4 A;  4EW9 A;  3KRG A;  4YEL A;  2NTP A;  4XN3 A;  1O8H A;  4XKW A;  2IQ7 A;  2PYH A;  1OOC A;  4XLE A;  4HWV A;  3JUR A;  2X3H A; 
#chains in the Genus database with same CATH topology
 3ML3 A;  1LM1 A;  3T9G A;  4OJP A;  4URR A;  2QX3 A;  3VMW A;  2YUH A;  4OZZ A;  2INV A;  3BH6 B;  3H09 A;  3VSV A;  2NT9 A;  1KCC A;  1O8E A;  1K5C A;  2VBM A;  2EWE A;  3GRH A;  1AIR A;  1RWR A;  1OFD A;  1RU4 A;  2XTY A;  3EQO A;  4JRA C;  3RIQ A;  3PSZ A;  2X6X A;  4OJ5 A;  4XKV A;  4YEI A;  1GQ8 A;  2X6W A;  2BM4 A;  2NTQ A;  1DAB A;  2VJI A;  4XLF A;  1H80 A;  2G0Y A;  2O04 A;  5DNS A;  5C1C A;  3AK5 A;  4XLA A;  3LYC A;  3SZE A;  4Z06 A;  4MXN A;  2NSP A;  2J8I A;  1O88 A;  4HWV A;  1EZG A;  2QY1 A;  4W8T A;  2XT4 A;  2X6Y A;  3EQN A;  4OJ6 A;  2O1D A;  1KQ5 A;  4KH3 A;  2BSP A;  4OM9 A;  2VBE A;  1JRG A;  2X85 A;  1RMG A;  4YZQ A;  4XNF A;  4YC5 A;  4NK6 A;  4I84 A;  4XLH A;  2VFO A;  4W8Q A;  3GQA A;  4XOP A;  3N6Z A;  1O8G A;  3DU1 X;  3SQV A;  4XM3 A;  4AVZ A;  4W8S A;  4XR6 A;  2VBK A;  2PEC A;  1L1I A;  2BM7 A;  4XOT A;  1QA1 A;  4Z03 A;  1OFM A;  1LLZ A;  4XON A;  2VFP A;  4YFO A;  2X3H A;  1K8F A;  2BM6 A;  2QYU A;  5JLV C;  2BX6 A;  4XLC A;  1IA5 A;  1O8J A;  3VSU A;  1DBG A;  1DBO A;  3P4G A;  1TYU A;  2V5I A;  3GQ9 A;  1QJV A;  3SYJ A;  3VMV A;  1K4Z A;  1PLU A;  2NTB A;  1O8D A;  1KCD A;  3JX8 A;  4Z05 A;  2INU A;  3GQ7 A;  4V02 C;  3ZSC A;  1IDK A;  4YZA A;  2W7Z A;  1TYW A;  1KTW A;  4OJL A;  1EA0 A;  1OFL A;  1OGM X;  1O8F A;  4XOR A;  1O8K A;  1EE6 A;  1TYV A;  4OZY A;  4W8R A;  2XC1 A;  3B8Y A;  4XL9 A;  2B0R A;  2NST A;  1PE9 A;  4C2L A;  1TSP A;  3WWG A;  1QQ1 A;  1IDJ A;  1XG2 A;  2F3L A;  3FY3 A;  1LLW A;  2IOU G;  1PXZ A;  2UVE A;  4OPW A;  5C1E A;  2QXZ A;  3SY2 A;  3TH0 A;  1QCX A;  4XN0 A;  1HG8 A;  1TYX A;  1OGO X;  2QZA A;  4XQF A;  2UVF A;  2VFQ A;  3B4N A;  4YCQ A;  2NT6 A;  5JMC B;  2O0V A;  4U4B A;  4XMY A;  1WMR A;  2O6W A;  1CZF A;  1JTA A;  1X0C A;  4YDT A;  1BHE A;  1NHC A;  2VFM A;  3PET A;  2PYG A;  4NK8 A;  1CLW A;  2O0W A;  2XTW A;  4PMH A;  2VJJ A;  3SUC A;  3LMW A;  3VST A;  2NZM A;  3N90 