1O94D

Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
189
Chain Sequence
b'SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIMETHYLAMINE DEHYDROGENASE
molecule tags Electron transport
source organism Methylophilus methylotrophus
publication title Extensive Conformational Sampling in a Ternary Electron Transfer Complex.
pubmed doi rcsb
total genus 50
structure length 189
sequence length 189
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
D PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1o94D00
4YMIA 4X0EA 4ARIA 3IOEA 4BWVA 1M83A 3D6VA 1YULA 1WY5A 2E0IA 2BTEA 4MWCA 3N9IA 4MVWA 2QJOA 3ZIUA 2A7XA 1S4MA 1WXHA 3P52A 5FO0A 4OJMX 4ZCQA 1T6XA 3F3MA 1JHDA 2D5BA 3NV7A 4MWBA 5JBNA 1JILA 4UZEA 3IUEA 3ELBA 2Z08A 4JZYA 4MLPA 1N2GA 3KFLA 3JXEA 1TYBE 1EJ2A 4ZCRA 1PFWA 1JEDA 2X0KA 1NYLA 2PFSA 3LCJA 1OWPA 2PZBA 1NUTA 5DASA 2IELA 3VU8A 1OD6A 3SDBA 3L93A 2A88A 3L92A 3A2KA 3ZXIA 3IOCA 1TEZA 2CV0A 3AG6A 1H1TA 3Q4GA 4KKVA 5FNZA 2IP1A 1PG2A 2B7LA 3BL5A 3X1MA 2QTNA 4EG4A 1Q15A 4KR9A 3RK0A 2R5WA 2CV1A 3A4IA 3COZA 2PXHA 2VXOA 2NZ2A 4Q93A 2XRYA 3KT3A 4K0RA 4EG8A 4ZT3A 1JGTA 5TS2A 2QUKA 1R6UA 3N8HA 3P0HA 3M5WA 3ZJTA 1H3NA 1COZA 1ZH6A 4ZCTA 1QJCA 4MUKA 1V8FA 4ND6A 2ZP1A 3IMEA 4R0NA 4JYZA 1NZJA 3MUEA 4EG7A 1WOYA 3KT0A 4MUGA 3HGMA 4NATA 3SZ3A 1O94D 5LM3A 1MB2A 1U7XA 1GTSA 2A84A 4QRDA 3QTBA 3FH0A 4HJXA 1N2EA 3CVWA 1F7UA 2E21A 4MVXA 1GN8A 4MWDA 4DDMA 3G6KA 1T9GS 4F4HA 1J1UA 3OP1A 1KQNA 4JFAA 4NAUA 2TS1A 5TEVA 5KWVA 2YWCA 1IQ0A 1YUNA 1KH1A 2D54A 1GAXA 2RE8A 1OWOA 4PBRA 2OQ2A 1K92A 1I6KA 2AZXA 3MXTA 1NUPA 4QREA 2DXIA 3PXUA 4U63A 1KQOA 1XNHA 1H3FA 4MUEA 2A86A 1N3LA 1JZQA 1KKUA 1IQRA 1IRXA 2DERA 3CA8A 1IFXA 1N2BA 2DPLA 2V0CA 4KR7A 4MQ6A 4GRIA 1Q19A 3HL4A 4HPWA 4YP5A 1N2JA 1N2OA 2PIDA 5H7XA 3VRHA 3FWKA 4MW0A 1DNPA 5H16A 3H9CA 5KCMA 2QJFA 2PZAA 4QBTA 3TS1A 3KT6A 4Q16A 1O5TA 1TYDE 3H99A 1TYCA 1M8FA 3G5AA 2QTRA 2CYAA 4NAHA 1SURA 1Y42X 2DEUA 1JMVA 1Q11A 3HMQA 3ZJUA 4L2IB 1F4LA 1K97A 1YIAA 1V47A 1EFVA 4RUKA 4AS1A 4YP6A 1VBMA 1H3EA 1WZ2A 1JECA 3SP1A 1YI8A 3CR8A 2C5SA 1N2IA 1VBNA 4HJRA 1NP7A 1Q77A 1R6TA 4MUNA 3DLAA 3KT8A 3CLTD 3FY4A 3UC5A 5LLTA 1XNGA 3TNJA 5BNZA 2ZUEA 2A1UA 3ND6A 2J07A 1O94C 1MAUA 1LW7A 4I6EA 2RD2A 1F7VA 3GMIA 1NI5A 4ZT7A 4E1AA 4XSVA 3IMGA 1GPMA 3TZEA 1OWNA 2YWBA 4P2BA 1PFUA 3COWA 1QU3A 1KP2A 5J58A 1EE1A 4U8HA 2A1UB 4YP7A 4ARCA 1GTRA 4EG6A 3QE4A 1IHOA 3CVXA 4MVCA 4J76A 1KORA 1QQTA 4KR6A 4XFDA 3RBAA 1QRUA 5DEOA 3AG5A 4PY2A 4EG3A 3G59A 1OWLA 2DETA 3HFJA 4MW9A 1N77A 3AL0C 2H2AA 2A1TS 4DJAA 2GKSA 3UK2A 3ZUGA 2CUZA 