1O8KA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 20mm ca2+
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8kA00
4XN0A 1WMRA 1IDJA 2VJIA 1OFLA 4HWVA 2O17A 1O8LA 4XOTA 2NSPA 4W8SA 1RWRA 4XONA 5C1CA 1O8KA 2QY1A 1O8MA 2UVFA 1OFMA 1QCXA 4XOPA 1IA5A 4YZXA 3UW0A 3JURA 4URRA 1VBLA 4YEJA 2PYGA 3GQ9A 1H80A 4XORA 3GQAA 1DBOA 3B4NA 4Z05A 2VBMA 4XMYA 2VJJA 3ZSCA 1CZFA 2O1DA 4U49A 2X3HA 1OGOX 4EW9A 4XLFA 2NZMA 4XKWA 1AIRA 2PECA 1X0CA 1RMGA 1OGMX 2PYHA 2NSTA 2NT9A 2INUA 1NHCA 1QJVA 3GRHA 4XLEA 4AVZA 3EQOA 2O0VA 2X6WA 4OJOA 1PXZA 1KTWA 1XG2A 3VSTA 1O8FA 4XLHA 1O8JA 4NK8A 2IQ7A 2X85A 2NTPA 1BHEA 2QXZA 2BSPA 2NTBA 5C1EA 1KCCA 3LMWA 3GQ8A 1O8EA 4NK6A 4XL9A 4OZYA 4XM3A 4YELA 1GQ8A 4U4BA 1IB4A 3VMVA 1HG8A 4XR6A 1EE6A 4XN3A 4YZ0A 5AMVA 1BN8A 1O8DA 4YZAA 2INVA 3T9GA 4XLCA 2O04A 3EQNA 2X6XA 4I84A 1JTAA 3GQ7A 4XLAA 2O0WA 2EWEA 2VBKA 4OZZA 4XNFA 1RU4A 4PMHA 3B8YA 4OJPA 4MR0A 4XQFA 1OOCA 3FY3A 4OJ6A 1DBGA 3WWGA 2QX3A 2X6YA 4OJ5A 1K5CA 3VMWA 1O8IA 2NTQA 4W8RA 1O88A 1IDKA 4W8QA 2UVEA 2ODLA 3SUCA 3ZPPA 1JRGA 4YZQA 3VSUA 4XKVA 4W8TA 4C2LA 1KCDA 4Z03A 4Z06A 1O8HA 1O8GA 3B90A 2Z8GA 3KRGA 1PE9A 1PLUA 2VBEA 4OJLA 3VSVA 4MXNA 2NT6A
chains in the Genus database with same CATH superfamily
1KQ5A 4XN0A 1WMRA 3SZEA 1IDJA 2VJIA 1QQ1A 5JMCB 2QZAA 1OFLA 4HWVA 3AK5A 2O17A 1O8LA 1TYUA 4XOTA 5DNSA 2NSPA 4W8SA 1RWRA 4XONA 5C1CA 1O8KA 2QY1A 1O8MA 2UVFA 1OFMA 1K4ZA 1QCXA 4XOPA 1IA5A 2XTYA 4YZXA 2XT2A 3RIQA 3UW0A 2J8IA 3JURA 4URRA 2B0RA 4YDTA 1LLWA 1VBLA 4YEJA 1OFDA 2PYGA 2VFQA 3P4GA 2O6WA 3GQ9A 1EA0A 1H80A 4XORA 3GQAA 3TH0A 1DBOA 3H09A 3B4NA 4Z05A 2VBMA 1HF2A 2VJJA 4XMYA 3ZSCA 1CZFA 2O1DA 4U49A 2VFMA 4JRAC 1OFEA 1K8FA 3BH7B 3JX8A 2X3HA 3LJYA 1OGOX 4EW9A 4OPWA 2BM6A 4XLFA 2YUHA 3NAWA 1QA1A 2G0YA 3NB2A 2NZMA 2VFOA 1AIRA 1TYXA 2PECA 4XKWA 1TYWA 1X0CA 1RMGA 2VFNA 1OGMX 2PYHA 3N6ZA 2VFPA 2NSTA 2NT9A 2INUA 3N90A 1NHCA 1QJVA 3GRHA 4XLEA 4AVZA 3EQOA 4OM9A 2O0VA 3SQVA 1QRBA 