1O94D

Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
189
Chain Sequence
b'SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIMETHYLAMINE DEHYDROGENASE
publication title Extensive Conformational Sampling in a Ternary Electron Transfer Complex.
pubmed doi rcsb
source organism Methylophilus methylotrophus
molecule tags Electron transport
total genus 50
structure length 189
sequence length 189
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
D PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1o94D00
1N2BA 3H9BA 1Y42X 5J58A 1G59A 1Q15A 1GN8A 2RE8A 1YUNA 1K92A 3BL5A 1QTQA 1R6TA 2EJCA 1QRSA 1NURA 3HFJA 1KH1A 1O96A 2AG6A 3CLTC 2A1UA 5AHWA 1KQPA 3HZRA 4ARIA 2DUMA 2OQ2A 4CT0A 3AIIA 3NV7A 4MVXA 5J59A 1EFPA 1V8FA 3IVCA 3H05A 3CLRD 4CDNA 1T9GR 3FHJA 4MUGA 2GKSA 3G59A 1N75A 1K4MA 3IODA 3X1KA 2O5RA 3FWKA 1YI8A 3PXUA 4YP7A 1ZJWA 3ND6A 2DETA 2CYBA 1U3DA 2D5BA 1J21A 1JIJA 4NATA 4EG6A 3FH0A 3G6KA 1B6TA 1O97C 3KT0A 1KH2A 1MRZA 3IUBA 2CV0A 4AS1A 2HZ7A 4QREA 5K0SA 5FNZA 3PRHA 3RK0A 4DJAA 4OJMX 3CVVA 1OWOA 5TEVA 2PXHA 4MAFA 5FO0A 2QJFA 5IJXA 1M1ZA 2QUIA 4DDMA 3MMXA 1OD6A 1NUQA 4DDHA 4MW5A 3NBAA 4ZT7A 4S1OA 1WQ3A 1OWPA 4RPIA 1JEEA 2O8VA 1F7UA 4DE5A 3QTBA 1O97D 3CLUD 1QRUA 1XJQA 5TEWA 3ZIUA 2AKEA 1FFYA 5KCMA 1PFYA 2J07A 3H97A 3VRHA 4U8HA 4ZT4A 4ZT5A 4GU5A 1NUPA 5DB4A 1M8FA 4R0NA 2BTEA 3GUZA 4MUHA 3TQIA 3GLVA 3SEQA 2D13A 2J09A 4HPWA 2PIDA 1O0CA 3IOEA 1KORA 4HJXA 3IOCA 4KPUB 1G8HA 3KT6A 1N2IA 1GTSA 1EXDA 5DK4A 1TYBE 3AG5A 1H3NA 3AKZA 3FNRA 5JBNA 1EUQA 3CVXA 3HL4A 1XNGA 3IMGA 3MXTA 2X1LA 4ZT6A 4EFKA 1WXEA 2QTRA 2WQ6A 3X1JA 2CYAA 1O5TA 4DLPA 1ULHA 3QE4A 3UC5A 4R2MA 2QUHA 1TYCA 3TQOA 4MW7A 4YP6A 1IVSA 2PFSA 3DLAA 1IQRA 1GAXA 1O95C 2PZBA 3P52A 3CLSC 1MB9A 4JZYA 3K32A 4MVWA 3OTWA 4HJRA 2ZP1A 3P0JA 3SYTA 2C5SA 1O94C 4L2IB 1F9AA 3PNYA 3ZJUA 2DR2A 3A04A 1ILEA 4CDMA 1A8HA 1N2EA 5HUHA 2WB2A 4KR9A 1KH3A 3COVA 3DPIA 1WY5A 3N9IA 4J76A 1QRTA 5FO1A 5KWVA 4F4HA 4HK4A 4QBTA 1O95D 4X0EA 3CLRC 3CLSD 1XNJA 3ZGZA 1O94D 4I6EA 2YXNA 1K4KA 1WOYA 1J1UA 1QNFA 3X1MA 1QJCA 3AL0C 3SZGA 1EJ2A 4MUJA 1H3EA 1OWNA 2A88A 3ZXSA 4EG1A 3HGMA 4KPUA 4EGAA 4DNXA 3MLBA 1MBZA 1PFWA 1YIDA 2CFOA 2PZAA 3S3TA 2I1LA 4ZCQA 1N3LA 5H7XA 1WQ4A 2JA2A 1YUMA 2HMAA 1R6XA 1XNHA 2QTNA 4K0RA 4NDAA 3FY4A 3D6VA 3ZXIA 4WNYA 5F23A 3COZA 3FETA 3OP1A 3IMEA 2QUKA 4J75A 3NBKA 3IMCA 2WQ7A 3SEZA 3QTTA 1VLHA 4UZFA 4JFAA 4MVYA 3FI0A 3CLUC 1KQNA 2D54A 2H29A 3A05A 4JYZA 4U63A 3FDXA 1O0BA 1WJGA 1M83A 3COYA 4NAUA 1J20A 4L2IA 2Z09A 1HYBA 3SZ3A 3MUEA 1IQ0A 2CSXA 4GRIA 3Q12A 1U0BB 1JEDA 3G5AA 5LM3A 4MQ6A 4KR6A 3U1VA 3N8HA 1JILA 4F3RA 1GLNA 4XFDA 3VGJA 2DLCX 4OUDB 5LLTA 3H9CA 4TS1A 3L93A 5J5AA 3FIUA 3UMVA 1NI5A 2AZXA 3SDBA 2VTBB 4MULA 4MW9A 1SURA 4AQ7A 1MB2A 1KQOA 4ZCSA 1NP7A 2IJGX 2JANA 3SP1A 2G36A 2H2AA 4A91A 1T6XA 4MW4A 1N1DA 4P2BA 3N05A 2QJTA 4EG5A 4MUKA 2PZ8A 4G5FA 2IP1A 1R6UA 5HUJA 3DV2A 1N77A 3VU8A 1RQGA 2QJOA 1Q11A 4I6JA 2E0IA 1WZ2A 4MW1A 1WXFA 3JXEA 3F3MA 3CVYA 5H16A 1EE1A 2A4MA 1N78A 1NUUA 4MUEA 2CT8A 1IH8A 1J09A 1D2RA 3D6UA 3TZLA 4WSOA 3C8ZA 4YBRA 1J70A 1BS2A 4ND6A 1H1TA 4EG4A 3ISJA 4KKVA 3A2KA 3LCJA 2CV2A 5LFAA 5KHAA 3Q10A 3CVWA 1QU2A 3P0IA 1WKBA 3ELBA 1JZSA 1X8XA 2R5WA 3K9WA 1UFVA 1U7XA 1T9GS 3KT3A 4H3SA 4UZEA 4CQNA 3TZEA 1LI5A 1IHOA 1IRXA 4ND7A 3ZJTA 1MC1A 1VBMA 1FYDA 3IH5A 4MW2A 4OUDA 1GTRA 1JMVA 1S4MA 4PY2A 2BYTA 2VTBA 3KFLA 4ZCTA 4MWDA 1KP2A 1OWLA 4EF6A 1T6ZA 2A1TS 3I05A 1WXGA 1I2DA 1NUTA 2E89A 1WXHA 4YMIA 4G6ZA 1GZUA 4MWEA 2X3FA 1NYLA 1KAQA 4MLPA 4ZCPA 2NSYA 1I6MA 1M8GA 4MUIA 2E21A 3HMQA 1V47A 1JZQA 2J5BA 1VBNA 2PG3A 4BWVA 3TS1A 1N2GA 1YIAA 2A7XA 5HG0A 2DPLA 4NX2A 3CVUA 3AG6A 3CA8A 3RBAA 3ZUGA 3Q4GA 3RK1A 3N2YA 3LE8A 3ND5A 1F7VA 2CYCA 1M8KA 1N2OA 3RFFA 1EFVB 2OV4A 1M8JA 4EG7A 2QTMA 1TYAE 3MLAA 4EG8A 1JIKA 2ZUFA 1G8FA 1YULA 2A84A 4MUNA 3UOWA 3IUEA 2RD2A 3TNJA 4R2LA 4U7JA 3CR8A 3M5WA 2DEUA 2VXOA 1TEZA 3PNVA 1NUSA 2CUZA 2QUJA 1JECA 4Q16A 1NZJA 3IOBA 4MWCA 3PNBA 3H99A 3IDFA 3FOCA 4MW6A 3CLTD 4QRDA 3UK2A 5TGTA 1EUYA 2DXIA 2Z08A 4MUFA 1M8PA 1U3CA 4JXXA 4MWBA 4Q93A 2HGZA 2J4DA 3GMIA 1J1ZA 1MOPA 2GOYA 4XFJA 5BNZA 2WSIA 2A1TR 2DERA 4ZT2A 1N2HA 4PBRA 4DDKA 4RUKA 1N2JA 5K0TA 1DNPA 1P7PA 4I6GA 5TS2A 3AFHA 1U7DA 3A4IA 3KT8A 2V0CA 1GPMA 2YWCA 4NAHA 3IVXA 1VBKA 1CT9A 1ZUNA 4PBSA 1QU3A 4ZCRA 1JIIA 4EG3A 3LOQA 1EFVA 1IQUA 1JGTA 2B7LA 4XSVA 4JXZA 4PBTA 1Q19A 4G5YA 1MJHA 1KKUA 5DASA 5IHXA 1O96B 2A1UB 2J08A 1KR2A 4KR7A 1OWMA 5EKDA 1EFPB 1WXIA 1LW7A 1O6BA 2YY5A 2GM3A 4ARCA 2E18A 2CV1A 3ILVA 1ZH6A 3RHSA 1H3FA 1PFUA 1PG0A 1F4LA 1PG2A 2JAXA 1KAMA 3IVGA 1I6KA 2ZUEA 4MW0A 2EL7A 1KP3A 3L92A 1NSYA 1I6LA 3HV0A 4NZPA 2X1MA 3COWA 2IELA 3P0HA 2TS1A 1TFUA 3ZJVA 1JHDA 1COZA 1PFVA 2NZ2A 3INNA 3ND7A 2A86A 4K03A 5DEOA 4E1AA 2XRZA 1MAUA 2X0KA 3FG9A 4MVCA 1IFXA 1MAWA 1T6YA 4FZJA 1G8GA 1OBCA 2Z3VA 1TYDE 2V0GA 1X6VA 2YWBA 1QQTA 1Q77A 2XRYA 1OBHA 1TQ8A 3RJZA 3UY4A 1K97A 4ZT3A 1LI7A 1VL2A 1ZH0A 3E27A 3DO8A 4YP5A
chains in the Genus database with same CATH superfamily
