1O8WA

Radiation-reduced tryparedoxin-i
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
GLDKYLPGIEKLRRGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFCTWDEEEDGFAGYFAKMPWLAVPFAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQFPWKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
source organism Crithidia fasciculata
molecule tags Oxidoreductase
total genus 41
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o8wA00
1U3IA 4HOJA 2K8VA 4V2MA 2H74A 2OE1A 3GMFA 2F8AA 1UA5A 4N10A 5DDLA 4WETA 3MNGA 4JEDA 4LL1B 3VI5A 3CSJA 1KEBA 1S3DA 5IO2A 1MDJA 2HZEA 4G9HA 1XZOA 1H75A 3BCIA 1TXXA 2IFQB 3PGTA 1WE0A 1OYJA 4TRXA 4KDUA 1A8YA 3ZTLA 1ST9A 2IFQA 4CW9A 1TW9A 4K2DA 2H0IA 3KIJA 3ERWA 1YQ1A 3LG6A 3F0IA 4F82A 3VWWA 3LFLA 1XOBA 1BAYA 2G2QA 4K7NA 5ECRB 1A24A 2PGTA 2I81A 4GSNA 5CREA 1LJRA 4I8BA 1WRYA 2C0DA 1EOGA 4EXJA 2DJ2A 2TIRA 2WFCA 1MDKA 1M99A 1ZMAA 4KSOA 3NZNA 1K0AA 1O6JA 2C3NA 2AUVA 2GVPA 2H6YA 4PX1A 1O8XA 3DVXA 4MPFA 4LLRA 4HQZA 4ZBAA 1AC1A 5HFIA 2C1YA 1X5CA 1GL8A 3H4KA 5J3RA 5DALA 3EVIA 3SWLA 4XS4A 4AGSA 4CDOA 2VCXA 1FO5A 4BL7A 3KH7A 2DJ0A 1GULA 2XHFA 1ZOFA 3CSIA 5AIVA 2VLVA 4RUVA 4NMUA 1EEMA 4MF6A 3EYTA 1QXHA 4GCIA 1WP0A 1T4ZA 4ACSA 3ERGA 1URMA 1WOUA 3UBLA 6GSYA 2PN8A 2ON5A 2HYXA 2OE3A 1HNCA 1O85A 4KB3A 1DBYA 5D9TA 1YEXA 3TKSC 3M0FA 5G31A 4J57E 4ECJA 5ECPB 3R2QA 1NHOA 2NTOA 3TJJA 5KN0A 3N5OA 4L0WA 3GX0A 3LXZA 1PKWA 3ZFBA 5F06A 5B6NA 4OD7A 1SJZA 3MSZA 5KN3A 2RUEA 5HR3A 8GSSA 4EO3A 4FIWA 2YZUA 1FHEA 4NXIA 1GLPA 3VPTA 5A4VA 4K0NA 1OAZA 2H70A 5IMAA 5GSSA 2AV4A 5D9VA 3LXTA 4GTUA 4D73B 2JACA 1K0CA 1FB0A 5COHA 1XWBA 2OA7A 2ZCTA 4GXZA 4ZB9A 5CAXA 4MLYA 3HZ4A 5ENUA 3GSTA 1EEJA 2QC7A 4XIHA 4KDXA 5IMVA 1Y6EA 2L4CA 3HCZA 3L4NA 4IN0A 2BJXA 1ZCPA 5F07A 4ULXA 4AJ7A 4FYBA 2GDRA 2R3XA 4RI6A 1GSSA 1TRUA 1LU4A 2VL3A 5D96A 2P31A 4TR1B 2YJ7A 5B8AA 2FWFA 5ECHB 2XBQA 2VCVA 2L59A 3D5JA 3GV1A 5E4WA 2LQQA 4I97A 2B3SA 3IOSA 4MPGA 3G7JA 4TR1A 3S9FA 2AJQB 3Q19A 4RQRA 2YCDA 1ZYEA 1SD8A 4I2UA 3MWHA 3IC4A 3P8WA 4EKZA 3A2VA 1TKDB 4MJCA 3IR4A 1EV4A 2L4QA 2GSTA 4K8MA 1ERWA 3TB2A 4V1Ag 2FD3A 1E2YA 5F0GA 3IPZA 3HJPA 1X5DA 3O76A 4V1Ap 1J08A 2JZSA 5H5QA 1T7PB 3M8NA 3HVXA 1VGLA 3KMOA 3IAM2 5ID2B 3H8QA 3KP8A 1Y25A 3DWVA 3KEBA 3VFIA 3EURA 1TU7A 1OC9A 4N11A 2DMMA 3C1RA 2YWNA 3H93A 1A2JA 5JCWA 5ID2A 3M1GA 2KLXA 4KCAA 2H66A 3BOAA 1B8XA 1J9BA 1YKCA 2MMNA 4MJBA 1SENA 4I2TA 4WBRD 5HR0A 3QFBC 3WGXA 4WKWA 2XPDA 2YJHA 1SJ6A 3F4RA 1M2DA 2NVLA 3KMNA 5JWOB 2LNTA 2FGXA 1I9DA 4V2LA 3QPMA 2C0EA 1EGOA 2QGVA 4KGIA 1PQNA 3L0HA 2R2JA 2AHEA 2KOKA 5J9CA 2DSAA 2DJJA 2KP1A 4GQFA 2D2ZA 4EDZA 3N9JA 1Q4JA 2GQKA 2HLSA 1G7OA 2A2RA 4HZ2A 1SU9A 4CHSA 3IRAA 2HE3A 3ZYWA 3HA9A 1PX7A 4F0CA 2VM2A 2C0FA 5GAND 1EGRA 1K0MA 3FEUA 3TOUA 3DVWA 4KDYA 2O87A 2H1BA 1R4WA 1V9WA 5KEJA 2VOCA 2YV9A 3FHKA 3GYKA 3UVHA 4ZL7A 1A23A 1B9YC 2VL9A 3ME7A 1TK5B 4NV5A 1XWCA 3LORA 1PRXA 2EIRA 4KH7A 2MZCA 3IXRA 2HT9A 2J9HA 1USBA 1ON4A 1T4YA 4KNDA 2GZYA 1XWAA 1GSQA 1R26A 5L71A 1RK4A 2H73A 3WGEA 1MTCA 4Q5RA 1XXUA 4JZQA 5B7CA 2VD0A 5JCGA 2V1MA 3US3A 4KUNA 1VF4A 1SKWB 2E2GA 5J9BA 3ZIJA 2F8FA 4MA9A 1S3AA 4EUYA 4HUAA 3IE3A 5G30A 2V6KA 4Z7XA 4EE0A 1K0OA 5IPHA 3LYKA 1QMVA 1ABAA 1FVJA 3RBTA 3ZRDA 1GSYA 6GSUA 2ZUPA 5IMDA 3IK9A 3IHQA 4NHZA 3U6VA 1E6BA 2M46A 2DLXA 1BEDA 1AXDA 1F2EA 2JL4A 3P2AA 2HSHA 3QFAC 4G10A 4L5LA 4OWYA 3P7XA 4WEYA 3HJMA 3IBHA 3HYPA 1SK1A 1XWKA 2I3YA 3GIXA 3UARA 4IVFA 2HZEB 5D73A 4ML1A 1X9MB 3AY8A 3LJRA 1XOAA 3RHCA 3UMAA 2K9FA 3ZVJD 3HDCA 3CTFA 11GSA 5G5EA 5H5RA 4XRAA 1OE8A 4BWSA 3UAPA 4QL9A 5HFGA 3QD9A 4MDCA 1GLQA 1Z7RA 2IL3A 4MABA 4X1UA 16GSA 2YANA 1AIUA 2JZTA 1T00A 3G7YA 4TXOB 1XVWA 3L9UA 2WULA 4ECBA 5DCHA 4OFMA 2R4VA 1B4PA 1NW2A 3EU4A 2ALBA 3O6TA 4F9ZA 4DSSA 3RAZA 3DGQA 2M72A 4TXOA 1V57A 2IN3A 3A2WA 5JWQB 1BJXA 1BX9A 3TJBA 2R37A 5CRHA 2IPAA 4HJMA 4OFTA 2WZ9A 3U5RE 2H6ZA 4K9ZA 3NIVA 3ZREA 4L0UA 3UIWA 1OC8A 2GS3A 2R6KA 3D0ZA 3NOFA 1M9BA 3EINA 1SL2B 2V2GA 4MZWA 1ML6A 1FVKA 3KCMA 2RUFA 2LNSA 2F3MA 4EC0A 4GF0A 1O81A 1GP1A 4ZBDA 3IDVA 1GNEA 1K3OA 3DD3A 3GL5A 2H01A 1XW6A 2JSZA 3FW2A 3BCKA 2G0FA 2LSTA 4ZB8A 4IW9A 1GRXA 2H1AA 3ERFA 3ED3A 2RIIA 3KZQA 4HI7A 1GUHA 5DALB 2J23A 4POLA 3UJ1A 2VM1A 1N2AA 4DEJA 5C00A 4XS4B 1X0RA 3TKSE 1T1VA 4Q5NA 1YKAA 4ZILA 5ECSA 4PQ1A 3E3EA 2CZ2A 1DE2A 2KUCA 4JR6A 4YQUA 1SK0A 1EP8A 5ECOB 4ZB6A 1OE7A 4KAEA 4N30A 1O7UA 2PERA 2OBKA 5LD0A 3ZLPA 4HEA2 1UVZA 2OADA 1Z6NA 1C72A 2ES7A 5CNWA 3EMPA 5IM9A 3FR6A 2KHPA 4YQMA 5KN2A 1IYIA 1V40A 3FZAA 4G19A 3ZIVA 1T8EB 1JZRA 1JLVA 1PN9A 5ABRA 3KGKA 5EVOA 22GSA 4ILFA 5HFKA 2LJKA 18GSA 1WMJA 17GSA 1JHBA 3GTUA 3WT2A 2PPTA 4IJIA 9GSSA 2B1KA 2VAFA 4BPYA 1PGTA 2RLIA 3I43A 3GFKA 6GSTA 3J7Yk 5IPGA 2C8UA 3P90A 1XWGA 3EMXA 1THXA 1A8LA 1R7HA 3WGDA 4GRFA 4E8EA 4PQHA 3PH9A 2CX3A 2FWHA 2YP6A 2VD1A 3L9SA 1BG5A 2RM6A 1M0UA 4HQSA 3HXSA 4ISDA 3TJFA 1Z7PA 1YF1A 1VF3A 2H72A 4TKYA 5AGYA 4F2IA 3GH9A 1XCCA 1FAAA 2N5FA 2C3TA 2H0HA 5B6MA 2QSIA 3M9KA 3DKSA 5IO0A 3UEMA 4JE1A 2YWOA 1M7TA 4HJ2A 1DUGA 1EP7A 1R5AA 4O5RA 2PBJA 3F63A 5G1KA 2K18A 4MF5A 1YDKA 2YPMA 3QAVA 2H8LA 5DAKB 1EOHA 3HJOA 2LRTA 2V32A 3G9BA 4AF2A 1Q98A 4BA7A 4HS1A 3FZ4A 3UL3A 5B8BA 4E8HA 1K0BA 5DAKA 4ZL9A 3PR8A 2CA8A 4X43A 1OKTA 2X8GA 3FZ5A 3H1NA 2LJRA 1ERUA 1MD4A 1Z3EA 2X8HA 2E7PA 4XS6A 4QQ7A 1SL1B 2IMFA 1W89A 2GSQA 3GN3A 1K3YA 3KJYA 1K0DA 4TR4A 2AYTA 10GSA 4TW5A 5HR2A 3KTBA 3QAWA 2EC4A 2Z9SA 3ISOA 1A2MA 1UC7A 4K0GA 5H5SA 5J4UA 4J56E 3F6FA 2H1GA 4FO5A 4YH2A 2DC5A 3GHAA 4ZIJA 5A4WA 3F4TA 4TXVA 4BVXA 3EWLA 2WDUA 2C3QA 4KCEA 1ERTA 3G7IA 4XS1A 4MZBA 3BD2A 3HHVA 2ZNMA 4RI7A 3I9V2 1OC9B 2IMDA 3ZVJA 1ZZYA 2NPBA 3BJ5A 2DMLA 2O85A 13GSA 1HNAA 3FZ9A 3IK7A 4MH3A 1BQ7A 2PVOC 2VCZA 5INYA 4PUFC 4IQ1A 2LV3A 2PU9C 1GTUA 4NPBA 1R5PA 1TDIA 4HU9A 4IGJA 4HU7A 1TI1A 5DQSA 5IQYA 2A4VA 4AJ6A 3FR3A 3IA1A 5DJLA 5IMFA 1H4OA 1AAZA 3F3QA 2P5QA 3QOUA 3EU3A 1FB6A 2CX4A 3KM6A 1XBSA 1TP9A 4OO4A 3TJGA 3QAGA 1KBNA 2CVDA 4O32A 3ZFLA 1SD9A 4JBBA 2DIZA 1PL1A 1TK0B 4KA0A 2GSSA 1CQGA 3VLNA 1V98A 2DJKA 3WT1A 4PQIA 4XCSA 5CYYA 1T3BA 2YV7A 5D93A 3W8SA 4K7IA 3F4SA 3ZZXA 3Q18A 3MAKA 3TDGA 2FHEA 2N5BA 2JU5A 4EL1A 1G7EA 4PUAA 3WD6A 2JZRA 2HI7A 1TJDA 2K8SA 4ZL8A 5ECMB 1GSFA 1YF0A 3O3TA 3TCOA 3TRPA 1J0FA 1OVNA 3DEXA 4YAPA 3GKKA 2A2SA 2O89A 2H1DA 4LMVA 2H0GA 2TRCP 4JR4A 4OO5A 2AAWA 1JZWA 3VWXA 2I1UA 4TVEA 1PMTA 1SK2A 2LS5A 3RPNA 4GLTA 3DRNA 1FOVA 2FCHA 1AUCA 3H79A 4WR5A 4KW6A 2CV4A 2IJYA 1WIKA 1V58A 4NAXA 2WCIA 4O7HA 3VWVA 2JSYA 2OE0A 3C8EA 5A4UA 2FA8A 2IMEA 3CBUA 3GL3A 4WF4A 4PNFA 2X8CA 2LRNA 4K1FA 3TUEA 1TOFA 1G6WA 1M9AA 4IKHA 3D4TA 3RHBA 3LYPA 1NSWA 3JCML 1LBKA 2FUG2 5C04A 4POMA 2L5OA 3LWAA 5EPFA 4EDYA 2CQ9A 3WYWA 2GGTA 4I6XA 1PA3A 3LEFA 3VURA 3TKQA 2PVQA 4NV2A 5IMZA 3L78A 2MBTA 2C80A 2MMZA 2DJ1A 1RQMA 1FW1A 2VCTA 4ECIA 2LUSA 2B5XA 5FWGA 4N0VA 5LNKe 5J5NA 1PL2A 5ECNB 3FK8A 2DBCA 1PX6A 3C73A 1TRSA 4K7OA 5JCUA 3ZMKA 4JU5A 1U3AA 2CAQA 1YJ6A 1TU8A 1QUWA 1M2BA 1O8WA 4YQVA 2C0GA 1G6YA 4F0BA 2GQLA 4DSSB 1GH2A 3APOA 2OJLA 1B48A 2FWGA 1WPIA 2LKUA 5A5KA 2FNOA 4MP4A 1F3BA 1XFLA 1U88A 4IQAA 5E59A 2MMOA 3CMIA 4ID0A 3CTGA 1WJKA 5ELAA 3Q74A 3APQA 3VPQA 2ON7A 4N0ZA 1GUKA 4IBPA 2BTOT 3EC3A 3C1SA 1GSEA 3D21A 4PURA 2BMXA 5DBQA 2CVKA 6GSWA 4WXTA 3FYGA 2OBIA 2LJAA 2REMA 3KXOA 1CQHA 1W4VA 3C7MA 2CAIA 4WBJA 2XC2A 3IV4A 2MBSA 2L6CA 3HD5A 2FWEA 2TRXA 2YNXA 3BBYA 4O92A 1O73A 2B6MA 1TK8B 1F9MA 2P0GA 4QL7A 3TRXA 5D8IA 2GQMA 4H86A 7GSSA 2VIMA 1AQVA 1JLWA 1SYXA 2B7KA 1B4QA 4JRRA 3K8NA 2VL2A 1F3AA 3FRCA 1SKSB 3RPPA 1SYRA 1SKRB 1XW5A 2O8VB 4ZBBA 2IWTA 1X9SB 5ECKB 2PWJA 1KTEA 5ECIB 3UOMA 4TOPA 1YEPA 3GA4A 2VLUA 1TTZA 2CT6A 5CRGA 5IIZA 3DIEA 3QCPA 4POKA 3GRXA 5DCGA 2VUPA 2JADA 1FG4A 4LA1A 2VLTA 1ZGNA 3I6AA 3KD0A 3GTUB 2WJUA 3D6IA 1GSUA 2H71A 1KNGA 2H75A 5FHIA 1K3LA 5D9XA 4KE3A 4EF0A 2VCWA 2GTUA 4XHMA 1HYUA 3DMLA 12GSA 3GH6A 5G5FA 2YN1A 4AJ8A 20GSA 3QR6A 3E0UA 3GUSA 2GZZA 4OFNA 4TR0A 2VO4A 1ZYQB 4GSTA 1QK8A 1GTBA 2H76A 3F9UA 3ZL5A 4I5QA 3TGZA 4FYUA 5EY6A 2WRTA 2L57A 3D4MA 3LGCA 2MMAA 4OCEA 3UVTA 3F3RA 4IS0A 2XBIA 2H6XA 1DE1A 4MCUA 4IJ3A 4P3YB 2CVBA 4X0XA 2B1LA 3HZ8A 3ZITA 1UN2A 3A2XA 1XVQA 1Z6MA 5J41A 1U6TA 4DSQA 4EVMA 2IIYA 4POBA 2C4JA 2LQOA 3C71A 4FH8A 3E9JB 3L9VA 2H19A 6GSXA 2I4AA 1NM3A 2V6OA 2IMKA 3A3TA 2FY6A 4DSRA 4D73A 1MD3A 1PD21 1ERVA 1GTIA 1VRSD 3F6DA 1WWJA 4G2EA 1X9WB 5IOWA 2HZFA 3GKMA 3LQ7A 3TOTA 1OKDA 5ECQB 1GUMA 1F6MC 5AIXA 3APSA 1N8JA 1I5GA 3M9JA 3CYNA 2LRCA 1JFUA 2L5LA 1NHYA 4L8EA 3RDWA 2GSRA 5DJMA 5HQPA 1QQ2A 2NBSA 3M3MA 1BYEA 3UBKA 3ME8A 1Z9HA 4F03A 2FLSA 4NHWA 1DSBA 4MF7A 5G1LA 3EE2A 4TN8A 3KP9A 2M80A 1A0FA 1RW1A 4ECCA 2YOIA 3GKXA 3VWUA 1JZDA 4ML6A 4MJEA 2PUKC 5G2ZA 3FY7A 2CZ3A 4YAVA 3CRUA 2NDOA 1S3CA 4IP1A 4Q5QA 4L5OA 4MH2A 3DYRA 5ECLB 3PINA 1GNWA 2DJ3A 3QMXA 4Q5FA 4KSMA 1JZOA 3W6GA 5AN1A 1EV9A 1OC3A 5GZZB 3D22A 3VI7A 1YZXA 2GLRA 2DIYA 3GX8A 1QFNA 4V2NA 1VF1A 5EL8A 5HR1A 2PMTA 2XPEA 2P5RA 3CSHA 4FYCA 2V41A 5KN1A 4LMWA 3V1WA 1A0RP 3ZMLA 1TRWA 3GNJA 3Q6OA 2GZPA 2YZHA 5IMCA 2EIOA 4MZCA 3TRQA 4LL4B 4MMMA 3A5WA 5D9WA 1PSQA 4PXOA 3OR5A 4J2FA 5CRDA 1THOA 2FA4A 14GSA 3HKRA 2WGRA 1HNBA 3LSZA 5AISA 3HVVA 2O7KA 4IHUA 2F51A 3FR9A 3KH9A 1AQWA 1F37A 5IOXA 4K6XA 2QKEA 2AB6A 3FKFA 3GKNA 1X5EA 2VL2C 2B5EA 5CP1A 1K0NA 4BVYA 2WB9A 2KP2A 5ELGA 5JWRB 5LCZA 4ZXGA 1TI3A 2HNLA 2B5YA 2OKAA 2X99A 1B9XC 2N5AA 1XIYA 3VK9A 1AW9A 2L6DA 1V2AA 1GTAA 4IP6A 1TRVA 2RM5A 3TKSA 1HQOA 1Z5YE 1G0TA 1A2LA 3IAS2 5FT3A 3QDNA 1EZKA 1PKZA 5CO3A 3KTLA 2HSYA 3CRTA 3CXGA 3GURA 1SL0B 3F8UA 1ZL9A 2IMIA 1SJIA 2WS2A 6GSSA 2F9SA 19GSA 1GSDA 3GSSA 1AQXA 2H30A 4PNGA 2MYGA 2R5GA 4GQCA 2LEGA 2YWMA 2VCQA 3TKRA 4IELA 6GSVA 4HZ4A 2E0QA 4WR4A 3I69A 4TR3A 2HRFA 3TKPA 1QGVA 4HDEA 1XW9A 1ACVA 5GAPD 3HVSA 2E2MA 1MEKA 2OACA 1XPVA 4PGTA 4DVCA 4XRDA 1M2AA 1MDIA 1YY7A 3MDKA 4MJAA 3TJKA 3DXBA 3W8JA 3J7Yb 2LTKA 5CRWA 4MK3A 4BWQA 5DQYA 3HY2A 2YWIA 5GSTA 4KX4A 2HFDA 4OMVA 2HXKA 1HD2A 2I9HA 1GWCA 2K6VA 2HRNA 1ILOA 1EWXA 2B7JA 4NWYA 1VF2A 2GT6A 3SBCA 5F8BA 5DVBA 4XTSA 1IYHA 1U87A 2GT5A 4GSSA 5F05A 2EIQA 4RQXA 2X64A 4GWRA 4OCFA 4WF5A