2X6WA 3SYJA 1CLWA 4OJOA 2BM5A 1PXZA 1KTWA 1XG2A 3VSTA 1O8FA 4XLHA 1WXRA 1O8JA 2XT4A 2IQ7A 2QYUA 3PSSA 1LLZA 4NK8A 2X85A 2NTPA 1BHEA 2QXZA 3BH6B 2BSPA 2NTBA 5C1EA 1KCCA 3LMWA 3ML3A 3GQ8A 1TSPA 3DU1X 1O8EA 1EZGA 4NK6A 1TYVA 4XL9A 4OZYA 2XTXA 4XM3A 3LYCA 1QA2A 4YELA 2BX6A 3SY2A 2V5IA 1GQ8A 4U4BA 1IB4A 2F3LA 3VMVA 1HG8A 4XR6A 1EE6A 4XN3A 4YZ0A 5AMVA 1BN8A 2W7ZA 1O8DA 3PSZA 4YZAA 1DABA 2INVA 3T9GA 1L1IA 4XLCA 2O04A 3EQNA 2X6XA 4I84A 2IOUG 1JTAA 2BM7A 2XC1A 3GQ7A 4KH3A 4XLAA 2O0WA 2EWEA 2VBKA 4OZZA 4XNFA 1RU4A 1LM1A 3B8YA 4OJPA 4MR0A 4PMHA 4XQFA 1OOCA 3FY3A 1QA3A 4OJ6A 1DBGA 3PETA 3WWGA 2J8KA 2QX3A 2X6YA 4OJ5A 1K5CA 4V02C 3VMWA 1O8IA 2NTQA 2BM4A 1O88A 4W8RA 4YCQA 4YEIA 5JLVC 1IDKA 4W8QA 2UVEA 1QRCA 2ODLA 3SUCA 3ZPPA 2XTWA 1JRGA 4YZQA 3VSUA 4XKVA 4W8TA 4C2LA 4YFOA 1KCDA 4Z03A 4Z06A 1O8HA 1O8GA 3B90A 4YC5A 2Z8GA 3KRGA 1PE9A 1PLUA 2VBEA 4OJLA 3VSVA 4MXNA 2NT6A
chains in the Genus database with same CATH topology
4XN0A 1WMRA 1IDJA 2VJIA 1OFLA 4HWVA 2O17A 1O8LA 4XOTA 2NSPA 4W8SA 1RWRA 4XONA 5C1CA 1O8KA 2QY1A 1O8MA 2UVFA 1OFMA 1QCXA 4XOPA 1IA5A 4YZXA 3UW0A 3JURA 4URRA 1VBLA 4YEJA 2PYGA 3GQ9A 1H80A 4XORA 3GQAA 1DBOA 3B4NA 4Z05A 2VBMA 4XMYA 2VJJA 3ZSCA 1CZFA 2O1DA 4U49A 2X3HA 1OGOX 4EW9A 4XLFA 2NZMA 4XKWA 1AIRA 2PECA 1X0CA 1RMGA 1OGMX 2PYHA 2NSTA 2NT9A 2INUA 1NHCA 1QJVA 3GRHA 4XLEA 4AVZA 3EQOA 2O0VA 2X6WA 4OJOA 1PXZA 1KTWA 1XG2A 3VSTA 1O8FA 4XLHA 1O8JA 4NK8A 2IQ7A 2X85A 2NTPA 1BHEA 2QXZA 2BSPA 2NTBA 5C1EA 1KCCA 3LMWA 3GQ8A 1O8EA 4NK6A 4XL9A 4OZYA 4XM3A 4YELA 1GQ8A 4U4BA 1IB4A 3VMVA 1HG8A 4XR6A 1EE6A 4XN3A 4YZ0A 5AMVA 1BN8A 1O8DA 4YZAA 2INVA 3T9GA 4XLCA 2O04A 3EQNA 2X6XA 4I84A 1JTAA 3GQ7A 4XLAA 2O0WA 2EWEA 2VBKA 4OZZA 4XNFA 1RU4A 4PMHA 3B8YA 4OJPA 4MR0A 4XQFA 1OOCA 3FY3A 4OJ6A 1DBGA 3WWGA 2QX3A 2X6YA 4OJ5A 1K5CA 3VMWA 1O8IA 2NTQA 4W8RA 1O88A 1IDKA 4W8QA 2UVEA 2ODLA 3SUCA 3ZPPA 1JRGA 4YZQA 3VSUA 4XKVA 4W8TA 4C2LA 1KCDA 4Z03A 4Z06A 1O8HA 1O8GA 