1IZZA 2DHEA 2Z3ZA 3FCXA 4N0DA 4S1PA 3O8NA 3PFNA 1V8OA 1I1QB 2EZ4A 2E4VA 4Q3BA 2G72A 3BAZA 3QVJA 4M9QA 2AI2A 2O23A 3HWWA 2NVOA 4NMHA 4WBNB 2XECA 4V3CA 1QZUA 1IB0A 3DEZA 2O8BB 1CQPA 4G1MB 4TRJA 3NORA 4WN3A 4MS1A 4TX1A 3AF6A 2XGGA 1E59A 3MTIA 2G67A 5FT9A 4MRSA 3PPXA 4HGPA 3KKKA 2OQVA 2IY9A 2DFPA 3H8SA 4B31A 4TUYA 2G83A 4ZI2A 5ISMA 1Z6PA 4LYDA 3MERA 3NALA 4URVR 2GZHA 4MYHA 3LGSA 3NHFA 3GCWA 4OXRA 4F21A 4H1UA 2XCTB 3DHYA 3AMVA 4YR9A 4PZDA 2FGKA 2BHRA 3ANMA 2WY2D 2OUIA 1H0SA 4AROA 2Q4RA 1YB5A 4CEIB 3IBGA 3KUUA 2BEVA 4OHYA 1EWQA 2WSYB 2OV3A 4MRMB 1M34A 3JQAB 3QWIA 4U7GA 4DCOA 5E9JA 4EG6A 2UUPA 3FH0A 4QJBA 3W5IA 3G6KA 5H59A 1ODCA 3TLZA 1NRIA 4GRDA 1WMEA 2XLCA 2O05A 2IP4A 4LDQA 3OJFA 3OICA 1FF9A 1XEWY 2LPMA 2QM0A 4DAEA 4DEXA 4DJAA 2HDWA 4JI2B 3U4MA 1GXSB 2PXHA 3RODA 2BMAA 2FPMA 3B5EA 3ON5A 1NUAA 2HZBA 2HYDA 2WE8A 4H3HB 4V0OA 5FUYA 1JUDA 1G9TA 2O1EA 1UXOA 4M1OA 5CA1F 1YFZA 1ZK1A 2V7QA 1AU9A 3WMWA 4DDHA 4S1TA 1U7TA 4NZYA 2Z5LA 4DDWA 5EP4A 4AUEA 4AD8A 1CJUC 1OXKB 2XGOA 1IAQA 3DFIA 3PC7A 4CG1A 3D6NB 3NCHA 4HWOA 1OREA 3KO8A 4NK4A 5LA6F 3H9GA 3HJCA 5DNDA 2BMFA 2GK4A 2HDNB 2XUGA 3LBYA 4WOJA 1UBFA 3QJYA 3AFGA 4HEJA 4R8RA 1CQIA 1M2HA 2BFWA 4J8PA 2O7QA 4UZSA 4JVOA 3K70B 3KUKA 2VTDA 2I2FA 1ZCFA 4NJMA 4QELA 1KI2A 4GMKA 2ZDGA 4C7OB 5AHXA 2Q41A 4E7PA 5D87A 4FI3C 4JDUA 5DGDA 2CK3D 3ICWA 5LKAA 4ZO7A 2HREA 1FNBA 4YB8A 3D1VA 1Q2XA 2P40A 3WK9A 1KORA 5K0BA 2OFPA 4TWZA 4IVQA 4O63O 1MHPA 3EK2A 3DOFA 2M6LA 1E6UA 4QPZA 1RHKA 3D8BA 1HYEA 1JSXA 3K8OE 5JRZA 1BKYA 4YRDA 3MHPA 1ENPA 5JBNA 3A1CA 4V1CA 1Q1NA 3O5AA 1RBZA 4PO1A 5A3SA 4I0WB 3JYHA 4CIXA 1GR0A 5HVNA 2JK0A 2F90A 4RULA 4RQTA 3RGWS 3TTXA 1O7JA 1V3UA 1VXOA 2B98A 2HLDD 4L74A 1GTMA 3DWGA 3HG7A 4N5DA 5ALHA 2QZZA 3KZOA 3UC5A 3GLIE 5LCXA 3B6MA 3LF2A 3S6JA 1G20B 1PJ4A 3WWEA 8MHTA 2J9FB 3MFYA 3OQPA 3KD2A 3L01A 4KFUA 4NU0A 3PC8A 2PRZA 1T1SA 5AW2A 2C88A 3FRJA 4QNRA 5FR1A 2WMDA 4KAAA 4LOIA 4YAFA 3GIWA 4PLTA 3QPAA 5H9WA 3K32A 2AOTB 3GGOA 2C4MA 2ZP1A 4JN6B 1NW4A 2FK8A 1W0JA 4RLHA 3W1EA 3WRYC 4DDTA 2WTMA 2YINC 3KQQA 3MWJA 4GOJA 2HD4A 3JD4A 4S35A 4EKIA 1U9CA 5LYJB 2GWHA 3T3NA 2V5UA 3LUFA 8GPBA 3DMFA 4O4LF 2BKUA 2UU9B 2PX2A 1DJQA 1UJ6A 4NS4A 2H4HA 5KWVA 1I5OA 1E3LA 1JP7A 3P9RA 2IYRA 3LYUA 4P80A 4A23A 5C9ZA 4LF8B 1FP4A 3PEEA 1CHNA 2FWPA 3GJ5A 2PVPA 5EZQA 5BV7A 1DV1A 5EERA 4DANA 4IIFA 4FB4A 1S2IA 2CLHB 1K06A 3MM4A 3QF4B 5AHOA 2EFEB 5KYTA 4D9BA 2V9ZA 3EFBA 2R3SA 3INTA 1EJ2A 2I2WA 3HSKA 4PYMA 2PS9A 4EJ2A 2HEGA 2OE2A 4EG1A 2WF9A 4LHWA 2VUIB 5H83A 3TD2A 1W2WB 2C3OA 3WJ2A 1SVKA 2WSLA 2P4HX 2E49A 2JGKA 3F6PA 2OB2A 3HCRA 1E1MA 3OZCA 4GLOA 3P2YA 1PTKA 2FRDC 4ZCQA 5KJCA 5BR4A 3UGKA 4KWIA 1Z73A 1VP3A 3JQ7B 3QKRB 2IUYA 1EUDB 1B76A 4P08A 2A7QA 4YA6A 4PQYA 2O2DA 1PR5A 1MQAA 4HX2A 4U2KA 3L0ZA 1OV4A 1P0CA 1W9HA 4HDMA 2W6ZA 1Y6RA 1GL9B 3FETA 1XALA 1ZH2A 4WQMA 4REQA 2Z83A 3QFHA 2WZBA 5JDIA 2I67A 3WIBA 1GLVA 3E3OA 3S27A 2C9MA 1AG9A 1ZFNA 2ISQA 5KWEA 2CLFB 2AW3A 5IT9A 4PQFA 1NVAA 1P74A 1UJNA 1Z0KA 1Z25A 2K5UA 4BMPB 3KYBA 4IKPA 5PGMA 5F3RA 3COYA 3IHTA 2QQ0A 2ORVA 3P2JA 5EIBD 1O4VA 3QYJA 1NAHA 2REQA 4JX9A 2GF2A 2HSDA 2Z5FA 3PQ5A 1C3OB 3FGOA 3G2IA 4YAEA 1Z38A 4EHJA 2VDJA 4KGZA 1G19A 1WIWA 1GLNA 2B9EA 3C3DA 1W25A 3MT9A 4OUDB 4EA6A 4F38A 2BE9A 1SG9A 4R1TA 2CL0X 3FAZA 5HQ3A 2CHFA 3L9XA 4Z4GA 3UMVA 1GU7A 3TW0A 3SDBA 4H17A 4DSNA 1WDWB 3S8YA 1OX6A 3AF4A 5JI2E 4ZICA 3KSMA 2GBFA 2GH1A 1PYGA 3PJDA 2JKZA 3ZXYA 2O1WA 3T4PA 2QD1A 4UBKA 1OFGA 1MCZA 3ZD7A 1Q1EA 4MQEA 2D5CA 1M5TA 1QX4A 1S7GA 1L8LA 1ZOLA 4FBGA 3VTAA 4GWLA 5A9SA 3UGJA 2RARA 2WUGA 3O8OA 1OROA 3PXAA 4UFOA 4YRLA 2J6BA 3A9VA 2WJVA 1LV8A 3OPQA 4ENUA 2NO9A 3W9UA 1O1YA 3M6UA 4P2BA 4M9UA 4R1PA 5EEHA 1WBJB 1N2XA 2B8TA 2GTPA 5JAUA 2OL4A 4C14A 3K4PA 2MSCB 1PV1A 3SFVA 2D2XA 2PUAA 4I6JA 1NP3A 4BMYA 4RPCA 3VHXB 4P1ZA 4JLSA 1E3EA 4FGSA 1A4XA 3R7DA 1BYUA 1DUVG 4PZ9A 1ODTC 2CLDX 5ESDA 5FNVF 1OW3B 1SQ6A 5JS6A 2QZSA 4OJQA 5J40A 4BMSA 4WUVA 3EC1A 1TW2A 4HFRA 2SHKA 3D6UA 3IULA 4RXMA 4C1NA 2GKOA 4YBRA 4CM3A 2IYLD 1L4KA 2PEYA 4M9RA 4Q3CA 4BNMA 4O5OA 1DQSA 2C5BA 2QN6A 3G8BA 5GAJA 1QQ7A 1Q5PA 4BN0A 3A2KA 2YIJA 3B9BA 4CQMB 3ID6C 1XTUA 3N0RA 1NBMD 3AR5A 5ITSA 1FA9A 1FVXA 4A16A 1Z68A 2ZI5A 3ELBA 3QVGA 2FE1A 3UAWA 4ABTA 2R5WA 1X8JA 1H5QA 1NT2A 4UBOA 2FOIA 3K53A 1M67A 1MNQA 2QMQA 4L4XA 2DKNA 3CH6A 4RA9A 1JHVA 3E1KA 4BJ5A 1DAGA 1SOWA 2GSDA 1QK3A 4CM9D 1RD4A 2KBFA 4JC8A 1YDMA 2VRWA 1IRXA 4XR9A 5CHEA 5JNSA 4I1PA 5AVKA 3GH1A 3D59A 1T5LA 2G0TA 3OPYI 2C7PA 2VS1A 3BL8A 4Y6QA 3OQ1A 3OZEA 4FDUA 3LPAA 4DLBA 2QY6A 4K6MA 3DAFA 5KYXB 5G2OA 2D0DA 1YCDA 3PCRB 4QU9A 1J06A 4TV9A 4LDZA 4D96A 5CLJA 2X9GA 1VPWA 4DIDA 4X1YA 2XQJA 3WOVA 1K9VF 2V6MA 5FD8A 2WFMA 3V7YA 4XRGA 1IHUA 4GP6A 4KIUA 4R05A 1BJKA 1OYYA 2Q4TA 3I2FA 2IBSA 3O8LA 1O95A 4CFSA 1RE1A 1X7ZA 3GHYA 4OLHA 4PZYA 3I73A 4FZ5A 3MWYW 5F35A 2YIVX 2V7XA 1T3LA 1LQUA 1NJGA 2Z2KA 2TYSB 3SBOA 3PFFA 4M38A 5BR8B 2H9YA 1Y1LA 1VYVA 3G2NA 2E21A 3T7TA 3U4GA 4JBXA 2CBGA 4CMKA 4UNPA 2GNPA 1JVSA 2I78A 1UJMA 3NUQA 3G2HA 2FE4A 4GLLA 4HS4A 4OHKA 3SOZA 2O5EA 4DADA 2OZPA 1NHGA 2BCEA 2GEKA 3WXBA 3AG6A 3SR3A 5ALVA 4Y18A 1GADO 1MO3A 3U0VA 3HZHA 1T0IA 3Q4GA 5ALWA 1OZAA 3TRKA 