chains in the Genus database with same CATH superfamily
1U3IA 4HOJA 2K8VA 4V2MA 2H74A 2OE1A 3GMFA 2F8AA 1UA5A 4N10A 5DDLA 4WETA 3MNGA 4JEDA 4LL1B 3VI5A 3CSJA 1KEBA 4A5PA 1S3DA 5IO2A 1MDJA 2HZEA 4G9HA 4MNNA 1XZOA 4G0LA 1H75A 3BCIA 1TXXA 2IFQB 3PGTA 1WE0A 1OYJA 4TRXA 4KDUA 1A8YA 3ZTLA 1ST9A 2IFQA 4CW9A 1TW9A 4K2DA 2H0IA 3KIJA 3ERWA 1YQ1A 3LG6A 3F0IA 4F82A 3VWWA 3LFLA 1XOBA 1BAYA 2G2QA 4K7NA 5ECRB 3LW9A 1A24A 2PGTA 2I81A 2R0PA 4GSNA 5CREA 1LJRA 4I8BA 1WRYA 2C0DA 1EOGA 4EXJA 2DJ2A 4KF9A 2TIRA 2WFCA 1MDKA 1M99A 1ZMAA 4KSOA 3NZNA 1K0AA 1O6JA 2C3NA 2AUVA 4FQUA 2GVPA 2H6YA 4PX1A 1O8XA 3DVXA 4MPFA 4LLRA 4HQZA 1M3IA 4ZBAA 1AC1A 5HFIA 2C1YA 1X5CA 1GL8A 3H4KA 5J3RA 5DALA 3EVIA 3SWLA 4XS4A 4AGSA 4CDOA 2VCXA 1FO5A 4BL7A 3KH7A 2DJ0A 1GULA 2XHFA 1ZOFA 3CSIA 5AIVA 2VLVA 4RUVA 4NMUA 1EEMA 4MF6A 3EYTA 1QXHA 4GCIA 1WP0A 1T4ZA 1XG8A 4ACSA 3ERGA 1URMA 1WOUA 3UBLA 6GSYA 2PN8A 2ON5A 2HYXA 2OE3A 1HNCA 1O85A 4KB3A 1DBYA 5D9TA 1YEXA 3TKSC 3M0FA 5G31A 4J57E 4ECJA 5ECPB 3R2QA 1NHOA 2NTOA 3TJJA 5KN0A 3N5OA 4L0WA 3GX0A 3LXZA 1PKWA 3ZFBA 5F06A 5B6NA 4OD7A 1SJZA 3MSZA 5KN3A 2RUEA 5HR3A 8GSSA 4EO3A 4FIWA 2YZUA 1FHEA 4NXIA 1GLPA 3VPTA 5A4VA 4K0NA 1OAZA 2H70A 5IMAA 5GSSA 2AV4A 4BIKA 5D9VA 3LXTA 4GTUA 4D73B 2JACA 1K0CA 1FB0A 5COHA 1XWBA 2X49A 2OA7A 2ZCTA 3MYDA 4GXZA 4ZB9A 4MLYA 5CAXA 3HZ4A 5ENUA 3GSTA 1EEJA 2QC7A 4XIHA 4KDXA 5IMVA 1Y6EA 2L4CA 3HCZA 3L4NA 4IN0A 2BJXA 4X4JA 1ZCPA 5F07A 4ULXA 4AJ7A 4FYBA 2GDRA 2R3XA 4RI6A 1GSSA 1TRUA 1LU4A 2VL3A 5D96A 2P31A 4TR1B 2YJ7A 5B8AA 2FWFA 5ECHB 2XBQA 2VCVA 2L59A 3D5JA 3GV1A 5E4WA 2LQQA 4I97A 2B3SA 3IOSA 4MPGA 3G7JA 4TR1A 3S9FA 2AJQB 3Q19A 4RQRA 2YCDA 1ZYEA 1SD8A 4I2UA 3MWHA 3IC4A 3CQFA 3P8WA 4EKZA 3A2VA 1TKDB 4MJCA 3IR4A 1EV4A 2L4QA 2GSTA 4K8MA 1ERWA 3TB2A 4V1Ag 2FD3A 1E2YA 5F0GA 3IPZA 3HJPA 1X5DA 3O76A 4V1Ap 1J08A 2JZSA 5H5QA 1T7PB 3M8NA 3HVXA 1PFOA 1VGLA 3KMOA 3IAM2 5ID2B 3H8QA 3KP8A 1Y25A 3DWVA 3KEBA 3VFIA 3EURA 1TU7A 1OC9A 3R3EA 4N11A 2DMMA 3C1RA 2YWNA 3H93A 1A2JA 5JCWA 5ID2A 3M1GA 2KLXA 4KCAA 2H66A 3BOAA 1B8XA 1J9BA 1YKCA 2MMNA 4MJBA 1SENA 4Z2UA 4I2TA 4WBRD 5HR0A 3QFBC 3WGXA 4WKWA 4BVYB 2XPDA 2YJHA 5KOWA 1SJ6A 3F4RA 1M2DA 2NVLA 3KMNA 5JWOB 2LNTA 2FGXA 1I9DA 4V2LA 3QPMA 2C0EA 5BRTA 1EGOA 2QGVA 4KGIA 1PQNA 3L0HA 2R2JA 2AHEA 2KOKA 5KOXA 5J9CA 2DSAA 2DJJA 2KP1A 4GQFA 2D2ZA 4EDZA 3N9JA 1Q4JA 2GQKA 2HLSA 1G7OA 2A2RA 4HZ2A 1SU9A 4CHSA 3IRAA 2HE3A 3ZYWA 3HA9A 1PX7A 2R0CA 4F0CA 2VM2A 2C0FA 5GAND 1EGRA 1K0MA 3FEUA 3TOUA 3DVWA 4KDYA 2O87A 2H1BA 1R4WA 1V9WA 5KEJA 2VOCA 2YV9A 3FHKA 3GYKA 3UVHA 4ZL7A 1A23A 1B9YC 2VL9A 4CY6A 3ME7A 1TK5B 4NV5A 1XWCA 3LORA 1PRXA 2EIRA 4KH7A 2MZCA 3IXRA 2HT9A 2J9HA 3MIXA 1USBA 1ON4A 1T4YA 4KNDA 2GZYA 1XWAA 1GSQA 1R26A 5L71A 1RK4A 2H73A 3WGEA 1MTCA 4USSA 4Q5RA 1XXUA 4JZQA 5B7CA 2VD0A 5JCGA 2V1MA 3US3A 2A4HA 4KUNA 1VF4A 1SKWB 2E2GA 4ICYA 4K5RA 5J9BA 3ZIJA 2F8FA 4MA9A 1S3AA 4EUYA 4HUAA 3IE3A 5G30A 2V6KA 4Z7XA 4EE0A 1K0OA 5IPHA 3LYKA 1QMVA 1ABAA 1FVJA 3RBTA 3ZRDA 1GSYA 6GSUA 2ZUPA 5IMDA 3IK9A 3IHQA 4NHZA 3U6VA 1E6BA 2M46A 2DLXA 1BEDA 1AXDA 1F2EA 2JL4A 3P2AA 2HSHA 3QFAC 4G10A 4L5LA 4OWYA 3P7XA 4WEYA 3HJMA 3IBHA 3HYPA 1SK1A 1XWKA 2I3YA 3GIXA 3UARA 4IVFA 2HZEB 5D73A 4ML1A 1X9MB 3AY8A 3LJRA 1XOAA 3RHCA 3UMAA 2K9FA 3ZVJD 3HDCA 3CTFA 11GSA 5G5EA 5H5RA 4XRAA 1OE8A 4BWSA 3UAPA 4QL9A 5HFGA 3QD9A 4MDCA 1GLQA 1Z7RA 2IL3A 4MABA 4X1UA 16GSA 2YANA 1AIUA 2JZTA 1T00A 3G7YA 4TXOB 1XVWA 3L9UA 2WULA 4ECBA 5DCHA 4OFMA 2R4VA 1B4PA 1NW2A 3EU4A 2ALBA 3O6TA 4F9ZA 4DSSA 3RAZA 3DGQA 2M72A 4TXOA 1V57A 2IN3A 3A2WA 5JWQB 1BJXA 1BX9A 3TJBA 2R37A 5CRHA 3PPUA 2IPAA 4HJMA 4OFTA 2WZ9A 3U5RE 2H6ZA 4K9ZA 3NIVA 3ZREA 4L0UA 3UIWA 1OC8A 2GS3A 2R6KA 3D0ZA 3NOFA 1M9BA 3EINA 1SL2B 2V2GA 4MZWA 1ML6A 1FVKA 3KCMA 2RUFA 2LNSA 2F3MA 4EC0A 4GF0A 1O81A 1GP1A 4ZBDA 3IDVA 1GNEA 1K3OA 3DD3A 3GL5A 2H01A 1XW6A 2JSZA 3FW2A 3BCKA 2G0FA 2LSTA 4ZB8A 4IW9A 1GRXA 2H1AA 3ERFA 3ED3A 2RIIA 3KZQA 4HI7A 1GUHA 5DALB 2J23A 4POLA 3UJ1A 4YKGA 2VM1A 1N2AA 4DEJA 5C00A 4XS4B 1X0RA 3TKSE 1T1VA 4Q5NA 4BL7B 1YKAA 4ZILA 5ECSA 4PQ1A 3E3EA 2CZ2A 1DE2A 2KUCA 4JR6A 4YQUA 1SK0A 1EP8A 5ECOB 4ZB6A 1OE7A 4KAEA 4N30A 1O7UA 2PERA 2OBKA 5LD0A 3ZLPA 4HEA2 1UVZA 2OADA 1Z6NA 1C72A 2ES7A 5CNWA 3EMPA 5IM9A 3FR6A 2KHPA 4YQMA 5KN2A 1IYIA 1V40A 3FZAA 4G19A 3ZIVA 1T8EB 1JZRA 1JLVA 1PN9A 5ABRA 3KGKA 5EVOA 22GSA 4ILFA 5HFKA 2LJKA 18GSA 1WMJA 17GSA 1JHBA 3GTUA 3WT2A 2PPTA 4IJIA 9GSSA 2B1KA 2VAFA 4BPYA 1PGTA 2RLIA 3I43A 3GFKA 6GSTA 3J7Yk 5IPGA 2C8UA 3P90A 1XWGA 3EMXA 3HVNA 1THXA 1A8LA 1R7HA 3WGDA 4GRFA 4E8EA 4PQHA 3PH9A 4G0IA 2CX3A 2FWHA 2YP6A 2VD1A 3L9SA 1BG5A 4Z2TA 2RM6A 1M0UA 4HQSA 3HXSA 4ISDA 3TJFA 1Z7PA 1YF1A 1VF3A 2H72A 4TKYA 5AGYA 4F2IA 3GH9A 1XCCA 1FAAA 2N5FA 2C3TA 2H0HA 5B6MA 2QSIA 3M9KA 3DKSA 5IO0A 3UEMA 4JE1A 2YWOA 1M7TA 4HJ2A 1DUGA 1EP7A 1R5AA 3A5IA 4O5RA 2PBJA 3F63A 5G1KA 2K18A 4MF5A 1YDKA 2YPMA 3QAVA 2H8LA 5DAKB 1EOHA 3HJOA 2LRTA 2V32A 3G9BA 4AF2A 1Q98A 4BA7A 4HS1A 3FZ4A 3UL3A 5B8BA 4E8HA 1K0BA 5DAKA 4ZL9A 3PR8A 2CA8A 4X43A 1OKTA 2X8GA 3FZ5A 3H1NA 2LJRA 1ERUA 1MD4A 1Z3EA 2X8HA 2HRKA 2E7PA 4XS6A 4QQ7A 1SL1B 2IMFA 1W89A 2GSQA 3GN3A 1K3YA 3KJYA 1K0DA 4TR4A 2AYTA 10GSA 4TW5A 5HR2A 3KTBA 3QAWA 2EC4A 2Z9SA 3ISOA 1A2MA 1UC7A 4K0GA 5H5SA 5J4UA 4BVXB 4J56E 3F6FA 2H1GA 4FO5A 4YH2A 2DC5A 2HSMA 3GHAA 4ZIJA 5A4WA 3F4TA 4TXVA 4BVXA 3EWLA 2WDUA 2C3QA 4KCEA 1ERTA 3G7IA 4XS1A 4MZBA 3BD2A 3HHVA 2ZNMA 4RI7A 3I9V2 1OC9B 2IMDA 3ZVJA 1ZZYA 2NPBA 3BJ5A 2DMLA 2O85A 13GSA 1HNAA 3FZ9A 3IK7A 4MH3A 1BQ7A 2PVOC 2VCZA 5INYA 4PUFC 4IQ1A 2LV3A 2PU9C 1GTUA 4NPBA 1R5PA 1TDIA 4HU9A 4IGJA 4HU7A 1TI1A 5DQSA 5IQYA 2A4VA 4AJ6A 3FR3A 3IA1A 5DJLA 5IMFA 1H4OA 1AAZA 3F3QA 2P5QA 3QOUA 3EU3A 1FB6A 2CX4A 3KM6A 1XBSA 1TP9A 4OO4A 3TJGA 3QAGA 1KBNA 2CVDA 4O32A 3ZFLA 1SD9A 4JBBA 2DIZA 1PL1A 1TK0B 4KA0A 2GSSA 1CQGA 3VLNA 1V98A 2DJKA 3WT1A 4PQIA 4XCSA 5CYYA 1T3BA 2HRAA 2YV7A 5D93A 3W8SA 4K7IA 3F4SA 3ZZXA 3Q18A 3MAKA 3TDGA 2FHEA 2N5BA 2JU5A 4EL1A 1G7EA 4PUAA 3WD6A 2JZRA 2HI7A 1TJDA 2K8SA 4ZL8A 5ECMB 1GSFA 1YF0A 3O3TA 3TCOA 3TRPA 1J0FA 1M3JA 1OVNA 3DEXA 4YAPA 3GKKA 2A2SA 2R0GA 2O89A 2H1DA 2DKHA 4LMVA 2H0GA 2TRCP 4JR4A 4EIPA 4OO5A 2AAWA 1JZWA 3VWXA 2I1UA 4TVEA 1PMTA 1SK2A 2LS5A 3RPNA 4GLTA 3DRNA 1FOVA 2FCHA 1AUCA 3H79A 4WR5A 4KW6A 2CV4A 2IJYA 1WIKA 1V58A 4NAXA 2WCIA 4O7HA 3VWVA 2JSYA 2OE0A 3C8EA 5A4UA 2FA8A 2IMEA 3CBUA 3GL3A 3IHGA 4WF4A 4PNFA 2X8CA 2LRNA 4K1FA 3TUEA 1TOFA 1G6WA 1M9AA 4IKHA 3D4TA 3RHBA 3LYPA 1NSWA 3JCML 1LBKA 2FUG2 3IC8A 4POMA 5C04A 2L5OA 3LWAA 5EPFA 4EDYA 2CQ9A 4K5SA 3WYWA 2GGTA 4I6XA 1PA3A 3LEFA 3VURA 3TKQA 2PVQA 4NV2A 4EIQA 5IMZA 3L78A 2MBTA 2C80A 2MMZA 2DJ1A 1RQMA 1FW1A 2VCTA 4ECIA 2LUSA 2B5XA 5FWGA 4N0VA 5LNKe 5J5NA 1PL2A 5ECNB 3FK8A 2DBCA 1PX6A 3C73A 1TRSA 4K7OA 5JCUA 3ZMKA 4JU5A 1U3AA 2CAQA 1YJ6A 1TU8A 1QUWA 1M2BA 1O8WA 4YQVA 2C0GA 1G6YA 4F0BA 2GQLA 4DSSB 1GH2A 3APOA 2OJLA 1ZYPA 1B48A 2FWGA 1WPIA 2LKUA 5A5KA 2FNOA 4MP4A 1F3BA 1XFLA 1U88A 4IQAA 5E59A 2MMOA 3CMIA 4ID0A 3CTGA 1WJKA 5ELAA 3Q74A 3APQA 3VPQA 2ON7A 4N0ZA 1GUKA 4IBPA 2BTOT 3EC3A 4PURA 3C1SA 1GSEA 3D21A 2BMXA 5DBQA 2CVKA 6GSWA 4WXTA 3FYGA 2OBIA 2LJAA 2REMA 3KXOA 1CQHA 1W4VA 3C7MA 2CAIA 4WBJA 2XC2A 3IV4A 2MBSA 2L6CA 3HD5A 2FWEA 2TRXA 2YNXA 3BBYA 4O92A 1O73A 2B6MA 1TK8B 1F9MA 2P0GA 4QL7A 3TRXA 5D8IA 2GQMA 4H86A 7GSSA 2VIMA 1AQVA 1JLWA 1SYXA 2B7KA 1B4QA 4JRRA 3K8NA 2VL2A 1F3AA 3FRCA 1SKSB 3RPPA 1SYRA 1SKRB 1XW5A 2O8VB 4ZBBA 2IWTA 1X9SB 5ECKB 2PWJA 1KTEA 5ECIB 3UOMA 4TOPA 1YEPA 3GA4A 2VLUA 1TTZA 2CT6A 5CRGA 5IIZA 3DIEA 3QCPA 4POKA 3GRXA 5DCGA 2VUPA 2JADA 1FG4A 4LA1A 2VLTA 1ZGNA 3I6AA 3KD0A 2A2PA 3GTUB 2WJUA 3D6IA 1GSUA 2H71A 1KNGA 2H75A 2X4AA 1K3LA 5FHIA 5D9XA 4KE3A 4EF0A 2VCWA 2GTUA 4XHMA 1HYUA 3DMLA 12GSA 3GH6A 5G5FA 2YN1A 4AJ8A 20GSA 3QR6A 3E0UA 3GUSA 4PTSA 2GZZA 4OFNA 4TR0A 2VO4A 1ZYQB 4GSTA 1QK8A 1GTBA 2H76A 3F9UA 3ZL5A 4I5QA 3TGZA 4FYUA 5EY6A 2WRTA 2L57A 2QA1A 3D4MA 3LGCA 2MMAA 4OCEA 3UVTA 3F3RA 4IS0A 1S3RA 2H6XA 2XBIA 1DE1A 4MCUA 4IJ3A 4P3YB 2CVBA 4X0XA 2B1LA 3HZ8A 3ZITA 1UN2A 3A2XA 1XVQA 1Z6MA 5J41A 1U6TA 4DSQA 4EVMA 2IIYA 4POBA 2C4JA 2LQOA 3C71A 4FH8A 3E9JB 3L9VA 2H19A 6GSXA 2I4AA 1NM3A 2V6OA 2IMKA 3A3TA 1FOHA 2FY6A 4DSRA 4D73A 1MD3A 1PD21 2QA2A 1ERVA 1GTIA 1VRSD 3F6DA 1WWJA 4G2EA 1X9WB 5IOWA 2HZFA 3GKMA 3LQ7A 3TOTA 1OKDA 5ECQB 1GUMA 1F6MC 5AIXA 3APSA 1N8JA 1I5GA 3M9JA 3CYNA 2LRCA 1JFUA 2L5LA 1NHYA 4L8EA 3RDWA 2GSRA 5DJMA 5HQPA 1QQ2A 2NBSA 3M3MA 1BYEA 3UBKA 3ME8A 1Z9HA 4F03A 2FLSA 4NHWA 1DSBA 4MF7A 5G1LA 3EE2A 4TN8A 3KP9A 2M80A 1A0FA 1RW1A 4ECCA 2YOIA 3GKXA 3VWUA 1JZDA 4ML6A 4MJEA 2PUKC 5G2ZA 3FY7A 2CZ3A 3CRUA 4YAVA 2NDOA 1S3CA 4IP1A 