3B90A 2Z8GA 3KRGA 1PE9A 1PLUA 2VBEA 4OJLA 3VSVA 4MXNA 2NT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XN0 A;  1WMR A;  1IDJ A;  2VJI A;  1OFL A;  4HWV A;  2O17 A;  1O8L A;  4XOT A;  2NSP A;  4W8S A;  1RWR A;  4XON A;  5C1C A;  1O8K A;  2QY1 A;  1O8M A;  2UVF A;  1OFM A;  1QCX A;  4XOP A;  1IA5 A;  4YZX A;  3UW0 A;  3JUR A;  4URR A;  1VBL A;  4YEJ A;  2PYG A;  3GQ9 A;  1H80 A;  4XOR A;  3GQA A;  1DBO A;  3B4N A;  4Z05 A;  2VBM A;  4XMY A;  2VJJ A;  3ZSC A;  1CZF A;  2O1D A;  4U49 A;  2X3H A;  1OGO X;  4EW9 A;  4XLF A;  2NZM A;  4XKW A;  1AIR A;  2PEC A;  1X0C A;  1RMG A;  1OGM X;  2PYH A;  2NST A;  2NT9 A;  2INU A;  1NHC A;  1QJV A;  3GRH A;  4XLE A;  4AVZ A;  3EQO A;  2O0V A;  2X6W A;  4OJO A;  1PXZ A;  1KTW A;  1XG2 A;  3VST A;  1O8F A;  4XLH A;  1O8J A;  4NK8 A;  2IQ7 A;  2X85 A;  2NTP A;  1BHE A;  2QXZ A;  2BSP A;  2NTB A;  5C1E A;  1KCC A;  3LMW A;  3GQ8 A;  1O8E A;  4NK6 A;  4XL9 A;  4OZY A;  4XM3 A;  4YEL A;  1GQ8 A;  4U4B A;  1IB4 A;  3VMV A;  1HG8 A;  4XR6 A;  1EE6 A;  4XN3 A;  4YZ0 A;  5AMV A;  1BN8 A;  1O8D A;  4YZA A;  2INV A;  3T9G A;  4XLC A;  2O04 A;  3EQN A;  2X6X A;  4I84 A;  1JTA A;  3GQ7 A;  4XLA A;  2O0W A;  2EWE A;  2VBK A;  4OZZ A;  4XNF A;  1RU4 A;  4PMH A;  3B8Y A;  4OJP A;  4MR0 A;  4XQF A;  1OOC A;  3FY3 A;  4OJ6 A;  1DBG A;  3WWG A;  2QX3 A;  2X6Y A;  4OJ5 A;  1K5C A;  3VMW A;  1O8I A;  2NTQ A;  4W8R A;  1O88 A;  1IDK A;  4W8Q A;  2UVE A;  2ODL A;  3SUC A;  3ZPP A;  1JRG A;  4YZQ A;  3VSU A;  4XKV A;  4W8T A;  4C2L A;  1KCD A;  4Z03 A;  4Z06 A;  1O8H A;  1O8G A;  3B90 A;  2Z8G A;  3KRG A;  1PE9 A;  1PLU A;  2VBE A;  4OJL A;  3VSV A;  4MXN A;  2NT6 A; 
#chains in the Genus database with same CATH topology
