1O8KA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 20mm ca2+
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8kA00
4U49A 4EW9A 1JRGA 1O8FA 4URRA 1O8GA 1O88A 2PECA 3SUCA 4OZYA 2QX3A 4XR6A 3T9GA 2O1DA 4C2LA 2NTBA 3VMVA 1OFLA 4PMHA 2NTQA 4OJPA 4XLCA 1OOCA 2EWEA 2NT6A 4XLFA 2X3HA 2VJIA 2Z8GA 3GQ8A 3ZPPA 2NTPA 4XN3A 2O04A 3KRGA 4Z05A 1OGOX 5AMVA 5C1CA 2VBEA 1PE9A 3B90A 4W8RA 1O8LA 4OJOA 1BHEA 1O8IA 2QY1A 3UW0A 4OJ5A 4XN0A 4Z06A 3ZSCA 2VBMA 4I84A 2O0WA 2BSPA 3VSVA 4W8QA 4HWVA 4XNFA 3VSUA 1KCCA 4OZZA 2PYHA 1IA5A 1QJVA 1H80A 4W8SA 3GQAA 1IDKA 4XKWA 5C1EA 3LMWA 1HG8A 1QCXA 4MR0A 1O8KA 1O8JA 2O17A 2QXZA 4YZAA 4YZXA 4XLAA 1OFMA 4XM3A 4YZ0A 1AIRA 1O8DA 3EQNA 2UVFA 1PLUA 2X6YA 4XLEA 3JURA 4NK8A 3GRHA 2NSTA 4W8TA 1GQ8A 2VJJA 2ODLA 1DBGA 4YZQA 1CZFA 1BN8A 3VSTA 1O8EA 2NT9A 3GQ7A 1K5CA 4XONA 2X6XA 1RWRA 4XQFA 1DBOA 4XKVA 3B8YA 4OJ6A 1OGMX 4NK6A 2X6WA 4AVZA 2X85A 4XOTA 3EQOA 3B4NA 2UVEA 1XG2A 4XL9A 1IB4A 1EE6A 2IQ7A 4OJLA 2INVA 1X0CA 2NSPA 4YELA 2PYGA 3GQ9A 2NZMA 1O8MA 1PXZA 1JTAA 4U4BA 1VBLA 4YEJA 1KCDA 1KTWA 4XOPA 4XMYA 1O8HA 3FY3A 1RMGA 1RU4A 2O0VA 4XORA 3VMWA 4XLHA 1NHCA 1IDJA 4MXNA 2INUA 2VBKA 4Z03A 3WWGA 1WMRA
chains in the Genus database with same CATH superfamily
4U49A 3BH6B 4EW9A 3N6ZA 1JRGA 1O8FA 1QRBA 4URRA 1O8GA 3SZEA 1O88A 2PECA 2XTXA 3SUCA 4OZYA 2QX3A 4XR6A 3T9GA 5JLVC 1OFDA 2O1DA 4C2LA 3PSSA 1QA3A 2NTBA 3VMVA 1OFLA 4PMHA 2NTQA 4OJPA 4XLCA 1LM1A 1QQ1A 3TH0A 1OOCA 1OFEA 1QRCA 2EWEA 2NT6A 4KH3A 4XLFA 2X3HA 2VJIA 2Z8GA 3GQ8A 3ZPPA 1L1IA 2NTPA 4XN3A 2O04A 2O6WA 3H09A 3KRGA 1OGOX 4Z05A 5AMVA 5C1CA 1PE9A 2VBEA 3B90A 4YCQA 4W8RA 1O8LA 2VFQA 4OJOA 1BHEA 1O8IA 2QY1A 1TSPA 3ML3A 3PSZA 3UW0A 4OJ5A 4XN0A 4Z06A 3ZSCA 2VBMA 4I84A 2O0WA 2BSPA 2V5IA 3VSVA 4W8QA 4HWVA 4XNFA 4YDTA 3RIQA 3VSUA 1KCCA 4OZZA 1EA0A 2PYHA 1TYXA 1IA5A 1QJVA 1H80A 4W8SA 3GQAA 1IDKA 4XKWA 5C1EA 3LMWA 1K4ZA 1HG8A 1QCXA 4MR0A 1LLWA 1O8KA 2XTWA 1O8JA 2J8KA 2O17A 2QXZA 