3GUZA 1QU2A 1WQ3A 2Z3VA 4PBTA 4ND7A 4YBRA 5AHWA 2HMAA 4DDHA 2H29A 3A04A 3NBAA 5J5AA 3E27A 3N05A 3U1VA 3NBKA 4MUHA 1TYAE 2CYCA 5IHXA 1F9AA 1P7PA 2J09A 2PG3A 2CV2A 4R2LA 3H05A 3ND7A 4MWEA 1MC1A 4G5YA 1O95C 3FETA 4DNXA 4ZCPA 3IVGA 2QJTA 1OBCA 1KP3A 1O97D 1RQGA 2YY5A 3FI0A 2HZ7A 3TQOA 4EG5A 2O5RA 4GU5A 5K0TA 3C8ZA 1K4MA 4MUJA 5DB4A 1KAQA 1WXGA 3FNRA 1MJHA 2EL7A 4NX2A 1EFPA 1T6ZA 1IQUA 4PBSA 4I6GA 2BYTA 1I2DA 1NUSA 3RHSA 1G8FA 3MLAA 1EUQA 3Q10A 2GOYA 3A05A 4WNYA 3RK1A 1XJQA 1M8GA 1I6MA 4MW1A 1KH3A 1WXFA 3IODA 1WJGA 2J5BA 4RPIA 1IH8A 4ZT5A 2GM3A 3SYTA 5HUJA 1EFVB 5F23A 1U3DA 5K0SA 2VTBA 1QRTA 1O96A 1ULHA 2X3FA 3OTWA 3MLBA 1J21A 1ZUNA 1N75A 1WQ4A 2XRZA 4F3RA 3H9BA 4EF6A 2X1MA 2E89A 3ISJA 3PNBA 1KH2A 1HYBA 1UFVA 2G36A 3AKZA 2QUJA 2AG6A 3X1KA 1CT9A 1R6XA 2EJCA 1JEEA 1FYDA 4FZJA 2JA2A 1JIIA 3IVCA 2WQ7A 2VTBB 2WB2A 3FOCA 1JIJA 2ZUFA 1N78A 3X1JA 1YUMA 1NSYA 1B6TA 1X6VA 1QRSA 2QUIA 1MBZA 5DK4A 4J75A 5HUHA 1LI5A 1JIKA 1FFYA 1JZSA 1M8PA 3DPIA 1N2HA 3P0IA 4MUIA 1XNJA 1K4KA 3H97A 3HV0A 3CLRC 3AIIA 1EUYA 3LOQA 3CLSC 4KPUA 2PZ8A 1QNFA 1TQ8A 1J70A 1G8GA 3CVVA 1QTQA 3GLVA 2CSXA 4G5FA 3SZGA 3COVA 4TS1A 4CT0A 3I05A 4ZT6A 1J20A 1O6BA 3HZRA 1J09A 3ZJVA 1A8HA 5TGTA 3CVUA 4KPUB 5IJXA 1T9GR 2CYBA 2A4MA 1EXDA 3VGJA 2JANA 1U3CA 3FIUA 3IDFA 3IVXA 3QTTA 3IH5A 4L2IA 4EG1A 1MOPA 3D6UA 2HGZA 4DLPA 1GLNA 1WKBA 1GZUA 1VL2A 2E18A 3SEQA 3MMXA 1M8JA 3P0JA 4H3SA 3COYA 3CVYA 2QUHA 2DLCX 3PNVA 3LE8A 1U0BB 2O8VA 3K32A 4HK4A 4MULA 1U7DA 5TEWA 4MW6A 1OWMA 4ZT2A 4R2MA 1O0BA 4OUDB 3IMCA 3K9WA 3PNYA 1X8XA 2QTMA 5EKDA 3ILVA 4MUFA 2WQ6A 3UY4A 4MW2A 1ZH0A 4K03A 2CT8A 3CLUC 4U7JA 3FG9A 1BS2A 3CLRD 4A91A 2D13A 3Q12A 2J08A 1MAWA 3CLSD 5HG0A 3UOWA 4AQ7A 1VBKA 5FO1A 1NUUA 5J59A 1WXEA 1IVSA 4OUDA 1O95D 2YXNA 1LI7A 2OV4A 3IUBA 3N2YA 2J4DA 3FDXA 1O97C 1PG0A 1NUQA 1TFUA 4JXXA 2X1LA 1J1ZA 4NZPA 4DE5A 2DUMA 3ZXSA 2AKEA 4G6ZA 3RJZA 2JAXA 1EFPB 3FHJA 3CLTC 2CFOA 3ND5A 1G8HA 1MRZA 4EFKA 1ILEA 4NDAA 4EGAA 1KAMA 4MW5A 3RFFA 3DO8A 1T6YA 2I1LA 1ZJWA 3CLUD 1OBHA 1MB9A 4S1OA 3ZGZA 3TZLA 4I6JA 4WSOA 3UMVA 2IJGX 1VLHA 1KR2A 1YIDA 3IOBA 4ZT4A 2Z09A 2V0GA 1NURA 4CQNA 3DV2A 1KQPA 3AFHA 3TQIA 2NSYA 1O96B 3INNA 4MAFA 2DR2A 1PFYA 4XFJA 4MW4A 1M1ZA 4MW7A 1O0CA 4DDKA 5KHAA 4CDMA 2WSIA 3S3TA 4JXZA 4UZFA 2A1TR 5LFAA 1I6LA 4CDNA 3SEZA 1D2RA 1G59A 1N1DA 3PRHA 1M8KA 1WXIA 4MVYA 4ZCSA 1PFVA
chains in the Genus database with same CATH superfamily