 1KQ5 A;  4XN0 A;  1WMR A;  3SZE A;  1IDJ A;  2VJI A;  1QQ1 A;  5JMC B;  2QZA A;  1OFL A;  4HWV A;  3AK5 A;  2O17 A;  1O8L A;  1TYU A;  4XOT A;  5DNS A;  2NSP A;  4W8S A;  1RWR A;  4XON A;  5C1C A;  1O8K A;  2QY1 A;  1O8M A;  2UVF A;  1OFM A;  1K4Z A;  1QCX A;  4XOP A;  1IA5 A;  2XTY A;  4YZX A;  2XT2 A;  3RIQ A;  3UW0 A;  2J8I A;  3JUR A;  4URR A;  2B0R A;  4YDT A;  1LLW A;  1VBL A;  4YEJ A;  1OFD A;  2PYG A;  2VFQ A;  3P4G A;  2O6W A;  3GQ9 A;  1EA0 A;  1H80 A;  4XOR A;  3GQA A;  3TH0 A;  1DBO A;  3H09 A;  3B4N A;  4Z05 A;  2VBM A;  1HF2 A;  2VJJ A;  4XMY A;  3ZSC A;  1CZF A;  2O1D A;  4U49 A;  2VFM A;  4JRA C;  1OFE A;  1K8F A;  3BH7 B;  3JX8 A;  2X3H A;  3LJY A;  1OGO X;  4EW9 A;  4OPW A;  2BM6 A;  4XLF A;  2YUH A;  3NAW A;  1QA1 A;  2G0Y A;  3NB2 A;  2NZM A;  2VFO A;  1AIR A;  1TYX A;  2PEC A;  4XKW A;  1TYW A;  1X0C A;  1RMG A;  2VFN A;  1OGM X;  2PYH A;  3N6Z A;  2VFP A;  2NST A;  2NT9 A;  2INU A;  3N90 A;  1NHC A;  1QJV A;  3GRH A;  4XLE A;  4AVZ A;  3EQO A;  4OM9 A;  2O0V A;  3SQV A;  1QRB A;  2X6W A;  3SYJ A;  1CLW A;  4OJO A;  2BM5 A;  1PXZ A;  1KTW A;  1XG2 A;  3VST A;  1O8F A;  4XLH A;  1WXR A;  1O8J A;  2XT4 A;  2IQ7 A;  2QYU A;  3PSS A;  1LLZ A;  4NK8 A;  2X85 A;  2NTP A;  1BHE A;  2QXZ A;  3BH6 B;  2BSP A;  2NTB A;  5C1E A;  1KCC A;  3LMW A;  3ML3 A;  3GQ8 A;  1TSP A;  3DU1 X;  1O8E A;  1EZG A;  4NK6 A;  1TYV A;  4XL9 A;  4OZY A;  2XTX A;  4XM3 A;  3LYC A;  1QA2 A;  4YEL A;  2BX6 A;  3SY2 A;  2V5I A;  1GQ8 A;  4U4B A;  1IB4 A;  2F3L A;  3VMV A;  1HG8 A;  4XR6 A;  1EE6 A;  4XN3 A;  4YZ0 A;  5AMV A;  1BN8 A;  2W7Z A;  1O8D A;  3PSZ A;  4YZA A;  1DAB A;  2INV A;  3T9G A;  1L1I A;  4XLC A;  2O04 A;  3EQN A;  2X6X A;  4I84 A;  2IOU G;  1JTA A;  2BM7 A;  2XC1 A;  3GQ7 A;  4KH3 A;  4XLA A;  2O0W A;  2EWE A;  2VBK A;  4OZZ A;  4XNF A;  1RU4 A;  1LM1 A;  3B8Y A;  4OJP A;  4MR0 A;  4PMH A;  4XQF A;  1OOC A;  3FY3 A;  1QA3 A;  4OJ6 A;  1DBG A;  3PET A;  3WWG A;  2J8K A;  2QX3 A;  2X6Y A;  4OJ5 A;  1K5C A;  4V02 C;  3VMW A;  1O8I A;  2NTQ A;  2BM4 A;  1O88 A;  4W8R A;  4YCQ A;  4YEI A;  5JLV C;  1IDK A;  4W8Q A;  2UVE A;  1QRC A;  2ODL A;  3SUC A;  3ZPP A;  2XTW A;  1JRG A;  4YZQ A;  3VSU A;  4XKV A;  4W8T A;  4C2L A;  4YFO A;  1KCD A;  4Z03 A;  4Z06 A;  1O8H A;  1O8G A;  3B90 A;  4YC5 A;  2Z8G A;  3KRG A;  1PE9 A;  1PLU A;  2VBE A;  4OJL A;  3VSV A;  4MXN A;  2NT6 A; 
