1O8KA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 20mm ca2+
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8kA00
2X6XA 2PYGA 2X3HA 4OZZA 1BHEA 2PYHA 4XORA 3T9GA 3GQ8A 1IB4A 1DBOA 1H80A 4XMYA 1O88A 4XM3A 1IDJA 2O04A 4AVZA 4XN0A 4XNFA 4U4BA 3LMWA 3UW0A 4W8QA 5C1EA 4XLCA 2QX3A 2NSTA 2O0WA 3FY3A 2BSPA 2NTQA 4PMHA 1O8KA 1KCDA 1VBLA 1O8LA 2NTBA 1QJVA 1RWRA 3JURA 1IDKA 4XONA 4NK8A 3KRGA 4XN3A 4OJLA 3B4NA 1PE9A 2NT6A 1PLUA 4XLFA 2UVFA 3WWGA 2X85A 2VBMA 4I84A 2INUA 4YEJA 1JTAA 2ODLA 2PECA 1X0CA 4W8SA 4YZXA 3VSVA 2IQ7A 1CZFA 1OGOX 3EQOA 4Z06A 1K5CA 1O8JA 2VJJA 2EWEA 4OJ5A 4C2LA 4XOPA 4YELA 4W8TA 4XL9A 1DBGA 2VBKA 1OGMX 1OFLA 3SUCA 1HG8A 2NTPA 4YZ0A 4MR0A 4XQFA 5AMVA 4U49A 3VMVA 2NSPA 1QCXA 1PXZA 2O0VA 1O8IA 2O17A 1OOCA 1O8DA 4YZAA 1O8EA 1AIRA 1BN8A 2QY1A 5C1CA 4EW9A 2NT9A 3EQNA 3VSTA 3GQAA 3VMWA 1O8HA 1O8MA 1XG2A 4OJOA 4XR6A 2O1DA 3B90A 1JRGA 2Z8GA 4HWVA 2X6WA 1O8GA 2X6YA 4XKWA 4OZYA 4Z03A 2NZMA 4W8RA 3GQ7A 2INVA 1KCCA 2UVEA 4XKVA 4XOTA 1WMRA 4URRA 3GQ9A 4YZQA 1IA5A 3VSUA 1RMGA 3GRHA 1NHCA 3B8YA 1OFMA 1O8FA 4NK6A 1RU4A 2VJIA 4OJPA 4OJ6A 1KTWA 4XLEA 3ZSCA 3ZPPA 4XLHA 4XLAA 1GQ8A 2VBEA 1EE6A 4Z05A 2QXZA 4MXNA
chains in the Genus database with same CATH superfamily
2X6XA 2PYGA 4V02C 2XTXA 2X3HA 3SY2A 5JMCB 4OZZA 1BHEA 3SQVA 3DU1X 2PYHA 4XORA 3T9GA 3GQ8A 3N90A 1IB4A 3LJYA 1DBOA 4OPWA 1H80A 4XMYA 5JLVC 1O88A 4XM3A 1WXRA 1IDJA 3LYCA 2O04A 4AVZA 1LLZA 2J8KA 2VFQA 4XN0A 5DNSA 2QZAA 4XNFA 4U4BA 2QYUA 3LMWA 3UW0A 3P4GA 4W8QA 5C1EA 4YC5A 2G0YA 2BM4A 4YEIA 1TYVA 1TSPA 4XLCA 2QX3A 2NSTA 2O0WA 3PSZA 2VFNA 3FY3A 3H09A 2BSPA 2NTQA 4PMHA 1O8KA 1KCDA 1VBLA 1O8LA 2NTBA 1DABA 3PETA 1QJVA 1QRCA 1RWRA 2BM6A 3JURA 4YFOA 1QA1A 1IDKA 4XONA 3TH0A 2IOUG 4NK8A 3KRGA 4XN3A 4OJLA 3B4NA 1QQ1A 4OM9A 1PE9A 2XTWA 2NT6A 1OFEA 2XT2A 1PLUA 4XLFA 2UVFA 3WWGA 2X85A 2VBMA 4I84A 2INUA 4YEJA 1JTAA 2ODLA 2PECA 1X0CA 2BM5A 4W8SA 4YZXA 1EZGA 2XC1A 3VSVA 1TYWA 1CZFA 2IQ7A 