1O8KA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with 20mm ca2+
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
molecule tags Hydrolase
source organism Erwinia chrysanthemi
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8kA00
4U4BA 4XLFA 4XL9A 1OFLA 2INUA 1O8GA 1O8KA 3LMWA 4XOTA 1NHCA 1BHEA 3ZSCA 4XKVA 4YZXA 3GRHA 1CZFA 2X6WA 1HG8A 4OZYA 5C1EA 4XLEA 3B8YA 2O17A 1OGMX 2Z8GA 2UVFA 4YEJA 5C1CA 2X85A 1KCDA 1X0CA 1PE9A 2EWEA 2PYGA 4XONA 1O8FA 1DBGA 2VBMA 1O8DA 2O0WA 1JRGA 3VSUA 1O8IA 1RMGA 1O8LA 1RU4A 1PLUA 4YZQA 3T9GA 1O8MA 1DBOA 3FY3A 2X6XA 4MXNA 4AVZA 1AIRA 3KRGA 1IDJA 4OJOA 1QJVA 4W8SA 2BSPA 4YZ0A 1OOCA 5AMVA 4W8QA 4W8TA 1IB4A 4XLCA 4OJ5A 1XG2A 1H80A 2NSTA 2O1DA 2QY1A 4OJPA 1K5CA 2NTBA 3GQ7A 1OFMA 1WMRA 4XR6A 3B90A 2O0VA 1JTAA 1EE6A 4Z03A 3VMWA 4W8RA 3VSVA 4XN0A 4YELA 2ODLA 4XN3A 2NSPA 3UW0A 4XKWA 1KTWA 2O04A 1PXZA 1QCXA 2PYHA 1KCCA 4URRA 4XMYA 2VJIA 3WWGA 4OJ6A 4OJLA 4XLHA 4Z05A 1OGOX 4NK6A 3GQ8A 2NT6A 3GQAA 2QXZA 1O8JA 2UVEA 4YZAA 2IQ7A 2NTPA 2NZMA 4HWVA 2VBEA 4XLAA 4XM3A 4U49A 3VSTA 3ZPPA 4XQFA 2NTQA 2VJJA 3GQ9A 4I84A 3JURA 3SUCA 3VMVA 2NT9A 3EQOA 3EQNA 4XOPA 1GQ8A 2QX3A 2INVA 4NK8A 2X6YA 4Z06A 1VBLA 1RWRA 4XORA 4EW9A 1O8HA 4C2LA 4PMHA 1IA5A 4OZZA 2PECA 1IDKA 1O88A 2VBKA 1O8EA 4MR0A 4XNFA 3B4NA 1BN8A 2X3HA
chains in the Genus database with same CATH superfamily
4U4BA 4XLFA 2VFPA 4XL9A 1OFLA 2XTWA 3P4GA 2QYUA 2INUA 1O8GA 1O8KA 3LMWA 4YFOA 1WXRA 4XOTA 1NHCA 3JX8A 3H09A 1BHEA 3ZSCA 4KH3A 4XKVA 3GRHA 1CZFA 4YZXA 1OFDA 2X6WA 1HG8A 3PETA 4OZYA 5C1EA 4XLEA 2VFMA 3B8YA 2O17A 3BH7B 2VFQA 3PSSA 1OGMX 3TH0A 2G0YA 1HF2A 2XC1A 2Z8GA 2UVFA 4YEJA 5C1CA 2X85A 3SY2A 1KCDA 2V5IA 1X0CA 1PE9A 2EWEA 4V02C 2XT4A 2PYGA 1DABA 4XONA 1O8FA 1DBGA 2VBMA 1O8DA 1JRGA 2O0WA 3VSUA 4OPWA 1O8IA 3NAWA 1RMGA 1O8LA 1RU4A 1PLUA 3NB2A 1QA1A 4YZQA 3SZEA 3PSZA 2O6WA 3T9GA 1O8MA 3RIQA 1QRBA 1DBOA 3FY3A 4YEIA 1TYUA 2X6XA 4MXNA 1AIRA 1EZGA 3KRGA 5DNSA 4AVZA 1IDJA 4OJOA 1QJVA 