3NAWA 2XTYA 2IOUG 4YZAA 4YFOA 4JRAC 1TYUA 4YZXA 4XLAA 1OFMA 2F3LA 4XM3A 3BH7B 4YZ0A 1AIRA 3DU1X 4YEIA 1O8DA 1EZGA 3EQNA 2BX6A 2UVFA 1PLUA 2X6YA 2B0RA 2VFNA 3N90A 4XLEA 3SYJA 1LLZA 3LJYA 3JURA 1K8FA 4NK8A 3GRHA 2NSTA 4W8TA 1GQ8A 2BM7A 2VJJA 3JX8A 2ODLA 1DBGA 4YZQA 1CZFA 3SY2A 1CLWA 1BN8A 3VSTA 1O8EA 2NT9A 3GQ7A 1K5CA 4XONA 2X6XA 2VFPA 1RWRA 4XQFA 1DABA 1DBOA 4XKVA 3B8YA 3AK5A 4OJ6A 1OGMX 2J8IA 1HF2A 2X6WA 2XT2A 4NK6A 4AVZA 2X85A 4XOTA 3EQOA 2G0YA 3B4NA 2UVEA 1XG2A 4OPWA 2XT4A 4OM9A 4XL9A 1IB4A 5JMCB 1EE6A 2IQ7A 1QA2A 2QZAA 4OJLA 2INVA 2BM5A 1X0CA 2NSPA 1QA1A 4YELA 2PYGA 1TYVA 4V02C 2BM4A 3GQ9A 2VFOA 2NZMA 1O8MA 1PXZA 1JTAA 4U4BA 1VBLA 4YEJA 1WXRA 1KCDA 4YC5A 3PETA 1KTWA 3NB2A 4XOPA 1KQ5A 4XMYA 3P4GA 2BM6A 1TYWA 2XC1A 1O8HA 3FY3A 1RMGA 1RU4A 2O0VA 5DNSA 4XORA 3VMWA 2W7ZA 4XLHA 3LYCA 2YUHA 2VFMA 1NHCA 1IDJA 3SQVA 2QYUA 4MXNA 2INUA 2VBKA 4Z03A 3WWGA 1WMRA
chains in the Genus database with same CATH topology
4U49A 4EW9A 1JRGA 1O8FA 4URRA 1O8GA 1O88A 2PECA 3SUCA 4OZYA 2QX3A 4XR6A 3T9GA 2O1DA 4C2LA 2NTBA 3VMVA 1OFLA 4PMHA 2NTQA 4OJPA 4XLCA 1OOCA 2EWEA 2NT6A 4XLFA 2X3HA 2VJIA 2Z8GA 3GQ8A 3ZPPA 2NTPA 4XN3A 2O04A 3KRGA 4Z05A 1OGOX 5AMVA 5C1CA 2VBEA 1PE9A 3B90A 4W8RA 1O8LA 4OJOA 1BHEA 1O8IA 2QY1A 3UW0A 4OJ5A 4XN0A 4Z06A 3ZSCA 2VBMA 4I84A 2O0WA 2BSPA 3VSVA 4W8QA 4HWVA 4XNFA 3VSUA 1KCCA 4OZZA 2PYHA 1IA5A 1QJVA 1H80A 4W8SA 3GQAA 1IDKA 4XKWA 5C1EA 3LMWA 1HG8A 1QCXA 4MR0A 1O8KA 1O8JA 2O17A 2QXZA 4YZAA 4YZXA 4XLAA 1OFMA 4XM3A 4YZ0A 1AIRA 1O8DA 3EQNA 2UVFA 1PLUA 2X6YA 4XLEA 3JURA 4NK8A 3GRHA 2NSTA 4W8TA 1GQ8A 2VJJA 2ODLA 1DBGA 4YZQA 1CZFA 1BN8A 3VSTA 1O8EA 2NT9A 3GQ7A 1K5CA 4XONA 2X6XA 1RWRA 4XQFA 1DBOA 4XKVA 3B8YA 4OJ6A 1OGMX 4NK6A 2X6WA 4AVZA 2X85A 4XOTA 3EQOA 3B4NA 2UVEA 1XG2A 4XL9A 1IB4A 1EE6A 2IQ7A 4OJLA 2INVA 1X0CA 2NSPA 4YELA 2PYGA 3GQ9A 2NZMA 1O8MA 1PXZA 1JTAA 4U4BA 1VBLA 4YEJA 1KCDA 1KTWA 4XOPA 4XMYA 1O8HA 3FY3A 1RMGA 1RU4A 2O0VA 4XORA 