5ED4A 2GEBA 2JGDB 4K05A 1E7SA 1YRYE 4ITUA 1S9HA 3E7XA 1PDVA 2PT7A 3CEAA 3T5BA 5JAOA 3H9JA 1G0OA 4OPMA 4KHZA 3R09A 1JG4A 1DC6A 1JIKA 1A2KC 4RMIA 4AVYA 5L53A 2DM6A 4ZZ2A 1RCUA 2P4UA 1D04A 2V6BA 3BWCA 3L1IA 3A31A 4J16C 5K3AA 4ZJUA 8ABPA 1M2WA 5JJCA 1SC3A 5KWJA 1A50B 3KRTA 4JNKA 1DARA 3C3EA 1APBA 1MORA 3EH1A 4QU5A 1ZA1A 2J30A 1B00A 4RC9A 5IKOA 2ZU0C 1QAQA 3NHAA 1SEPA 1V37A 3SMQA 1MPXA 4BIMA 4MB6A 3FOCA 4I8DA 1WSWA 9LDBA 3DMYA 3G49A 2H4ZA 4MR8B 2A5JA 2RBEA 4DJDC 1SXJA 2RJNA 1PR4A 1TM7E 5ESRA 5DM2A 1DBVO 5FEMA 2RDMA 1A7KA 2VQSA 4QKQA 5EHXA 1SXPA 5DX1A 3DQQA 4UHBA 1YBHA 4N0MA 4DNFA 4MJLA 3VDMA 1NC1A 1EM6A 1NQ5A 3COPA 2QX7A 2W2KA 4ZI3A 1P6XA 4WOCA 5CLLA 1SBTA 2LBPA 1RRMA 2I4OA 3FPAA 2VF2A 3QOFA 1J97A 4DHWA 1FMFA 1ZVQA 3LY5A 1D5CA 3IHWA 4Y8VA 1VJDA 4F5ZA 3JALB 3IEXA 3TMYA 1TKCA 2OP0A 2X2PA 5FPSA 4PF1A 3KJFA 2AT1A 3QV2A 1ZRNA 4X8OA 2AMVA 2HHJA 1ADFA 2YDYA 2GFQA 3OWHA 3UIEA 1YNSA 3JQCA 3EXIA 3ZYZA 1N6KA 1YR6A 4D4KA 4WV3A 5E4YA 4E4YA 3OQIB 4M6WB 1FUYB 3D5QA 3FPLA 5AJXA 2WJZB 1T5DX 4Q39A 4G0WA 4D6PA 2R68A 4P4NA 1B93A 1ZIOA 5ILOA 1NVGA 4AUKA 2H1SA 5T64A 4B5LA 1Y3HA 4W5JA 1EVEA 3HRKA 4A0GA 2ZULA 3MS7A 3QEMB 1JDZA 4F9EA 1YL7A 1V2GA 2BKLA 2XD4A 2GZAA 3FUUA 4BB6A 3U3JA 1TGVA 2BISA 4LYAA 3T7RA 3OO1A 1EK0A 4EUSA 4ZRMA 4KQHA 4N9WA 4GOLD 5C8XA 3T5AA 1O6BA 2EBUA 2FWMX 2GM9A 4RCYA 1RLIA 2HQRA 4BXOB 3JSXA 1NFFA 3GA0A 5IP5A 4QJ3A 1HUQA 1SUEA 3LLMA 1X1BA 1I33A 1MC5A 2G17A 2LW7A 4BTLA 1VC2A 1OFIA 1TK2A 5LQMA 1R9GA 4LOLA 1AO0A 4LSMA 1SZCA 3JQQA 3G2KA 2NPIA 3R7SA 4AT1A 1FX0B 4LN1A 2K2WA 2QZ9A 3KR0A 4X65B 3KLNA 1OA1A 3QKIA 1RXEA 2QM3A 4QYMA 2MYTA 4UXIA 2ZJ6A 3HCPA 4L08A 1VCHA 2PGNA 1NXVA 3INYA 1TC2A 3DXFA 1QQ6A 3HV0A 1DO0A 1F5SA 1ZAKA 2XUPA 2FHPA 3EQ7A 3QU5A 4MQ4A 3FDZA 4TTQA 2Y1GA 1ZWLA 4BKRA 4JL5A 2YVAA 1JIXA 4DN6A 2AZ4A 5AKXA 1V6CA 2OCLA 2Q3EA 1UM8A 1DHRA 1JJVA 2V1XA 3D8NA 3KXLA 4L4UA 2V7VA 4P2GA 3MJFA 4EI8A 3CUVA 2O8CB 3C5CA 4PHHA 1S8OA 1Z6QA 2UZIR 2B78A 4MGHA 4Y0AA 5G53C 5KUTA 1FFCA 1XZEA 4UBJA 1NNLA 1C7FA 1UF9A 4RD1A 5CB8A 3HM2A 1G7SA 2BRUC 1LKZA 4DNPA 1JTFA 5CDHA 1DC8A 3FCOA 5JS8A 2Z6UA 2O07A 2RAUA 1ZH8A 2B1IA 5IDQA 2Y0EA 3VUEA 4UUPA 1VCMA 3CLHA 4G24A 4KJZA 1P9OA 1LI7A 3GRPA 4RHEA 5D51S 5HWSA 1XYVA 5DHPA 5LNK6 4BASA 1V4NA 1X7HA 1Z18A 1Y42X 1ND6A 2RE8A 5CURA 4P3PA 4BNWA 1EFAA 3AKYA 3WLAA 3VSDA 1NXXA 3SJ7A 3RYFA 4QUAA 5DIFA 3PTLA 4P0QB 1MABB 1LPSA 1KH1A 3QLJA 3K2EA 4B33A 3HYCA 5SYAA 3BTVA 5NLLA 1GTVA 3PUJA 1CP3A 2RBKA 3HDYA 1K6IA 2ODTX 5FP0A 3X1YA 5DNCA 3OLCX 4M37A 4UTVA 4XLZA 3VYVA 3V48A 3TVTA 3NANA 5DRTA 2W58A 2GF9A 2WM2A 3BHMA 3SQMA 2HW8A 5C53B 1RAAA 2UUCB 3WLSA 2EARA 4WZZA 1PJ8A 1RKQA 3DZGA 2AFIB 1U7OA 1M0TA 4EG0A 1NF9A 2WHXA 2WPNA 2QVZX 3VO1A 1SHTX 3CUWA 4EPVA 1DI0A 3L6UA 4MV6A 3HUTA 2ZJFA 4FDLA 1R9MA 3NCTA 4IZHA 1M2GA 2O2GA 1G5IA 1I0ZA 3EVBA 4Q24A 2BJHA 1Q0SA 4FHDA 5EZ5A 1QQ5A 5IAGA 5ALSA 2FSVA 5FTLA 2NO0A 3K8ZA 4OQMA 4ZA2A 5F9HA 1PQPA 4KXLA 2KHZA 1EHIA 2HBYA 4PWYA 2PPLA 4BNXA 4WNCA 1XVLA 1PCXA 3RK0A 1XTQA 3T3GA 2M32A 2OENG 1DPGA 2BM8A 4LMAA 1GCIA 2JJMA 2DX7A 3FFXA 1AIPA 1NW5A 3CZPA 3LD9A 3NH6A 4KMSA 4MP3A 1TVKB 4OYHA 4DQDA 3ORQA 4WKGA 2J0UB 1G7CA 5CYPA 2ZQ5A 1YR7A 4NCKA 3H1EA 4LDRA 4P4TA 3BILA 3OKAA 2RCNA 1F7UA 4Y6PA 3GBSA 4AM8A 1U90A 3GRAA 2GARA 3DMTC 3QTBA 4GEGA 4Q05A 3ZDDA 2ZSDA 4MYCA 5E6UB 4J2TA 1DXYA 3T4XA 2EFCB 1MDFA 4JJEA 4ICIA 3VVLA 6ABPA 4RTKA 3HKDB 3U4HA 4BQOA 2W2LD 4R1OA 3EXAA 3B6IA 1TJ3A 3UXEA 4WXMA 3UWOA 3O0DA 4BU0A 4E32A 1Z62A 3PFBA 1EXWA 4AMVA 1FTWA 2AA3A 2HKIA 2P41A 4RZ3A 5CDFE 1SVNA 3E5MA 2RGXA 1UK8A 3TECE 1UMCA 4WK4B 3TD6A 3EC2A 1RP7A 2IIQA 4ZYUA 3ESAA 4MUHA 4OTZA 2FSGA 3W8FA 3ZWAA 1DPFA 2QRVB 3OQBA 4IIJB 3RVLA 2YJGA 1YBVA 4EHKA 1Z2PX 3WKAA 3I62A 1U0OC 5JBQA 3WV5A 1CR1A 2JDIA 4TVKA 5I4IA 2PRIA 4O4HB 3TUZC 1J8MF 4MWGA 1KJIA 2E87A 1RQPA 4IIVA 3VMMA 3H6GA 1FU8A 2VZEA 2XOKD 4BFVA 1QFXA 3RUIA 5D86A 5JQWA 3THXA 4D26A 3I92A 2AH5A 2WIDA 4HB3A 3LT5A 5LLSA 4E07A 1CR2A 1EBUA 2GD0A 4RLSA 1TNDA 2OB1A 1B4DA 1WVMA 3FVTA 3IMGA 5BYAA 3G6WA 2ZAGA 5KYWB 4IDDA 3CRZA 2EGUA 1JJIA 3BHIA 5FWAA 2ZJBA 4JYPA 1HDOA 5IW8A 1U0JA 2Y66A 3U44B 1TFRA 5TIIA 1FMLA 1O2DA 1YACA 2HQ1A 1HDXA 4A8JB 2I3GA 3AI7A 3L4EA 2Y9MB 1GQFA 3OTIA 5F5XA 5C4IA 4UVEA 1V4BA 1Y1RA 1C9KA 3PITA 3GP5A 4J7AA 3RTDA 5C0OE 1IQRA 3LY7A 2Q5FA 1JW9B 4FC6A 4HATA 3DWEX 1RNLA 1CUAA 2CNKA 4FTWA 1X7XB 1A82A 5E2BA 1P1HA 3EIXA 1BMDA 5CT8A 3WKEA 7YASA 2EX4A 4JQSA 1C29B 1FFAA 4CTJA 1AMUA 5D84A 4D3YA 2PSFA 2XWJI 2NUTA 2IVFA 2J6IA 3NDIA 3DJFA 4IF4A 4INJA 4LIPD 1CIPA 1FPQA 2ZSUA 3ELYA 3UA4A 4YJHB 4JKOA 1ZD3A 4Z51A 5G3ZA 3J81k 4Z99A 3AEKA 4HGNA 3GMDA 1A96A 1YZHA 2VBFA 4QBTA 4DMRA 2W9XA 5HR5A 3UAGA 3CO5A 5T8KA 4LDAA 3JD1A 3RYIA 2IK8A 1FTNA 3AY6A 3EA4A 3H8VA 3GGCA 4Y9TA 5ELMA 5HBGA 3B8HA 2Y1CA 1LPAB 1P7WA 3I6QA 3AX6A 1JPNA 4F2DA 1U9IC 5E9WA 3NXSA 2WJ4A 1CG6A 3G13A 3AVTA 3IGFA 3JVVA 5G0UA 1V26A 5I7UA 3PLNA 3QXSA 4IHJA 3MLBA 1E58A 3B20A 3WADA 2FDXA 3K30A 4MGEA 1PJTA 3UJAA 4EAQA 4YCMA 1K5DA 1Q0RA 1W9MA 1GGJA 2VOEA 1IVYA 3OSUA 2PH1A 1GZ7A 1RMQA 2X41A 3HQ4O 1YZFA 1WQ4A 4L02A 4D7AA 1CS0A 1XCJA 2OORA 4KTVE 1RJ9B 