4W8SA 2BSPA 4YZ0A 1OOCA 5AMVA 4W8QA 4W8TA 1IB4A 2BM7A 4XLCA 4OJ5A 1XG2A 1H80A 2NSTA 2O1DA 1K8FA 2QY1A 4OJPA 1K5CA 4YC5A 2NTBA 3GQ7A 5JLVC 1OFMA 3SQVA 1WMRA 4XR6A 3B90A 2O0VA 1JTAA 1EE6A 1TYVA 2BX6A 4Z03A 2XT2A 3VMWA 4W8RA 3VSVA 4OM9A 3DU1X 4XN0A 4YELA 2VFOA 2XTXA 2ODLA 4XN3A 2NSPA 3UW0A 4XKWA 1KTWA 2O04A 1PXZA 1QCXA 3N6ZA 2PYHA 2BM4A 4URRA 1KCCA 1KQ5A 2F3LA 2VJIA 4XMYA 2XTYA 4OJ6A 1LLWA 3WWGA 4OJLA 4XLHA 4Z05A 1OGOX 3ML3A 4YCQA 4NK6A 3GQ8A 2NT6A 3GQAA 2QXZA 1O8JA 2UVEA 2IOUG 1CLWA 4YZAA 1QA3A 2IQ7A 2YUHA 4YDTA 2NTPA 2W7ZA 1TSPA 2NZMA 2VFNA 3BH6B 4HWVA 2VBEA 3SYJA 4XLAA 4XM3A 4U49A 3VSTA 1QA2A 3ZPPA 1QQ1A 4XQFA 2NTQA 2VJJA 3GQ9A 3AK5A 4I84A 2J8KA 3JURA 3SUCA 3VMVA 2NT9A 3EQOA 1OFEA 1K4ZA 3EQNA 4XOPA 1EA0A 1GQ8A 2QX3A 2INVA 4NK8A 2X6YA 1TYXA 4Z06A 1VBLA 1RWRA 4XORA 2QZAA 4EW9A 1O8HA 4C2LA 4PMHA 1IA5A 2BM5A 3LJYA 3N90A 1QRCA 4OZZA 1LLZA 2PECA 1IDKA 2B0RA 1O88A 2J8IA 2VBKA 5JMCB 1TYWA 2BM6A 1O8EA 4MR0A 4XNFA 3B4NA 4JRAC 3LYCA 1BN8A 1L1IA 2X3HA 1LM1A
chains in the Genus database with same CATH topology
4U4BA 4XLFA 4XL9A 1OFLA 2INUA 1O8GA 1O8KA 3LMWA 4XOTA 1NHCA 1BHEA 3ZSCA 4XKVA 4YZXA 3GRHA 1CZFA 2X6WA 1HG8A 4OZYA 5C1EA 4XLEA 3B8YA 2O17A 1OGMX 2Z8GA 2UVFA 4YEJA 5C1CA 2X85A 1KCDA 1X0CA 1PE9A 2EWEA 2PYGA 4XONA 1O8FA 1DBGA 2VBMA 1O8DA 2O0WA 1JRGA 3VSUA 1O8IA 1RMGA 1O8LA 1RU4A 1PLUA 4YZQA 3T9GA 1O8MA 1DBOA 3FY3A 2X6XA 4MXNA 4AVZA 1AIRA 3KRGA 1IDJA 4OJOA 1QJVA 4W8SA 2BSPA 4YZ0A 1OOCA 5AMVA 4W8QA 4W8TA 1IB4A 4XLCA 4OJ5A 1XG2A 1H80A 2NSTA 2O1DA 2QY1A 4OJPA 1K5CA 2NTBA 3GQ7A 1OFMA 1WMRA 4XR6A 3B90A 2O0VA 1JTAA 1EE6A 4Z03A 3VMWA 4W8RA 3VSVA 4XN0A 4YELA 2ODLA 4XN3A 2NSPA 3UW0A 4XKWA 1KTWA 2O04A 1PXZA 1QCXA 2PYHA 1KCCA 4URRA 4XMYA 2VJIA 3WWGA 4OJ6A 4OJLA 4XLHA 4Z05A 1OGOX 4NK6A 3GQ8A 2NT6A 3GQAA 2QXZA 1O8JA 2UVEA 4YZAA 2IQ7A 2NTPA 2NZMA 4HWVA 2VBEA 4XLAA 4XM3A 4U49A 3VSTA 3ZPPA 4XQFA 2NTQA 2VJJA 3GQ9A 4I84A 3JURA 3SUCA 3VMVA 2NT9A 3EQOA 3EQNA 4XOPA 1GQ8A 2QX3A 2INVA 