4Q5QA 4L5OA 4MH2A 3DYRA 5ECLB 3PINA 1GNWA 4O5UA 2DJ3A 3QMXA 4Q5FA 5BMUA 4KSMA 1JZOA 3W6GA 5AN1A 1EV9A 1OC3A 5GZZB 3D22A 2UZ8A 3VI7A 1YZXA 2GLRA 2DIYA 3GX8A 1QFNA 4V2NA 1VF1A 5EL8A 5HR1A 2PMTA 2XPEA 2P5RA 4YKFA 3CSHA 4FYCA 2V41A 5KN1A 4LMWA 3V1WA 1A0RP 3ZMLA 1TRWA 4CY8A 3GNJA 3Q6OA 2GZPA 2YZHA 5IMCA 2EIOA 4MZCA 3TRQA 4LL4B 4MMMA 3A5WA 5D9WA 1PSQA 4PXOA 3OR5A 4J2FA 5CRDA 1THOA 2FA4A 14GSA 3EPTA 3HKRA 2WGRA 1HNBA 3LSZA 5AISA 3HVVA 2O7KA 4IHUA 4K2XA 2F51A 3FR9A 3KH9A 1AQWA 1F37A 5IOXA 4K6XA 2QKEA 2AB6A 3FKFA 3GKNA 1X5EA 2VL2C 2B5EA 5CP1A 1K0NA 4BVYA 2WB9A 2KP2A 5ELGA 5JWRB 1PN0A 5LCZA 4ZXGA 1TI3A 2HNLA 2B5YA 2OKAA 2X99A 1B9XC 2N5AA 1XIYA 3VK9A 1AW9A 2L6DA 1V2AA 1GTAA 4IP6A 1TRVA 2RM5A 3TKSA 1HQOA 1Z5YE 1G0TA 1A2LA 3IAS2 5FT3A 2DKIA 3QDNA 1EZKA 1PKZA 3FMWA 5CO3A 3KTLA 2HSYA 3CRTA 3CXGA 3GURA 1SL0B 3F8UA 4HSCX 1ZL9A 2IMIA 1SJIA 2WS2A 6GSSA 2F9SA 19GSA 1GSDA 3GSSA 1AQXA 2H30A 4PNGA 2MYGA 1ZYNA 2R5GA 4GQCA 2LEGA 2YWMA 2VCQA 3TKRA 4IELA 6GSVA 4HZ4A 2E0QA 4WR4A 3I69A 4TR3A 2HRFA 3TKPA 1QGVA 4HDEA 1XW9A 1ACVA 5GAPD 3HVSA 2E2MA 1MEKA 2OACA 1XPVA 4PGTA 4DVCA 4XRDA 1M2AA 1MDIA 1YY7A 3MDKA 4MJAA 3TJKA 3DXBA 3W8JA 3J7Yb 2LTKA 5CRWA 4MK3A 4BWQA 5DQYA 3HY2A 2YWIA 5GSTA 4KX4A 2HFDA 4OMVA 2HXKA 1HD2A 2I9HA 1GWCA 4O5QA 2K6VA 2HRNA 1ILOA 1EWXA 2B7JA 4Z2RA 4NWYA 1VF2A 2GT6A 4G0KA 3SBCA 5F8BA 5DVBA 4XTSA 1IYHA 1U87A 2GT5A 4GSSA 5F05A 2EIQA 4RQXA 2X64A 4GWRA 4OCFA 4WF5A
chains in the Genus database with same CATH topology
1U3IA 4HOJA 2K8VA 4V2MA 2H74A 2OE1A 3GMFA 2F8AA 1UA5A 4N10A 5DDLA 4WETA 3MNGA 4JEDA 4LL1B 3VI5A 3CSJA 1KEBA 4A5PA 1S3DA 5IO2A 1MDJA 2HZEA 4G9HA 4MNNA 1XZOA 4G0LA 1H75A 3BCIA 1TXXA 2IFQB 3PGTA 1WE0A 1OYJA 4TRXA 4KDUA 1A8YA 3ZTLA 1ST9A 2IFQA 4CW9A 1TW9A 4K2DA 2H0IA 3KIJA 3ERWA 1YQ1A 3LG6A 3F0IA 4F82A 3VWWA 3LFLA 1XOBA 1BAYA 2G2QA 4K7NA 5ECRB 3LW9A 1A24A 2PGTA 2I81A 2R0PA 4GSNA 5CREA 1LJRA 4I8BA 1WRYA 2C0DA 1EOGA 4EXJA 2DJ2A 4KF9A 2TIRA 2WFCA 1MDKA 1M99A 1ZMAA 4KSOA 3NZNA 1K0AA 1O6JA 2C3NA 2AUVA 4FQUA 2GVPA 2H6YA 4PX1A 1O8XA 3DVXA 4MPFA 4LLRA 4HQZA 4ZBAA 1AC1A 5HFIA 2C1YA 1X5CA 1GL8A 3H4KA 5J3RA 5DALA 3EVIA 3SWLA 4XS4A 4AGSA 4CDOA 2VCXA 1FO5A 4BL7A 3KH7A 2DJ0A 1GULA 2XHFA 1ZOFA 3CSIA 5AIVA 2VLVA 4RUVA 4NMUA 1EEMA 4MF6A 3EYTA 1QXHA 4GCIA 1WP0A 1T4ZA 4ACSA 3ERGA 1URMA 1WOUA 3UBLA 6GSYA 2PN8A 2ON5A 2HYXA 2OE3A 1HNCA 1O85A 4KB3A 1DBYA 5D9TA 1YEXA 3TKSC 3M0FA 5G31A 4J57E 4ECJA 5ECPB 3R2QA 1NHOA 2NTOA 3TJJA 5KN0A 3N5OA 4L0WA 3GX0A 3LXZA 1PKWA 3ZFBA 5F06A 5B6NA 4OD7A 1SJZA 3MSZA 5KN3A 2RUEA 5HR3A 8GSSA 4EO3A 4FIWA 2YZUA 1FHEA 4NXIA 1GLPA 3VPTA 5A4VA 4K0NA 1OAZA 2H70A 5IMAA 5GSSA 2AV4A 5D9VA 3LXTA 4GTUA 4D73B 2JACA 1K0CA 1FB0A 5COHA 1XWBA 2X49A 2OA7A 2ZCTA 3MYDA 4GXZA 4ZB9A 4MLYA 5CAXA 3HZ4A 5ENUA 3GSTA 1EEJA 2QC7A 4XIHA 4KDXA 5IMVA 1Y6EA 2L4CA 3HCZA 3L4NA 4IN0A 2BJXA 4X4JA 1ZCPA 5F07A 4ULXA 4AJ7A 4FYBA 2GDRA 2R3XA 4RI6A 1GSSA 1TRUA 1LU4A 2VL3A 5D96A 2P31A 4TR1B 2YJ7A 5B8AA 2FWFA 5ECHB 2XBQA 2VCVA 2L59A 3D5JA 3GV1A 5E4WA 2LQQA 4I97A 2B3SA 3IOSA 4MPGA 3G7JA 4TR1A 3S9FA 2AJQB 3Q19A 4RQRA 2YCDA 1ZYEA 1SD8A 4I2UA 3MWHA 3IC4A 3P8WA 4EKZA 3A2VA 1TKDB 4MJCA 3IR4A 1EV4A 2L4QA 2GSTA 4K8MA 1ERWA 3TB2A 4V1Ag 2FD3A 1E2YA 5F0GA 3IPZA 3HJPA 1X5DA 3O76A 4V1Ap 1J08A 2JZSA 5H5QA 1T7PB 3M8NA 3HVXA 1VGLA 3KMOA 3IAM2 5ID2B 3H8QA 3KP8A 1Y25A 3DWVA 3KEBA 3VFIA 3EURA 1TU7A 1OC9A 3R3EA 4N11A 2DMMA 3C1RA 2YWNA 3H93A 1A2JA 5JCWA 5ID2A 3M1GA 2KLXA 4KCAA 2H66A 3BOAA 1B8XA 1J9BA 1YKCA 2MMNA 4MJBA 1SENA 4Z2UA 4I2TA 4WBRD 5HR0A 3QFBC 3WGXA 4WKWA 4BVYB 2XPDA 2YJHA 5KOWA 1SJ6A 3F4RA 1M2DA 2NVLA 3KMNA 5JWOB 2LNTA 2FGXA 1I9DA 4V2LA 3QPMA 2C0EA 5BRTA 1EGOA 2QGVA 4KGIA 1PQNA 3L0HA 2R2JA 2AHEA 2KOKA 5KOXA 5J9CA 2DSAA 2DJJA 2KP1A 4GQFA 2D2ZA 4EDZA 3N9JA 1Q4JA 2GQKA 2HLSA 1G7OA 2A2RA 4HZ2A 1SU9A 4CHSA 3IRAA 2HE3A 3ZYWA 3HA9A 1PX7A 2R0CA 4F0CA 2VM2A 2C0FA 5GAND 1EGRA 1K0MA 3FEUA 3TOUA 3DVWA 4KDYA 2O87A 2H1BA 1R4WA 1V9WA 5KEJA 2VOCA 2YV9A 3FHKA 3GYKA 3UVHA 4ZL7A 1A23A 1B9YC 2VL9A 4CY6A 3ME7A 1TK5B 4NV5A 1XWCA 3LORA 1PRXA 2EIRA 4KH7A 2MZCA 3IXRA 2HT9A 2J9HA 3MIXA 1USBA 1ON4A 1T4YA 4KNDA 2GZYA 1XWAA 1GSQA 1R26A 5L71A 1RK4A 2H73A 3WGEA 1MTCA 4USSA 4Q5RA 1XXUA 4JZQA 5B7CA 2VD0A 5JCGA 2V1MA 3US3A 2A4HA 4KUNA 1VF4A 1SKWB 2E2GA 4ICYA 4K5RA 5J9BA 3ZIJA 2F8FA 4MA9A 1S3AA 4EUYA 4HUAA 3IE3A 5G30A 2V6KA 4Z7XA 4EE0A 1K0OA 5IPHA 3LYKA 1QMVA 1ABAA 1FVJA 3RBTA 3ZRDA 1GSYA 6GSUA 2ZUPA 5IMDA 3IK9A 3IHQA 4NHZA 3U6VA 1E6BA 2M46A 2DLXA 1BEDA 1AXDA 1F2EA 2JL4A 3P2AA 2HSHA 3QFAC 4G10A 4L5LA 4OWYA 3P7XA 4WEYA 3HJMA 3IBHA 3HYPA 1SK1A 1XWKA 2I3YA 3GIXA 3UARA 4IVFA 2HZEB 5D73A 4ML1A 1X9MB 3AY8A 3LJRA 1XOAA 3RHCA 3UMAA 2K9FA 3ZVJD 3HDCA 3CTFA 11GSA 5G5EA 5H5RA 4XRAA 1OE8A 4BWSA 3UAPA 4QL9A 5HFGA 3QD9A 4MDCA 1GLQA 1Z7RA 2IL3A 4MABA 4X1UA 16GSA 2YANA 1AIUA 2JZTA 1T00A 3G7YA 4TXOB 1XVWA 3L9UA 2WULA 4ECBA 5DCHA 4OFMA 2R4VA 1B4PA 1NW2A 3EU4A 2ALBA 3O6TA 4F9ZA 4DSSA 3RAZA 3DGQA 2M72A 4TXOA 1V57A 2IN3A 3A2WA 5JWQB 1BJXA 1BX9A 3TJBA 2R37A 5CRHA 3PPUA 2IPAA 4HJMA 4OFTA 2WZ9A 3U5RE 2H6ZA 4K9ZA 3NIVA 3ZREA 4L0UA 3UIWA 1OC8A 2GS3A 2R6KA 3D0ZA 3NOFA 1M9BA 3EINA 1SL2B 2V2GA 4MZWA 1ML6A 1FVKA 3KCMA 2RUFA 2LNSA 2F3MA 4EC0A 4GF0A 1O81A 1GP1A 4ZBDA 3IDVA 1GNEA 1K3OA 3DD3A 3GL5A 2H01A 1XW6A 2JSZA 3FW2A 3BCKA 2G0FA 2LSTA 4ZB8A 4IW9A 1GRXA 2H1AA 3ERFA 3ED3A 2RIIA 3KZQA 4HI7A 1GUHA 5DALB 2J23A 4POLA 3UJ1A 4YKGA 2VM1A 1N2AA 4DEJA 5C00A 4XS4B 1X0RA 3TKSE 1T1VA 4Q5NA 4BL7B 1YKAA 4ZILA 5ECSA 4PQ1A 3E3EA 2CZ2A 1DE2A 2KUCA 4JR6A 4YQUA 1SK0A 1EP8A 5ECOB 4ZB6A 1OE7A 4KAEA 4N30A 1O7UA 2PERA 2OBKA 5LD0A 3ZLPA 4HEA2 1UVZA 2OADA 1Z6NA 1C72A 2ES7A 5CNWA 3EMPA 5IM9A 3FR6A 2KHPA 4YQMA 5KN2A 1IYIA 1V40A 3FZAA 4G19A 3ZIVA 1T8EB 1JZRA 1JLVA 1PN9A 5ABRA 3KGKA 5EVOA 22GSA 4ILFA 5HFKA 2LJKA 18GSA 1WMJA 17GSA 1JHBA 3GTUA 3WT2A 2PPTA 4IJIA 9GSSA 2B1KA 2VAFA 4BPYA 1PGTA 2RLIA 3I43A 3GFKA 6GSTA 3J7Yk 5IPGA 2C8UA 3P90A 1XWGA 3EMXA 1THXA 1A8LA 1R7HA 3WGDA 4GRFA 4E8EA 4PQHA 3PH9A 4G0IA 2CX3A 2FWHA 2YP6A 2VD1A 3L9SA 1BG5A 4Z2TA 2RM6A 1M0UA 4HQSA 3HXSA 4ISDA 3TJFA 1Z7PA 1YF1A 1VF3A 2H72A 4TKYA 5AGYA 4F2IA 3GH9A 1XCCA 1FAAA 2N5FA 2C3TA 2H0HA 5B6MA 2QSIA 3M9KA 3DKSA 5IO0A 3UEMA 4JE1A 2YWOA 1M7TA 4HJ2A 1DUGA 1EP7A 1R5AA 3A5IA 4O5RA 2PBJA 3F63A 5G1KA 2K18A 4MF5A 1YDKA 2YPMA 3QAVA 2H8LA 5DAKB 1EOHA 3HJOA 2LRTA 2V32A 3G9BA 4AF2A 1Q98A 4BA7A 4HS1A 3FZ4A 3UL3A 5B8BA 4E8HA 1K0BA 5DAKA 4ZL9A 3PR8A 2CA8A 4X43A 1OKTA 2X8GA 3FZ5A 3H1NA 2LJRA 1ERUA 1MD4A 1Z3EA 2X8HA 2HRKA 2E7PA 4XS6A 4QQ7A 1SL1B 2IMFA 1W89A 2GSQA 3GN3A 1K3YA 3KJYA 1K0DA 4TR4A 2AYTA 10GSA 4TW5A 5HR2A 3KTBA 3QAWA 2EC4A 2Z9SA 3ISOA 1A2MA 1UC7A 4K0GA 5H5SA 5J4UA 4BVXB 4J56E 3F6FA 2H1GA 4FO5A 4YH2A 2DC5A 2HSMA 3GHAA 4ZIJA 5A4WA 3F4TA 4TXVA 4BVXA 3EWLA 2WDUA 2C3QA 4KCEA 1ERTA 3G7IA 4XS1A 4MZBA 3BD2A 3HHVA 2ZNMA 4RI7A 3I9V2 1OC9B 2IMDA 3ZVJA 1ZZYA 2NPBA 3BJ5A 2DMLA 2O85A 13GSA 1HNAA 3FZ9A 3IK7A 4MH3A 1BQ7A 2PVOC 2VCZA 5INYA 4PUFC 4IQ1A 2LV3A 2PU9C 1GTUA 4NPBA 1R5PA 1TDIA 4HU9A 4IGJA 4HU7A 1TI1A 5DQSA 5IQYA 2A4VA 4AJ6A 3FR3A 3IA1A 5DJLA 5IMFA 1H4OA 1AAZA 3F3QA 2P5QA 3QOUA 3EU3A 1FB6A 2CX4A 3KM6A 1XBSA 1TP9A 4OO4A 3TJGA 3QAGA 1KBNA 2CVDA 4O32A 3ZFLA 1SD9A 4JBBA 2DIZA 1PL1A 1TK0B 4KA0A 2GSSA 1CQGA 3VLNA 1V98A 2DJKA 3WT1A 4PQIA 4XCSA 5CYYA 1T3BA 2HRAA 2YV7A 5D93A 3W8SA 4K7IA 3F4SA 3ZZXA 3Q18A 3MAKA 3TDGA 2FHEA 2N5BA 2JU5A 4EL1A 1G7EA 4PUAA 3WD6A 2JZRA 2HI7A 1TJDA 2K8SA 4ZL8A 5ECMB 1GSFA 1YF0A 3O3TA 3TCOA 3TRPA 1J0FA 1OVNA 3DEXA 4YAPA 3GKKA 2A2SA 2R0GA 2O89A 2H1DA 2DKHA 4LMVA 2H0GA 2TRCP 4JR4A 4EIPA 4OO5A 2AAWA 1JZWA 3VWXA 2I1UA 4TVEA 1PMTA 1SK2A 2LS5A 3RPNA 4GLTA 3DRNA 1FOVA 2FCHA 1AUCA 3H79A 4WR5A 4KW6A 2CV4A 2IJYA 1WIKA 1V58A 4NAXA 2WCIA 4O7HA 3VWVA 2JSYA 2OE0A 3C8EA 5A4UA 2FA8A 2IMEA 3CBUA 3GL3A 3IHGA 4WF4A 4PNFA 2X8CA 2LRNA 4K1FA 3TUEA 1TOFA 1G6WA 1M9AA 4IKHA 3D4TA 3RHBA 3LYPA 1NSWA 3JCML 1LBKA 2FUG2 3IC8A 4POMA 5C04A 2L5OA 3LWAA 5EPFA 4EDYA 2CQ9A 4K5SA 3WYWA 2GGTA 4I6XA 1PA3A 3LEFA 3VURA 3TKQA 2PVQA 4NV2A 4EIQA 5IMZA 3L78A 2MBTA 2C80A 2MMZA 2DJ1A 1RQMA 1FW1A 2VCTA 4ECIA 2LUSA 2B5XA 5FWGA 4N0VA 5LNKe 5J5NA 1PL2A 5ECNB 3FK8A 2DBCA 1PX6A 3C73A 1TRSA 4K7OA 5JCUA 3ZMKA 4JU5A 1U3AA 2CAQA 1YJ6A 1TU8A 1QUWA 1M2BA 1O8WA 4YQVA 2C0GA 1G6YA 4F0BA 2GQLA 4DSSB 1GH2A 3APOA 2OJLA 1ZYPA 1B48A 2FWGA 1WPIA 2LKUA 5A5KA 2FNOA 4MP4A 1F3BA 1XFLA 1U88A 4IQAA 5E59A 2MMOA 3CMIA 4ID0A 3CTGA 1WJKA 5ELAA 3Q74A 3APQA 3VPQA 2ON7A 4N0ZA 1GUKA 4IBPA 2BTOT 3EC3A 4PURA 3C1SA 1GSEA 3D21A 2BMXA 5DBQA 2CVKA 6GSWA 4WXTA 3FYGA 2OBIA 2LJAA 2REMA 3KXOA 1CQHA 1W4VA 3C7MA 2CAIA 4WBJA 2XC2A 3IV4A 2MBSA 2L6CA 3HD5A 2FWEA 2TRXA 2YNXA 3BBYA 4O92A 1O73A 2B6MA 1TK8B 1F9MA 2P0GA 4QL7A 3TRXA 5D8IA 2GQMA 4H86A 7GSSA 2VIMA 1AQVA 1JLWA 1SYXA 2B7KA 1B4QA 4JRRA 3K8NA 2VL2A 1F3AA 3FRCA 1SKSB 3RPPA 1SYRA 1SKRB 1XW5A 2O8VB 4ZBBA 2IWTA 1X9SB 5ECKB 2PWJA 1KTEA 5ECIB 3UOMA 4TOPA 1YEPA 3GA4A 2VLUA 1TTZA 2CT6A 5CRGA 5IIZA 3DIEA 3QCPA 4POKA 3GRXA 5DCGA 2VUPA 2JADA 1FG4A 4LA1A 2VLTA 1ZGNA 3I6AA 3KD0A 2A2PA 3GTUB 2WJUA 3D6IA 1GSUA 2H71A 1KNGA 2H75A 2X4AA 1K3LA 5FHIA 5D9XA 4KE3A 4EF0A 2VCWA 2GTUA 4XHMA 1HYUA 3DMLA 12GSA 3GH6A 5G5FA 2YN1A 4AJ8A 20GSA 3QR6A 3E0UA 3GUSA 4PTSA 2GZZA 4OFNA 4TR0A 2VO4A 1ZYQB 4GSTA 1QK8A 1GTBA 2H76A 3F9UA 3ZL5A 4I5QA 3TGZA 4FYUA 5EY6A 2WRTA 2L57A 2QA1A 3D4MA 3LGCA 2MMAA 4OCEA 3UVTA 3F3RA 