3NUGA 4YJ3B 2HXYA 3NFRA 4L7QA 2OHOA 1ORDA 5MFZA 3D8SA 2EV9A 1HFKA 2WTMA 3BB3A 3MWGA 5KYVA 4Y98A 2QAGC 2ZT7A 4BAGA 2XWBF 4L0QA 2Q4EA 2HA6A 3VR5D 3GLFA 1P19A 2IPOA 4M76B 1BX3A 1GPNA 1FYWA 2JHFA 1Q3HA 1N0WA 4MR7A 4C5AA 1Z73A 4HRVA 4UM7A 2FPGA 4OGWA 4DR2B 2IODA 6LDHA 1NSFA 5E1BA 5KB3A 2I22A 1UXJA 4IZOA 4F3CA 2O1XA 3U4IA 1LTKA 1DKNA 3SDZA 4TV9F 4CMJA 5D5HA 3KKPA 3INYA 5G0TA 4E09A 3DV0B 2D5BA 2H51A 3VR3D 3F9RA 3WX0A 2GH1A 3L06A 3PQ3A 4R5HA 3T95A 3WE7A 3N2NA 4AKIA 4WESA 5J2UB 4OJQA 3PBKA 4OQDA 3NXSA 4Z1MD 4QT0A 1ZICA 3DAOA 4U6NA 2W2TA 2MYTA 3B3JA 4MQ5A 4MPTA 1BE6A 2G28A 2WF8A 3PCTA 3OTHA 1C7EA 1CP3A 1FVFA 2JLAA 2WHPA 2AGVA 5A6VA 1JHRA 2I4NA 5CT5A 4QDXA 1HMYA 1WPQA 2DECA 3EOAI 1ZUWA 1LX7A 3CQ9A 2C1XA 4JJFA 3LUBA 5LP6C 2PJZA 4KB5A 1WCIB 1V7CA 2B3DA 3PHCA 2PYDA 3HY6A 3BA6A 2O2JA 1QIDA 2HBYA 2R25B 3C6QA 2CXXA 1ULAA 4X1YA 3LUPA 1KHTA 1D09A 1UWVA 4ICIA 1ZFNA 3ZNPA 1K75A 5A5EA 3GZTB 1SRRA 2SBTA 2WJZB 2FXIA 3V48A 2Y1KA 4QBHA 1WUHS 5ERYA 1DTWA 4MWSA 4Z86A 5GOTA 2WW8A 2PH7A 2AG8A 1TCVA 2O7QA 5DX8A 2W0SA 1BVYF 4DMLA 3IV7A 3WFIA 4AFNA 2JGLA 3KOOA 1W76A 1XU4A 2EBHX 3PD1A 3Q3IA 4KIJA 3S8YA 2P77A 2H00A 2XEDA 3CNBA 4JD5A 3RSOA 2ZWVA 2IBTA 4WNAB 1ZH6A 2VXCA 3HJUA 4XSHA 4Y9SA 3HTXA 4LJAA 1XEWX 1UXGA 1CQWA 1HT3A 1C3OA 3NAGA 4NG5A 5DNAA 5IYZF 3L8CA 4R0NA 4UEKA 2GT1A 2PUWA 4FXPA 3GPIA 3MUEA 4V0OA 2VBGA 1PWHA 4LF9B 1RLOA 4HRYA 2V6FA 3JU3A 4NEGA 5FWYA 3DEZA 4NATA 1SY7A 1Y9JA 4IXDA 3CX8A 5L3SB 4FWBA 3CZMA 1VPLA 3Q8WA 2A5FA 2EDCA 2B9VA 2F59A 2J33A 3DNPA 2WKSA 5GM2A 1HDYA 4NBVA 2BH2A 5D86A 3GLGB 4HT3B 3H7AA 1A97A 2A8YA 4JKOA 1JLSA 4PYNA 4W5TA 2G4CA 2CL6X 3ESZA 3KUKA 5D3KA 4XDHA 3QTLA 3ROTA 4EVSA 5EZ5A 3W9UA 3B36A 2F2TA 2JIRA 4PHTA 5CCEA 2TS1A 4HH1A 4UUPA 1BKDR 2VFAA 2X9VA 3CVJA 2QQEA 4NK5A 4JLSA 5ALWA 5AM5A 4JROA 3SIWA 2Y2VA 4IRMA 4ZZ2A 4E5SA 3PXAA 1U6JA 2EX1A 2OQ2A 1WCXA 1OAOC 3DH0A 3TW0A 2MMCA 2P9HA 4ADSG 2FW1A 1YDGA 2JD1A 1OY1A 2Z3WA 3SKYA 4Q3DA 1JZQA 4XCVA 2CD7A 2R84A 1KKUA 1XCPA 5CB0A 3PPIA 5AHKA 2R6FA 2X22A 1BCRB 1ZK1A 2DPLA 4M1TA 2Q5CA 3DZJA 2Y93A 1PKEA 3P9PA 4XYBA 4XWOA 3IELA 5HF6A 4OXIA 3UK1A 3CIOA 5FPTA 3HM2A 5FLEX 3RD5A 3OZVA 3UHAA 4AY2A 1XTRA 4NMXB 2O23A 5H16A 4IDEA 5C53B 1QHGA 4JXKA 4QBTA 4FC7A 4MV7A 5C1DA 1J7KA 1M34B 1E9EA 1MXHA 1QTRA 1WPRA 2PUVA 2ZJ3A 3GFBA 3GEMA 4Q1FA 3T7IA 3FZYA 4YYZA 3RV4A 2H31A 2WAXA 1YDMA 4TQGA 3Q3JB 4MEJA 4KO2S 1PZFA 4BFXA 5EIXA 2QTRA 2ZAGA 4Q3BA 5KYWB 2A35A 4V0NA 1CUDA 4LJ9A 2O2DA 3HMQA 1Z74A 5AW9A 4AW9A 3EDQA 4AO7A 4C6RA 1TYZA 2RHLA 2FI1A 5KYYB 4GR4A 1JXAA 1T2DA 5FFNA 5KWEA 3FOAA 1II9A 3QE2A 5DTMA 1ZC3A 2W98A 2NU9A 1H2YA 4UDYX 6PFKA 2H3HA 3QF7A 3QU9A 2B7CA 1VBMA 2AR0A 1CY2A 3JALA 2ZYDA 5DFAA 2B6NA 5HF5A 4RHCA 5ALLA 3SFZA 3EGDA 2GR9A 2P9TA 