3VMWA 4XLHA 1NHCA 1IDJA 4MXNA 2INUA 2VBKA 4Z03A 3WWGA 1WMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U49 A;  4EW9 A;  1JRG A;  1O8F A;  4URR A;  1O8G A;  1O88 A;  2PEC A;  3SUC A;  4OZY A;  2QX3 A;  4XR6 A;  3T9G A;  2O1D A;  4C2L A;  2NTB A;  3VMV A;  1OFL A;  4PMH A;  2NTQ A;  4OJP A;  4XLC A;  1OOC A;  2EWE A;  2NT6 A;  4XLF A;  2X3H A;  2VJI A;  2Z8G A;  3GQ8 A;  3ZPP A;  2NTP A;  4XN3 A;  2O04 A;  3KRG A;  4Z05 A;  1OGO X;  5AMV A;  5C1C A;  2VBE A;  1PE9 A;  3B90 A;  4W8R A;  1O8L A;  4OJO A;  1BHE A;  1O8I A;  2QY1 A;  3UW0 A;  4OJ5 A;  4XN0 A;  4Z06 A;  3ZSC A;  2VBM A;  4I84 A;  2O0W A;  2BSP A;  3VSV A;  4W8Q A;  4HWV A;  4XNF A;  3VSU A;  1KCC A;  4OZZ A;  2PYH A;  1IA5 A;  1QJV A;  1H80 A;  4W8S A;  3GQA A;  1IDK A;  4XKW A;  5C1E A;  3LMW A;  1HG8 A;  1QCX A;  4MR0 A;  1O8K A;  1O8J A;  2O17 A;  2QXZ A;  4YZA A;  4YZX A;  4XLA A;  1OFM A;  4XM3 A;  4YZ0 A;  1AIR A;  1O8D A;  3EQN A;  2UVF A;  1PLU A;  2X6Y A;  4XLE A;  3JUR A;  4NK8 A;  3GRH A;  2NST A;  4W8T A;  1GQ8 A;  2VJJ A;  2ODL A;  1DBG A;  4YZQ A;  1CZF A;  1BN8 A;  3VST A;  1O8E A;  2NT9 A;  3GQ7 A;  1K5C A;  4XON A;  2X6X A;  1RWR A;  4XQF A;  1DBO A;  4XKV A;  3B8Y A;  4OJ6 A;  1OGM X;  4NK6 A;  2X6W A;  4AVZ A;  2X85 A;  4XOT A;  3EQO A;  3B4N A;  2UVE A;  1XG2 A;  4XL9 A;  1IB4 A;  1EE6 A;  2IQ7 A;  4OJL A;  2INV A;  1X0C A;  2NSP A;  4YEL A;  2PYG A;  3GQ9 A;  2NZM A;  1O8M A;  1PXZ A;  1JTA A;  4U4B A;  1VBL A;  4YEJ A;  1KCD A;  1KTW A;  4XOP A;  4XMY A;  1O8H A;  3FY3 A;  1RMG A;  1RU4 A;  2O0V A;  4XOR A;  3VMW A;  4XLH A;  1NHC A;  1IDJ A;  4MXN A;  2INU A;  2VBK A;  4Z03 A;  3WWG A;  1WMR A; 
#chains in the Genus database with same CATH topology