4IS0A 2XBIA 2H6XA 1DE1A 4MCUA 4IJ3A 4P3YB 2CVBA 4X0XA 2B1LA 3HZ8A 3ZITA 1UN2A 3A2XA 1XVQA 1Z6MA 5J41A 1U6TA 4DSQA 4EVMA 2IIYA 4POBA 2C4JA 2LQOA 3C71A 4FH8A 3E9JB 3L9VA 2H19A 6GSXA 2I4AA 1NM3A 2V6OA 2IMKA 3A3TA 1FOHA 2FY6A 4DSRA 4D73A 1MD3A 1PD21 2QA2A 1ERVA 1GTIA 1VRSD 3F6DA 1WWJA 4G2EA 1X9WB 5IOWA 2HZFA 3GKMA 3LQ7A 3TOTA 1OKDA 5ECQB 1GUMA 1F6MC 5AIXA 3APSA 1N8JA 1I5GA 3M9JA 3CYNA 2LRCA 1JFUA 2L5LA 1NHYA 4L8EA 3RDWA 2GSRA 5DJMA 5HQPA 1QQ2A 2NBSA 3M3MA 1BYEA 3UBKA 3ME8A 1Z9HA 4F03A 2FLSA 4NHWA 1DSBA 4MF7A 5G1LA 3EE2A 4TN8A 3KP9A 2M80A 1A0FA 1RW1A 4ECCA 2YOIA 3GKXA 3VWUA 1JZDA 4ML6A 4MJEA 2PUKC 5G2ZA 3FY7A 2CZ3A 4YAVA 3CRUA 2NDOA 1S3CA 4IP1A 4Q5QA 4L5OA 4MH2A 3DYRA 5ECLB 3PINA 1GNWA 4O5UA 2DJ3A 3QMXA 4Q5FA 5BMUA 4KSMA 1JZOA 3W6GA 5AN1A 1EV9A 1OC3A 5GZZB 3D22A 2UZ8A 3VI7A 1YZXA 2GLRA 2DIYA 3GX8A 1QFNA 4V2NA 1VF1A 5EL8A 5HR1A 2PMTA 2XPEA 2P5RA 4YKFA 3CSHA 4FYCA 2V41A 5KN1A 4LMWA 3V1WA 1A0RP 3ZMLA 1TRWA 4CY8A 3GNJA 3Q6OA 2GZPA 2YZHA 5IMCA 2EIOA 4MZCA 3TRQA 4LL4B 4MMMA 3A5WA 5D9WA 1PSQA 4PXOA 3OR5A 4J2FA 5CRDA 1THOA 2FA4A 14GSA 3EPTA 3HKRA 2WGRA 1HNBA 3LSZA 5AISA 3HVVA 2O7KA 4IHUA 4K2XA 2F51A 3FR9A 3KH9A 1AQWA 1F37A 5IOXA 4K6XA 2QKEA 2AB6A 3FKFA 3GKNA 1X5EA 2VL2C 2B5EA 5CP1A 1K0NA 4BVYA 2WB9A 2KP2A 5ELGA 5JWRB 1PN0A 5LCZA 4ZXGA 1TI3A 2HNLA 2B5YA 2OKAA 2X99A 1B9XC 2N5AA 1XIYA 3VK9A 1AW9A 2L6DA 1V2AA 1GTAA 4IP6A 1TRVA 2RM5A 3TKSA 1HQOA 1Z5YE 1G0TA 1A2LA 3IAS2 5FT3A 2DKIA 3QDNA 1EZKA 1PKZA 3FMWA 5CO3A 3KTLA 2HSYA 3CRTA 3CXGA 3GURA 1SL0B 3F8UA 1ZL9A 2IMIA 1SJIA 2WS2A 6GSSA 2F9SA 19GSA 1GSDA 3GSSA 1AQXA 2H30A 4PNGA 2MYGA 1ZYNA 2R5GA 4GQCA 2LEGA 2YWMA 2VCQA 3TKRA 4IELA 6GSVA 4HZ4A 2E0QA 4WR4A 3I69A 4TR3A 2HRFA 3TKPA 1QGVA 4HDEA 1XW9A 1ACVA 5GAPD 3HVSA 2E2MA 1MEKA 2OACA 1XPVA 4PGTA 4DVCA 4XRDA 1M2AA 1MDIA 1YY7A 3MDKA 4MJAA 3TJKA 3DXBA 3W8JA 3J7Yb 2LTKA 5CRWA 4MK3A 4BWQA 5DQYA 3HY2A 2YWIA 5GSTA 4KX4A 2HFDA 4OMVA 2HXKA 1HD2A 2I9HA 1GWCA 4O5QA 2K6VA 2HRNA 1ILOA 1EWXA 2B7JA 4Z2RA 4NWYA 1VF2A 2GT6A 4G0KA 3SBCA 5F8BA 5DVBA 4XTSA 1IYHA 1U87A 2GT5A 4GSSA 5F05A 2EIQA 4RQXA 2X64A 4GWRA 4OCFA 4WF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3I A;  4HOJ A;  2K8V A;  4V2M A;  2H74 A;  2OE1 A;  3GMF A;  2F8A A;  1UA5 A;  4N10 A;  5DDL A;  4WET A;  3MNG A;  4JED A;  4LL1 B;  3VI5 A;  3CSJ A;  1KEB A;  1S3D A;  5IO2 A;  1MDJ A;  2HZE A;  4G9H A;  1XZO A;  1H75 A;  3BCI A;  1TXX A;  2IFQ B;  3PGT A;  1WE0 A;  1OYJ A;  4TRX A;  4KDU A;  1A8Y A;  3ZTL A;  1ST9 A;  2IFQ A;  4CW9 A;  1TW9 A;  4K2D A;  2H0I A;  3KIJ A;  3ERW A;  1YQ1 A;  3LG6 A;  3F0I A;  4F82 A;  3VWW A;  3LFL A;  1XOB A;  1BAY A;  2G2Q A;  4K7N A;  5ECR B;  1A24 A;  2PGT A;  2I81 A;  4GSN A;  5CRE A;  1LJR A;  4I8B A;  1WRY A;  2C0D A;  1EOG A;  4EXJ A;  2DJ2 A;  2TIR A;  2WFC A;  1MDK A;  1M99 A;  1ZMA A;  4KSO A;  3NZN A;  1K0A A;  1O6J A;  2C3N A;  2AUV A;  2GVP A;  2H6Y A;  4PX1 A;  1O8X A;  3DVX A;  4MPF A;  4LLR A;  4HQZ A;  4ZBA A;  1AC1 A;  5HFI A;  2C1Y A;  1X5C A;  1GL8 A;  3H4K A;  5J3R A;  5DAL A;  3EVI A;  3SWL A;  4XS4 A;  4AGS A;  4CDO A;  2VCX A;  1FO5 A;  4BL7 A;  3KH7 A;  2DJ0 A;  1GUL A;  2XHF A;  1ZOF A;  3CSI A;  5AIV A;  2VLV A;  4RUV A;  4NMU A;  1EEM A;  4MF6 A;  3EYT A;  1QXH A;  4GCI A;  1WP0 A;  1T4Z A;  4ACS A;  3ERG A;  1URM A;  1WOU A;  3UBL A;  6GSY A;  2PN8 A;  2ON5 A;  2HYX A;  2OE3 A;  1HNC A;  1O85 A;  4KB3 A;  1DBY A;  5D9T A;  1YEX A;  3TKS C;  3M0F A;  5G31 A;  4J57 E;  4ECJ A;  5ECP B;  3R2Q A;  1NHO A;  2NTO A;  3TJJ A;  5KN0 A;  3N5O A;  4L0W A;  3GX0 A;  3LXZ A;  1PKW A;  3ZFB A;  5F06 A;  5B6N A;  4OD7 A;  1SJZ A;  3MSZ A;  5KN3 A;  2RUE A;  5HR3 A;  8GSS A;  4EO3 A;  4FIW A;  2YZU A;  1FHE A;  4NXI A;  1GLP A;  3VPT A;  5A4V A;  4K0N A;  1OAZ A;  2H70 A;  5IMA A;  5GSS A;  2AV4 A;  5D9V A;  3LXT A;  4GTU A;  4D73 B;  2JAC A;  1K0C A;  1FB0 A;  5COH A;  1XWB A;  2OA7 A;  2ZCT A;  4GXZ A;  4ZB9 A;  5CAX A;  4MLY A;  3HZ4 A;  5ENU A;  3GST A;  1EEJ A;  2QC7 A;  4XIH A;  4KDX A;  5IMV A;  1Y6E A;  2L4C A;  3HCZ A;  3L4N A;  4IN0 A;  2BJX A;  1ZCP A;  5F07 A;  4ULX A;  4AJ7 A;  4FYB A;  2GDR A;  2R3X A;  4RI6 A;  1GSS A;  1TRU A;  1LU4 A;  2VL3 A;  5D96 A;  2P31 A;  4TR1 B;  2YJ7 A;  5B8A A;  2FWF A;  5ECH B;  2XBQ A;  2VCV A;  2L59 A;  3D5J A;  3GV1 A;  5E4W A;  2LQQ A;  4I97 A;  2B3S A;  3IOS A;  4MPG A;  3G7J A;  4TR1 A;  3S9F A;  2AJQ B;  3Q19 A;  4RQR A;  2YCD A;  1ZYE A;  1SD8 A;  4I2U A;  3MWH A;  3IC4 A;  3P8W A;  4EKZ A;  3A2V A;  1TKD B;  4MJC A;  3IR4 A;  1EV4 A;  2L4Q A;  2GST A;  4K8M A;  1ERW A;  3TB2 A;  4V1A g;  2FD3 A;  1E2Y A;  5F0G A;  3IPZ A;  3HJP A;  1X5D A;  3O76 A;  4V1A p;  1J08 A;  2JZS A;  5H5Q A;  1T7P B;  3M8N A;  3HVX A;  1VGL A;  3KMO A;  3IAM 2;  5ID2 B;  3H8Q A;  3KP8 A;  1Y25 A;  3DWV A;  3KEB A;  3VFI A;  3EUR A;  1TU7 A;  1OC9 A;  4N11 A;  2DMM A;  3C1R A;  2YWN A;  3H93 A;  1A2J A;  5JCW A;  5ID2 A;  3M1G A;  2KLX A;  4KCA A;  2H66 A;  3BOA A;  1B8X A;  1J9B A;  1YKC A;  2MMN A;  4MJB A;  1SEN A;  4I2T A;  4WBR D;  5HR0 A;  3QFB C;  3WGX A;  4WKW A;  2XPD A;  2YJH A;  1SJ6 A;  3F4R A;  1M2D A;  2NVL A;  3KMN A;  5JWO B;  2LNT A;  2FGX A;  1I9D A;  4V2L A;  3QPM A;  2C0E A;  1EGO A;  2QGV A;  4KGI A;  1PQN A;  3L0H A;  2R2J A;  2AHE A;  2KOK A;  5J9C A;  2DSA A;  2DJJ A;  2KP1 A;  4GQF A;  2D2Z A;  4EDZ A;  3N9J A;  1Q4J A;  2GQK A;  2HLS A;  1G7O A;  2A2R A;  4HZ2 A;  1SU9 A;  4CHS A;  3IRA A;  2HE3 A;  3ZYW A;  3HA9 A;  1PX7 A;  4F0C A;  2VM2 A;  2C0F A;  5GAN D;  1EGR A;  1K0M A;  3FEU A;  3TOU A;  3DVW A;  4KDY A;  2O87 A;  2H1B A;  1R4W A;  1V9W A;  5KEJ A;  2VOC A;  2YV9 A;  3FHK A;  3GYK A;  3UVH A;  4ZL7 A;  1A23 A;  1B9Y C;  2VL9 A;  3ME7 A;  1TK5 B;  4NV5 A;  1XWC A;  3LOR A;  1PRX A;  2EIR A;  4KH7 A;  2MZC A;  3IXR A;  2HT9 A;  2J9H A;  1USB A;  1ON4 A;  1T4Y A;  4KND A;  2GZY A;  1XWA A;  1GSQ A;  1R26 A;  5L71 A;  1RK4 A;  2H73 A;  3WGE A;  1MTC A;  4Q5R A;  1XXU A;  4JZQ A;  5B7C A;  2VD0 A;  5JCG A;  2V1M A;  3US3 A;  4KUN A;  1VF4 A;  1SKW B;  2E2G A;  5J9B A;  3ZIJ A;  2F8F A;  4MA9 A;  1S3A A;  4EUY A;  4HUA A;  3IE3 A;  5G30 A;  2V6K A;  4Z7X A;  4EE0 A;  1K0O A;  5IPH A;  3LYK A;  1QMV A;  1ABA A;  1FVJ A;  3RBT A;  3ZRD A;  1GSY A;  6GSU A;  2ZUP A;  5IMD A;  3IK9 A;  3IHQ A;  4NHZ A;  3U6V A;  1E6B A;  2M46 A;  2DLX A;  1BED A;  1AXD A;  1F2E A;  2JL4 A;  3P2A A;  2HSH A;  3QFA C;  4G10 A;  4L5L A;  4OWY A;  3P7X A;  4WEY A;  3HJM A;  3IBH A;  3HYP A;  1SK1 A;  1XWK A;  2I3Y A;  3GIX A;  3UAR A;  4IVF A;  2HZE B;  5D73 A;  4ML1 A;  1X9M B;  3AY8 A;  3LJR A;  1XOA A;  3RHC A;  3UMA A;  2K9F A;  3ZVJ D;  3HDC A;  3CTF A;  11GS A;  5G5E A;  5H5R A;  4XRA A;  1OE8 A;  4BWS A;  3UAP A;  4QL9 A;  5HFG A;  3QD9 A;  4MDC A;  1GLQ A;  1Z7R A;  2IL3 A;  4MAB A;  4X1U A;  16GS A;  2YAN A;  1AIU A;  2JZT A;  1T00 A;  3G7Y A;  4TXO B;  1XVW A;  3L9U A;  2WUL A;  4ECB A;  5DCH A;  4OFM A;  2R4V A;  1B4P A;  1NW2 A;  3EU4 A;  2ALB A;  3O6T A;  4F9Z A;  4DSS A;  3RAZ A;  3DGQ A;  2M72 A;  4TXO A;  1V57 A;  2IN3 A;  3A2W A;  5JWQ B;  1BJX A;  1BX9 A;  3TJB A;  2R37 A;  5CRH A;  2IPA A;  4HJM A;  4OFT A;  2WZ9 A;  3U5R E;  2H6Z A;  4K9Z A;  3NIV A;  3ZRE A;  4L0U A;  3UIW A;  1OC8 A;  2GS3 A;  2R6K A;  3D0Z A;  3NOF A;  1M9B A;  3EIN A;  1SL2 B;  2V2G A;  4MZW A;  1ML6 A;  1FVK A;  3KCM A;  2RUF A;  2LNS A;  2F3M A;  4EC0 A;  4GF0 A;  1O81 A;  1GP1 A;  4ZBD A;  3IDV A;  1GNE A;  1K3O A;  3DD3 A;  3GL5 A;  2H01 A;  1XW6 A;  2JSZ A;  3FW2 A;  3BCK A;  2G0F A;  2LST A;  4ZB8 A;  4IW9 A;  1GRX A;  2H1A A;  3ERF A;  3ED3 A;  2RII A;  3KZQ A;  4HI7 A;  1GUH A;  5DAL B;  2J23 A;  4POL A;  3UJ1 A;  2VM1 A;  1N2A A;  4DEJ A;  5C00 A;  4XS4 B;  1X0R A;  3TKS E;  1T1V A;  4Q5N A;  1YKA A;  4ZIL A;  5ECS A;  4PQ1 A;  3E3E A;  2CZ2 A;  1DE2 A;  2KUC A;  4JR6 A;  4YQU A;  1SK0 A;  1EP8 A;  5ECO B;  4ZB6 A;  1OE7 A;  4KAE A;  4N30 A;  1O7U A;  2PER A;  2OBK A;  5LD0 A;  3ZLP A;  4HEA 2;  1UVZ A;  2OAD A;  1Z6N A;  1C72 A;  2ES7 A;  5CNW A;  3EMP A;  5IM9 A;  3FR6 A;  2KHP A;  4YQM A;  5KN2 A;  1IYI A;  1V40 A;  3FZA A;  4G19 A;  3ZIV A;  1T8E B;  1JZR A;  1JLV A;  1PN9 A;  5ABR A;  3KGK A;  5EVO A;  22GS A;  4ILF A;  5HFK A;  2LJK A;  18GS A;  1WMJ A;  17GS A;  1JHB A;  3GTU A;  3WT2 A;  2PPT A;  4IJI A;  9GSS A;  2B1K A;  2VAF A;  4BPY A;  1PGT A;  2RLI A;  3I43 A;  3GFK A;  6GST A;  3J7Y k;  5IPG A;  2C8U A;  3P90 A;  1XWG A;  3EMX A;  1THX A;  1A8L A;  1R7H A;  3WGD A;  4GRF A;  4E8E A;  4PQH A;  3PH9 A;  2CX3 A;  2FWH A;  2YP6 A;  2VD1 A;  3L9S A;  1BG5 A;  2RM6 A;  1M0U A;  4HQS A;  3HXS A;  4ISD A;  3TJF A;  1Z7P A;  1YF1 A;  1VF3 A;  2H72 A;  4TKY A;  5AGY A;  4F2I A;  3GH9 A;  1XCC A;  1FAA A;  2N5F A;  2C3T A;  2H0H A;  5B6M A;  2QSI A;  3M9K A;  3DKS A;  5IO0 A;  3UEM A;  4JE1 A;  2YWO A;  1M7T A;  4HJ2 A;  1DUG A;  1EP7 A;  1R5A A;  4O5R A;  2PBJ A;  3F63 A;  5G1K A;  2K18 A;  4MF5 A;  1YDK A;  2YPM A;  3QAV A;  2H8L A;  5DAK B;  1EOH A;  3HJO A;  2LRT A;  2V32 A;  3G9B A;  4AF2 A;  1Q98 A;  4BA7 A;  4HS1 A;  3FZ4 A;  3UL3 A;  5B8B A;  4E8H A;  1K0B A;  5DAK A;  4ZL9 A;  3PR8 A;  2CA8 A;  4X43 A;  1OKT A;  2X8G A;  3FZ5 A;  3H1N A;  2LJR