3JR7A 4RK7A 3D7LA 3FWHA 4HDRB 4NDAA 3FY4A 4D4LA 1YSCA 5LBTA 3DDNA 2WUEA 2M2IA 3NHZA 5KDLA 2BVNA 3USZA 4Q4CA 2WF6A 4DIEA 3IMCA 3R76A 1E5DA 1EXMA 4TMKA 3WQRA 4GSKA 4E4RA 1N32B 3W6PA 5F5NA 4Q6BA 5F9FA 4NC9A 2GZSA 4Y1RA 1M1YE 4NBRA 5E7QA 4U7DA 1OR8A 4KYIB 4QUHA 1T0UA 1ZRSA 5HYVA 2QR3A 3DVLA 4KLCA 3EDYA 3DDOA 2ATVA 3O8DA 1YRBA 3WLPA 2JGAA 2CSXA 2PIAA 4GRIA 1PR2A 1ZK4A 1SCUA 5C1DA 1H4QA 1R5NA 2C54A 1K75A 2IYTA 2VHZA 2W6QA 4BAUA 3PC2A 1P6QA 3JQBC 1BA3A 1ODSA 4B76A 2DLCX 2HU8A 3G9TA 1VDZA 3FUXA 3IAUA 1NI5A 4RZSA 3B6JA 3JD0A 4HAIA 4L73A 4KITB 4L0DA 1JWBB 3J81A 3I72A 4DR5B 1O6FA 5TPWB 1GR1A 4MA5A 1EGQA 5TRTA 3PUKA 2NO5A 3Q1KA 2QT1A 1QYIA 3ITKA 5L3QB 1S3FA 3CN7A 4WFJA 1SZDA 1UOPA 3PPIA 5BSRA 1E1CB 5FI1B 2IU0A 4FYPA 1RYMA 2DY1A 2NW6A 1JKJA 1PVVA 1L5YA 2HRCA 1GD1O 2VUUA 1UPBA 1EG2A 3T38A 1GQQA 5JAPA 2B5OA 4JI7B 1JU4A 2FETA 4C2BA 2IX3A 1C3VA 3TR0A 1A5SB 1Q12A 2CNNA 2DFNA 2GESA 2IXGA 2WLSA 1M6VB 2ONCA 1AXGA 1JHZA 1CIVA 3D6FA 4ES6A 1WZ2A 1NY6A 2C8LA 4L5AA 4UEOA 4C0QC 5FFMA 2VJAA 3I76A 4HQ0A 4XPIA 3GCZA 3Q7SA 5JVDA 2H17A 5H16A 3T9FA 4XOIA 3IYLW 2RGDA 2WVAA 4MV0A 1VLLA 2FEMA 1FRNA 2R1VB 2PWPA 3V7FA 5CIYA 3KB2A 2X3YA 3D6AA 2I9PA 1MJ5A 4WXHA 2Q1XA 2PAAA 3BE4A 4HDSA 4C05A 3T94A 4TZTA 4J1TA 4V0MA 1RAHA 3ELUA 4UPVA 2POQX 3G0IA 2PWZA 4YCBA 4W9NC 4DYDA 3O8RA 2SCUB 1H65A 4ND3A 1ISGA 1VPLA 4KOAA 4PSCA 3W5CA 1G5PA 3ODGA 4UUMA 3KLOA 3HY6A 3IJRA 1E20A 4RV9A 1VGQA 4HO1X 3VNVA 4F96A 3SHOA 4GG1A 1M34E 3LHDA 2DG2A 3L84A 3LPNA 4QEKA 3ZCSA 3DMPA 3CEPB 3I5AA 2OESA 2AB0A 1IHOA 4RM3A 4BNVA 3P4YA 4H1HA 1RBQA 2G9NA 3DEIA 5B4TA 4DA0A 4AY2A 2BHLA 1Y9EA 2ACWA 3RHTA 5CUQA 1YJ5A 5IJZA 1NJ1A 3OX2A 2YWFA 4QOSA 4R9UC 3GRVA 5BOSB 5DSXA 5KINB 1PSWA 3BXXA 2RH9B 4B44A 2DH5A 2WW8A 1I1NA 3DEFA 1SQ0A 1AQYA 3L7AA 3FVWA 1U2PA 5LOVF 1S5PA 5IZCC 4M53A 4FGLA 4JWKA 3O91A 3F7TA 1LNQA 2A9PA 3HA5A 3AUXA 4E88A 1LY1A 1T9CA 1ZMOA 3WLLA 3LBHA 1P62B 2PHZA 3TN7A 2VHYA 3FROA 4TV8F 5M3BA 5FPKA 1G1MA 3Q6IA 3U13A 3DZFA 2ETVA 2QN1A 2V6IA 3C3PA 3GPIA 4L3WA 2IH5A 4DHEA 3EEBA 3F90A 3MAAC 3PNSA 4LOJA 3TTVA 2PZEA 2XEDA 1RXWA 3WBJA 3QJGA 1O6ZA 1MAAA 1R9NA 5ARBA 5EZYF 3SJCA 2G08A 2VFAA 4ESOA 4DC9A 1NQVA 4S05A 4G4IA 5A4MS 2OBMA 1F06A 3M5CA 5ESXA 1WNFA 5A2GA 1F0NA 1M8JA 3PICA 3CO0S 4XUEA 5ICGA 3JATA 3EWAA 3R0JA 3ZIDA 2P3OA 1N5RA 3BMOA 5T4FA 1U0RA 1MOQA 4UQLA 3D3KA 5B3JC 3OJCA 4MUNA 4RKRA 5EKTA 3OQOA 1B73A 3M5WA 5E6RB 5BMVF 4L5BA 5J4LA 4GWKA 1HZJA 2IBMA 4DRXA 1N33B 4FUTA 3I9LA 1E4EA 1J42A 2QUJA 1ZL0A 1JECA 1G18A 1QIGA 2IW3A 1HK7A 2UDPA 2J48A 3DW3X 1W85B 3OG9A 4NQRA 2ONJA 3ZGOA 3ZPXA 4OL9A 4Q34A 1IWPB 3DVAA 3QZUA 1Y89A 4IDOA 1ZKDA 2EHJA 3UK2A 1E3SA 3QLUA 3RK4A 1GPWB 2EKZA 2YRFA 2HCTA 3IMFA 4IYRA 4PIPA 2VP2A 5M29A 2Q9CA 3HCAA 4CMAA 3DBHA 3RWOA 3IUPA 1R0RE 2JLRA 2HLPA 5JSZB 4OY3A 3H1BA 2CLSA 3PUZA 2IP2A 1QHXA 2O52A 4HUTA 2WSIA 5P8WA 3A1DA 3MJEA 2A1TR 2P11A 2VQ6A 3DV0B 5JH7F 2BW0A 1Q1GA 1BXKA 3E22A 4WKBA 4RUKA 3UF0A 3IL2A 2JCBA 4TTTS 4U2CA 4FB5A 3ZKWB 1U9YA 1BJRE 4MRRA 3SSAA 4LCBA 1U5BB 4OB8A 4W8HA 2FN4A 3EEQA 4U2EA 2Q3LA 2B94A 1TK9A 2W2TA 1AM4D 1H9CA 1MFZA 2COUA 2NSLA 4IIYA 3U81A 1ZMXA 1R74A 3IB3A 3IQDB 4RORA 4DTIA 3NFRA 1JDJA 1NM5A 1U2GA 2FFBA 3K16A 3KB6A 5EPEA 3RLFA 3OEED 4BWFB 3OTHA 2YZKA 3VU9A 4GWGA 4NFHA 1HDGO 2HA7A 5KAPA 4HZUB 1XXHA 2WNIA 1A9PA 1O87A 1RSZA 4L7VA 3L1KA 1A95A 1LWOA 1RM3A 3MRXA 4M0EA 4Y1EA 3V5NA 2QKYA 3UH1A 4L4RA 4GFDA 1Z3CA 3KPWA 4R51A 2FR8A 2B7CA 2QPAA 3LQ1A 4MEJA 5GONB 3K8YA 4TMTA 1E3IA 1W34A 5A03A 1JHYA 1ZU4A 3ADKA 1VZ2A 4OGKA 4TXHA 1H2EA 5C5IA 5EIXA 4W6QA 4V0RA 4FCCA 3C5VA 1RQLA 1SHUX 2HBQA 2C3YA 4NNJA 4D92A 4ENVA 1I01A 2I29A 4MCIA 1T9ZA 3I2IA 4G81A 5CVEA 3JV7A 2QLLA 3MWDA 5FTWA 2DHDA 2Q0SA 3X1WA 4CL8A 5F51A 3AR4A 1R9JA 3UXHA 2WJWA 4TTJA 1L3CA 1BEZA 4RFSA 5IK2D 5HRCA 4EGQA 4QHYA 4DIMA 1DAEA 1UANA 1RQRA 2MINB 2WTBA 3A4MA 5B1HA 3T7KA 4F2GA 5COBA 2C7OA 5IJ9B 3I6YA 1SU6A 3KBBA 3B1JA 2KX7A 4KPGA 1R0SA 1XPRA 2OZLB 3M3PA 1KVUA 3OT1B 4G01B 1JHDA 2GJ9A 3K6JA 1NFRA 3KLMX 3MGGA 3O82A 4WY8A 5LZ5A 3C7KA 5I7SA 5F64A 5BQPA 2OYSA 1N6RA 1D09A 3USCS 2PR2A 3HXOA 3GCGA 1RS0A 2EJVA 1ONPA 2NO1A 4DSOA 3TLGA 1QGUA 5KDOA 3ESZA 3G17A 2WZDA 4CM4A 3AIMA 3QFFA 4JBLA 5IC5A 2HMSA 3SS8A 5TARA 1II8B 1GNPA 2WG1A 4C4XA 1ONOA 4HY3A 3NGMA 3CKKA 3K0FB 2PM8A 1CULC 3IMKA 3L3BA 1MQ8B 3OETA 2J7PD 4ZPJA 1QVZA 1JA9A 4GMGA 4HGOA 1CY2A 4ZAYA 3RR2A 1W88B 1O9HA 2ZJYA 1LX7A 2WPDD 3MOIA 5IFLA 3WRWA 4RYDA 1QWOA 1X86B 4H7JA 3PGKA 3UCXA 2HK8A 3A6KA 2WU4A 1YUNA 1JYEA 2G63A 5ARCA 3BL5A 3LDHA 3RJTA 2HMVA 2A0WA 3IPYA 3TQFA 3EVDA 4F6LA 1ZVVA 3MF4A 2W2OA 4G0XA 4KNWA 1E1NA 1FE8A 3T0IA 5TMPA 2JLUA 3PKZA 2WSBA 2FXIA 1DRWA 3TTYA 1EVIA 1EZZA 1VRWA 1WB4A 1RJDA 3CPEA 5LSAA 4M1EA 4ARIA 4TKVB 3AIIA 1VCOA 4ARAA 5J59A 2Y27A 2I6XA 4E5PA 2WWXA 1KPIA 3DT8A 4AZVA 2IZ7A 1KYWA 5ALIA 2R6GA 3CLRD 4K6FA 2PMKA 5EPUA 1CP2A 2VYFA 3ZU2A 5FEUA 4JYMA 3KUCA 3L41A 5IC6A 3X1ZA 3LC1O 3FWPA 1M2FA 3KEQA 1GSOA 5AJTA 4RL4A 5DTMA 3VNQA 3R0IA 3TIVA 2Z2YA 1R5BA 3K1AA 2F3QA 3DGEC 4JOBA 2IIBA 4XA8A 2WG0A 2P2GA 3X1KA 4IDAA 4BNJA 5BQOA 1XZHA 3FSGD 4FI3F 4IMRA 5IAAA 4QFBA 4U9UA 3PXBA 4KPFC 