#chains in the Genus database with same CATH homology
 4XN0 A;  1WMR A;  1IDJ A;  2VJI A;  1OFL A;  4HWV A;  2O17 A;  1O8L A;  4XOT A;  2NSP A;  4W8S A;  1RWR A;  4XON A;  5C1C A;  1O8K A;  2QY1 A;  1O8M A;  2UVF A;  1OFM A;  1QCX A;  4XOP A;  1IA5 A;  4YZX A;  3UW0 A;  3JUR A;  4URR A;  1VBL A;  4YEJ A;  2PYG A;  3GQ9 A;  1H80 A;  4XOR A;  3GQA A;  1DBO A;  3B4N A;  4Z05 A;  2VBM A;  4XMY A;  2VJJ A;  3ZSC A;  1CZF A;  2O1D A;  4U49 A;  2X3H A;  1OGO X;  4EW9 A;  4XLF A;  2NZM A;  4XKW A;  1AIR A;  2PEC A;  1X0C A;  1RMG A;  1OGM X;  2PYH A;  2NST A;  2NT9 A;  2INU A;  1NHC A;  1QJV A;  3GRH A;  4XLE A;  4AVZ A;  3EQO A;  2O0V A;  2X6W A;  4OJO A;  1PXZ A;  1KTW A;  1XG2 A;  3VST A;  1O8F A;  4XLH A;  1O8J A;  4NK8 A;  2IQ7 A;  2X85 A;  2NTP A;  1BHE A;  2QXZ A;  2BSP A;  2NTB A;  5C1E A;  1KCC A;  3LMW A;  3GQ8 A;  1O8E A;  4NK6 A;  4XL9 A;  4OZY A;  4XM3 A;  4YEL A;  1GQ8 A;  4U4B A;  1IB4 A;  3VMV A;  1HG8 A;  4XR6 A;  1EE6 A;  4XN3 A;  4YZ0 A;  5AMV A;  1BN8 A;  1O8D A;  4YZA A;  2INV A;  3T9G A;  4XLC A;  2O04 A;  3EQN A;  2X6X A;  4I84 A;  1JTA A;  3GQ7 A;  4XLA A;  2O0W A;  2EWE A;  2VBK A;  4OZZ A;  4XNF A;  1RU4 A;  4PMH A;  3B8Y A;  4OJP A;  4MR0 A;  4XQF A;  1OOC A;  3FY3 A;  4OJ6 A;  1DBG A;  3WWG A;  2QX3 A;  2X6Y A;  4OJ5 A;  1K5C A;  3VMW A;  1O8I A;  2NTQ A;  4W8R A;  1O88 A;  1IDK A;  4W8Q A;  2UVE A;  2ODL A;  3SUC A;  3ZPP A;  1JRG A;  4YZQ A;  3VSU A;  4XKV A;  4W8T A;  4C2L A;  1KCD A;  4Z03 A;  4Z06 A;  1O8H A;  1O8G A;  3B90 A;  2Z8G A;  3KRG A;  1PE9 A;  1PLU A;  2VBE A;  4OJL A;  3VSV A;  4MXN A;  2NT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...