A;  1ERU A;  1MD4 A;  1Z3E A;  2X8H A;  2E7P A;  4XS6 A;  4QQ7 A;  1SL1 B;  2IMF A;  1W89 A;  2GSQ A;  3GN3 A;  1K3Y A;  3KJY A;  1K0D A;  4TR4 A;  2AYT A;  10GS A;  4TW5 A;  5HR2 A;  3KTB A;  3QAW A;  2EC4 A;  2Z9S A;  3ISO A;  1A2M A;  1UC7 A;  4K0G A;  5H5S A;  5J4U A;  4J56 E;  3F6F A;  2H1G A;  4FO5 A;  4YH2 A;  2DC5 A;  3GHA A;  4ZIJ A;  5A4W A;  3F4T A;  4TXV A;  4BVX A;  3EWL A;  2WDU A;  2C3Q A;  4KCE A;  1ERT A;  3G7I A;  4XS1 A;  4MZB A;  3BD2 A;  3HHV A;  2ZNM A;  4RI7 A;  3I9V 2;  1OC9 B;  2IMD A;  3ZVJ A;  1ZZY A;  2NPB A;  3BJ5 A;  2DML A;  2O85 A;  13GS A;  1HNA A;  3FZ9 A;  3IK7 A;  4MH3 A;  1BQ7 A;  2PVO C;  2VCZ A;  5INY A;  4PUF C;  4IQ1 A;  2LV3 A;  2PU9 C;  1GTU A;  4NPB A;  1R5P A;  1TDI A;  4HU9 A;  4IGJ A;  4HU7 A;  1TI1 A;  5DQS A;  5IQY A;  2A4V A;  4AJ6 A;  3FR3 A;  3IA1 A;  5DJL A;  5IMF A;  1H4O A;  1AAZ A;  3F3Q A;  2P5Q A;  3QOU A;  3EU3 A;  1FB6 A;  2CX4 A;  3KM6 A;  1XBS A;  1TP9 A;  4OO4 A;  3TJG A;  3QAG A;  1KBN A;  2CVD A;  4O32 A;  3ZFL A;  1SD9 A;  4JBB A;  2DIZ A;  1PL1 A;  1TK0 B;  4KA0 A;  2GSS A;  1CQG A;  3VLN A;  1V98 A;  2DJK A;  3WT1 A;  4PQI A;  4XCS A;  5CYY A;  1T3B A;  2YV7 A;  5D93 A;  3W8S A;  4K7I A;  3F4S A;  3ZZX A;  3Q18 A;  3MAK A;  3TDG A;  2FHE A;  2N5B A;  2JU5 A;  4EL1 A;  1G7E A;  4PUA A;  3WD6 A;  2JZR A;  2HI7 A;  1TJD A;  2K8S A;  4ZL8 A;  5ECM B;  1GSF A;  1YF0 A;  3O3T A;  3TCO A;  3TRP A;  1J0F A;  1OVN A;  3DEX A;  4YAP A;  3GKK A;  2A2S A;  2O89 A;  2H1D A;  4LMV A;  2H0G A;  2TRC P;  4JR4 A;  4OO5 A;  2AAW A;  1JZW A;  3VWX A;  2I1U A;  4TVE A;  1PMT A;  1SK2 A;  2LS5 A;  3RPN A;  4GLT A;  3DRN A;  1FOV A;  2FCH A;  1AUC A;  3H79 A;  4WR5 A;  4KW6 A;  2CV4 A;  2IJY A;  1WIK A;  1V58 A;  4NAX A;  2WCI A;  4O7H A;  3VWV A;  2JSY A;  2OE0 A;  3C8E A;  5A4U A;  2FA8 A;  2IME A;  3CBU A;  3GL3 A;  4WF4 A;  4PNF A;  2X8C A;  2LRN A;  4K1F A;  3TUE A;  1TOF A;  1G6W A;  1M9A A;  4IKH A;  3D4T A;  3RHB A;  3LYP A;  1NSW A;  3JCM L;  1LBK A;  2FUG 2;  5C04 A;  4POM A;  2L5O A;  3LWA A;  5EPF A;  4EDY A;  2CQ9 A;  3WYW A;  2GGT A;  4I6X A;  1PA3 A;  3LEF A;  3VUR A;  3TKQ A;  2PVQ A;  4NV2 A;  5IMZ A;  3L78 A;  2MBT A;  2C80 A;  2MMZ A;  2DJ1 A;  1RQM A;  1FW1 A;  2VCT A;  4ECI A;  2LUS A;  2B5X A;  5FWG A;  4N0V A;  5LNK e;  5J5N A;  1PL2 A;  5ECN B;  3FK8 A;  2DBC A;  1PX6 A;  3C73 A;  1TRS A;  4K7O A;  5JCU A;  3ZMK A;  4JU5 A;  1U3A A;  2CAQ A;  1YJ6 A;  1TU8 A;  1QUW A;  1M2B A;  1O8W A;  4YQV A;  2C0G A;  1G6Y A;  4F0B A;  2GQL A;  4DSS B;  1GH2 A;  3APO A;  2OJL A;  1B48 A;  2FWG A;  1WPI A;  2LKU A;  5A5K A;  2FNO A;  4MP4 A;  1F3B A;  1XFL A;  1U88 A;  4IQA A;  5E59 A;  2MMO A;  3CMI A;  4ID0 A;  3CTG A;  1WJK A;  5ELA A;  3Q74 A;  3APQ A;  3VPQ A;  2ON7 A;  4N0Z A;  1GUK A;  4IBP A;  2BTO T;  3EC3 A;  3C1S A;  1GSE A;  3D21 A;  4PUR A;  2BMX A;  5DBQ A;  2CVK A;  6GSW A;  4WXT A;  3FYG A;  2OBI A;  2LJA A;  2REM A;  3KXO A;  1CQH A;  1W4V A;  3C7M A;  2CAI A;  4WBJ A;  2XC2 A;  3IV4 A;  2MBS A;  2L6C A;  3HD5 A;  2FWE A;  2TRX A;  2YNX A;  3BBY A;  4O92 A;  1O73 A;  2B6M A;  1TK8 B;  1F9M A;  2P0G A;  4QL7 A;  3TRX A;  5D8I A;  2GQM A;  4H86 A;  7GSS A;  2VIM A;  1AQV A;  1JLW A;  1SYX A;  2B7K A;  1B4Q A;  4JRR A;  3K8N A;  2VL2 A;  1F3A A;  3FRC A;  1SKS B;  3RPP A;  1SYR A;  1SKR B;  1XW5 A;  2O8V B;  4ZBB A;  2IWT A;  1X9S B;  5ECK B;  2PWJ A;  1KTE A;  5ECI B;  3UOM A;  4TOP A;  1YEP A;  3GA4 A;  2VLU A;  1TTZ A;  2CT6 A;  5CRG A;  5IIZ A;  3DIE A;  3QCP A;  4POK A;  3GRX A;  5DCG A;  2VUP A;  2JAD A;  1FG4 A;  4LA1 A;  2VLT A;  1ZGN A;  3I6A A;  3KD0 A;  3GTU B;  2WJU A;  3D6I A;  1GSU A;  2H71 A;  1KNG A;  2H75 A;  5FHI A;  1K3L A;  5D9X A;  4KE3 A;  4EF0 A;  2VCW A;  2GTU A;  4XHM A;  1HYU A;  3DML A;  12GS A;  3GH6 A;  5G5F A;  2YN1 A;  4AJ8 A;  20GS A;  3QR6 A;  3E0U A;  3GUS A;  2GZZ A;  4OFN A;  4TR0 A;  2VO4 A;  1ZYQ B;  4GST A;  1QK8 A;  1GTB A;  2H76 A;  3F9U A;  3ZL5 A;  4I5Q A;  3TGZ A;  4FYU A;  5EY6 A;  2WRT A;  2L57 A;  3D4M A;  3LGC A;  2MMA A;  4OCE A;  3UVT A;  3F3R A;  4IS0 A;  2XBI A;  2H6X A;  1DE1 A;  4MCU A;  4IJ3 A;  4P3Y B;  2CVB A;  4X0X A;  2B1L A;  3HZ8 A;  3ZIT A;  1UN2 A;  3A2X A;  1XVQ A;  1Z6M A;  5J41 A;  1U6T A;  4DSQ A;  4EVM A;  2IIY A;  4POB A;  2C4J A;  2LQO A;  3C71 A;  4FH8 A;  3E9J B;  3L9V A;  2H19 A;  6GSX A;  2I4A A;  1NM3 A;  2V6O A;  2IMK A;  3A3T A;  2FY6 A;  4DSR A;  4D73 A;  1MD3 A;  1PD2 1;  1ERV A;  1GTI A;  1VRS D;  3F6D A;  1WWJ A;  4G2E A;  1X9W B;  5IOW A;  2HZF A;  3GKM A;  3LQ7 A;  3TOT A;  1OKD A;  5ECQ B;  1GUM A;  1F6M C;  5AIX A;  3APS A;  1N8J A;  1I5G A;  3M9J A;  3CYN A;  2LRC A;  1JFU A;  2L5L A;  1NHY A;  4L8E A;  3RDW A;  2GSR A;  5DJM A;  5HQP A;  1QQ2 A;  2NBS A;  3M3M A;  1BYE A;  3UBK A;  3ME8 A;  1Z9H A;  4F03 A;  2FLS A;  4NHW A;  1DSB A;  4MF7 A;  5G1L A;  3EE2 A;  4TN8 A;  3KP9 A;  2M80 A;  1A0F A;  1RW1 A;  4ECC A;  2YOI A;  3GKX A;  3VWU A;  1JZD A;  4ML6 A;  4MJE A;  2PUK C;  5G2Z A;  3FY7 A;  2CZ3 A;  4YAV A;  3CRU A;  2NDO A;  1S3C A;  4IP1 A;  4Q5Q A;  4L5O A;  4MH2 A;  3DYR A;  5ECL B;  3PIN A;  1GNW A;  2DJ3 A;  3QMX A;  4Q5F A;  4KSM A;  1JZO A;  3W6G A;  5AN1 A;  1EV9 A;  1OC3 A;  5GZZ B;  3D22 A;  3VI7 A;  1YZX A;  2GLR A;  2DIY A;  3GX8 A;  1QFN A;  4V2N A;  1VF1 A;  5EL8 A;  5HR1 A;  2PMT A;  2XPE A;  2P5R A;  3CSH A;  4FYC A;  2V41 A;  5KN1 A;  4LMW A;  3V1W A;  1A0R P;  3ZML A;  1TRW A;  3GNJ A;  3Q6O A;  2GZP A;  2YZH A;  5IMC A;  2EIO A;  4MZC A;  3TRQ A;  4LL4 B;  4MMM A;  3A5W A;  5D9W A;  1PSQ A;  4PXO A;  3OR5 A;  4J2F A;  5CRD A;  1THO A;  2FA4 A;  14GS A;  3HKR A;  2WGR A;  1HNB A;  3LSZ A;  5AIS A;  3HVV A;  2O7K A;  4IHU A;  2F51 A;  3FR9 A;  3KH9 A;  1AQW A;  1F37 A;  5IOX A;  4K6X A;  2QKE A;  2AB6 A;  3FKF A;  3GKN A;  1X5E A;  2VL2 C;  2B5E A;  5CP1 A;  1K0N A;  4BVY A;  2WB9 A;  2KP2 A;  5ELG A;  5JWR B;  5LCZ A;  4ZXG A;  1TI3 A;  2HNL A;  2B5Y A;  2OKA A;  2X99 A;  1B9X C;  2N5A A;  1XIY A;  3VK9 A;  1AW9 A;  2L6D A;  1V2A A;  1GTA A;  4IP6 A;  1TRV A;  2RM5 A;  3TKS A;  1HQO A;  1Z5Y E;  1G0T A;  1A2L A;  3IAS 2;  5FT3 A;  3QDN A;  1EZK A;  1PKZ A;  5CO3 A;  3KTL A;  2HSY A;  3CRT A;  3CXG A;  3GUR A;  1SL0 B;  3F8U A;  1ZL9 A;  2IMI A;  1SJI A;  2WS2 A;  6GSS A;  2F9S A;  19GS A;  1GSD A;  3GSS A;  1AQX A;  2H30 A;  4PNG A;  2MYG A;  2R5G A;  4GQC A;  2LEG A;  2YWM A;  2VCQ A;  3TKR A;  4IEL A;  6GSV A;  4HZ4 A;  2E0Q A;  4WR4 A;  3I69 A;  4TR3 A;  2HRF A;  3TKP A;  1QGV A;  4HDE A;  1XW9 A;  1ACV A;  5GAP D;  3HVS A;  2E2M A;  1MEK A;  2OAC A;  1XPV A;  4PGT A;  4DVC A;  4XRD A;  1M2A A;  1MDI A;  1YY7 A;  3MDK A;  4MJA A;  3TJK A;  3DXB A;  3W8J A;  3J7Y b;  2LTK A;  5CRW A;  4MK3 A;  4BWQ A;  5DQY A;  3HY2 A;  2YWI A;  5GST A;  4KX4 A;  2HFD A;  4OMV A;  2HXK A;  1HD2 A;  2I9H A;  1GWC A;  2K6V A;  2HRN A;  1ILO A;  1EWX A;  2B7J A;  4NWY A;  1VF2 A;  2GT6 A;  3SBC A;  5F8B A;  5DVB A;  4XTS A;  1IYH A;  1U87 A;  2GT5 A;  4GSS A;  5F05 A;  2EIQ A;  4RQX A;  2X64 A;  4GWR A;  4OCF A;  4WF5 A; 
#chains in the Genus database with same CATH topology
 1U3I A;  4HOJ A;  2K8V A;  4V2M A;  2H74 A;  2OE1 A;  3GMF A;  2F8A A;  1UA5 A;  4N10 A;  5DDL A;  4WET A;  3MNG A;  4JED A;  4LL1 B;  3VI5 A;  3CSJ A;  1KEB A;  4A5P A;  1S3D A;  5IO2 A;  1MDJ A;  2HZE A;  4G9H A;  4MNN A;  1XZO A;  4G0L A;  1H75 A;  3BCI A;  1TXX A;  2IFQ B;  3PGT A;  1WE0 A;  1OYJ A;  4TRX A;  4KDU A;  1A8Y A;  3ZTL A;  1ST9 A;  2IFQ A;  4CW9 A;  1TW9 A;  4K2D A;  2H0I A;  3KIJ A;  3ERW A;  1YQ1 A;  3LG6 A;  3F0I A;  4F82 A;  3VWW A;  3LFL A;  1XOB A;  1BAY A;  2G2Q A;  4K7N A;  5ECR B;  3LW9 A;  1A24 A;  2PGT A;  2I81 A;  2R0P A;  4GSN A;  5CRE A;  1LJR A;  4I8B A;  1WRY A;  2C0D A;  1EOG A;  4EXJ A;  2DJ2 A;  4KF9 A;  2TIR A;  2WFC A;  1MDK A;  1M99 A;  1ZMA A;  4KSO A;  3NZN A;  1K0A A;  1O6J A;  2C3N A;  2AUV A;  4FQU A;  2GVP A;  2H6Y A;  4PX1 A;  1O8X A;  3DVX A;  4MPF A;  4LLR A;  4HQZ A;  1M3I A;  4ZBA A;  1AC1 A;  5HFI A;  2C1Y A;  1X5C A;  1GL8 A;  3H4K A;  5J3R A;  5DAL A;  3EVI A;  3SWL A;  4XS4 A;  4AGS A;  4CDO A;  2VCX A;  1FO5 A;  4BL7 A;  3KH7 A;  2DJ0 A;  1GUL A;  2XHF A;  1ZOF A;  3CSI A;  5AIV A;  2VLV A;  4RUV A;  4NMU A;  1EEM A;  4MF6 A;  3EYT A;  1QXH A;  4GCI A;  1WP0 A;  1T4Z A;  1XG8 A;  4ACS A;  3ERG A;  1URM A;  1WOU A;  3UBL A;  6GSY A;  2PN8 A;  2ON5 A;  2HYX A;  2OE3 A;  1HNC A;  1O85 A;  4KB3 A;  1DBY A;  5D9T A;  1YEX A;  3TKS C;  3M0F A;  5G31 A;  4J57 E;  4ECJ A;  5ECP B;  3R2Q A;  1NHO A;  2NTO A;  3TJJ A;  5KN0 A;  3N5O A;  4L0W A;  3GX0 A;  3LXZ A;  1PKW A;  3ZFB A;  5F06 A;  5B6N A;  4OD7 A;  1SJZ A;  3MSZ A;  5KN3 A;  2RUE A;  5HR3 A;  8GSS A;  4EO3 A;  4FIW A;  2YZU A;  1FHE A;  4NXI A;  1GLP A;  3VPT A;  5A4V A;  4K0N A;  1OAZ A;  2H70 A;  5IMA A;  5GSS A;  2AV4 A;  4BIK A;  5D9V A;  3LXT A;  4GTU A;  4D73 B;  2JAC A;  1K0C A;  1FB0 A;  5COH A;  1XWB A;  2X49 A;  2OA7 A;  2ZCT A;  3MYD A;  4GXZ A;  4ZB9 A;  4MLY A;  5CAX A;  3HZ4 A;  5ENU A;  3GST A;  1EEJ A;  2QC7 A;  4XIH A;  4KDX A;  5IMV A;  1Y6E A;  2L4C A;  3HCZ A;  3L4N A;  4IN0 A;  2BJX A;  4X4J A;  1ZCP