2YUHA 3RIQA 1OGOX 2W7ZA 3EQOA 4Z06A 2J8IA 1K5CA 1O8JA 2VJJA 2EWEA 4OJ5A 4C2LA 2O6WA 3SZEA 4XOPA 4YELA 2VFOA 4W8TA 4XL9A 1DBGA 2VBKA 1QA3A 1OGMX 1OFLA 3SUCA 1K4ZA 1QA2A 3SYJA 1HG8A 2NTPA 3N6ZA 4YZ0A 4MR0A 4XQFA 5AMVA 4U49A 1OFDA 3VMVA 2NSPA 1QCXA 2XT4A 1PXZA 2O0VA 1O8IA 2XTYA 1LLWA 2O17A 3BH6B 2VFMA 3NAWA 4YDTA 1OOCA 3AK5A 1O8DA 1KQ5A 4YZAA 1EA0A 1O8EA 1AIRA 1BN8A 2QY1A 3JX8A 5C1CA 4EW9A 4JRAC 2NT9A 1K8FA 3EQNA 2BM7A 3VSTA 3GQAA 1QRBA 3VMWA 1O8HA 1O8MA 1XG2A 4YCQA 4OJOA 4XR6A 2O1DA 3B90A 1JRGA 1LM1A 3NB2A 2Z8GA 4HWVA 2X6WA 1L1IA 1O8GA 2X6YA 1TYXA 4XKWA 4OZYA 4Z03A 2NZMA 4W8RA 3GQ7A 2INVA 2V5IA 1KCCA 2UVEA 4XKVA 4XOTA 2VFPA 1WMRA 4URRA 3GQ9A 4YZQA 1IA5A 3VSUA 1RMGA 3GRHA 3BH7B 1NHCA 2BX6A 2F3LA 3B8YA 1HF2A 1OFMA 3PSSA 1O8FA 4NK6A 4KH3A 1RU4A 1TYUA 1CLWA 2VJIA 4OJPA 4OJ6A 1KTWA 4XLEA 3ZSCA 3ZPPA 4XLHA 4XLAA 1GQ8A 2VBEA 3ML3A 1EE6A 4Z05A 2QXZA 4MXNA 2B0RA
chains in the Genus database with same CATH topology
2X6XA 2PYGA 2X3HA 4OZZA 1BHEA 2PYHA 4XORA 3T9GA 3GQ8A 1IB4A 1DBOA 1H80A 4XMYA 1O88A 4XM3A 1IDJA 2O04A 4AVZA 4XN0A 4XNFA 4U4BA 3LMWA 3UW0A 4W8QA 5C1EA 4XLCA 2QX3A 2NSTA 2O0WA 3FY3A 2BSPA 2NTQA 4PMHA 1O8KA 1KCDA 1VBLA 1O8LA 2NTBA 1QJVA 1RWRA 3JURA 1IDKA 4XONA 4NK8A 3KRGA 4XN3A 4OJLA 3B4NA 1PE9A 2NT6A 1PLUA 4XLFA 2UVFA 3WWGA 2X85A 2VBMA 4I84A 2INUA 4YEJA 1JTAA 2ODLA 2PECA 1X0CA 4W8SA 4YZXA 3VSVA 2IQ7A 1CZFA 1OGOX 3EQOA 4Z06A 1K5CA 1O8JA 2VJJA 2EWEA 4OJ5A 4C2LA 4XOPA 4YELA 4W8TA 4XL9A 1DBGA 2VBKA 1OGMX 1OFLA 3SUCA 1HG8A 2NTPA 4YZ0A 4MR0A 4XQFA 5AMVA 4U49A 3VMVA 2NSPA 1QCXA 1PXZA 2O0VA 1O8IA 2O17A 1OOCA 1O8DA 4YZAA 1O8EA 1AIRA 1BN8A 2QY1A 5C1CA 4EW9A 2NT9A 3EQNA 3VSTA 3GQAA 3VMWA 1O8HA 1O8MA 1XG2A 4OJOA 4XR6A 2O1DA 3B90A 1JRGA 2Z8GA 4HWVA 2X6WA 1O8GA 2X6YA 4XKWA 4OZYA 4Z03A 2NZMA 4W8RA 3GQ7A 2INVA 1KCCA 2UVEA 4XKVA 4XOTA 1WMRA 4URRA 3GQ9A 4YZQA 1IA5A 3VSUA 1RMGA 3GRHA 1NHCA 3B8YA 1OFMA 1O8FA 4NK6A 1RU4A 2VJIA 4OJPA 4OJ6A 1KTWA 4XLEA 