4EZBA 2RBGA 1WB5A 4Y6RA 1NJ8A 4IJVA 4C78A 1U3DA 3BAFA 5GJVC 3ZH2A 1KQ3A 4EECA 5HKKD 1QP7A 3VYSB 2YZNA 1U11A 2NZYA 3CR3C 3E23A 3IUBA 2OLEA 2ZWIA 3OZAA 3RIHA 3SFZA 4JXJA 3RE1A 5A7FA 2OXEA 4JEHA 1UWCA 2ORYA 4MITA 1V8PA 1XDZA 3WX0A 4LPKA 2IYYA 3BH0A 2HK9A 4BLRA 4JU9A 4XCVA 1ZGZA 1BOFA 5CTAA 2QUIA 3SHVA 2ZRJA 3K6RA 3O31A 4FWBA 1OAOC 3I5UA 3IP8A 3LI2A 1KJWA 4HAVA 4N5HX 4OSOA 5HZKA 1BXGA 3VSAA 1W5TA 1EHCA 1YZQA 3MFQA 1K6MA 4MW5A 5TPZD 2CJXA 4JEUA 2WD9A 4GR9A 4YXWD 4YCSA 1PWYE 5KX5A 1UPAA 1E5LA 1KZ1A 3CNHA 2A5DA 4M86A 3TJZA 5EE1A 4D8UA 4NCNA 3UT0A 4CN8A 2R8BA 3PCTA 4NESA 3LVRE 5C4MA 2EZUA 1Z33A 2AUNA 4Q7QA 3OPVA 4KN5A 4Z6KA 1Z8DA 2P0YA 4Q9NA 1C8VB 1HKHA 1NU6A 2DBZA 3L4BC 4U0KA 5HILA 3RTEA 1SAYA 1UC9A 1QFYA 4LHZA 3W6NA 4G0NA 5HCNA 2WZQA 4TGLA 4BEVA 1U1GA 1XPJA 2YJ5A 3QIVA 1TMKA 3NX4A 4MGYR 2JD0A 4QPNA 4R01A 1UP6A 4HNSA 1E9BA 2B3DA 2A1IA 2D13A 4RL6A 4UJ3A 1UMDB 3WYAA 4TRMA 2VI5A 4DLWA 4RJTA 3K0AB 2CXQA 2NN3C 4JAVC 4FFPA 3JY6A 4HJXA 3DGFC 2H00A 3DJYA 3MILA 4KAXA 1OI7A 4QQRA 1NG9A 4U7WA 1TEXA 4DW8A 2ZRMA 4FFNA 3OWOA 4CZ2A 3R74A 3PP8A 4RV5A 3FVVA 4G1UC 3VA7A 1Z17A 1UBJS 1M2OA 1XG5A 1JEQA 3LFUA 4M3NA 4E33A 2DSTA 4K8OA 3L7DA 1T13A 1R4NB 2IE0A 3AR2A 1UUFA 3H2GA 5A4JA 4ZXPA 3PEWA 3OE1A 4JOQA 5FBWB 1XELA 4CKBA 1EUQA 3VDQA 1GAQA 2H52A 2H4XA 4DV2B 5D3MB 2W98A 1FQJA 1ZJJA 4AWXA 3PDIB 1PZNA 3MB8A 1ISSA 3SXUA 4D81A 4MX8A 1V1MB 1WXEA 2XDQA 4ZT5A 4AZ3A 4KGVA 1DDIA 2Y99A 1BE1A 4CM9A 3EODA 1XHLA 2QVGA 2Z04A 3ML1A 4IQ0A 4WCFB 4X7BA 5F3WB 1WPXA 2HBRA 4ENQA 5LMZA 4MI3A 4RBNA 4H7KA 4PWZA 5IM4A 5DV9A 4OX9B 1AKYA 2FPOA 1MEJA 2OTCA 3V2UA 4R5MA 3KU1A 1TVMA 4R8LA 3BGIA 4ZO4A 2MWMA 3FOZA 3OZUA 4A4DA 1TX4B 4ECAA 1SXJE 4LZZA 2NXJA 1HY3A 2DGDA 2HI0A 2Q5QA 2ZDQA 3FYTA 2Y0CA 5KNDH 3R75A 1O94C 4CGZA 4NV1A 4MA0A 3NHYA 4XWOA 5GZ3A 1W4CA 4O02B 3AM3A 1NRXA 1SQGA 1RPNA 3CNLA 5IT4A 2X19A 1U98A 3OQNA 5IM5A 2XSZA 5CB4B 2CKMA 4ZJYA 1WUJS 4J1SA 2IQ5A 4DVJA 1X7WB 2ZYRA 2Q29A 4G36A 5DTEA 3TRHA 4B4OA 2OA0A 5TQ2A 4DARA 2HMUA 4P4SA 4JT4A 4OQNA 1AQJA 2D1RA 1BMFD 1EBBA 2R8EA 1K7FB 1CY8A 4IRUB 3QKTA 2VUSA 4B4WA 3RAGA 4II7A 2AW5A 3SPXA 3SNHA 1EUCA 4D6XA 2WD7A 1JI3A 5CH8A 3J7AC 1A9ZA 1J5XA 4H31A 4O4IF 1PR6A 2F3SA 3T0GA 4DLLA 2VBIA 1YQQA 2BE7A 2WKPA 2WZCA 5DHRA 4IOMA 5BSGA 3VH2A 2Y0BA 2YMPA 3O9ZA 4FFMA 2Y1DA 2ECOA 2YTZA 4J07A 2H92A 5JO0A 1O4WA 1U8ZA 3KYDA 4PGMA 4YK7A 4NCAA 3W2FA 3CXRA 1NVEA 1T1RA 3P27A 3I5MA 1S2LA 1QTIA 5TMBA 4HNTA 5EUQB 5AW3A 3GN1A 3PSHA 2OHGA 4ZHSA 3EHEA 1T29A 3NW9A 4ZU6X 1J8DA 2UZ4A 1YA6A 2WLTA 3TD9A 3FLMA 3VDRA 5HJEA 5TGZA 3MMZA 4JWTA 3HKEB 3VKFA 2MJLA 2CNDA 2Q6LA 1WLSA 3PU6A 3WE7A 3BHNA 2AQ8A 5FFNA 3RUCA 5IYZF 4LSZA 2Q3HA 2GDZA 3IP5A 1PG5A 4A8PA 4KBGA 3CUUA 3H6HA 4YJ2F 1M1XB 4KE7A 1C1XB 1IZ8A 1NVMB 3QM1A 2NU6A 4PCLA 3AKEA 4OREX 5DVZA 1QCDA 4BAGA 1WU8A 4CXMA 1E18A 3HXQA 3SHQA 3TZCA 4RFVA 2ZSIA 3F2VA 5CAEA 1H2XA 1IIBA 4FS3A 2EFHB 2W37A 3H75A 2GJ4A 2YXPX 4NAUA 4W1QA 4WT7A 1OX4B 1YS4A 2VHQA 2YC2C 3DOEA 3IE2A 4E7OA 1HDEA 2PU7A 4I55A 4Q4DA 4BZWA 2HA0A 4NCJA 3TW4A 1EP1B 4G1BA 1B6RA 1JQLB 2INGX 4JDPA 1P0PA 2OAP1 2VJKA 4YI5A 4QUBA 3R7NA 4ZCMA 3R9XB 4LISA 4K40A 1KI1A 3GJ7A 1NNEA 3CB4A 3YASA 1GPAA 2V54A 1Z8FA 4ZAGA 1IUPA 2FEXA 2ZJ5A 3L7YA 4MQBA 1OH6A 3IKJA 1W6UA 1CYDA 2P8SA 4ARSA 2ZQYA 1WEKA 5JD5A 3ZNQA 1YHYA 2OKCA 1PT8A 1QTRA 4CEJA 3D81A 4R98A 4ZCSA 1T2CA 1T25A 2HRQA 2RJOA 2QLBA 3HCWA 5K3DA 3LC0A 4J91A 2WWVD 3SP1A 1S01A 1J49A 3Q2IA 3WKBA 4K8RB 3RYCB 1XP5A 4KKXB 3A36A 4F3KA 4CIVA 3BJZA 2FP3A 3IKMB 3PGJA 1UKAA 4DSAA 3QLTA 5CLQA 2Q7OE 4NYMR 2VJMB 4M7OA 4EHDA 2YHIB 2PXAA 1PV2A 2MMCA 4OHZA 4HT3B 1CE8B 2AN4A 2X9LA 2E0IA 3GCXA 2FVXA 4EGCB 3KC2A 3NTOA 5AW8A 5DX8A 5KSWB 2W11A 1ORIA 3SQDA 2O2JA 1N78A 5IBCA 4KE8A 2O8EA 3FTPA 4PLYA 3GLGA 1CUXA 1MG0A 1FMTA 1Y7HA 1WEHA 3O26A 4R16A 4PXAA 1JLHA 1YZLA 3OHPA 2FQ1A 1Z56C 4NE7A 3L7LA 1ZISA 1V8BA 4F85A 2GS9A 5BW8A 1N3YA 3WP1B 4A36A 4ZYXA 3EGXB 2AJBA 2VQFB 1JI0A 2PFGA 3ZDEA 3C43A 3FCUB 5IUJC 1CBUA 1SOMA 1YTLA 2QGZA 4H77A 4YJ3B 5E0OA 3SIPA 3MC1A 3CVWA 5BT8A 3AUKA 1M7GA 1T9GS 1UP4A 4DOMA 2EWVA 1HTTA 4X1KA 1JL3A 5HJ5A 4PFJA 4BN4A 4Q48A 2B4AA 5AVUA 1GGHA 2G3YA 3LUJA 3W5SA 1IATA 4FFSA 4HI0E 4JEMA 3O1HB 1NJSA 3GLIB 4AO8A 2D5AA 3GEEA 4MS3B 4TL6A 2NV6A 2G40A 4FJ2A 4B6OA 1JU3A 3R4VA 3HB0A 3VV2A 5HQTA 2PL5A 4D9NA 1KC3A 3CF4A 4Q9LA 4CIWA 3SK0A 4D25A 3GFPA 3HY4A 2NVBA 3Q9LA 1QZXA 3DUFB 4BNNA 5DCUA 4NYJQ 1Z6AA 1VHDA 1XA3A 3UJBA 5BXYA 1PYOA 4QHTA 2CJWB 4LZJA 1DX9A 3LYHA 1YOVA 3RSQA 3QU4A 4EF6A 3FFAA 2VF8A 1T6ZA 2ON6A 1HG1A 5KYUA 4TS9A 1KZ7B 3A6JA 4B46A 4JASB 1D1SA 5HOEA 8ATCA 1GG8A 1G64A 4BV2A 4QOJA 2JI4A 3C7AA 2EV9A 2XNJA 3KV3O 4CU5A 1E9VA 1P4GA 2FPRA 3H4TA 1RJFA 4HQLA 5K0FA 3WWYA 2ZDHA 3MS4A 4F1JA 2DECA 4Z3KA 2REBA 1K8QA 4LMBA 4MA4A 2JLZA 2QM8A 5CT5A 2OR3A 3EJ6A 1YL6A 2B92A 2ONYA 2PXXA 4UE6A 1J2UA 4ZDWA 4KO3S 4EEXA 4ZZ1A 5KB3A 1LEHA 2NSDA 2P9FA 1JZQA 3QXHA 2HF8A 3O4GA 5IVKA 2RI1A 3LXXA 3WICA 4EB6A 2C07A 2OG1A 4HRYA 4GYKA 4EVSA 3VXKA 1BRTA 1OCEA 5LVAA 1KEKA 4FYWA 3EPLA 3I04A 3AR9A 1G2OA 1SVWA 2QRJA 1DMRA 3LE8A 1WZCA 1OFVA 2IITA 4P0PB 4HEA1 4IIXA 3ME5A 4D9FA 