A;  5F07 A;  4ULX A;  4AJ7 A;  4FYB A;  2GDR A;  2R3X A;  4RI6 A;  1GSS A;  1TRU A;  1LU4 A;  2VL3 A;  5D96 A;  2P31 A;  4TR1 B;  2YJ7 A;  5B8A A;  2FWF A;  5ECH B;  2XBQ A;  2VCV A;  2L59 A;  3D5J A;  3GV1 A;  5E4W A;  2LQQ A;  4I97 A;  2B3S A;  3IOS A;  4MPG A;  3G7J A;  4TR1 A;  3S9F A;  2AJQ B;  3Q19 A;  4RQR A;  2YCD A;  1ZYE A;  1SD8 A;  4I2U A;  3MWH A;  3IC4 A;  3CQF A;  3P8W A;  4EKZ A;  3A2V A;  1TKD B;  4MJC A;  3IR4 A;  1EV4 A;  2L4Q A;  2GST A;  4K8M A;  1ERW A;  3TB2 A;  4V1A g;  2FD3 A;  1E2Y A;  5F0G A;  3IPZ A;  3HJP A;  1X5D A;  3O76 A;  4V1A p;  1J08 A;  2JZS A;  5H5Q A;  1T7P B;  3M8N A;  3HVX A;  1PFO A;  1VGL A;  3KMO A;  3IAM 2;  5ID2 B;  3H8Q A;  3KP8 A;  1Y25 A;  3DWV A;  3KEB A;  3VFI A;  3EUR A;  1TU7 A;  1OC9 A;  3R3E A;  4N11 A;  2DMM A;  3C1R A;  2YWN A;  3H93 A;  1A2J A;  5JCW A;  5ID2 A;  3M1G A;  2KLX A;  4KCA A;  2H66 A;  3BOA A;  1B8X A;  1J9B A;  1YKC A;  2MMN A;  4MJB A;  1SEN A;  4Z2U A;  4I2T A;  4WBR D;  5HR0 A;  3QFB C;  3WGX A;  4WKW A;  4BVY B;  2XPD A;  2YJH A;  5KOW A;  1SJ6 A;  3F4R A;  1M2D A;  2NVL A;  3KMN A;  5JWO B;  2LNT A;  2FGX A;  1I9D A;  4V2L A;  3QPM A;  2C0E A;  5BRT A;  1EGO A;  2QGV A;  4KGI A;  1PQN A;  3L0H A;  2R2J A;  2AHE A;  2KOK A;  5KOX A;  5J9C A;  2DSA A;  2DJJ A;  2KP1 A;  4GQF A;  2D2Z A;  4EDZ A;  3N9J A;  1Q4J A;  2GQK A;  2HLS A;  1G7O A;  2A2R A;  4HZ2 A;  1SU9 A;  4CHS A;  3IRA A;  2HE3 A;  3ZYW A;  3HA9 A;  1PX7 A;  2R0C A;  4F0C A;  2VM2 A;  2C0F A;  5GAN D;  1EGR A;  1K0M A;  3FEU A;  3TOU A;  3DVW A;  4KDY A;  2O87 A;  2H1B A;  1R4W A;  1V9W A;  5KEJ A;  2VOC A;  2YV9 A;  3FHK A;  3GYK A;  3UVH A;  4ZL7 A;  1A23 A;  1B9Y C;  2VL9 A;  4CY6 A;  3ME7 A;  1TK5 B;  4NV5 A;  1XWC A;  3LOR A;  1PRX A;  2EIR A;  4KH7 A;  2MZC A;  3IXR A;  2HT9 A;  2J9H A;  3MIX A;  1USB A;  1ON4 A;  1T4Y A;  4KND A;  2GZY A;  1XWA A;  1GSQ A;  1R26 A;  5L71 A;  1RK4 A;  2H73 A;  3WGE A;  1MTC A;  4USS A;  4Q5R A;  1XXU A;  4JZQ A;  5B7C A;  2VD0 A;  5JCG A;  2V1M A;  3US3 A;  2A4H A;  4KUN A;  1VF4 A;  1SKW B;  2E2G A;  4ICY A;  4K5R A;  5J9B A;  3ZIJ A;  2F8F A;  4MA9 A;  1S3A A;  4EUY A;  4HUA A;  3IE3 A;  5G30 A;  2V6K A;  4Z7X A;  4EE0 A;  1K0O A;  5IPH A;  3LYK A;  1QMV A;  1ABA A;  1FVJ A;  3RBT A;  3ZRD A;  1GSY A;  6GSU A;  2ZUP A;  5IMD A;  3IK9 A;  3IHQ A;  4NHZ A;  3U6V A;  1E6B A;  2M46 A;  2DLX A;  1BED A;  1AXD A;  1F2E A;  2JL4 A;  3P2A A;  2HSH A;  3QFA C;  4G10 A;  4L5L A;  4OWY A;  3P7X A;  4WEY A;  3HJM A;  3IBH A;  3HYP A;  1SK1 A;  1XWK A;  2I3Y A;  3GIX A;  3UAR A;  4IVF A;  2HZE B;  5D73 A;  4ML1 A;  1X9M B;  3AY8 A;  3LJR A;  1XOA A;  3RHC A;  3UMA A;  2K9F A;  3ZVJ D;  3HDC A;  3CTF A;  11GS A;  5G5E A;  5H5R A;  4XRA A;  1OE8 A;  4BWS A;  3UAP A;  4QL9 A;  5HFG A;  3QD9 A;  4MDC A;  1GLQ A;  1Z7R A;  2IL3 A;  4MAB A;  4X1U A;  16GS A;  2YAN A;  1AIU A;  2JZT A;  1T00 A;  3G7Y A;  4TXO B;  1XVW A;  3L9U A;  2WUL A;  4ECB A;  5DCH A;  4OFM A;  2R4V A;  1B4P A;  1NW2 A;  3EU4 A;  2ALB A;  3O6T A;  4F9Z A;  4DSS A;  3RAZ A;  3DGQ A;  2M72 A;  4TXO A;  1V57 A;  2IN3 A;  3A2W A;  5JWQ B;  1BJX A;  1BX9 A;  3TJB A;  2R37 A;  5CRH A;  3PPU A;  2IPA A;  4HJM A;  4OFT A;  2WZ9 A;  3U5R E;  2H6Z A;  4K9Z A;  3NIV A;  3ZRE A;  4L0U A;  3UIW A;  1OC8 A;  2GS3 A;  2R6K A;  3D0Z A;  3NOF A;  1M9B A;  3EIN A;  1SL2 B;  2V2G A;  4MZW A;  1ML6 A;  1FVK A;  3KCM A;  2RUF A;  2LNS A;  2F3M A;  4EC0 A;  4GF0 A;  1O81 A;  1GP1 A;  4ZBD A;  3IDV A;  1GNE A;  1K3O A;  3DD3 A;  3GL5 A;  2H01 A;  1XW6 A;  2JSZ A;  3FW2 A;  3BCK A;  2G0F A;  2LST A;  4ZB8 A;  4IW9 A;  1GRX A;  2H1A A;  3ERF A;  3ED3 A;  2RII A;  3KZQ A;  4HI7 A;  1GUH A;  5DAL B;  2J23 A;  4POL A;  3UJ1 A;  4YKG A;  2VM1 A;  1N2A A;  4DEJ A;  5C00 A;  4XS4 B;  1X0R A;  3TKS E;  1T1V A;  4Q5N A;  4BL7 B;  1YKA A;  4ZIL A;  5ECS A;  4PQ1 A;  3E3E A;  2CZ2 A;  1DE2 A;  2KUC A;  4JR6 A;  4YQU A;  1SK0 A;  1EP8 A;  5ECO B;  4ZB6 A;  1OE7 A;  4KAE A;  4N30 A;  1O7U A;  2PER A;  2OBK A;  5LD0 A;  3ZLP A;  4HEA 2;  1UVZ A;  2OAD A;  1Z6N A;  1C72 A;  2ES7 A;  5CNW A;  3EMP A;  5IM9 A;  3FR6 A;  2KHP A;  4YQM A;  5KN2 A;  1IYI A;  1V40 A;  3FZA A;  4G19 A;  3ZIV A;  1T8E B;  1JZR A;  1JLV A;  1PN9 A;  5ABR A;  3KGK A;  5EVO A;  22GS A;  4ILF A;  5HFK A;  2LJK A;  18GS A;  1WMJ A;  17GS A;  1JHB A;  3GTU A;  3WT2 A;  2PPT A;  4IJI A;  9GSS A;  2B1K A;  2VAF A;  4BPY A;  1PGT A;  2RLI A;  3I43 A;  3GFK A;  6GST A;  3J7Y k;  5IPG A;  2C8U A;  3P90 A;  1XWG A;  3EMX A;  3HVN A;  1THX A;  1A8L A;  1R7H A;  3WGD A;  4GRF A;  4E8E A;  4PQH A;  3PH9 A;  4G0I A;  2CX3 A;  2FWH A;  2YP6 A;  2VD1 A;  3L9S A;  1BG5 A;  4Z2T A;  2RM6 A;  1M0U A;  4HQS A;  3HXS A;  4ISD A;  3TJF A;  1Z7P A;  1YF1 A;  1VF3 A;  2H72 A;  4TKY A;  5AGY A;  4F2I A;  3GH9 A;  1XCC A;  1FAA A;  2N5F A;  2C3T A;  2H0H A;  5B6M A;  2QSI A;  3M9K A;  3DKS A;  5IO0 A;  3UEM A;  4JE1 A;  2YWO A;  1M7T A;  4HJ2 A;  1DUG A;  1EP7 A;  1R5A A;  3A5I A;  4O5R A;  2PBJ A;  3F63 A;  5G1K A;  2K18 A;  4MF5 A;  1YDK A;  2YPM A;  3QAV A;  2H8L A;  5DAK B;  1EOH A;  3HJO A;  2LRT A;  2V32 A;  3G9B A;  4AF2 A;  1Q98 A;  4BA7 A;  4HS1 A;  3FZ4 A;  3UL3 A;  5B8B A;  4E8H A;  1K0B A;  5DAK A;  4ZL9 A;  3PR8 A;  2CA8 A;  4X43 A;  1OKT A;  2X8G A;  3FZ5 A;  3H1N A;  2LJR A;  1ERU A;  1MD4 A;  1Z3E A;  2X8H A;  2HRK A;  2E7P A;  4XS6 A;  4QQ7 A;  1SL1 B;  2IMF A;  1W89 A;  2GSQ A;  3GN3 A;  1K3Y A;  3KJY A;  1K0D A;  4TR4 A;  2AYT A;  10GS A;  4TW5 A;  5HR2 A;  3KTB A;  3QAW A;  2EC4 A;  2Z9S A;  3ISO A;  1A2M A;  1UC7 A;  4K0G A;  5H5S A;  5J4U A;  4BVX B;  4J56 E;  3F6F A;  2H1G A;  4FO5 A;  4YH2 A;  2DC5 A;  2HSM A;  3GHA A;  4ZIJ A;  5A4W A;  3F4T A;  4TXV A;  4BVX A;  3EWL A;  2WDU A;  2C3Q A;  4KCE A;  1ERT A;  3G7I A;  4XS1 A;  4MZB A;  3BD2 A;  3HHV A;  2ZNM A;  4RI7 A;  3I9V 2;  1OC9 B;  2IMD A;  3ZVJ A;  1ZZY A;  2NPB A;  3BJ5 A;  2DML A;  2O85 A;  13GS A;  1HNA A;  3FZ9 A;  3IK7 A;  4MH3 A;  1BQ7 A;  2PVO C;  2VCZ A;  5INY A;  4PUF C;  4IQ1 A;  2LV3 A;  2PU9 C;  1GTU A;  4NPB A;  1R5P A;  1TDI A;  4HU9 A;  4IGJ A;  4HU7 A;  1TI1 A;  5DQS A;  5IQY A;  2A4V A;  4AJ6 A;  3FR3 A;  3IA1 A;  5DJL A;  5IMF A;  1H4O A;  1AAZ A;  3F3Q A;  2P5Q A;  3QOU A;  3EU3 A;  1FB6 A;  2CX4 A;  3KM6 A;  1XBS A;  1TP9 A;  4OO4 A;  3TJG A;  3QAG A;  1KBN A;  2CVD A;  4O32 A;  3ZFL A;  1SD9 A;  4JBB A;  2DIZ A;  1PL1 A;  1TK0 B;  4KA0 A;  2GSS A;  1CQG A;  3VLN A;  1V98 A;  2DJK A;  3WT1 A;  4PQI A;  4XCS A;  5CYY A;  1T3B A;  2HRA A;  2YV7 A;  5D93 A;  3W8S A;  4K7I A;  3F4S A;  3ZZX A;  3Q18 A;  3MAK A;  3TDG A;  2FHE A;  2N5B A;  2JU5 A;  4EL1 A;  1G7E A;  4PUA A;  3WD6 A;  2JZR A;  2HI7 A;  1TJD A;  2K8S A;  4ZL8 A;  5ECM B;  1GSF A;  1YF0 A;  3O3T A;  3TCO A;  3TRP A;  1J0F A;  1M3J A;  1OVN A;  3DEX A;  4YAP A;  3GKK A;  2A2S A;  2R0G A;  2O89 A;  2H1D A;  2DKH A;  4LMV A;  2H0G A;  2TRC P;  4JR4 A;  4EIP A;  4OO5 A;  2AAW A;  1JZW A;  3VWX A;  2I1U A;  4TVE A;  1PMT A;  1SK2 A;  2LS5 A;  3RPN A;  4GLT A;  3DRN A;  1FOV A;  2FCH A;  1AUC A;  3H79 A;  4WR5 A;  4KW6 A;  2CV4 A;  2IJY A;  1WIK A;  1V58 A;  4NAX A;  2WCI A;  4O7H A;  3VWV A;  2JSY A;  2OE0 A;  3C8E A;  5A4U A;  2FA8 A;  2IME A;  3CBU A;  3GL3 A;  3IHG A;  4WF4 A;  4PNF A;  2X8C A;  2LRN A;  4K1F A;  3TUE A;  1TOF A;  1G6W A;  1M9A A;  4IKH A;  3D4T A;  3RHB A;  3LYP A;  1NSW A;  3JCM L;  1LBK A;  2FUG 2;  3IC8 A;  4POM A;  5C04 A;  2L5O A;  3LWA A;  5EPF A;  4EDY A;  2CQ9 A;  4K5S A;  3WYW A;  2GGT A;  4I6X A;  1PA3 A;  3LEF A;  3VUR A;  3TKQ A;  2PVQ A;  4NV2 A;  4EIQ A;  5IMZ A;  3L78 A;  2MBT A;  2C80 A;  2MMZ A;  2DJ1 A;  1RQM A;  1FW1 A;  2VCT A;  4ECI A;  2LUS A;  2B5X A;  5FWG A;  4N0V A;  5LNK e;  5J5N A;  1PL2 A;  5ECN B;  3FK8 A;  2DBC A;  1PX6 A;  3C73 A;  1TRS A;  4K7O A;  5JCU A;  3ZMK A;  4JU5 A;  1U3A A;  2CAQ A;  1YJ6 A;  1TU8 A;  1QUW A;  1M2B A;  1O8W A;  4YQV A;  2C0G A;  1G6Y A;  4F0B A;  2GQL A;  4DSS B;  1GH2 A;  3APO A;  2OJL A;  1ZYP A;  1B48 A;  2FWG A;  1WPI A;  2LKU A;  5A5K A;  2FNO A;  4MP4 A;  1F3B A;  1XFL A;  1U88 A;  4IQA A;  5E59 A;  2MMO A;  3CMI A;  4ID0 A;  3CTG A;  1WJK A;  5ELA A;  3Q74 A;  3APQ A;  3VPQ A;  2ON7 A;  4N0Z A;  1GUK A;  4IBP A;  2BTO T;  3EC3 A;  4PUR A;  3C1S A;  1GSE A;  3D21 A;  2BMX A;  5DBQ A;  2CVK A;  6GSW A;  4WXT A;  3FYG A;  2OBI A;  2LJA A;  2REM A;  3KXO A;  1CQH A;  1W4V A;  3C7M A;  2CAI A;  4WBJ A;  2XC2 A;  3IV4 A;  2MBS A;  2L6C A;  3HD5 A;  2FWE A;  2TRX A;  2YNX A;  3BBY A;  4O92 A;  1O73 A;  2B6M A;  1TK8 B;  1F9M A;  2P0G A;  4QL7 A;  3TRX A;  5D8I A;  2GQM A;  4H86 A;  7GSS A;  2VIM A;  1AQV A;  1JLW A;  1SYX A;  2B7K A;  1B4Q A;  4JRR A;  3K8N A;  2VL2 A;  1F3A A;  3FRC A;  1SKS B;  3RPP A;  1SYR A;  1SKR B;  1XW5 A;  2O8V B;  4ZBB A;  2IWT A;  1X9S B;  5ECK B;  2PWJ A;  1KTE A;  5ECI B;  3UOM A;  4TOP A;  1YEP A;  3GA4 A;  2VLU A;  1TTZ A;  2CT6 A;  5CRG A;  5IIZ A;  3DIE A;  3QCP A;  4POK A;  3GRX A;  5DCG A;  2VUP A;  2JAD A;  1FG4 A;  4LA1 A;  2VLT A;  1ZGN A;  3I6A A;  3KD0 A;  2A2P A;  3GTU B;  2WJU A;  3D6I A;  1GSU A;  2H71 A;  1KNG A;  2H75 A;  2X4A A;  1K3L A;  