 4U49 A;  3BH6 B;  4EW9 A;  3N6Z A;  1JRG A;  1O8F A;  1QRB A;  4URR A;  1O8G A;  3SZE A;  1O88 A;  2PEC A;  2XTX A;  3SUC A;  4OZY A;  2QX3 A;  4XR6 A;  3T9G A;  5JLV C;  1OFD A;  2O1D A;  4C2L A;  3PSS A;  1QA3 A;  2NTB A;  3VMV A;  1OFL A;  4PMH A;  2NTQ A;  4OJP A;  4XLC A;  1LM1 A;  1QQ1 A;  3TH0 A;  1OOC A;  1OFE A;  1QRC A;  2EWE A;  2NT6 A;  4KH3 A;  4XLF A;  2X3H A;  2VJI A;  2Z8G A;  3GQ8 A;  3ZPP A;  1L1I A;  2NTP A;  4XN3 A;  2O04 A;  2O6W A;  3H09 A;  3KRG A;  1OGO X;  4Z05 A;  5AMV A;  5C1C A;  1PE9 A;  2VBE A;  3B90 A;  4YCQ A;  4W8R A;  1O8L A;  2VFQ A;  4OJO A;  1BHE A;  1O8I A;  2QY1 A;  1TSP A;  3ML3 A;  3PSZ A;  3UW0 A;  4OJ5 A;  4XN0 A;  4Z06 A;  3ZSC A;  2VBM A;  4I84 A;  2O0W A;  2BSP A;  2V5I A;  3VSV A;  4W8Q A;  4HWV A;  4XNF A;  4YDT A;  3RIQ A;  3VSU A;  1KCC A;  4OZZ A;  1EA0 A;  2PYH A;  1TYX A;  1IA5 A;  1QJV A;  1H80 A;  4W8S A;  3GQA A;  1IDK A;  4XKW A;  5C1E A;  3LMW A;  1K4Z A;  1HG8 A;  1QCX A;  4MR0 A;  1LLW A;  1O8K A;  2XTW A;  1O8J A;  2J8K A;  2O17 A;  2QXZ A;  3NAW A;  2XTY A;  2IOU G;  4YZA A;  4YFO A;  4JRA C;  1TYU A;  4YZX A;  4XLA A;  1OFM A;  2F3L A;  4XM3 A;  3BH7 B;  4YZ0 A;  1AIR A;  3DU1 X;  4YEI A;  1O8D A;  1EZG A;  3EQN A;  2BX6 A;  2UVF A;  1PLU A;  2X6Y A;  2B0R A;  2VFN A;  3N90 A;  4XLE A;  3SYJ A;  1LLZ A;  3LJY A;  3JUR A;  1K8F A;  4NK8 A;  3GRH A;  2NST A;  4W8T A;  1GQ8 A;  2BM7 A;  2VJJ A;  3JX8 A;  2ODL A;  1DBG A;  4YZQ A;  1CZF A;  3SY2 A;  1CLW A;  1BN8 A;  3VST A;  1O8E A;  2NT9 A;  3GQ7 A;  1K5C A;  4XON A;  2X6X A;  2VFP A;  1RWR A;  4XQF A;  1DAB A;  1DBO A;  4XKV A;  3B8Y A;  3AK5 A;  4OJ6 A;  1OGM X;  2J8I A;  1HF2 A;  2X6W A;  2XT2 A;  4NK6 A;  4AVZ A;  2X85 A;  4XOT A;  3EQO A;  2G0Y A;  3B4N A;  2UVE A;  1XG2 A;  4OPW A;  2XT4 A;  4OM9 A;  4XL9 A;  1IB4 A;  5JMC B;  1EE6 A;  2IQ7 A;  1QA2 A;  2QZA A;  4OJL A;  2INV A;  2BM5 A;  1X0C A;  2NSP A;  1QA1 A;  4YEL A;  2PYG A;  1TYV A;  4V02 C;  2BM4 A;  3GQ9 A;  2VFO A;  2NZM A;  1O8M A;  1PXZ A;  1JTA A;  4U4B A;  1VBL A;  4YEJ A;  1WXR A;  1KCD A;  4YC5 A;  3PET A;  1KTW A;  3NB2 A;  4XOP A;  1KQ5 A;  4XMY A;  3P4G A;  2BM6 A;  1TYW A;  2XC1 A;  1O8H A;  3FY3 A;  1RMG A;  1RU4 A;  2O0V A;  5DNS A;  4XOR A;  3VMW A;  2W7Z A;  4XLH A;  3LYC A;  2YUH A;  2VFM A;  1NHC A;  1IDJ A;  3SQV A;  2QYU A;  4MXN A;  2INU A;  2VBK A;  4Z03 A;  3WWG A;  1WMR A; 