1L7DA 3LKBA 4JI0B 1TECE 3H18A 2GJSA 2V4MA 4QXMA 1LWNA 3HVJA 3AETB 4RETA 4WXYB 4UNQA 2GZ2A 1GVHA 4FIDA 4KOEC 4XX1A 2I1QA 3GJ6A 1THZA 1YVPA 2H3HA 4MYRA 3R9WA 1FJGB 3TNJA 1LUAA 2QYHA 2J5QA 4R2LA 3T3EA 3OJOA 3DLBA 1XJWA 4QGFA 5KDDA 3ANTA 2YMMA 1L7OA 2V58A 3AUUA 4WLNA 2DVMA 5KQSA 3U7GA 3UJDA 3EDRA 4WL0A 3GOHA 1RRGA 5GV8A 1AHHA 3ZNOA 3MD9A 3ICPA 4DCMA 1DOHA 4X6YA 2M6SA 5JYBA 5E4JA 5JLJA 4QRIA 4FHZA 4CLRB 4ODIA 4CUKA 1VJCA 4IH1A 4QO8A 4WK2B 4CMJA 4NG5A 3PQ8A 4AKHA 3ZVRA 3EBPA 4D9HA 1E60A 5CYFA 1BQEA 1XAIA 4HWTA 5LU8A 3OEWA 1MOPA 2GOYA 2HIGA 1USGA 2CNWD 2Y6VA 1YDGA 3R5FA 2WUFA 2H1HA 2PSHA 1XQ9A 4V2IA 5B36A 4OX9Y 1QQAA 3GO4A 3ECSA 2W2LA 1F14A 3OCJA 3PGVA 2FMUA 4H18A 4B5KA 2H7CA 3LCVB 5TS2A 2W7TA 2ODEA 2J33A 5BWOA 3ESCA 3HPQA 3EIUA 5C31A 1GPMA 1XT6A 4RSHA 4BDSA 5CG2A 8OHMA 3IAAA 4RH3A 3A2LA 2EU8A 5DLPA 4B4KA 4QM7A 1F2VA 4U5XA 4ZQCB 4BLOA 2A33A 4PXSA 1PUJA 3GUUA 2AHOA 3EAFA 4OKSA 4QRHA 4YMGA 1X94A 1H4TA 3E2IA 5HMLA 1NQTA 1QHHA 5C8ZA 1CJSA 2XUIA 2IS2A 2ZI6A 3VZPA 3DTNA 5CFZA 3OMWA 3F9RA 3LAWA 2XOKA 5J63A 5KHOC 1NQAO 1XRLA 2XYVA 1P7ZA 1MH9A 3LO8A 3ORSA 4C3UA 4ZDKA 3N59A 4IDEA 4EEKA 1VL6A 1E8NA 3ADOA 3OFJA 1N5LA 4E5VA 1EM8A 3KSZO 5KJEA 3WNDA 3JQDA 3T9EA 2QTBA 3M1AA 4DLTA 5DP1A 1IWOA 1N2CA 4XOUA 3LHKA 1F8XA 5CJPA 2BDUA 3L7IA 5JS7A 3E70C 3R6TA 1WUKS 1BG6A 2QSYA 2IOQA 2AG1A 5T4HA 3TOXA 4FFOA 3VH3A 2CJFA 3ZHRA 4QVIA 3Q1LA 2VDPB 1N9ZA 2LGJA 3PWTA 2H59A 1XPOA 3N2GA 3WGQA 1B6SA 5KSZA 3LLSA 1WD5A 1IN6A 4TLCA 1U04A 3WWOA 2X76A 5IC4A 1Y8RB 5DGXA 2PUTA 2EL7A 4NNPA 4LRWA 3C41J 1IPEA 2A78A 3KWMA 2BGTA 5SZIA 1CRQA 3VYUB 4BMVA 3QKSB 3ONEA 2Y76A 1RHMA 2P1DA 4ZVNA 1COZA 1PFVA 2PN1A 4K03A 5DIZA 1FUKA 1VMKA 4ETMA 4N8DA 3RUPA 1U6KA 2X0KA 1CSEE 2R6CA 2AVDA 3HABA 3SHWA 1GKKA 2XB9A 3V2HA 1DHTA 5KTOA 3S2EA 5HFNA 1V5GA 2JBAB 3JTMA 1MMFB 3H5IA 2V0GA 1CQXA 2RKWA 3G0HA 1E9DA 1ORRA 4CR8A 2XTJA 4X6XA 2NYVA 3F9CA 4KQWA 4S1WA 3IR7A 4BKUA 1H1LA 1EWVA 3IE1A 2JI9A 2Y1EA 5HIMA 4GLBA 4HLNA 1SA0B 4RELA 1QLWA 1ZH0A 3E27A 3N86A 3PD1A 3REQB 3GU3A 4HNQA 1EAYA 4EW6A 4D8VA 1F17A 1VE9A 4B85A 1DT3A 2GMWA 4U7PB 5ALXA 3KKPA 1XZIA 3ESXA 5E1OA 4GMHA 2VNHA 1L5SA 4R1QA 1W4BA 3FKJA 1EMDA 2WFLB 1AXEA 1DS6A 4LXGA 3CEMA 3DCNA 4JU8A 5TT0A 1XZ8A 1GZVA 2NQTA 2RAVA 3TCKA 3F9IA 4IRXA 1RHQA 3HZRA 1UBUS 1LF5A 4R9VA 2HMTA 5I7WA 5JDCC 3FPKA 4MWSA 4RNDB 1PT5A 3C7CB 3DE4X 1V96A 3IHLA 4COKA 1XD8A 1U2TA 2PT9A 2J6HA 4HMPA 1AF7A 2CZCA 4KL8S 4V0ME 3B53X 1CR4A 2BELA 1SBYA 2Z30A 3ET5A 4BLWA 2WOJA 2HJGA 4MQFA 4MARA 5HK9A 1FS4A 1K4MA 2PX3A 2NYRA 4US0R 4YAGA 4Y2TA 1SC4A 1KEVA 2IKSA 3SLRA 3CM0A 1PNVA 2NMVA 2DETA 1M1NA 1OBVA 3WRXA 4B3XA 1E89A 5IBPA 3WFJA 1OZ0A 2Z98A 3ZQJA 4UOEA 2P9QA 3IVAA 5H80A 1UBNA 3H4MA 3W0LB 1Z4OA 2NQ8A 3ETNA 4UTZA 5E9AA 4YN3A 1UXIA 4OB6A 5LQCA 2OO7A 2FQQA 1T3GA 4N47A 3TTTA 3QE0A 3QMVA 1EBFA 3M6FA 4KSYA 1G2IA 4H3KB 4OJMX 1B7GO 4UMVA 5TEVA 3V00A 3P1JA 3VH4A 7GPBA 3EYAA 5DM1A 2EZ9A 3LUAA 4Y9UA 1AMOA 4GKKB 4ZMSA 2N42A 4C4TA 3IR5A 4LOKA 1GCUA 1T26A 4KO4S 3VKHA 1XMPA 3OTOB 1GHTA 1BFKA 4Y6SA 3UFXB 5HM8A 3L05A 4ZOLA 1PJBA 3L1HA 3EPRA 3SG0A 5CLGA 1GPJA 2BT4A 1QDLB 4H4DA 2WM9B 4GPIB 4IYJA 3GD5A 4E11A 1EFDN 1Q22A 1TU3A 3DEHA 4Q1DA 3ZIUA 1T35A 3E9RA 4X1IA 5AVYA 1I3MA 2GN9A 3GDGA 4RD2A 2YJ6A 4PCVA 4EPYA 1VA5A 2Z4TA 2QZ4A 4L16A 5DB4A 3VPFA 1PT9A 2VT2A 1ONSA 4CCYB 2OGWA 3FM9A 5AXCA 4FMDB 3UK0A 3PNPA 5JMOA 4UCWA 3O75A 1R00A 5FUMA 1IOZA 1KI6A 2WHEA 3CF2A 3SD7A 2VZ8A 3VZRA 1QG0A 1YI1A 3L0BA 4HPWA 2PVCA 4YUYA 1ZINA 2OC9A 4ZRNA 2VAVA 2WDZA 3QQPA 1XCBA 2I33A 4GMXA 4CV2A 2HHCA 5F4BA 4D4JA 3WYDA 2X5OA 3GN2A 2JBWA 1A97A 2QBYB 1L8QA 2WYIA 2D0PB 4QBGB 3U6BA 3ANYB 4O2BF 4DA4A 4PSVA 1MA0A 4LDNA 3M1IA 3OOJA 1XRJA 3IJEB 3GFSA 2VK2A 2DBVO 3QP9A 3TRJA 1Y9ZA 4GI3A 3MT7A 1RRKA 1UMKA 3OLQA 4LE2A 1QIMA 1SUPA 1BSVA 1U7HA 2QG9A 1Q91A 2RB4A 3C85A 5A5FA 2IYSA 3LT1A 5KVSA 2IDJA 3RJ9A 3EW7A 2O0KA 3X1JA 1QSGA 3MELA 2PS1A 1SCIA 3D8TA 5ALZA 1LBSA 2GK3A 3MK31 3Q5DA 4R2MA 2HA3A 2R0QC 1LQTA 4HXEB 5FOSA 2V1UA 4GBGA 3CXUA 2PGXA 3GLRA 4HQNA 3FFTA 3BKXA 1DP4A 5HIKA 1MTZA 1Y63A 4MVJA 5F78A 1RWQA 3K5IA 5B6JA 5L7TA 4GPEA 2J0QA 3LQKA 4HXGA 2Z6QA 1YNOA 1ZUHA 3SYTA 1TZMA 1BGWA 5DBFA 1NY5A 4NH0A 4XJVA 1E62A 3D2LA 3H1TA 2DR3A 1U0HC 2R97A 1NLFA 2AK3A 4PAGA 2H7VA 3BSSA 3E9DA 4X62B 1N2EA 3Q40A 4JKYA 1W35A 3QEJA 4UARA 3DFZA 2QAIA 3B6ZA 1UKZA 5CIQA 2PGAA 3ZWKA 4EPRA 1JLSA 2X4IA 2G9RA 4GVLA 4LZNA 4E46A 1JAIA 3H2BA 1CEXA 2LV8A 3N6RA 5NULA 2C98A 1WS6A 1SVLA 1K8XB 2XQVA 3O3NB 4FEEA 2DMRA 3H17A 2CDRA 1ZI6A 5AOBA 1U0FA 1L7VC 3EH2A 2NUPA 1P9WA 3RBXA 1QYCA 4JI1B 1NG1A 1PBTA 1HRKA 3LSYA 1O94D 5LZ8A 1XWWA 3UKOA 1K4KA 1FTGA 1R4ZA 2HSGA 1YL5A 1V1JA 1J7KA 4LW8A 1QJCA 1AY0A 4QDOA 3KOXA 1ODLA 3DFUA 2IX9A 2ZB7A 3ER6A 4GZ3A 2QMHA 5EWMB 2PCJA 5EPOA 1EKXA 4JT9A 1LBIA 4QOHA 3GJRA 1Z3IX 3QBEA 5E4TA 1UXKA 1QHGA 2WAMA 1NYQA 3SBXA 3WGVA 1RYBA 1OC2A 1P9LA 4H0FA 4QSMA 2V4UA 2DAPA 2NXCA 3ORHA 1EDEA 3ZJ5A 1USWA 3RKRA 3UMBA 1FS6A 5ALKA 1ZD2P 3UXYA 4V38A 4D9EA 3LBAA 1R6XA 2VWPA 4ND5A 4RVGA 3CRVA 5JJKA 1Q44A 3GVCA 4MLZA 3FNBA 3P9CA 4I1YA 5F3DA 1ZUWA 3DM9B 3H9QA 1NYRA 4RY2A 2X14A 2O57A 