3ZSCA 3ZPPA 4XLHA 4XLAA 1GQ8A 2VBEA 1EE6A 4Z05A 2QXZA 4MXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6X A;  2PYG A;  2X3H A;  4OZZ A;  1BHE A;  2PYH A;  4XOR A;  3T9G A;  3GQ8 A;  1IB4 A;  1DBO A;  1H80 A;  4XMY A;  1O88 A;  4XM3 A;  1IDJ A;  2O04 A;  4AVZ A;  4XN0 A;  4XNF A;  4U4B A;  3LMW A;  3UW0 A;  4W8Q A;  5C1E A;  4XLC A;  2QX3 A;  2NST A;  2O0W A;  3FY3 A;  2BSP A;  2NTQ A;  4PMH A;  1O8K A;  1KCD A;  1VBL A;  1O8L A;  2NTB A;  1QJV A;  1RWR A;  3JUR A;  1IDK A;  4XON A;  4NK8 A;  3KRG A;  4XN3 A;  4OJL A;  3B4N A;  1PE9 A;  2NT6 A;  1PLU A;  4XLF A;  2UVF A;  3WWG A;  2X85 A;  2VBM A;  4I84 A;  2INU A;  4YEJ A;  1JTA A;  2ODL A;  2PEC A;  1X0C A;  4W8S A;  4YZX A;  3VSV A;  2IQ7 A;  1CZF A;  1OGO X;  3EQO A;  4Z06 A;  1K5C A;  1O8J A;  2VJJ A;  2EWE A;  4OJ5 A;  4C2L A;  4XOP A;  4YEL A;  4W8T A;  4XL9 A;  1DBG A;  2VBK A;  1OGM X;  1OFL A;  3SUC A;  1HG8 A;  2NTP A;  4YZ0 A;  4MR0 A;  4XQF A;  5AMV A;  4U49 A;  3VMV A;  2NSP A;  1QCX A;  1PXZ A;  2O0V A;  1O8I A;  2O17 A;  1OOC A;  1O8D A;  4YZA A;  1O8E A;  1AIR A;  1BN8 A;  2QY1 A;  5C1C A;  4EW9 A;  2NT9 A;  3EQN A;  3VST A;  3GQA A;  3VMW A;  1O8H A;  1O8M A;  1XG2 A;  4OJO A;  4XR6 A;  2O1D A;  3B90 A;  1JRG A;  2Z8G A;  4HWV A;  2X6W A;  1O8G A;  2X6Y A;  4XKW A;  4OZY A;  4Z03 A;  2NZM A;  4W8R A;  3GQ7 A;  2INV A;  1KCC A;  2UVE A;  4XKV A;  4XOT A;  1WMR A;  4URR A;  3GQ9 A;  4YZQ A;  1IA5 A;  3VSU A;  1RMG A;  3GRH A;  1NHC A;  3B8Y A;  1OFM A;  1O8F A;  4NK6 A;  1RU4 A;  2VJI A;  4OJP A;  4OJ6 A;  1KTW A;  4XLE A;  3ZSC A;  3ZPP A;  4XLH A;  4XLA A;  1GQ8 A;  2VBE A;  1EE6 A;  4Z05 A;  2QXZ A;  4MXN A; 
#chains in the Genus database with same CATH topology