5FHI A;  5D9X A;  4KE3 A;  4EF0 A;  2VCW A;  2GTU A;  4XHM A;  1HYU A;  3DML A;  12GS A;  3GH6 A;  5G5F A;  2YN1 A;  4AJ8 A;  20GS A;  3QR6 A;  3E0U A;  3GUS A;  4PTS A;  2GZZ A;  4OFN A;  4TR0 A;  2VO4 A;  1ZYQ B;  4GST A;  1QK8 A;  1GTB A;  2H76 A;  3F9U A;  3ZL5 A;  4I5Q A;  3TGZ A;  4FYU A;  5EY6 A;  2WRT A;  2L57 A;  2QA1 A;  3D4M A;  3LGC A;  2MMA A;  4OCE A;  3UVT A;  3F3R A;  4IS0 A;  1S3R A;  2H6X A;  2XBI A;  1DE1 A;  4MCU A;  4IJ3 A;  4P3Y B;  2CVB A;  4X0X A;  2B1L A;  3HZ8 A;  3ZIT A;  1UN2 A;  3A2X A;  1XVQ A;  1Z6M A;  5J41 A;  1U6T A;  4DSQ A;  4EVM A;  2IIY A;  4POB A;  2C4J A;  2LQO A;  3C71 A;  4FH8 A;  3E9J B;  3L9V A;  2H19 A;  6GSX A;  2I4A A;  1NM3 A;  2V6O A;  2IMK A;  3A3T A;  1FOH A;  2FY6 A;  4DSR A;  4D73 A;  1MD3 A;  1PD2 1;  2QA2 A;  1ERV A;  1GTI A;  1VRS D;  3F6D A;  1WWJ A;  4G2E A;  1X9W B;  5IOW A;  2HZF A;  3GKM A;  3LQ7 A;  3TOT A;  1OKD A;  5ECQ B;  1GUM A;  1F6M C;  5AIX A;  3APS A;  1N8J A;  1I5G A;  3M9J A;  3CYN A;  2LRC A;  1JFU A;  2L5L A;  1NHY A;  4L8E A;  3RDW A;  2GSR A;  5DJM A;  5HQP A;  1QQ2 A;  2NBS A;  3M3M A;  1BYE A;  3UBK A;  3ME8 A;  1Z9H A;  4F03 A;  2FLS A;  4NHW A;  1DSB A;  4MF7 A;  5G1L A;  3EE2 A;  4TN8 A;  3KP9 A;  2M80 A;  1A0F A;  1RW1 A;  4ECC A;  2YOI A;  3GKX A;  3VWU A;  1JZD A;  4ML6 A;  4MJE A;  2PUK C;  5G2Z A;  3FY7 A;  2CZ3 A;  3CRU A;  4YAV A;  2NDO A;  1S3C A;  4IP1 A;  4Q5Q A;  4L5O A;  4MH2 A;  3DYR A;  5ECL B;  3PIN A;  1GNW A;  4O5U A;  2DJ3 A;  3QMX A;  4Q5F A;  5BMU A;  4KSM A;  1JZO A;  3W6G A;  5AN1 A;  1EV9 A;  1OC3 A;  5GZZ B;  3D22 A;  2UZ8 A;  3VI7 A;  1YZX A;  2GLR A;  2DIY A;  3GX8 A;  1QFN A;  4V2N A;  1VF1 A;  5EL8 A;  5HR1 A;  2PMT A;  2XPE A;  2P5R A;  4YKF A;  3CSH A;  4FYC A;  2V41 A;  5KN1 A;  4LMW A;  3V1W A;  1A0R P;  3ZML A;  1TRW A;  4CY8 A;  3GNJ A;  3Q6O A;  2GZP A;  2YZH A;  5IMC A;  2EIO A;  4MZC A;  3TRQ A;  4LL4 B;  4MMM A;  3A5W A;  5D9W A;  1PSQ A;  4PXO A;  3OR5 A;  4J2F A;  5CRD A;  1THO A;  2FA4 A;  14GS A;  3EPT A;  3HKR A;  2WGR A;  1HNB A;  3LSZ A;  5AIS A;  3HVV A;  2O7K A;  4IHU A;  4K2X A;  2F51 A;  3FR9 A;  3KH9 A;  1AQW A;  1F37 A;  5IOX A;  4K6X A;  2QKE A;  2AB6 A;  3FKF A;  3GKN A;  1X5E A;  2VL2 C;  2B5E A;  5CP1 A;  1K0N A;  4BVY A;  2WB9 A;  2KP2 A;  5ELG A;  5JWR B;  1PN0 A;  5LCZ A;  4ZXG A;  1TI3 A;  2HNL A;  2B5Y A;  2OKA A;  2X99 A;  1B9X C;  2N5A A;  1XIY A;  3VK9 A;  1AW9 A;  2L6D A;  1V2A A;  1GTA A;  4IP6 A;  1TRV A;  2RM5 A;  3TKS A;  1HQO A;  1Z5Y E;  1G0T A;  1A2L A;  3IAS 2;  5FT3 A;  2DKI A;  3QDN A;  1EZK A;  1PKZ A;  3FMW A;  5CO3 A;  3KTL A;  2HSY A;  3CRT A;  3CXG A;  3GUR A;  1SL0 B;  3F8U A;  4HSC X;  1ZL9 A;  2IMI A;  1SJI A;  2WS2 A;  6GSS A;  2F9S A;  19GS A;  1GSD A;  3GSS A;  1AQX A;  2H30 A;  4PNG A;  2MYG A;  1ZYN A;  2R5G A;  4GQC A;  2LEG A;  2YWM A;  2VCQ A;  3TKR A;  4IEL A;  6GSV A;  4HZ4 A;  2E0Q A;  4WR4 A;  3I69 A;  4TR3 A;  2HRF A;  3TKP A;  1QGV A;  4HDE A;  1XW9 A;  1ACV A;  5GAP D;  3HVS A;  2E2M A;  1MEK A;  2OAC A;  1XPV A;  4PGT A;  4DVC A;  4XRD A;  1M2A A;  1MDI A;  1YY7 A;  3MDK A;  4MJA A;  3TJK A;  3DXB A;  3W8J A;  3J7Y b;  2LTK A;  5CRW A;  4MK3 A;  4BWQ A;  5DQY A;  3HY2 A;  2YWI A;  5GST A;  4KX4 A;  2HFD A;  4OMV A;  2HXK A;  1HD2 A;  2I9H A;  1GWC A;  4O5Q A;  2K6V A;  2HRN A;  1ILO A;  1EWX A;  2B7J A;  4Z2R A;  4NWY A;  1VF2 A;  2GT6 A;  4G0K A;  3SBC A;  5F8B A;  5DVB A;  4XTS A;  1IYH A;  1U87 A;  2GT5 A;  4GSS A;  5F05 A;  2EIQ A;  4RQX A;  2X64 A;  4GWR A;  4OCF A;  4WF5 A; 
#chains in the Genus database with same CATH homology
 1U3I A;  4HOJ A;  2K8V A;  4V2M A;  2H74 A;  2OE1 A;  3GMF A;  2F8A A;  1UA5 A;  4N10 A;  5DDL A;  4WET A;  3MNG A;  4JED A;  4LL1 B;  3VI5 A;  3CSJ A;  1KEB A;  4A5P A;  1S3D A;  5IO2 A;  1MDJ A;  2HZE A;  4G9H A;  4MNN A;  1XZO A;  4G0L A;  1H75 A;  3BCI A;  1TXX A;  2IFQ B;  3PGT A;  1WE0 A;  1OYJ A;  4TRX A;  4KDU A;  1A8Y A;  3ZTL A;  1ST9 A;  2IFQ A;  4CW9 A;  1TW9 A;  4K2D A;  2H0I A;  3KIJ A;  3ERW A;  1YQ1 A;  3LG6 A;  3F0I A;  4F82 A;  3VWW A;  3LFL A;  1XOB A;  1BAY A;  2G2Q A;  4K7N A;  5ECR B;  3LW9 A;  1A24 A;  2PGT A;  2I81 A;  2R0P A;  4GSN A;  5CRE A;  1LJR A;  4I8B A;  1WRY A;  2C0D A;  1EOG A;  4EXJ A;  2DJ2 A;  4KF9 A;  2TIR A;  2WFC A;  1MDK A;  1M99 A;  1ZMA A;  4KSO A;  3NZN A;  1K0A A;  1O6J A;  2C3N A;  2AUV A;  4FQU A;  2GVP A;  2H6Y A;  4PX1 A;  1O8X A;  3DVX A;  4MPF A;  4LLR A;  4HQZ A;  4ZBA A;  1AC1 A;  5HFI A;  2C1Y A;  1X5C A;  1GL8 A;  3H4K A;  5J3R A;  5DAL A;  3EVI A;  3SWL A;  4XS4 A;  4AGS A;  4CDO A;  2VCX A;  1FO5 A;  4BL7 A;  3KH7 A;  2DJ0 A;  1GUL A;  2XHF A;  1ZOF A;  3CSI A;  5AIV A;  2VLV A;  4RUV A;  4NMU A;  1EEM A;  4MF6 A;  3EYT A;  1QXH A;  4GCI A;  1WP0 A;  1T4Z A;  4ACS A;  3ERG A;  1URM A;  1WOU A;  3UBL A;  6GSY A;  2PN8 A;  2ON5 A;  2HYX A;  2OE3 A;  1HNC A;  1O85 A;  4KB3 A;  1DBY A;  5D9T A;  1YEX A;  3TKS C;  3M0F A;  5G31 A;  4J57 E;  4ECJ A;  5ECP B;  3R2Q A;  1NHO A;  2NTO A;  3TJJ A;  5KN0 A;  3N5O A;  4L0W A;  3GX0 A;  3LXZ A;  1PKW A;  3ZFB A;  5F06 A;  5B6N A;  4OD7 A;  1SJZ A;  3MSZ A;  5KN3 A;  2RUE A;  5HR3 A;  8GSS A;  4EO3 A;  4FIW A;  2YZU A;  1FHE A;  4NXI A;  1GLP A;  3VPT A;  5A4V A;  4K0N A;  1OAZ A;  2H70 A;  5IMA A;  5GSS A;  2AV4 A;  5D9V A;  3LXT A;  4GTU A;  4D73 B;  2JAC A;  1K0C A;  1FB0 A;  5COH A;  1XWB A;  2X49 A;  2OA7 A;  2ZCT A;  3MYD A;  4GXZ A;  4ZB9 A;  4MLY A;  5CAX A;  3HZ4 A;  5ENU A;  3GST A;  1EEJ A;  2QC7 A;  4XIH A;  4KDX A;  5IMV A;  1Y6E A;  2L4C A;  3HCZ A;  3L4N A;  4IN0 A;  2BJX A;  4X4J A;  1ZCP A;  5F07 A;  4ULX A;  4AJ7 A;  4FYB A;  2GDR A;  2R3X A;  4RI6 A;  1GSS A;  1TRU A;  1LU4 A;  2VL3 A;  5D96 A;  2P31 A;  4TR1 B;  2YJ7 A;  5B8A A;  2FWF A;  5ECH B;  2XBQ A;  2VCV A;  2L59 A;  3D5J A;  3GV1 A;  5E4W A;  2LQQ A;  4I97 A;  2B3S A;  3IOS A;  4MPG A;  3G7J A;  4TR1 A;  3S9F A;  2AJQ B;  3Q19 A;  4RQR A;  2YCD A;  1ZYE A;  1SD8 A;  4I2U A;  3MWH A;  3IC4 A;  3P8W A;  4EKZ A;  3A2V A;  1TKD B;  4MJC A;  3IR4 A;  1EV4 A;  2L4Q A;  2GST A;  4K8M A;  1ERW A;  3TB2 A;  4V1A g;  2FD3 A;  1E2Y A;  5F0G A;  3IPZ A;  3HJP A;  1X5D A;  3O76 A;  4V1A p;  1J08 A;  2JZS A;  5H5Q A;  1T7P B;  3M8N A;  3HVX A;  1VGL A;  3KMO A;  3IAM 2;  5ID2 B;  3H8Q A;  3KP8 A;  1Y25 A;  3DWV A;  3KEB A;  3VFI A;  3EUR A;  1TU7 A;  1OC9 A;  3R3E A;  4N11 A;  2DMM A;  3C1R A;  2YWN A;  3H93 A;  1A2J A;  5JCW A;  5ID2 A;  3M1G A;  2KLX A;  4KCA A;  2H66 A;  3BOA A;  1B8X A;  1J9B A;  1YKC A;  2MMN A;  4MJB A;  1SEN A;  4Z2U A;  4I2T A;  4WBR D;  5HR0 A;  3QFB C;  3WGX A;  4WKW A;  4BVY B;  2XPD A;  2YJH A;  5KOW A;  1SJ6 A;  3F4R A;  1M2D A;  2NVL A;  3KMN A;  5JWO B;  2LNT A;  2FGX A;  1I9D A;  4V2L A;  3QPM A;  2C0E A;  5BRT A;  1EGO A;  2QGV A;  4KGI A;  1PQN A;  3L0H A;  2R2J A;  2AHE A;  2KOK A;  5KOX A;  5J9C A;  2DSA A;  2DJJ A;  2KP1 A;  4GQF A;  2D2Z A;  4EDZ A;  3N9J A;  1Q4J A;  2GQK A;  2HLS A;  1G7O A;  2A2R A;  4HZ2 A;  1SU9 A;  4CHS A;  3IRA A;  2HE3 A;  3ZYW A;  3HA9 A;  1PX7 A;  2R0C A;  4F0C A;  2VM2 A;  2C0F A;  5GAN D;  1EGR A;  1K0M A;  3FEU A;  3TOU A;  3DVW A;  4KDY A;  2O87 A;  2H1B A;  1R4W A;  1V9W A;  5KEJ A;  2VOC A;  2YV9 A;  3FHK A;  3GYK A;  3UVH A;  4ZL7 A;  1A23 A;  1B9Y C;  2VL9 A;  4CY6 A;  3ME7 A;  1TK5 B;  4NV5 A;  1XWC A;  3LOR A;  1PRX A;  2EIR A;  4KH7 A;  2MZC A;  3IXR A;  2HT9 A;  2J9H A;  3MIX A;  1USB A;  1ON4 A;  1T4Y A;  4KND A;  2GZY A;  1XWA A;  1GSQ A;  1R26 A;  5L71 A;  1RK4 A;  2H73 A;  3WGE A;  1MTC A;  4USS A;  4Q5R A;  1XXU A;  4JZQ A;  5B7C A;  2VD0 A;  5JCG A;  2V1M A;  3US3 A;  2A4H A;  4KUN A;  1VF4 A;  1SKW B;  2E2G A;  4ICY A;  4K5R A;  5J9B A;  3ZIJ A;  2F8F A;  4MA9 A;  1S3A A;  4EUY A;  4HUA A;  3IE3 A;  5G30 A;  2V6K A;  4Z7X A;  4EE0 A;  1K0O A;  5IPH A;  3LYK A;  1QMV A;  1ABA A;  1FVJ A;  3RBT A;  3ZRD A;  1GSY A;  6GSU A;  2ZUP A;  5IMD A;  3IK9 A;  3IHQ A;  4NHZ A;  3U6V A;  1E6B A;  2M46 A;  2DLX A;  1BED A;  1AXD A;  1F2E A;  2JL4 A;  3P2A A;  2HSH A;  3QFA C;  4G10 A;  4L5L A;  4OWY A;  3P7X A;  4WEY A;  3HJM A;  3IBH A;  3HYP A;  1SK1 A;  1XWK A;  2I3Y A;  3GIX A;  3UAR A;  4IVF A;  2HZE B;  5D73 A;  4ML1 A;  1X9M B;  3AY8 A;  3LJR A;  1XOA A;  3RHC A;  3UMA A;  2K9F A;  3ZVJ D;  3HDC A;  3CTF A;  11GS A;  5G5E A;  5H5R A;  4XRA A;  1OE8 A;  4BWS A;  3UAP A;  4QL9 A;  5HFG A;  3QD9 A;  4MDC A;  1GLQ A;  1Z7R A;  2IL3 A;  4MAB A;  4X1U A;  16GS A;  2YAN A;  1AIU A;  2JZT A;  1T00 A;  3G7Y A;  4TXO B;  1XVW A;  3L9U A;  2WUL A;  4ECB A;  5DCH A;  4OFM A;  2R4V A;  1B4P A;  1NW2 A;  3EU4 A;  2ALB A;  3O6T A;  4F9Z A;  4DSS A;  3RAZ A;  3DGQ A;  2M72 A;  4TXO A;  1V57 A;  2IN3 A;  3A2W A;  5JWQ B;  1BJX A;  1BX9 A;  3TJB A;  2R37 A;  5CRH A;  3PPU A;  2IPA A;  4HJM A;  4OFT A;  2WZ9 A;  3U5R E;  2H6Z A;  4K9Z A;  3NIV A;  3ZRE A;  4L0U A;  3UIW A;  1OC8 A;  2GS3 A;  2R6K A;  3D0Z A;  3NOF A;  1M9B A;  3EIN A;  1SL2 B;  2V2G A;  4MZW A;  1ML6 A;  1FVK A;  3KCM A;  2RUF A;  2LNS A;  2F3M A;  4EC0 A;  4GF0 A;  1O81 A;  1GP1 A;  4ZBD A;  3IDV A;  1GNE A;  1K3O A;  3DD3 A;  3GL5 A;  2H01 A;  1XW6 A;  2JSZ A;  