4NK8A 2X6YA 4Z06A 1VBLA 1RWRA 4XORA 4EW9A 1O8HA 4C2LA 4PMHA 1IA5A 4OZZA 2PECA 1IDKA 1O88A 2VBKA 1O8EA 4MR0A 4XNFA 3B4NA 1BN8A 2X3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U4B A;  4XLF A;  4XL9 A;  1OFL A;  2INU A;  1O8G A;  1O8K A;  3LMW A;  4XOT A;  1NHC A;  1BHE A;  3ZSC A;  4XKV A;  4YZX A;  3GRH A;  1CZF A;  2X6W A;  1HG8 A;  4OZY A;  5C1E A;  4XLE A;  3B8Y A;  2O17 A;  1OGM X;  2Z8G A;  2UVF A;  4YEJ A;  5C1C A;  2X85 A;  1KCD A;  1X0C A;  1PE9 A;  2EWE A;  2PYG A;  4XON A;  1O8F A;  1DBG A;  2VBM A;  1O8D A;  2O0W A;  1JRG A;  3VSU A;  1O8I A;  1RMG A;  1O8L A;  1RU4 A;  1PLU A;  4YZQ A;  3T9G A;  1O8M A;  1DBO A;  3FY3 A;  2X6X A;  4MXN A;  4AVZ A;  1AIR A;  3KRG A;  1IDJ A;  4OJO A;  1QJV A;  4W8S A;  2BSP A;  4YZ0 A;  1OOC A;  5AMV A;  4W8Q A;  4W8T A;  1IB4 A;  4XLC A;  4OJ5 A;  1XG2 A;  1H80 A;  2NST A;  2O1D A;  2QY1 A;  4OJP A;  1K5C A;  2NTB A;  3GQ7 A;  1OFM A;  1WMR A;  4XR6 A;  3B90 A;  2O0V A;  1JTA A;  1EE6 A;  4Z03 A;  3VMW A;  4W8R A;  3VSV A;  4XN0 A;  4YEL A;  2ODL A;  4XN3 A;  2NSP A;  3UW0 A;  4XKW A;  1KTW A;  2O04 A;  1PXZ A;  1QCX A;  2PYH A;  1KCC A;  4URR A;  4XMY A;  2VJI A;  3WWG A;  4OJ6 A;  4OJL A;  4XLH A;  4Z05 A;  1OGO X;  4NK6 A;  3GQ8 A;  2NT6 A;  3GQA A;  2QXZ A;  1O8J A;  2UVE A;  4YZA A;  2IQ7 A;  2NTP A;  2NZM A;  4HWV A;  2VBE A;  4XLA A;  4XM3 A;  4U49 A;  3VST A;  3ZPP A;  4XQF A;  2NTQ A;  2VJJ A;  3GQ9 A;  4I84 A;  3JUR A;  3SUC A;  3VMV A;  2NT9 A;  3EQO A;  3EQN A;  4XOP A;  1GQ8 A;  2QX3 A;  2INV A;  4NK8 A;  2X6Y A;  4Z06 A;  1VBL A;  1RWR A;  4XOR A;  4EW9 A;  1O8H A;  4C2L A;  4PMH A;  1IA5 A;  4OZZ A;  2PEC A;  1IDK A;  1O88 A;  2VBK A;  1O8E A;  4MR0 A;  4XNF A;  3B4N A;  1BN8 A;  2X3H A; 
#chains in the Genus database with same CATH topology