 2X6X A;  2PYG A;  4V02 C;  2XTX A;  2X3H A;  3SY2 A;  5JMC B;  4OZZ A;  1BHE A;  3SQV A;  3DU1 X;  2PYH A;  4XOR A;  3T9G A;  3GQ8 A;  3N90 A;  1IB4 A;  3LJY A;  1DBO A;  4OPW A;  1H80 A;  4XMY A;  5JLV C;  1O88 A;  4XM3 A;  1WXR A;  1IDJ A;  3LYC A;  2O04 A;  4AVZ A;  1LLZ A;  2J8K A;  2VFQ A;  4XN0 A;  5DNS A;  2QZA A;  4XNF A;  4U4B A;  2QYU A;  3LMW A;  3UW0 A;  3P4G A;  4W8Q A;  5C1E A;  4YC5 A;  2G0Y A;  2BM4 A;  4YEI A;  1TYV A;  1TSP A;  4XLC A;  2QX3 A;  2NST A;  2O0W A;  3PSZ A;  2VFN A;  3FY3 A;  3H09 A;  2BSP A;  2NTQ A;  4PMH A;  1O8K A;  1KCD A;  1VBL A;  1O8L A;  2NTB A;  1DAB A;  3PET A;  1QJV A;  1QRC A;  1RWR A;  2BM6 A;  3JUR A;  4YFO A;  1QA1 A;  1IDK A;  4XON A;  3TH0 A;  2IOU G;  4NK8 A;  3KRG A;  4XN3 A;  4OJL A;  3B4N A;  1QQ1 A;  4OM9 A;  1PE9 A;  2XTW A;  2NT6 A;  1OFE A;  2XT2 A;  1PLU A;  4XLF A;  2UVF A;  3WWG A;  2X85 A;  2VBM A;  4I84 A;  2INU A;  4YEJ A;  1JTA A;  2ODL A;  2PEC A;  1X0C A;  2BM5 A;  4W8S A;  4YZX A;  1EZG A;  2XC1 A;  3VSV A;  1TYW A;  1CZF A;  2IQ7 A;  2YUH A;  3RIQ A;  1OGO X;  2W7Z A;  3EQO A;  4Z06 A;  2J8I A;  1K5C A;  1O8J A;  2VJJ A;  2EWE A;  4OJ5 A;  4C2L A;  2O6W A;  3SZE A;  4XOP A;  4YEL A;  2VFO A;  4W8T A;  4XL9 A;  1DBG A;  2VBK A;  1QA3 A;  1OGM X;  1OFL A;  3SUC A;  1K4Z A;  1QA2 A;  3SYJ A;  1HG8 A;  2NTP A;  3N6Z A;  4YZ0 A;  4MR0 A;  4XQF A;  5AMV A;  4U49 A;  1OFD A;  3VMV A;  2NSP A;  1QCX A;  2XT4 A;  1PXZ A;  2O0V A;  1O8I A;  2XTY A;  1LLW A;  2O17 A;  3BH6 B;  2VFM A;  3NAW A;  4YDT A;  1OOC A;  3AK5 A;  1O8D A;  1KQ5 A;  4YZA A;  1EA0 A;  1O8E A;  1AIR A;  1BN8 A;  2QY1 A;  3JX8 A;  5C1C A;  4EW9 A;  4JRA C;  2NT9 A;  1K8F A;  3EQN A;  2BM7 A;  3VST A;  3GQA A;  1QRB A;  3VMW A;  1O8H A;  1O8M A;  1XG2 A;  4YCQ A;  4OJO A;  4XR6 A;  2O1D A;  3B90 A;  1JRG A;  1LM1 A;  3NB2 A;  2Z8G A;  4HWV A;  2X6W A;  1L1I A;  1O8G A;  2X6Y A;  1TYX A;  4XKW A;  4OZY A;  4Z03 A;  2NZM A;  4W8R A;  3GQ7 A;  2INV A;  2V5I A;  1KCC A;  2UVE A;  4XKV A;  4XOT A;  2VFP A;  1WMR A;  4URR A;  3GQ9 A;  4YZQ A;  1IA5 A;  3VSU A;  1RMG A;  3GRH A;  3BH7 B;  1NHC A;  2BX6 A;  2F3L A;  3B8Y A;  1HF2 A;  1OFM A;  3PSS A;  1O8F A;  4NK6 A;  4KH3 A;  1RU4 A;  1TYU A;  1CLW A;  2VJI A;  4OJP A;  4OJ6 A;  1KTW A;  4XLE A;  3ZSC A;  3ZPP A;  4XLH A;  4XLA A;  1GQ8 A;  2VBE A;  3ML3 A;  1EE6 A;  4Z05 A;  2QXZ A;  4MXN A;  2B0R A; 