#chains in the Genus database with same CATH homology
 4U49 A;  4EW9 A;  1JRG A;  1O8F A;  4URR A;  1O8G A;  1O88 A;  2PEC A;  3SUC A;  4OZY A;  2QX3 A;  4XR6 A;  3T9G A;  2O1D A;  4C2L A;  2NTB A;  3VMV A;  1OFL A;  4PMH A;  2NTQ A;  4OJP A;  4XLC A;  1OOC A;  2EWE A;  2NT6 A;  4XLF A;  2X3H A;  2VJI A;  2Z8G A;  3GQ8 A;  3ZPP A;  2NTP A;  4XN3 A;  2O04 A;  3KRG A;  4Z05 A;  1OGO X;  5AMV A;  5C1C A;  2VBE A;  1PE9 A;  3B90 A;  4W8R A;  1O8L A;  4OJO A;  1BHE A;  1O8I A;  2QY1 A;  3UW0 A;  4OJ5 A;  4XN0 A;  4Z06 A;  3ZSC A;  2VBM A;  4I84 A;  2O0W A;  2BSP A;  3VSV A;  4W8Q A;  4HWV A;  4XNF A;  3VSU A;  1KCC A;  4OZZ A;  2PYH A;  1IA5 A;  1QJV A;  1H80 A;  4W8S A;  3GQA A;  1IDK A;  4XKW A;  5C1E A;  3LMW A;  1HG8 A;  1QCX A;  4MR0 A;  1O8K A;  1O8J A;  2O17 A;  2QXZ A;  4YZA A;  4YZX A;  4XLA A;  1OFM A;  4XM3 A;  4YZ0 A;  1AIR A;  1O8D A;  3EQN A;  2UVF A;  1PLU A;  2X6Y A;  4XLE A;  3JUR A;  4NK8 A;  3GRH A;  2NST A;  4W8T A;  1GQ8 A;  2VJJ A;  2ODL A;  1DBG A;  4YZQ A;  1CZF A;  1BN8 A;  3VST A;  1O8E A;  2NT9 A;  3GQ7 A;  1K5C A;  4XON A;  2X6X A;  1RWR A;  4XQF A;  1DBO A;  4XKV A;  3B8Y A;  4OJ6 A;  1OGM X;  4NK6 A;  2X6W A;  4AVZ A;  2X85 A;  4XOT A;  3EQO A;  3B4N A;  2UVE A;  1XG2 A;  4XL9 A;  1IB4 A;  1EE6 A;  2IQ7 A;  4OJL A;  2INV A;  1X0C A;  2NSP A;  4YEL A;  2PYG A;  3GQ9 A;  2NZM A;  1O8M A;  1PXZ A;  1JTA A;  4U4B A;  1VBL A;  4YEJ A;  1KCD A;  1KTW A;  4XOP A;  4XMY A;  1O8H A;  3FY3 A;  1RMG A;  1RU4 A;  2O0V A;  4XOR A;  3VMW A;  4XLH A;  1NHC A;  1IDJ A;  4MXN A;  2INU A;  2VBK A;  4Z03 A;  3WWG A;  1WMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...