 4U4B A;  4XLF A;  2VFP A;  4XL9 A;  1OFL A;  2XTW A;  3P4G A;  2QYU A;  2INU A;  1O8G A;  1O8K A;  3LMW A;  4YFO A;  1WXR A;  4XOT A;  1NHC A;  3JX8 A;  3H09 A;  1BHE A;  3ZSC A;  4KH3 A;  4XKV A;  3GRH A;  1CZF A;  4YZX A;  1OFD A;  2X6W A;  1HG8 A;  3PET A;  4OZY A;  5C1E A;  4XLE A;  2VFM A;  3B8Y A;  2O17 A;  3BH7 B;  2VFQ A;  3PSS A;  1OGM X;  3TH0 A;  2G0Y A;  1HF2 A;  2XC1 A;  2Z8G A;  2UVF A;  4YEJ A;  5C1C A;  2X85 A;  3SY2 A;  1KCD A;  2V5I A;  1X0C A;  1PE9 A;  2EWE A;  4V02 C;  2XT4 A;  2PYG A;  1DAB A;  4XON A;  1O8F A;  1DBG A;  2VBM A;  1O8D A;  1JRG A;  2O0W A;  3VSU A;  4OPW A;  1O8I A;  3NAW A;  1RMG A;  1O8L A;  1RU4 A;  1PLU A;  3NB2 A;  1QA1 A;  4YZQ A;  3SZE A;  3PSZ A;  2O6W A;  3T9G A;  1O8M A;  3RIQ A;  1QRB A;  1DBO A;  3FY3 A;  4YEI A;  1TYU A;  2X6X A;  4MXN A;  1AIR A;  1EZG A;  3KRG A;  5DNS A;  4AVZ A;  1IDJ A;  4OJO A;  1QJV A;  4W8S A;  2BSP A;  4YZ0 A;  1OOC A;  5AMV A;  4W8Q A;  4W8T A;  1IB4 A;  2BM7 A;  4XLC A;  4OJ5 A;  1XG2 A;  1H80 A;  2NST A;  2O1D A;  1K8F A;  2QY1 A;  4OJP A;  1K5C A;  4YC5 A;  2NTB A;  3GQ7 A;  5JLV C;  1OFM A;  3SQV A;  1WMR A;  4XR6 A;  3B90 A;  2O0V A;  1JTA A;  1EE6 A;  1TYV A;  2BX6 A;  4Z03 A;  2XT2 A;  3VMW A;  4W8R A;  3VSV A;  4OM9 A;  3DU1 X;  4XN0 A;  4YEL A;  2VFO A;  2XTX A;  2ODL A;  4XN3 A;  2NSP A;  3UW0 A;  4XKW A;  1KTW A;  2O04 A;  1PXZ A;  1QCX A;  3N6Z A;  2PYH A;  2BM4 A;  4URR A;  1KCC A;  1KQ5 A;  2F3L A;  2VJI A;  4XMY A;  2XTY A;  4OJ6 A;  1LLW A;  3WWG A;  4OJL A;  4XLH A;  4Z05 A;  1OGO X;  3ML3 A;  4YCQ A;  4NK6 A;  3GQ8 A;  2NT6 A;  3GQA A;  2QXZ A;  1O8J A;  2UVE A;  2IOU G;  1CLW A;  4YZA A;  1QA3 A;  2IQ7 A;  2YUH A;  4YDT A;  2NTP A;  2W7Z A;  1TSP A;  2NZM A;  2VFN A;  3BH6 B;  4HWV A;  2VBE A;  3SYJ A;  4XLA A;  4XM3 A;  4U49 A;  3VST A;  1QA2 A;  3ZPP A;  1QQ1 A;  4XQF A;  2NTQ A;  2VJJ A;  3GQ9 A;  3AK5 A;  4I84 A;  2J8K A;  3JUR A;  3SUC A;  3VMV A;  2NT9 A;  3EQO A;  1OFE A;  1K4Z A;  3EQN A;  4XOP A;  1EA0 A;  1GQ8 A;  2QX3 A;  2INV A;  4NK8 A;  2X6Y A;  1TYX A;  4Z06 A;  1VBL A;  1RWR A;  4XOR A;  2QZA A;  4EW9 A;  1O8H A;  4C2L A;  4PMH A;  1IA5 A;  2BM5 A;  3LJY A;  3N90 A;  1QRC A;  4OZZ A;  1LLZ A;  2PEC A;  1IDK A;  2B0R A;  1O88 A;  2J8I A;  2VBK A;  5JMC B;  1TYW A;  2BM6 A;  1O8E A;  4MR0 A;  4XNF A;  3B4N A;  4JRA C;  3LYC A;  1BN8 A;  1L1I A;  2X3H A;  1LM1 A; 