2W6PA 1NN0A 1Q84A 2GNOA 3AM3A 3AY7A 3EXAA 1XR3A 1YI8A 3QMVA 5DIZA 3VYTB 2JLCA 5ED4A 3PHHA 1RPAA 1NY6A 5B3KA 1GPWB 2BCJQ 3TTYA 4BFTA 2BSXA 1VSBA 1Z5UA 1KA9H 4HWKA 5KJ1A 2AYXA 4H0FA 4XQGA 4M7WA 4S1TA 3N6VA 4D4IA 2VYFA 2B1IA 3GA5A 1YHNA 4AMBA 3EXIB 1WXQA 5FBLB 4HFMA 4ALNA 1AO0A 4QYMA 2Q5FA 1C9EA 3W8FA 1D3AA 2FHPA 2IP2A 2N1BA 1O94C 2XADA 3C3EA 4A8HA 3G7NA 5JEEA 2FN8A 3DWEX 3G0DA 3ISTA 3JQ6A 5EQJB 5BNFA 3AIKA 5TR9A 4DGQA 4LOIA 4MCHA 1KNXA 2WF9A 4HTFB 5BUCA 2D5AA 1C9YA 1WDTA 4LMRA 3ZIAA 4A7PA 5IXYA 4DSTA 1N0UA 1OREA 3HA3A 1RAHA 4NECA 3N74A 4CU2A 4YAWA 4C7KA 1PYOA 2AOWA 1NJ5A 2VK4A 3HP1A 2WF6A 1MT0A 2Z9CA 1M6EX 3NEPX 3WLOA 2C1EA 4D1YA 1HX7A 3U7QA 1F6WA 3C7AA 3PPWA 1C7IA 5E6SB 2OR3A 3IP5A 4QYIA 2ZYUX 3FFTA 3T9FA 3OM0A 3OZDA 1KMNA 1QRUA 4KXWA 1ZVVA 3EGOA 4FONA 1A4IA 1HNNA 4BNHA 3TDKA 4AJPA 4MRNA 1WU7A 1ACJA 4D8UA 2H1OA 1JG6A 2DETA 1U9ZA 3OHPA 2D3TA 4KI7A 5BSKA 3FDFA 2OO5A 3AJAA 3R8XA 4BQQA 3H6GA 2YS7A 3O47A 3WYDA 2OHHA 5ADVA 4MWGA 5JJ5A 4BKOA 2EGHA 4MZXA 1UWCA 3K0CC 5DEIA 1EWRA 1Z7EA 4GSLA 2GBLC 4RM3A 4Q7EA 3AETB 4RE6A 5K3SA 1K7EB 1Y1PA 3UTCA 4AM8A 5ALSA 1M7HA 3ETDA 3MVEA 1DBVO 2F48A 2A9VA 2HMAA 3B52X 3D3EA 3HH8A 3MTAA 2M6RA 3OZSA 5AM2A 1V8PA 4NICA 3GPLA 1EFRD 2G71A 4TLMB 4C4OA 3LQQA 2YNMA 4DV2B 3NBFA 1LBQA 5GV7A 2IA5A 1DLJA 1I36A 4I19A 1C30B 1QHNA 1P29A 2XQGA 3SZRA 2H1LA 2C2HA 2Z1NA 3IJRA 3TLBA 1S2LA 2WPDD 2QIPA 4R2LA 1U11A 3VC2A 4AMGA 5JNSA 3QFRA 2VXBA 2UUCB 2OV2A 4QKQA 3I8OA 5JANA 2C59A 4A10A 1EQAA 3OLYA 3IVGA 5HTKA 3C5VA 1FFCA 4P7FA 4TSFA 1FJXA 3WYBA 1T9AA 3PC8C 2JVKA 1VMEA 4Q7LA 5CCBA 5J43A 1P18A 3KQSA 4JOBA 4CKCA 4U0KA 3NETA 1D6NA 1UIRA 2YJ6A 3GX1A 3R44A 1SELA 1S7GA 2ZBUA 3P4XA 1Z68A 4HCJA 4CIWA 1IBCA 3B2QA 5B5SA 1WXWA 1OXSC 2OBXA 3H4MA 3W1EA 3GN2A 3QKTA 5LZ4A 1MEJA 1IN6A 3JQAA 1Y6QA 3N07A 2W70A 3DC7A 10MHA 1NUSA 4UCFA 1GQFA 4HAWA 1JEYA 5TF4A 2I8AA 5E4YA 3VMMA 2CNWA 4YIHA 2PKQO 4KXNA 5ENVA 3VZDA 1N0HA 4K9OA 3HCEA 4NOKA 1VMIA 2IS4A 2JFYA 2IHBA 4HZUA 1BS9A 3VR4D 1KGSA 5JAQA 1IMJA 2PEYA 5I9SA 5ITZB 2YBEA 2X0RA 1NVXQ 1GAWA 3DTNA 1ULHA 1BHQ1 3BWEA 2WWRA 3I73A 4JC8A 4R1UA 4G4SO 2WTAA 3H8VA 3VDQA 3EGXA 4D6YA 4LOLA 5BSTA 3MXOA 3EF1A 5TT1A 3V3TA 4EY4A 2XRZA 5E3IA 5DP2A 4AJ9A 2C7BA 3IUSA 1AB6A 1J0XO 3RSHA 3QY9A 3SE7A 3RG8A 2E5FA 3W5UA 3HP4A 1U2PA 1FPQA 3KUUA 1Y4AE 5EI5A 2R6ZA 3VKGA 1D07A 2AG6A 3A4VA 1R6XA 3JPYA 3BAZA 4JJZA 3EIXA 1XMQB 5AKZA 1SCQA 1LF0A 5EUQB 1P0PA 2X2EA 3E53A 4ITRC 1SVKA 4C6SA 2X8LA 3H3XA 1P3DA 3ONWA 1YE5A 3U3ZA 1VGVA 1Z4NA 2R11A 4KN9S 2PDAA 9ABPA 4L57A 4DJFC 3WLQA 3QUTA 3I9V1 2GK7A 2QK4A 3EGDB 1N2HA 