A;  5AMV A;  1QA3 A;  1QA2 A;  1BN8 A;  4YZ0 A;  4YZX A;  1O8I A;  2ODL A;  1VBL A;  2Z8G A;  1WXR A;  3NAW A;  4MR0 A;  4OJO A;  2O17 A;  2VFN A;  4U49 A;  3ZPP A;  1O8M A;  2XTX A;  3B90 A;  1QRC A;  1QRB A;  2BM5 A;  1HF2 A;  2J8K A;  3GQ8 A;  3UW0 A;  3BH7 B;  4YEJ A;  4EW9 A;  3KRG A;  1OFE A;  1IB4 A;  4YEL A;  2NTP A;  4XN3 A;  1O8H A;  4XKW A;  3LJY A;  2IQ7 A;  2PYH A;  1OOC A;  3NB2 A;  4XLE A;  2XT2 A;  3PSS A;  3JUR A;  1O8L A; 
#chains in the Genus database with same CATH homology
 3T9G A;  4OJP A;  4URR A;  2QX3 A;  3VMW A;  4OZZ A;  2INV A;  3VSV A;  2NT9 A;  1KCC A;  1O8E A;  1K5C A;  2VBM A;  2EWE A;  3GRH A;  1AIR A;  1RWR A;  3EQO A;  1RU4 A;  2X6X A;  4OJ5 A;  4XKV A;  1GQ8 A;  2X6W A;  2NTQ A;  2VJI A;  4XLF A;  1H80 A;  2O04 A;  5C1C A;  4XLA A;  4Z06 A;  4MXN A;  2NSP A;  4W8T A;  1O88 A;  2QY1 A;  2X6Y A;  3EQN A;  4OJ6 A;  2O1D A;  2BSP A;  2VBE A;  1JRG A;  2X85 A;  1RMG A;  1O8L A;  4YZQ A;  4XNF A;  4NK6 A;  4I84 A;  4XLH A;  4W8Q A;  3GQA A;  4XOP A;  1O8G A;  4XM3 A;  4AVZ A;  4W8S A;  4XR6 A;  2VBK A;  2PEC A;  4XOT A;  4Z03 A;  1OFM A;  4XON A;  1IA5 A;  4XLC A;  1O8J A;  3VSU A;  1DBG A;  1DBO A;  3GQ9 A;  1QJV A;  3VMV A;  1PLU A;  2NTB A;  1O8D A;  1KCD A;  4Z05 A;  2INU A;  3GQ7 A;  3ZSC A;  1IDK A;  4YZA A;  1KTW A;  4OJL A;  1OFL A;  1OGM X;  1O8F A;  4XOR A;  1O8K A;  1EE6 A;  4OZY A;  4W8R A;  3B8Y A;  4XL9 A;  2NST A;  1PE9 A;  4C2L A;  3WWG A;  1IDJ A;  1XG2 A;  3FY3 A;  2UVE A;  1PXZ A;  5C1E A;  2QXZ A;  1QCX A;  4XN0 A;  1HG8 A;  1OGO X;  4XQF A;  2UVF A;  3B4N A;  2NT6 A;  2O0V A;  4U4B A;  4XMY A;  1WMR A;  1CZF A;  1JTA A;  1X0C A;  1NHC A;  1BHE A;  2PYG A;  4NK8 A;  2O0W A;  4PMH A;  3SUC A;  3VST A;  2VJJ A;  3LMW A;  2NZM A;  5AMV A;  1BN8 A;  4YZ0 A;  4YZX A;  1O8I A;  2ODL A;  1VBL A;  2Z8G A;  4MR0 A;  4OJO A;  2O17 A;  4U49 A;  3ZPP A;  1O8M A;  3B90 A;  3GQ8 A;  3UW0 A;  4YEJ A;  1IB4 A;  4EW9 A;  3KRG A;  4YEL A;  2NTP A;  4XN3 A;  1O8H A;  4XKW A;  2IQ7 A;  2PYH A;  1OOC A;  4XLE A;  4HWV A;  3JUR A;  2X3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...