3RRXA 3Q2KA 3EZXA 2GCOB 4QU8A 2WTXA 3GYBA 5B5SA 1UJ2A 1QIKA 4MKHA 4YLYA 3R0VA 4JUDX 1K7YA 1ZGJA 1SD5A 2G71A 1EFUA 3QYPA 4Q3LA 1U3VA 2Y3IA 2BZ0A 2HK7A 1L7EA 1P2TA 3MSXA 4JIMA 4MQMA 3SEZA 3VNBA 2WMOB 2ZPTX 1FL9A 1M7BA 2D54A 1NKTA 4U7HA 4IF6A 4YQZA 5HGJA 4BUZA 5J2TA 2EZTA 4I50B 4OG2A 3I2YX 4P33A 1WABA 2AMLA 2J1LA 3JZDA 2NU9A 3LX5A 3EIEA 2EXXA 3OZGA 1Y4DE 4AJ2A 4QICA 4E94A 3UA3A 4L4ZA 1LFAA 2VSFA 4QBIA 1T5HX 4IGFA 2P9YA 4HVAA 1RZRD 2RC6A 3A9RA 3OC6A 5DN9A 1IG0A 4KDEA 3EUEA 1JHOA 4LV5B 3LVQE 3KJGA 1QYVA 4REMA 4TS1A 2VHEA 1E0JA 5J5AA 1X0VA 1SCKA 1D2MA 6REQB 1BE8A 2EF0A 1NBOA 2AX4A 3PQEA 3C1TA 3N7TA 4NYMQ 4YREA 2C00A 4IJKA 3URMA 5F77A 4JJGA 4EQZA 4ETNA 1W96A 1MR3F 2IJGX 1T8WA 4KVAA 3G0OA 4D9GA 3DAGA 3OEEA 2Z1NA 1NN5A 3QHPA 1DCFA 1WDLA 4QT0A 5M34A 1RPAA 1DINA 2V6GA 1U0SY 4LFBB 1OPRA 1E66A 2C84A 1X74A 2F8MA 3FVRA 3PE3A 4MW4A 5LXTF 4DPLA 1UZLA 1F5NA 2PMCA 1UMBA 4JI5B 1N6OA 1CUZA 1KJQA 3M82A 1DKNA 1N77A 2YVLA 4BNYA 3VU8A 3MCTA 4JSRA 4GT1A 2WYHA 3STVA 1E6MA 3RH0A 1VHTA 1NW9B 4PLPA 3VHLB 3AY7A 4PPQA 3EZNA 3B3FA 4Y1GA 3JYQA 1FXWA 1UM9B 2R6FA 4CMIB 5LIRA 2YWDA 3EMBA 4HLUA 4GGPA 1DBQA 5B7PA 1IZ9A 1IN5A 1U28C 2DFLA 3B2EA 4B4DA 1IE3A 4QSHA 2YY6A 1YD7A 2JHAA 4IKEA 3SZLA 1ZNWA 1UDWA 2R7NA 3GP3A 4YRCA 5FTKA 1Z28A 5L7YA 4F0JA 5CYGA 1TCVA 2Q50A 1UP7A 2PKEA 4QLOA 6GPBA 1COWD 5IK2A 3G7UA 3U49A 3R24A 3L6BA 3OUZA 1QYRA 4QX6A 4UC0A 5KREA 4MV1A 1LV7A 3KQUA 4YRFA 1E9SA 2VZ9A 1GGKA 1KEEB 1KS2A 2EP7A 4PLWA 1X19A 1MKYA 4XLTA 2QRGA 2GXAA 4CQNA 2R7AA 3KZKA 1MENA 3NBZC 4KQGA 4V39A 4CWAA 1SNYA 2KW5A 4AJIA 4BNDB 1NBHA 1SM4A 4YNBA 3ZGYA 5FWNA 3D3QA 3HYTA 4HHEA 4JP8A 5AI4A 4B84A 3QJ5A 1BCRB 1D9ZA 2ZVQX 5CBKA 5FDFA 4LRTB 3NOVA 5FPTA 1KMQA 2VPQA 2CVPA 2O14A 4XUDA 1OLOA 3W2IA 3RFTA 3NETA 3KJQA 4MWDA 2IH2A 1JU9A 3L7KA 1NR7A 4JQOA 3IPLA 4TZ0A 1Q0UA 2QAGB 3DHWC 3B9PA 3RS2A 2AOUA 1G4HA 1O03A 3ZS9A 1LSOA 2GZRA 2J7PA 1DJMA 3JASB 1TLTA 4BO9A 1PGQA 2WPDA 2YV2A 1FUUA 4UNSA 4FD3A 2OCAA 3HUEA 3OCCA 7REQA 3F47A 5JEEA 1HDRA 1Z08A 1TA0A 5CRIA 5CEFA 4KAJA 3LWDA 3DVRX 2XUKA 1SVMA 3BE6A 3LMKA 4F7WA 3ZBTA 3ZY2A 2Q46A 1Y6JA 2PG3A 3HJRA 3KYJB 1MZVA 1Z29A 4EY4A 4WZAB 4HDKB 3AFMA 4C2TA 1B2RA 2NZUG 2CLEB 1F6DA 4XM0A 5J4YA 1UBHS 2PUHA 3GBPA 4GLJA 1J99A 3TAXA 1F7VA 1L4NA 3A6FA 1A2BA 2EOAA 4BP8A 1JLMA 3SQXA 2XE7A 2LKCA 4L8LA 4EITA 5ALFA 1EFVB 1QFJA 1U80A 4JB3A 3WYEA 4BU1A 4BV3A 3FLAA 2HJVA 3H2JA 2PMEA 3G9UA 5K8TA 5LOVB 2JB9A 4J2HA 2Z56A 1ZN2A 5KKAA 3WGHA 1Z9BA 1L5GB 3FSGA 1EGVB 4D3FA 4Y67A 2AJLI 1ZRMA 3IUEA 4EVQA 4KQ1A 2WHPA 1QH0A 2PLNA 1EDBA 1TEZA 2ADFA 2P77A 4FFRA 2YASA 3BCSA 1CETA 2A9RA 1NOJA 1V5FA 1T10A 4ZD6A 5SYMA 2JFNA 3AT1A 4BLUA 2ZVDA 1N9GB 2XA2A 4CI9A 3DLHA 1TXGA 4YRJA 2QL7A 3TOVA 1Q0TA 5KZMB 2PGLA 3F6BX 3PV0A 4RMNA 3F97A 4B7UA 2AWNA 1XTBA 2X8JB 4F04A 1AHNA 2BFCB 2XVAA 1KSJA 4FT4A 1M1YB 5EKSA 3V4SA 2D7DA 1HYGA 4TKLA 2CVQA 2GT1A 5CJ2A 2C2HA 4AKSA 3REOA 1B43A 1TQDA 5AO9A 2WNSA 1DU4A 3GG2A 3K05A 3JZFA 2HGZA 3LT0A 3OMLA 4MR9B 3EHDA 4PSKA 3W4KA 4J3FA 2JLYA 3IOYA 3GMIA 5TPZA 1ZX1A 1SD2A 5DN6D 5LLDA 2O19A 2Q8NA 4YXWA 4XFJA 4LEIA 3S2YA 2FFJA 4NU8X 3L6EA 3NH9A 4EKYA 2D59A 5KTNA 2BF7A 1M74A 3VH1A 5ALJA 3X44A 1ZC4A 4LI0A 3ADBA 1G17A 5EJ4A 2I6QA 1ZMBA 4M8SA 5CU7A 4UTPA 1KHHA 1L4HA 2NP7A 4TKMA 3LDAA 1U7DA 2QMOA 3MJDA 4ENTA 1U8AA 2HWWA 2JKVA 3G9ZA 1AGYA 5B7GA 2OILA 4BP1A 5BSEA 2F4VB 1Y81A 3EDCA 2D8MA 4OGWA 1XKTA 3QVUA 4IXTA 3NGLA 4BO0A 1DIAA 3M4YA 3QVWA 4RKYA 4DXAA 1U7ZA 3TNLA 1CJTC 2NZVG 1M2VB 4ENPA 4N1AA 5JCOC 1YVDA 3EF1A 2IEAA 2Q99A 4GVXA 4CTKA 2MOKA 3SYNA 1EP9A 1ZJYA 1EX7A 2C2OA 3IKVA 1J2JA 4A0FA 5K3CA 3BN3A 1ESDA 1G9SA 3KB1A 1JMKC 1P2UA 3G2PA 1SKYE 5IG2A 3QBDA 1M1UA 4WJZA 3ADPA 2QA5A 1CVLA 2BKEA 4LXTA 5EOVA 3MGCA 1UKEA 1WUYA 2CMKA 3KYCA 3BJMA 2HJ9A 2PY6A 2J08A 2RGEA 3IELA 3OLXA 1A98A 3U9TA 4J2OA 4GNKA 4MS1B 1YB2A 1W44A 3CX6A 2D74A 5BQXA 4EX6A 2BKVA 1TEHA 4U02A 1VGVA 4X20A 2YY5A 4TUYB 4I9FA 2D1FA 1KVQA 2NGRA 2SICE 3IXQA 3T52A 3NVMB 5AKZA 3ZU6A 3MIZA 3W5AA 1FW6A 3KAPA 2ERXA 3PPYA 3HWRA 1E7WA 2ZCVA 3Q3IA 4JI8B 3DULA 4IXDA 3HEBA 3ZC3A 4UD6A 2YWHA 1HNWB 4M83A 3TFQA 4JOSA 3FMOB 2FW1A 2Q4BA 3FPBA 4H7IA 3ZCXA 3S1LA 2ZUEA 1W48A 3JARA 4CI0B 3ZZUA 5C5CA 1QTNA 2BEVB 3L7MA 4AI6A 3TDMA 3PF9A 2R65A 3E35A 4OH1A 4EMBA 4TZ6A 1DKLA 3HNRA 3O2SB 1E1QA 1M34B 4NZPA 2NOAA 3FFWA 3QBVA 1CS4C 1OLSA 2YYZA 1A76A 3PFCA 5CPFA 5KVVA 1IEXA 4AURA 3VYTB 1SHKA 2X42A 4K2HA 5HZGA 4BFSA 2ZXFA 1N6PA 1MAWA 1RBMA 3U26A 1Q7TA 1GPYA 1BMFA 1UWLA 4FYVA 2HMWA 2Y1WA 3C5EA 3CCBA 3VPDA 4ID9A 1LBTA 3EPJA 1IZYA 1PNOA 3RJZA 4LZAA 1LDYA 5BV0A 2FZGA 4MWTA 4A2WA 2ANBA 2H2FA 1H6CA 2HHAA 4ZT3A 3L18A 5AOCA 2H2IA 3RARA 3EN0A 3WFZA 1F6BA 4RQUA 2I1WA 3Q7EA 2ET6A 4HX5A 5ENZA 3UBMA 2JHCA 1K5PA 3TPZA 4BNHA 5J58A 3U19A 1SHZA 3EEOA 2CHGA 5AVSA 5EE9A 3DTVD 5FPQA 5KVAA 1CQIB 4IXNA 2UYHA 1QTQA 2P1ZA 2H31A 2D1YA 4NJMB 1ZCZA 3KOUA 1T0BA 3T5MA 4A8JC 2JGLA 4HN9A 3UENA 1ZJZA 4NDZA 1DCMA 1J8VA 4HNHA 4BECA 4LDJA 4LUCA 1JAXA 4HVLA 3PIIA 1K68A 1NX9A 3PHBE 4RWEA 2GZDA 3RU3A 3E9CA 3GLGE 1D2EA 1G9XA 4RVUA 5I8WA 4PTLA 3MCUA 1QVWA 4PX2A 4X7PA 1KEUA 1P0QA 3BVPA 1KQFA 4FBLA 1DJLA 