3ORSA 4PFKA 3UJ8A 1M10A 1OIVA 3H97A 3OZ7A 5C46F 3L4EA 2VT6A 1KVTA 2RI1A 1IWBB 3LOUA 2PV0A 2QG4A 4OOEA 4XM1A 1BS1A 3CLSC 4ZEXA 4MUAA 1PUXA 4JELA 3C7TA 3EG9A 1RPJA 4XD7D 5D6NA 4RIEA 3T7AA 2D5LA 1G8GA 5GMOA 3THXB 3GLVA 3GU3A 1E0AA 5BWMA 5A5VA 2ETVA 2X77A 3ENZA 3M2TA 5CEJA 4D99A 5HR5A 3PRKE 4ZIRB 5IKPA 1RPZA 3FBGA 1C1XA 1IEQA 1CQXA 3W7VA 1TCUA 1L4LA 3CW9A 3F2IA 1PDWA 2FJUA 3PG5A 4GI3A 2LWIA 4OHCA 2RONA 3AVQA 4CTKA 5JALA 4Y1FA 1DJNA 2GYYA 5IJXA 4YAUA 2PZLA 1T9GR 3LVRE 4NJMB 5LL6P 4TKZA 1M1UA 3LCRA 3GLGA 1DCKA 4JZKA 4RE5A 1G6Q1 4XQ0A 2WI8A 3OPYA 4L2IA 4XW2A 3T5BA 2HGZA 5E8JA 2XZOA 3GUCA 4MWOA 1L4UA 4QWWA 2D4HA 2QEQA 4B75A 5DXAA 3RRFA 4JVOA 4MVJG 2QLLA 5JYBA 1IBKB 1XGKA 4D0GA 3ZU5A 3TM5A 3AKCA 4HQOA 5IU6A 3I0ZA 4B4WA 3EYWA 3USES 1YR9A 4FOLA 4NU0A 1A5SB 1FRQA 1QG2A 1SXQA 5KDLA 5TQ0A 1HDRA 2G17A 4DBZA 1IZZA 3BRWA 1MW8X 3FLEA 2DUNA 4WDRA 1LJLA 1N6NA 2CK3D 1MIHA 1GSAA 1NVAA 3HADA 2ACWA 2XTNA 1MT3A 4JI8B 1R4AA 1X7ZB 1Q3KA 3ZY4A 4R4JA 4IXWA 3IP8A 5CVTA 4OHOA 4D3DA 1OVMA 1U5BA 4O4JF 3TUZC 4WXEA 1WHSB 4XVCA 3SWWA 4FDTA 2BGGA 3BFKA 1J2JA 1FS6A 5H3HA 2AE1A 3U3JA 2JFPA 2I91A 2B8WA 2R1TA 2ZIAA 5EWLB 4BE7B 3OTIA 5GIPE 2V7VA 3R0XA 2WLTA 2NO6A 3KYCB 4Q7KA 4QGGA 2CLHB 4XVHA 2UKDA 5GJWC 4LXXA 3LXUX 3A9UA 3KKEA 4XASA 2I6TA 1HI9A 2P6PA 1YRBA 1REQA 2JCYA 3QFTA 1EKXA 1WXEA 4TL8A 5CB4F 1O95D 3SIPA 4ZMSA 1N7JA 4HBGA 2XMZA 5TB5A 3UG7A 1AM4D 3W5IA 3VR3A 1U8TA 4CWAA 2F55A 3AERA 5ALMA 3C5WP 1KFJB 1PG0A 1YRWA 1CIJA 5CK5A 3AV3A 3K15A 1N2CB 3TF5A 2EHJA 1C9KA 1V35A 2MSCB 2BV3A 3VPHA 3ZYCA 1GR1A 5CRIA 3RSFA 3A1DA 3KYCA 1DAPA 4KQ9A 1M2KA 4LC9A 4EGQA 2RH4A 3FPHA 2WHQA 4M87A 4X71A 1RNLA 2QDKA 1NULA 1GJRA 1K06A 3OKPA 3B7PA 3HGTA 2BW0A 2O1WA 1UF9A 3ND5A 4AJKA 5AW3A 4HMOA 1AURA 2JIBA 1OI2A 4CKYA 4R41A 1Z0ZA 2C2MA 5A1TA 4NNJA 2NAFA 1P1KA 1OOEA 3I9OA 4JP2A 4M0EA 3VDRA 4N3NA 4DA6A 3HJHA 3RVOA 3LY9A 4PQGA 4K9NA 2NWQA 1NBME 1VLHA 1HE1C 3EARA 4EMUA 1O6GA 2ORWA 2P5SA 3RTBA 2UVDA 3BREA 3DV2A 3AP3A 3QYJA 4C89A 5F1OA 3CT4A 3WB2A 3VU9B 4RSHA 4CETA 4GRAA 4IW3B 4CG1A 3HJGA 4JWTA 1US8B 1KTIA 1DJPA 1O96B 2ZITA 3OPMA 2AOVA 1ZDMA 1JDZA 1RBMA 4X1IA 4POOA 4CDMA 4JXZA 2A1TR 2C97A 2GLTA 2XXBA 1H69A 1POXA 4UATA 4D3YA 2UUOA 3WS7A 5CAEB 2RGXA 3ZKAA 1WKVA 1PFVA 3UJ9A 1K08A 1X7HA 3UPUA 3CC8A 3TNDA 5CLFA 2XHEA 2BR4A 2HPZA 3GEHA 1NDUA 1OZAA 2XB4A 2YJ3A 4DWOA 1EDBA 2RCYA 3LP5A 4RSMA 4LXYA 4DLTA 5BVGB 5IJWA 4R1NA 1BCSA 4Y7CA 4J0JA 3T7DA 1BYIA 1RI2A 1AXGA 2F3TA 2F3PA 4IWXA 5F35A 1A82A 3L0BA 2AK3A 2ZPAA 4JLDA 1LQ2A 2FVYA 2ZRIA 2RGRA 2FFRA 2QSYA 2VT3A 3KXKA 4JC5A 2PRYA 5FUWA 3PDWA 