#chains in the Genus database with same CATH homology
 4U4B A;  4XLF A;  4XL9 A;  1OFL A;  2INU A;  1O8G A;  1O8K A;  3LMW A;  4XOT A;  1NHC A;  1BHE A;  3ZSC A;  4XKV A;  4YZX A;  3GRH A;  1CZF A;  2X6W A;  1HG8 A;  4OZY A;  5C1E A;  4XLE A;  3B8Y A;  2O17 A;  1OGM X;  2Z8G A;  2UVF A;  4YEJ A;  5C1C A;  2X85 A;  1KCD A;  1X0C A;  1PE9 A;  2EWE A;  2PYG A;  4XON A;  1O8F A;  1DBG A;  2VBM A;  1O8D A;  2O0W A;  1JRG A;  3VSU A;  1O8I A;  1RMG A;  1O8L A;  1RU4 A;  1PLU A;  4YZQ A;  3T9G A;  1O8M A;  1DBO A;  3FY3 A;  2X6X A;  4MXN A;  4AVZ A;  1AIR A;  3KRG A;  1IDJ A;  4OJO A;  1QJV A;  4W8S A;  2BSP A;  4YZ0 A;  1OOC A;  5AMV A;  4W8Q A;  4W8T A;  1IB4 A;  4XLC A;  4OJ5 A;  1XG2 A;  1H80 A;  2NST A;  2O1D A;  2QY1 A;  4OJP A;  1K5C A;  2NTB A;  3GQ7 A;  1OFM A;  1WMR A;  4XR6 A;  3B90 A;  2O0V A;  1JTA A;  1EE6 A;  4Z03 A;  3VMW A;  4W8R A;  3VSV A;  4XN0 A;  4YEL A;  2ODL A;  4XN3 A;  2NSP A;  3UW0 A;  4XKW A;  1KTW A;  2O04 A;  1PXZ A;  1QCX A;  2PYH A;  1KCC A;  4URR A;  4XMY A;  2VJI A;  3WWG A;  4OJ6 A;  4OJL A;  4XLH A;  4Z05 A;  1OGO X;  4NK6 A;  3GQ8 A;  2NT6 A;  3GQA A;  2QXZ A;  1O8J A;  2UVE A;  4YZA A;  2IQ7 A;  2NTP A;  2NZM A;  4HWV A;  2VBE A;  4XLA A;  4XM3 A;  4U49 A;  3VST A;  3ZPP A;  4XQF A;  2NTQ A;  2VJJ A;  3GQ9 A;  4I84 A;  3JUR A;  3SUC A;  3VMV A;  2NT9 A;  3EQO A;  3EQN A;  4XOP A;  1GQ8 A;  2QX3 A;  2INV A;  4NK8 A;  2X6Y A;  4Z06 A;  1VBL A;  1RWR A;  4XOR A;  4EW9 A;  1O8H A;  4C2L A;  4PMH A;  1IA5 A;  4OZZ A;  2PEC A;  1IDK A;  1O88 A;  2VBK A;  1O8E A;  4MR0 A;  4XNF A;  3B4N A;  1BN8 A;  2X3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...