3E61A 2GYYA 3P9ZA 5ICSA 2VP3A 1VBFA 4LG1A 1XNRB 1TE2A 3RVQA 2GJAA 3Q0EA 1N75A 2X40A 5ED0A 3ZHTA 4ZQGA 1U5AA 2WDPA 2BZ1A 2IPLA 4V1CB 2OG2A 2O5RA 2NAPA 3O95A 4YC7A 4CE6A 3RRZA 1YI8A 4RJJA 4KYUA 5DLEA 3JW8A 3B9QA 4JJFA 4PAOA 3RM3A 1YZKA 4FFDA 3JWHA 5EJIA 5JBIA 1DVRA 1YBMA 1S4QA 2YL2A 2IUSA 4GF5A 4QO7A 4YAWA 1YASA 2JFYA 1HYQA 4B8ZA 4IHAA 4PGAA 1W47A 4TL9A 4DCCA 1KH2A 3KALA 1XVTA 4XIGS 3R4CA 3BM5A 1KMMA 3F3YA 1KYTA 2YW2A 2PE5A 1KMCA 3BZWA 3NJ4A 5BSMA 2D2IA 3PQ4A 1DB3A 1UDRA 1E6KA 2MR6A 5DGCA 4TTPA 3VTFA 1CR6A 3NIFB 4M46A 3ADDA 3NWBA 2NO6A 3I2KA 3RIYA 1V35A 4PCUA 3WISA 3I83A 1VSVA 2ZRPA 3LW7A 3WK7A 3GBVA 3SLGA 1R8QA 3A9TA 4WGGA 2VK4A 1S96A 3UB2A 2CD9A 2MU1A 2C20A 3LG2A 4WESA 5MDHA 5TX7A 1VFNA 1CY1A 1KK0A 2PKQP 4M60A 3A1SA 2EW8A 1S2GA 3UMRA 1B41A 3T7CA 1IJBA 4Q4JA 1P33A 1PT7A 3TVDA 4O59O 1FP4B 3FZYA 3OX1A 4I2VA 4IUDS 5CHYA 5U4QA 3SHFA 5IKMA 4IQ8A 3IQIX 4KSCA 2PCLA 1M8FA 3HA3A 5SY4A 3IT0A 3KV1A 1GKUB 3MT0A 4ZO9A 4G4JA 5EP3A 3ZG6A 1C50A 3VKWA 2N75A 2JNWA 2QLMA 5AJVB 2EDCA 2PAFA 2VYQA 3EQ9A 4Q4LA 1JVNA 1QGDA 3OI7A 3HA2A 3OY2A 4H7DA 4D9MA 2RGRA 3GZNA 3HVUA 4HMQA 3WNCA 4EAAA 2YYYA 3KOYA 4XQGA 3THSA 3WHLA 1I1OA 2A0XA 3DVQX 3ND8A 1NHWA 1Y9JA 1IOWA 5F7JA 4K9LA 3OUTA 5FXMA 4Z53A 1R8XA 2W6JD 4M49A 1YR2A 3OJXA 2QTVA 4UCQA 3V1LA 1ISPA 1TYBE 2A57A 4B1FA 4LJ7A 1CUVA 3L7OA 1YJBA 5C7OO 4ZU1X 4KX3A 3N2NA 1ZVMA 3MXTA 2FP4A 5CDGA 1JDPA 4MWZA 4TM7A 4TKUA 4BRZA 3S7TA 4HDMB 2FZLA 4X91A 2MYNA 3H5TA 3NYQA 3DCJA 5J4HA 4IS3A 4REQB 5T6BA 5LJIA 2E5FA 3JPWA 1ZLXA 3OKPA 5DMXA 2ORED 1OB2A 1VDMA 4M8LA 1OXVA 3O38A 3ZJYA 1K8YB 3QWHA 2G04A 3F46A 4WOBA 4EZIA 5GIPE 3EMVA 4LE0A 1JA0A 3LUCA 1PQWA 1BGVA 4IICA 1UOQA 1P1IA 2KWIA 3SR0A 3P0JA 5JZVA 1O3YA 3ZJUA 3S7ZA 3NFYA 3WIEA 3MBKA 2REQB 4AJJA 4EO4A 3AR7A 1A8HA 1EB9A 1E6LA 1NRWA 4GX5A 4LJSA 1HSOA 5EG5A 3O1LA 5K3SA 5HUHA 1KU0A 2BBWA 2WIJA 4J76A 5DZSA 3T6KA 5LP6A 1W73A 5KQLA 2ZREA 3RASA 5HQ3B 3BJRA 5HIJA 3RRNA 4F4HA 2XX3A 3DE2X 3I64A 1E2DA 3OZBA 3CX8A 3DBLA 3EOAI 3PRJA 4Y2SA 3U3XA 4AJPA 2POCA 1T36A 3SY8A 1AMNA 4EMSA 2GFIA 2XUQA 4OI1A 3QNMA 4BVGA 4MQEB 5A9SB 5FUQA 1TT7A 2R47A 2IS1A 1XZJA 1E3QA 3I2GA 2C7VA 3O8OB 3JQPA 3RIXA 1JTVA 3JAWA 1W36D 1G3IA 4EMTA 1JQEA 3FLEA 1H3EA 2VPIA 5AM5A 4PZCA 4LXIA 1TCCA 1ZXLA 1PL8A 3ZU3A 1X3SA 3LP5A 4GC9A 4LQDA 4EGAA 2XTMA 4A82A 4C4RA 1DADA 4AG6A 5L3VA 4F5WA 2VF7A 3NHWA 5LZ9A 2CWWA 4OAPA 1IXSB 3LSTA 5EGNA 5BW6B 3RSOA 2QI9C 3FW1A 3GR6A 2GAAA 3OEYA 2G9QA 4G9BA 2E1PA 1JLRA 3BWBA 3MLEA 4H7PA 4I7EA 4M0KA 3TEMA 1ABBA 3SIWA 4PVDA 4NBVA 3AUYA 4JLMA 2A3RA 2GJ8A 4ML3A 1YC5A 6PFKA 1J7JA 3VR5D 2CEKA 2XUAA 1N2ZA 3BXEA 4HPXB 1IXZA 3WIVA 4OF4A 3B2QA 1UEXC 3C1OA 2CDCA 1V95A 3I0ZA 3MJHA 4DNQA 2B6HA 2Q9AA 2REOA 1C0EA 1K5HA 1GM5A 4B34A 3UJ6A 4CNBA 3KAKA 3U5ZB 3BX1A 3CLUC 3I34X 2JIDA 4B9EA 4IJMA 4YCCA 1NMQA 5JS1A 3TSAA 3TM4A 1THMA 3H2SA 3HEMA 1VYUA 2XHEA 3C6ZA 1A5BB 3A1EA 3HU2A 3QVGB 1PQYA 4NY1A 2YNMD 3WSWA 1XLTA 2XXJA 4K2AA 5LN1A 5CGZA 4RA9B 1IQ0A 2C2XA 2EFDB 4O2RA 3N2EA 4KHPB 3FWZA 2CNWA 1ADYA 3VDXA 4KR6A 1J0AA 5DXFA 5JPIA 1CX9B 1D0SA 1URPA 3G2QA 4KLNA 4P0TA 4BLVA 1F48A 1ZN9A 1N0WA 4DQKA 1TD1A 1QWSA 3OZWA 1RWOA 2R751 3OSZA 4TN5A 3R7BA 1PLLA 3T5DA 4D4MA 4D57A 4TV9B 1KQOA 4IH4A 5FBRB 4PG5A 4X1YB 1YB1A 2KM1A 1IMOA 5AICA 5HW0A 3BWEA 1FMJA 4PLVA 4QULA 1L9XA 2G36A 1U6IA 1C0PA 2EGHA 4NHOA 4NOLA 2BR5A 3HP4A 2ZB8A 4PX9A 3THWA 2VHWA 2AXQA 2QD5A 4G86A 3W2HA 2CVFA 1WZIA 3DDZX 1X7ZB 3FCSB 3NHBA 4HYYA 2CFSA 4LWQA 1MAHA 4YI3A 4ZWNA 3OM8A 4MOWA 5HUJA 1FP6A 2IP1A 3AVYA 3Q7RA 4NZMA 3R5TA 1ZDMA 9LDTA 1JG2A 3NS7A 2NYAA 1Q11A 1HOTA 2PJZA 5JJBA 2WNHA 3HO1A 4OJNA 1Z0AA 4WZBA 4BS9A 4JR2A 4MROA 1J2YA 3VFDA 1HDZA 1N7JA 3F3MA 3ZWVA 4MO2A 5BWBA 2XKKA 3OOEA 1KETA 2A4MA 3CSUA 2XT9A 1ADBA 2J9GA 2OP1A 3NWJA 3CZAA 1RYZA 5MFZA 4KE6A 1QE3A 3GFBA 1Z36A 3AGPA 3LWBA 1YRQA 2Z2IA 2VNSA 2FAXA 1DBIA 2ZIAA 1T5IA 2CB9A 2EYUA 5HJ2A 1ZW6A 4QOEA 3UBTA 3MTJA 1RJEA 3N3BC 1Y9DA 1FDUA 1QIDA 4QYSA 1JEYA 1PS8A 2J9YB 5F5LA 3T1QA 4L9RA 1NDUA 4GZ6A 3LCJA 1Z47A 2PGIA 1U2RA 2FN8A 2ZBFA 4PAMA 3ER8A 3NT5A 3Q10A 1BEUB 3F5QA 5JS2A 5KMGA 2GN0A 1OTYA 4HUJA 2YOFA 4G23A 1JYSA 3TLEA 4HAZA 4DA6A 1VB5A 3LUBA 5AKHA 1DWQA 3TKLA 4P7BA 5B53A 4BZPA 1PVOA 2ZT5A 1G20E 4FOOA 5BWNA 2PX4A 4IP0A 3WIUA 5BWMA 4NH4A 4Q1BA 2L2QA 3FNFA 3PK0A 5KO2A 3DMRA 2ZJOA 5EJ6A 3ZJTA 4G0ZA 4MW2A 3ED1A 3KOZA 2D0OB 3BXGA 3N53A 1SVUA 3N8NA 4YYEA 3M6MD 3VC1A 1C81A 2BYTA 2BFNA 2D00A 3JQ6A 3S99A 4DM7A 4FGKA 2IIVA 1SXJB 4JP1A 4CMEA 3F4KA 5B6IA 2JKYA 3C15C 4DWVA 4TLDA 2WINI 3FOAA 3SJZA 3TBKA 4B3RB 3W5JA 4ABYA 3AGQA 1DRUA 1NNUA 1YZYA 2I3ZA 2W2KB 1QMPA 4NNOA 4OIFA 1CF2O 1GUBA 5EMJA 3CZRA 1GZUA 1N5JA 3H8WA 3SJBA 4LYHA 3QU2A 4Q0MA 1ECLA 3ZDCA 1ECCA 3FX2A 4AECA 4EW2A 5JXIA 3SSNA 3GL9A 1XMIA 4BJ3A 4ZI7F 1Y5RA 1XE3A 2XQIA 1A1VA 3VJMA 4TWBA 5GP1A 1A5AB 1DJOA 1R5OA 1VBNA 3SZOA 5H4GA 2AE2A 2J3IA 2YICA 1BFDA 3CU5A 4Y6OA 3RSSA 4BWVA 2Y77A 2PX6A 2JASA 1DC7A 3BPSA 4MZXA 3EXIB 4RY0A 2X0DA 4WBNF 4CODB 2N47A 4JY7A 1Z15A 1R0KA 4Q3NA 2OCDA 4PO8A 1VRVA 2C8KA 4BFYA 3FPEA 3OM1A 3LUHA 2ODWA 4G5QA 5KVQA 1WDTA 2QT9A 2IPAB 3UMJA 1Z26A 4Z49A