1TU4A 1V7QA 2ZYAA 3AR7A 4EMSA 1NQXA 3GYGA 3QG1A 1A5AB 5BOVA 1Q92A 3W4KA 4B4OA 3BM5A 1MV5A 3PEEA 1M72A 2ZR0A 1CU1A 3NV7A 1V43A 2VHQA 1PJ2A 4RNCA 1USIA 4V3BA 1NIPA 2Q5HA 5CIQA 3RREA 4PSVA 3TSYA 4E4RA 2Z08A 4A03A 4HNHA 2IV7A 6ABPA 3AERB 4BLQA 4XWWA 2ZIXA 3U56A 1XTZA 4ZJYA 1RXVA 3V8MA 1YQ9A 2B94A 2O3SA 3LCJA 1UKVY 1YR2A 3L3BA 2PZBA 2C95A 5JZSA 1NA5A 1XA3A 1YJXA 1DFIA 2D0PB 2VDNB 4FT2A 4NCHA 2J3HA 1I4EB 1L7MA 3JPWA 3GNTA 3MWYW 2OVFA 1JHVA 3ZWOA 1MX3A 4A23A 5JAOA 1WB9A 1WUKS 2CBZA 3A9SA 3TLYA 1BOOA 3FHTA 2HU2A 4AKTA 4B6SA 2QL6A 5ICMA 2FAXA 1NI4B 4ZVQA 4HZGA 3D0KA 4X1KB 4EB3A 3I1JA 4Z3KA 3WGNA 4C88A 2QX9A 2EZUA 3IT3A 3RR2A 3ESQA 4MDHA 1HMPA 3E2PA 1MPXA 3BRWD 4QQRA 1JDBB 2YUIA 1SVOA 4EG8A 4MIYA 1DKPA 1VDMA 1WBDA 4ZOLA 4J1QA 2YHUA 2AB0A 4LCBA 1SC1A 2C3PA 5J9FA 1JW9B 2XNSA 4BVKA 1ZM7A 5I9TA 5FOSA 1FFBA 2JFNA 1WPXA 1KMQA 1NDQA 1QE0A 2CFIA 2YV4A 3ID6C 4YN3A 2RHDA 2ZZKA 4EG7A 2IXGA 3WYGA 5TX7A 3FTCA 3T4EA 2O3UA 3OA0A 1PE0A 5IWCA 1ECCA 1G2OA 4WZAE 3A1WA 3G0BA 1SCBA 1EWYA 4BLOA 1U0NA 5HRAA 1U7XA 5B58C 3PXCX 1DARA 4RFSA 4YHBA 3ZS9A 4JENA 4NTZA 3FH0A 1WCWA 4EB0A 3GLRA 1OI7A 2F9MA 3O8OB 4BQNA 1ZX1A 5AJHA 2X0DA 1TI7A 3DDOA 1XL0A 4Z9FA 3CYFA 1T9GS 1B14A 4UTNA 2H2WA 1C9NA 5JD4A 3IILA 4X97A 3GVXA 1ISIA 2QMUA 1T91A 4BB0A 5I9LA 3N2GA 4LE2A 3UFXB 2B25A 4HVTA 3ZVLA 1X1AA 5ICSA 5T3UA 1XQWA 4JI7B 4AY5A 1P4RA 1CUSA 3KQOA 4ITVA 1XQ9A 4KDEA 2QI9C 1UK9A 3VH3A 4BVAA 5FJJA 3CUWA 3UWMA 4PBRA 1WU8A 3L6EA 4R8LA 3HCFA 4L0DA 1RXEA 1NKVA 2QNRA 1FVHA 4BEWA 2IVZA 1Y3FE 1X74A 4MEBA 2V59A 3TLKA 1KMMA 1NKTA 3IE2A 1AX9A 1SB9A 2JPDA 3FUVA 3G9XA 1RXYA 4N18A 4ZOAA 4PQFA 2ZRAA 4P33A 4TSRA 1KI2A 4A9AA 3RS7A 1NZDA 4MQ6A 1V8DA 1BXRB 5FBHA 4UEJA 1S01A 3PGLA 1AKUA 1GO2A 1PGQA 3G23A 2B99A 1C3EA 3ZCUA 5CFRA 1OYOA 2YVLA 3ENQA 1SULA 1S1CA 4JJ8A 3DF9A 2K4MA 3BWVA 5CA0A 4KQIA 4BKUA 1FX0B 1U2TA 1Z4QA 4WASA 3GMTA 5BO5A 5EKSA 1Z5VA 1MX9A 1XNRB 5BORA 4DSNA 4AF6A 1QX4A 2UUBB 4GL2A 2GPSA 4YCJA 3PTAA 2QMYA 1TYCA 4ZKDA 1P60A 5H02A 2ZPUA 3OESA 5KO2A 3WGQA 1LZKA 3PDIB 1H2RS 4OYHA 2WILA 3SMVA 2YRFA 2JGMA 1T3ZA 3N1UA 5ENZA 4QBGB 3JRXA 4ALLA 4KJZA 3OZCA 2IITA 1QZZA 4DABA 1TUEA 2OYRA 3QA9A 5CFMA 3IAAA 2PZMA 3C5CA 2JCGA 3NHZA 4B0PA 4TRRA 3ZVRA 1DO0A 1ZVKA 4BEBA 1MNQA 1CR1A 2DWOA 2H18A 4V0LA 1N5DA 3I9MA 5M7EA 2FMIA 3I53A 3KTAB 5AVRA 4XDGA 2RG7A 3I34X 4UXHA 1Y8AA 2M98A 4NPHA 5AKKA 3TXAA 3WGVA 5MGNA 3M83A 1AF7A 1GT6A 4LYDA 1VE7A 2C5SA 3OD1A 1UKCA 1JMYA 2DFVA 2F64A 1OFVA 2G0NA 2IGBA 3KCNA 5BSRA 4NABA 3TPZA 4C21A 2DSNA 1RS0A 2WAYA 3OX4A 2G5TA 3BSWA 4BCCA 3WMWA 2J87A 1QTNA 1TAHA 3Q9LA 