#chains in the Genus database with same CATH homology
 2X6X A;  2PYG A;  2X3H A;  4OZZ A;  1BHE A;  2PYH A;  4XOR A;  3T9G A;  3GQ8 A;  1IB4 A;  1DBO A;  1H80 A;  4XMY A;  1O88 A;  4XM3 A;  1IDJ A;  2O04 A;  4AVZ A;  4XN0 A;  4XNF A;  4U4B A;  3LMW A;  3UW0 A;  4W8Q A;  5C1E A;  4XLC A;  2QX3 A;  2NST A;  2O0W A;  3FY3 A;  2BSP A;  2NTQ A;  4PMH A;  1O8K A;  1KCD A;  1VBL A;  1O8L A;  2NTB A;  1QJV A;  1RWR A;  3JUR A;  1IDK A;  4XON A;  4NK8 A;  3KRG A;  4XN3 A;  4OJL A;  3B4N A;  1PE9 A;  2NT6 A;  1PLU A;  4XLF A;  2UVF A;  3WWG A;  2X85 A;  2VBM A;  4I84 A;  2INU A;  4YEJ A;  1JTA A;  2ODL A;  2PEC A;  1X0C A;  4W8S A;  4YZX A;  3VSV A;  2IQ7 A;  1CZF A;  1OGO X;  3EQO A;  4Z06 A;  1K5C A;  1O8J A;  2VJJ A;  2EWE A;  4OJ5 A;  4C2L A;  4XOP A;  4YEL A;  4W8T A;  4XL9 A;  1DBG A;  2VBK A;  1OGM X;  1OFL A;  3SUC A;  1HG8 A;  2NTP A;  4YZ0 A;  4MR0 A;  4XQF A;  5AMV A;  4U49 A;  3VMV A;  2NSP A;  1QCX A;  1PXZ A;  2O0V A;  1O8I A;  2O17 A;  1OOC A;  1O8D A;  4YZA A;  1O8E A;  1AIR A;  1BN8 A;  2QY1 A;  5C1C A;  4EW9 A;  2NT9 A;  3EQN A;  3VST A;  3GQA A;  3VMW A;  1O8H A;  1O8M A;  1XG2 A;  4OJO A;  4XR6 A;  2O1D A;  3B90 A;  1JRG A;  2Z8G A;  4HWV A;  2X6W A;  1O8G A;  2X6Y A;  4XKW A;  4OZY A;  4Z03 A;  2NZM A;  4W8R A;  3GQ7 A;  2INV A;  1KCC A;  2UVE A;  4XKV A;  4XOT A;  1WMR A;  4URR A;  3GQ9 A;  4YZQ A;  1IA5 A;  3VSU A;  1RMG A;  3GRH A;  1NHC A;  3B8Y A;  1OFM A;  1O8F A;  4NK6 A;  1RU4 A;  2VJI A;  4OJP A;  4OJ6 A;  1KTW A;  4XLE A;  3ZSC A;  3ZPP A;  4XLH A;  4XLA A;  1GQ8 A;  2VBE A;  1EE6 A;  4Z05 A;  2QXZ A;  4MXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...