3FW2 A;  3BCK A;  2G0F A;  2LST A;  4ZB8 A;  4IW9 A;  1GRX A;  2H1A A;  3ERF A;  3ED3 A;  2RII A;  3KZQ A;  4HI7 A;  1GUH A;  5DAL B;  2J23 A;  4POL A;  3UJ1 A;  4YKG A;  2VM1 A;  1N2A A;  4DEJ A;  5C00 A;  4XS4 B;  1X0R A;  3TKS E;  1T1V A;  4Q5N A;  4BL7 B;  1YKA A;  4ZIL A;  5ECS A;  4PQ1 A;  3E3E A;  2CZ2 A;  1DE2 A;  2KUC A;  4JR6 A;  4YQU A;  1SK0 A;  1EP8 A;  5ECO B;  4ZB6 A;  1OE7 A;  4KAE A;  4N30 A;  1O7U A;  2PER A;  2OBK A;  5LD0 A;  3ZLP A;  4HEA 2;  1UVZ A;  2OAD A;  1Z6N A;  1C72 A;  2ES7 A;  5CNW A;  3EMP A;  5IM9 A;  3FR6 A;  2KHP A;  4YQM A;  5KN2 A;  1IYI A;  1V40 A;  3FZA A;  4G19 A;  3ZIV A;  1T8E B;  1JZR A;  1JLV A;  1PN9 A;  5ABR A;  3KGK A;  5EVO A;  22GS A;  4ILF A;  5HFK A;  2LJK A;  18GS A;  1WMJ A;  17GS A;  1JHB A;  3GTU A;  3WT2 A;  2PPT A;  4IJI A;  9GSS A;  2B1K A;  2VAF A;  4BPY A;  1PGT A;  2RLI A;  3I43 A;  3GFK A;  6GST A;  3J7Y k;  5IPG A;  2C8U A;  3P90 A;  1XWG A;  3EMX A;  1THX A;  1A8L A;  1R7H A;  3WGD A;  4GRF A;  4E8E A;  4PQH A;  3PH9 A;  4G0I A;  2CX3 A;  2FWH A;  2YP6 A;  2VD1 A;  3L9S A;  1BG5 A;  4Z2T A;  2RM6 A;  1M0U A;  4HQS A;  3HXS A;  4ISD A;  3TJF A;  1Z7P A;  1YF1 A;  1VF3 A;  2H72 A;  4TKY A;  5AGY A;  4F2I A;  3GH9 A;  1XCC A;  1FAA A;  2N5F A;  2C3T A;  2H0H A;  5B6M A;  2QSI A;  3M9K A;  3DKS A;  5IO0 A;  3UEM A;  4JE1 A;  2YWO A;  1M7T A;  4HJ2 A;  1DUG A;  1EP7 A;  1R5A A;  3A5I A;  4O5R A;  2PBJ A;  3F63 A;  5G1K A;  2K18 A;  4MF5 A;  1YDK A;  2YPM A;  3QAV A;  2H8L A;  5DAK B;  1EOH A;  3HJO A;  2LRT A;  2V32 A;  3G9B A;  4AF2 A;  1Q98 A;  4BA7 A;  4HS1 A;  3FZ4 A;  3UL3 A;  5B8B A;  4E8H A;  1K0B A;  5DAK A;  4ZL9 A;  3PR8 A;  2CA8 A;  4X43 A;  1OKT A;  2X8G A;  3FZ5 A;  3H1N A;  2LJR A;  1ERU A;  1MD4 A;  1Z3E A;  2X8H A;  2HRK A;  2E7P A;  4XS6 A;  4QQ7 A;  1SL1 B;  2IMF A;  1W89 A;  2GSQ A;  3GN3 A;  1K3Y A;  3KJY A;  1K0D A;  4TR4 A;  2AYT A;  10GS A;  4TW5 A;  5HR2 A;  3KTB A;  3QAW A;  2EC4 A;  2Z9S A;  3ISO A;  1A2M A;  1UC7 A;  4K0G A;  5H5S A;  5J4U A;  4BVX B;  4J56 E;  3F6F A;  2H1G A;  4FO5 A;  4YH2 A;  2DC5 A;  2HSM A;  3GHA A;  4ZIJ A;  5A4W A;  3F4T A;  4TXV A;  4BVX A;  3EWL A;  2WDU A;  2C3Q A;  4KCE A;  1ERT A;  3G7I A;  4XS1 A;  4MZB A;  3BD2 A;  3HHV A;  2ZNM A;  4RI7 A;  3I9V 2;  1OC9 B;  2IMD A;  3ZVJ A;  1ZZY A;  2NPB A;  3BJ5 A;  2DML A;  2O85 A;  13GS A;  1HNA A;  3FZ9 A;  3IK7 A;  4MH3 A;  1BQ7 A;  2PVO C;  2VCZ A;  5INY A;  4PUF C;  4IQ1 A;  2LV3 A;  2PU9 C;  1GTU A;  4NPB A;  1R5P A;  1TDI A;  4HU9 A;  4IGJ A;  4HU7 A;  1TI1 A;  5DQS A;  5IQY A;  2A4V A;  4AJ6 A;  3FR3 A;  3IA1 A;  5DJL A;  5IMF A;  1H4O A;  1AAZ A;  3F3Q A;  2P5Q A;  3QOU A;  3EU3 A;  1FB6 A;  2CX4 A;  3KM6 A;  1XBS A;  1TP9 A;  4OO4 A;  3TJG A;  3QAG A;  1KBN A;  2CVD A;  4O32 A;  3ZFL A;  1SD9 A;  4JBB A;  2DIZ A;  1PL1 A;  1TK0 B;  4KA0 A;  2GSS A;  1CQG A;  3VLN A;  1V98 A;  2DJK A;  3WT1 A;  4PQI A;  4XCS A;  5CYY A;  1T3B A;  2HRA A;  2YV7 A;  5D93 A;  3W8S A;  4K7I A;  3F4S A;  3ZZX A;  3Q18 A;  3MAK A;  3TDG A;  2FHE A;  2N5B A;  2JU5 A;  4EL1 A;  1G7E A;  4PUA A;  3WD6 A;  2JZR A;  2HI7 A;  1TJD A;  2K8S A;  4ZL8 A;  5ECM B;  1GSF A;  1YF0 A;  3O3T A;  3TCO A;  3TRP A;  1J0F A;  1OVN A;  3DEX A;  4YAP A;  3GKK A;  2A2S A;  2R0G A;  2O89 A;  2H1D A;  2DKH A;  4LMV A;  2H0G A;  2TRC P;  4JR4 A;  4EIP A;  4OO5 A;  2AAW A;  1JZW A;  3VWX A;  2I1U A;  4TVE A;  1PMT A;  1SK2 A;  2LS5 A;  3RPN A;  4GLT A;  3DRN A;  1FOV A;  2FCH A;  1AUC A;  3H79 A;  4WR5 A;  4KW6 A;  2CV4 A;  2IJY A;  1WIK A;  1V58 A;  4NAX A;  2WCI A;  4O7H A;  3VWV A;  2JSY A;  2OE0 A;  3C8E A;  5A4U A;  2FA8 A;  2IME A;  3CBU A;  3GL3 A;  3IHG A;  4WF4 A;  4PNF A;  2X8C A;  2LRN A;  4K1F A;  3TUE A;  1TOF A;  1G6W A;  1M9A A;  4IKH A;  3D4T A;  3RHB A;  3LYP A;  1NSW A;  3JCM L;  1LBK A;  2FUG 2;  3IC8 A;  4POM A;  5C04 A;  2L5O A;  3LWA A;  5EPF A;  4EDY A;  2CQ9 A;  4K5S A;  3WYW A;  2GGT A;  4I6X A;  1PA3 A;  3LEF A;  3VUR A;  3TKQ A;  2PVQ A;  4NV2 A;  4EIQ A;  5IMZ A;  3L78 A;  2MBT A;  2C80 A;  2MMZ A;  2DJ1 A;  1RQM A;  1FW1 A;  2VCT A;  4ECI A;  2LUS A;  2B5X A;  5FWG A;  4N0V A;  5LNK e;  5J5N A;  1PL2 A;  5ECN B;  3FK8 A;  2DBC A;  1PX6 A;  3C73 A;  1TRS A;  4K7O A;  5JCU A;  3ZMK A;  4JU5 A;  1U3A A;  2CAQ A;  1YJ6 A;  1TU8 A;  1QUW A;  1M2B A;  1O8W A;  4YQV A;  2C0G A;  1G6Y A;  4F0B A;  2GQL A;  4DSS B;  1GH2 A;  3APO A;  2OJL A;  1ZYP A;  1B48 A;  2FWG A;  1WPI A;  2LKU A;  5A5K A;  2FNO A;  4MP4 A;  1F3B A;  1XFL A;  1U88 A;  4IQA A;  5E59 A;  2MMO A;  3CMI A;  4ID0 A;  3CTG A;  1WJK A;  5ELA A;  3Q74 A;  3APQ A;  3VPQ A;  2ON7 A;  4N0Z A;  1GUK A;  4IBP A;  2BTO T;  3EC3 A;  4PUR A;  3C1S A;  1GSE A;  3D21 A;  2BMX A;  5DBQ A;  2CVK A;  6GSW A;  4WXT A;  3FYG A;  2OBI A;  2LJA A;  2REM A;  3KXO A;  1CQH A;  1W4V A;  3C7M A;  2CAI A;  4WBJ A;  2XC2 A;  3IV4 A;  2MBS A;  2L6C A;  3HD5 A;  2FWE A;  2TRX A;  2YNX A;  3BBY A;  4O92 A;  1O73 A;  2B6M A;  1TK8 B;  1F9M A;  2P0G A;  4QL7 A;  3TRX A;  5D8I A;  2GQM A;  4H86 A;  7GSS A;  2VIM A;  1AQV A;  1JLW A;  1SYX A;  2B7K A;  1B4Q A;  4JRR A;  3K8N A;  2VL2 A;  1F3A A;  3FRC A;  1SKS B;  3RPP A;  1SYR A;  1SKR B;  1XW5 A;  2O8V B;  4ZBB A;  2IWT A;  1X9S B;  5ECK B;  2PWJ A;  1KTE A;  5ECI B;  3UOM A;  4TOP A;  1YEP A;  3GA4 A;  2VLU A;  1TTZ A;  2CT6 A;  5CRG A;  5IIZ A;  3DIE A;  3QCP A;  4POK A;  3GRX A;  5DCG A;  2VUP A;  2JAD A;  1FG4 A;  4LA1 A;  2VLT A;  1ZGN A;  3I6A A;  3KD0 A;  2A2P A;  3GTU B;  2WJU A;  3D6I A;  1GSU A;  2H71 A;  1KNG A;  2H75 A;  2X4A A;  1K3L A;  5FHI A;  5D9X A;  4KE3 A;  4EF0 A;  2VCW A;  2GTU A;  4XHM A;  1HYU A;  3DML A;  12GS A;  3GH6 A;  5G5F A;  2YN1 A;  4AJ8 A;  20GS A;  3QR6 A;  3E0U A;  3GUS A;  4PTS A;  2GZZ A;  4OFN A;  4TR0 A;  2VO4 A;  1ZYQ B;  4GST A;  1QK8 A;  1GTB A;  2H76 A;  3F9U A;  3ZL5 A;  4I5Q A;  3TGZ A;  4FYU A;  5EY6 A;  2WRT A;  2L57 A;  2QA1 A;  3D4M A;  3LGC A;  2MMA A;  4OCE A;  3UVT A;  3F3R A;  4IS0 A;  2XBI A;  2H6X A;  1DE1 A;  4MCU A;  4IJ3 A;  4P3Y B;  2CVB A;  4X0X A;  2B1L A;  3HZ8 A;  3ZIT A;  1UN2 A;  3A2X A;  1XVQ A;  1Z6M A;  5J41 A;  1U6T A;  4DSQ A;  4EVM A;  2IIY A;  4POB A;  2C4J A;  2LQO A;  3C71 A;  4FH8 A;  3E9J B;  3L9V A;  2H19 A;  6GSX A;  2I4A A;  1NM3 A;  2V6O A;  2IMK A;  3A3T A;  1FOH A;  2FY6 A;  4DSR A;  4D73 A;  1MD3 A;  1PD2 1;  2QA2 A;  1ERV A;  1GTI A;  1VRS D;  3F6D A;  1WWJ A;  4G2E A;  1X9W B;  5IOW A;  2HZF A;  3GKM A;  3LQ7 A;  3TOT A;  1OKD A;  5ECQ B;  1GUM A;  1F6M C;  5AIX A;  3APS A;  1N8J A;  1I5G A;  3M9J A;  3CYN A;  2LRC A;  1JFU A;  2L5L A;  1NHY A;  4L8E A;  3RDW A;  2GSR A;  5DJM A;  5HQP A;  1QQ2 A;  2NBS A;  3M3M A;  1BYE A;  3UBK A;  3ME8 A;  1Z9H A;  4F03 A;  2FLS A;  4NHW A;  1DSB A;  4MF7 A;  5G1L A;  3EE2 A;  4TN8 A;  3KP9 A;  2M80 A;  1A0F A;  1RW1 A;  4ECC A;  2YOI A;  3GKX A;  3VWU A;  1JZD A;  4ML6 A;  4MJE A;  2PUK C;  5G2Z A;  3FY7 A;  2CZ3 A;  4YAV A;  3CRU A;  2NDO A;  1S3C A;  4IP1 A;  4Q5Q A;  4L5O A;  4MH2 A;  3DYR A;  5ECL B;  3PIN A;  1GNW A;  4O5U A;  2DJ3 A;  3QMX A;  4Q5F A;  5BMU A;  4KSM A;  1JZO A;  3W6G A;  5AN1 A;  1EV9 A;  1OC3 A;  5GZZ B;  3D22 A;  2UZ8 A;  3VI7 A;  1YZX A;  2GLR A;  2DIY A;  3GX8 A;  1QFN A;  4V2N A;  1VF1 A;  5EL8 A;  5HR1 A;  2PMT A;  2XPE A;  2P5R A;  4YKF A;  3CSH A;  4FYC A;  2V41 A;  5KN1 A;  4LMW A;  3V1W A;  1A0R P;  3ZML A;  1TRW A;  4CY8 A;  3GNJ A;  3Q6O A;  2GZP A;  2YZH A;  5IMC A;  2EIO A;  4MZC A;  3TRQ A;  4LL4 B;  4MMM A;  3A5W A;  5D9W A;  1PSQ A;  4PXO A;  3OR5 A;  4J2F A;  5CRD A;  1THO A;  2FA4 A;  14GS A;  3EPT A;  3HKR A;  2WGR A;  1HNB A;  3LSZ A;  5AIS A;  3HVV A;  2O7K A;  4IHU A;  4K2X A;  2F51 A;  3FR9 A;  3KH9 A;  1AQW A;  1F37 A;  5IOX A;  4K6X A;  2QKE A;  2AB6 A;  3FKF A;  3GKN A;  1X5E A;  2VL2 C;  2B5E A;  5CP1 A;  1K0N A;  4BVY A;  2WB9 A;  2KP2 A;  5ELG A;  5JWR B;  1PN0 A;  5LCZ A;  4ZXG A;  1TI3 A;  2HNL A;  2B5Y A;  2OKA A;  2X99 A;  1B9X C;  2N5A A;  1XIY A;  3VK9 A;  1AW9 A;  2L6D A;  1V2A A;  1GTA A;  4IP6 A;  1TRV A;  2RM5 A;  3TKS A;  1HQO A;  1Z5Y E;  1G0T A;  1A2L A;  3IAS 2;  5FT3 A;  2DKI A;  3QDN A;  1EZK A;  1PKZ A;  3FMW A;  5CO3 A;  3KTL A;  2HSY A;  3CRT A;  3CXG A;  3GUR A;  1SL0 B;  3F8U A;  1ZL9 A;  2IMI A;  1SJI A;  2WS2 A;  6GSS A;  2F9S A;  19GS A;  1GSD A;  3GSS A;  1AQX A;  2H30 A;  4PNG A;  2MYG A;  1ZYN A;  2R5G A;  4GQC A;  2LEG A;  2YWM A;  2VCQ A;  3TKR A;  4IEL A;  6GSV A;  4HZ4 A;  2E0Q A;  4WR4 A;  3I69 A;  4TR3 A;  2HRF A;  3TKP A;  1QGV A;  4HDE A;  1XW9 A;  1ACV A;  5GAP D;  3HVS A;  2E2M A;  1MEK A;  2OAC A;  1XPV A;  4PGT A;  4DVC A;  4XRD A;  1M2A A;  1MDI A;  1YY7 A;  3MDK A;  4MJA A;  3TJK A;  3DXB A;  3W8J A;  3J7Y b;  2LTK A;  5CRW A;  4MK3 A;  4BWQ A;  5DQY A;  3HY2 A;  2YWI A;  5GST A;  4KX4 A;  2HFD A;  4OMV A;  2HXK A;  1HD2 A;  2I9H A;  1GWC A;  4O5Q A;  2K6V A;  2HRN A;  1ILO A;  1EWX A;  2B7J A;  4Z2R A;  4NWY A;  1VF2 A;  2GT6 A;  4G0K A;  3SBC A;  5F8B A;  5DVB A;  4XTS A;  1IYH A;  1U87 A;  2GT5 A;  4GSS A;  5F05 A;  2EIQ A;  4RQX A;  2X64 A;  4GWR A;  4OCF A;  4WF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...