5AM4A 4L8WB 2X9GA 3PFHA 4LVOA 2QT9A 2EW1A 5GM1A 5IC5A 2A1UA 5AVWA 4MRPA 2AI3A 3BORA 4TMKA 2NNLD 4C2UA 2ATEA 4HG2A 1NMZA 1V6SA 3C14C 3W8DA 1SVNA 4LV5B 1YXMA 4UM9D 4ZT7A 1OWNA 4QYIB 4NEQA 1L3CA 5IVIA 1X7WA 3COWA 1TC2A 2VYCA 1WHTA 2QDXA 1FRFS 2WKPA 3CRW1 3OLXA 3QNWA 3AI1A 3KLPX 1SUCA 3USZA 4A2CA 1ORHA 2CE2X 1IEXA 1QR2A 3L8FA 5TVGA 3P97A 1SH7A 4DA8A 1ODKA 2RSLA 3E5RA 3G2NA 3JD0A 2AZMA 1IYZA 1FF9A 3L4BC 4KIUA 4YLEA 1KORA 4CIYA 3T7JA 1XN4A 3L1VA 3NOVA 3KOUA 4NH0A 3OCVA 4XFDA 1RRVA 5EMJA 1CUWA 5GZ6A 4EJFA 2VF4X 6ADHA 4KQEA 5BQOA 1UMBA 4M83A 3GGDA 5I7FA 4L16A 1TO2E 3D54D 3G59A 4D3XA 5JY6A 3H4VA 1OWLA 1PWYE 3BRCA 1E3TA 2A67A 3HVJA 1YB5A 3MA0A 3NTVA 4ER7A 2HJVA 4JP3A 2FFQA 1ZXLA 2BP7A 3E7WA 4JSTA 5DWVA 5L53A 2NTEA 4HMPA 4BLTA 3RG2A 3VTFA 2YHIB 4AECA 3JRWA 3JQ9A 1QU2A 1R0KA 2VT7A 1NU6A 2CVZA 2CJYA 1EAMA 5EPEA 2FPIB 1M5RA 3EHEA 1IY1A 4FNGA 2H29A 3A0RB 2R86A 1MDBA 4WOPA 3JWJA 2R4QA 3U1VA 4QEDA 4B82A 1F4VA 1W4RA 1KJQA 3C7DB 2CHFA 5C7IO 3DBLB 1DXYA 1DMRA 2GEKA 2XZDA 1J8YF 4EVRA 1A50B 1GEEA 2IU4A 3BJIC 3PUHA 4HQ0A 3GJ8A 3PC3A 4MX8A 5F2EA 1TMKA 5DGHA 421PA 2CHEA 5LNK6 1MC1A 4DCNA 3FETA 3C3BA 2JBWA 4XJTA 1MQSA 2Q1UA 3BD6A 3P2EA 3TW4A 3LX6A 4QUAA 4IVQA 5H9VA 5DTIA 1S2MA 3V4FA 4RNDB 5HVNA 5EA2A 3OZIA 2CSUA 1ID8A 3QBJA 2BISA 4FCTA 1JHXA 1KAQA 3TECE 2PWBA 4Q9HA 2L0XA 1BRMA 2FPPA 5K3FB 1EZZA 4DLXA 3HJFA 1L4BA 4PTLA 3BQNB 3W3AA 4FZ5A 1OI3A 1U8CB 1OH8A 4WNYA 2AMVA 1LWNA 1G98A 4BE4A 4NOMA 4KXYA 1LNZA 2Z6VA 4JU8A 4PRYA 4YRCA 1GQQA 1Z28A 3DKKA 2O3QA 2G5PA 2B4QA 4LNUB 5FBQB 4AG6A 3O74A 1ZKMA 4XGNA 1ESEA 5JFGA 3L46A 4DXAA 1F1JA 1Z6TA 1JAZA 4AT1A 1QGUA 2FPWA 1U90A 1Y63A 4O63O 3OCZA 4TQAA 5DISB 2YINC 1PGNA 4V2UA 3X43A 4V03A 1LJ8A 1HORA 1T36B 1E2IA 2VHTA 1PIWA 1Y9DA 2HF8A 2ZSFA 3LYHA 3MLBA 3WG9A 4KDFA 3NR2A 2W2MA 3R0QA 5TIIA 3VC1A 3TFQA 3ZY3A 4DLYA 3OCJA 4FLEA 5FRDA 2X1MA 4EKGA 3MJSA 2I1VB 1KH2A 3M3PA 4HP8A 4B3XA 1P4HA 1COWD 4RJKA 1DEOA 3SBDA 1CT9A 3HA7A 5B1IA 2JFQA 3NTXA 4GH5A 1E64A 2ET6A 4D42A 3IVCA 5TQVA 3FOCA 4JVNA 3M82A 4JQOA 4ZICA 4JT4A 3FTPA 1EUZA 1JDPA 3LSTA 4D4LA 2I2XB 2I6FA 4ZI2A 5FA6A 1JDJA 1NAHA 5JR3A 5G41A 1EDDA 4B4UA 1XLWA 1XTKA 1J0AA 1I2CA 3RUPA 3KWMA 3K2QA 1O58A 3HDYA 3PHBE 1NJ8A 4TSFD 3OIVA 4F91B 1XMJA 1RP7A 3AIIA 4OBEA 2CXHA 3RQSA 4U2CA 3ONDA 2ONJA 4AQYB 1C9JA 3NDRA 5JCOA 2F62A 4LOJA 4PAGA 1EWKA 2YQ4A 2XMDA 1E2EA 1G7CA 3F8WA 3GH3A 1OCEA 4X00A 2CMKA 5FXMA 3AVVA 1AUVA 3MTIA 4GMHA 4JUFA 2YZKA 3H0EA 3SZGA 1E2MA 1YQTA 5JJLA 1Z2PX 3RIYA 1G6HA 3UYLA 2Q1TA 5ALNA 4R40A 4JJGA 5CX1B 5DK6A 4CCSA 1XDSA 2W6ZA 3S28A 5JS2A 3TQRA 4AI6A 2IZ6A 1Y8CA 2KHZA 5HRUA 4KPUB 2DMRA 3E9CA 1YA6A 2VP6A 3CF2A 3HRIA 2HC9A 4GZ5A 2P9BA 2IK8A 2FUEA 1RBYA 3K70C 1KC3A 3EWSA 1YVRA 4JLBA 4MKHA 3W8NA 2VPWA 4LUCA 1NGSA 4Q6WA 3RSSA 5K3FA 1GA6A 4DLPA 2UZ3A 1D6JA 4KWTA 2XCOA 3CUEF 4Y6OA 4C06A 1U3GA 4CV0A 3THYA 4DYDA 3HCDA 3ZDYB 5JDCC 2E4ZA 4LFCB 1E63A 1TK9A 3VZPA 1EBBA 3B85A 1E6MA 1HUQA 3F4BA 5CDTA 1SVIA 3I9NA 5IJ0B 2DLCX 1U0BB 3E8MA 2VWPA 4F5EA 5HKAA 1O0SA 4J43A 4IWYA 1ST2A 2MT9A 2BHNA 3NIGB 4DTIA 1Q50A 2H4XA 2OXTA 3VYRB 1DKQA 2NLOA 4QOSA 1RIIA 1NM5A 4WZBB 1YDHA 3F73A 3CONA 4KWHA 4OUDB 4UTZA 4HN9A 5DM0A 2F9FA 3M4JA 3RBVA 4PZ9A 3R5XA 3Q7TA 4S0ZA 4Y9TA 1KZYC 2FQQA 2M1ZA 4L8YA 4TGLA 3LK6A 4BMXA 5LMCA 2WJGA 1KIFA 4FXOA 3G5UA 2NZJA 4J6FA 2P6MA 4BOYA 1MW9X 3S81A 3QPAA 3U13A 3RADC 1A88A 2XTZA 2GYUA 4BV8A 1KZGB 2X8BA 1U8UA 1B7GO 3QBVA 4PYMA 4E5YA 4IDCA 3ZU6A 1RRFA 3K53A 2H2IA 1T2VA 5EZQA 4EO7A 4XUCA 5JQGF 3L7AA 5J59A 3W2TA 2HJWA 3V4OA 3RTAA 3IL2A 1RLIA 3K1AA 3GDGA 2FP4B 7REQB 5JHGB 1P39A 2LP4Y 1DIOB 2Y3IA 1EGHA 3AJEA 3MGGA 1O03A 4LHYA 1DRJA 3LDGA 1LDGA 2GD1O 2PK3A 5FOQA 4JI2B 4G84A 4HYTA 5KREA 5IM4F 2H92A 1TVCA 5B7GA 3SHTA 1TA9A 1LPOA 2R66A 1QVZA 2VK8A 1IJKA 2FMKA 4MARA 3IKTA 1VGQA 2UYHA 1ADCA 4CZ2A 1QH1B 1GTG1 4OB7A 4CLRA 4H7DA 4WLVA 4Y9RA 5IVHA 4CCAA 4U2FA 1BMTA 2E87A 3VVBA 5K0SA 1ZWLA 1MRZA 5EPOA 5SYAA 2OXIA 4PXYA 3UJDA 2Z6QA 2WU8A 2ZRHA 4OB6A 4OAPA 4QU8A 1UDBA 5FOUA 3ZGNA 1XTIA 5TT0A 2JI6A 5C4IA 4TKUA 4U5XA 3VSCA 3ROPA 3FXAA 1BW9B 4NFHA 1I3LA 1QUFA 2WD7A 4J4BA 1TJ3A 2OCLA 4GOJA 4EDFA 2QSZA 1U28C 3N2IA 1CNFA 4HGRA 1U1IA 2FEOA 4O25A 4PAQA 3NW9A 4Q1AA 2RCNA 4YUWA 2Y71A 3A11A 3P45A 2JLXA 5I6DA 1E2LA 2VCHA 3NC0C 5F5XA 5TRTA 3ML1A 2A2ZA 2GTHA 3X2SA 3OZFA 3QFFA 5AJWA 4C4SA 2R8YA 3S1LA 2OZLB 3R5HA 3NBUA 4GRDA 1KJZA 3MGCA 5C9ZA 1XLUA 4LN1A 2HHJA 3DBHB 1V2GA 4X84A 5KHAA 1HQKA 3S3TA 4ENWA 4Q37A 3KSZO 4LA4A 4LTMA 1RYZA 4D81A 1VXOA 3GRRA 5SICE 2NZ8A 1W5AA 2D00A 3AL2A 2ODTX 1RKVA 2BGLA 4QLAA 1TA0A 1JDVA 1ZPDA 2A5DA 4RZSA 4Y6GB 4D6XA 1FDRA 2BKAA 2QRKA 1M83A 1PD0A 3W04A 4KN8A 3F6CA 4KHPB 1XG5A 4NU5A 4RTNA 3H8SA 5DI3B 4D46A 4BUJA 3L4KA 1ZAYA 1BJTA 3RJ5A 5JAPA 4AX4A 1N7GA 2C9MA 2B9EA 2BKLA 5CGQB 3ANYB 3P52A 3KVYA 1PLLA 4OJMX 2V7XA 3L0SA 1BHJA 1PJAA 1PZGA 1ESMA 3IVAA 2FU5C 5AVYA 4OH7A 2NUAA 4RBNA 3E3AA 4UBNA 1QQBA 1S8NA 1KKLA 4EBBA 3ORQA 1NQUA 1DBRA 1F8GA 3LXRA 4H1TA 5IT0A 3F5SA 4KPGA 2W2VA 3QPVA 2BE7A 1P2BA 4OIFA 2PH5A 5H4HA 1Y6ZA 3VUEA 4B6QA 2J31A 4O2BB 4R1OA 5A9TA 3RO7A 2I4MA 1JL3A 2YNMC 2Z4RA 1P81A 5CDSA 2W6IA 3F4LA 4U9HS 4XLLA 1OWPA 2LR0A 3HA5A 4YRPA 3ZK9A 4LSZA 1K9SA 2PL5A 3I9KA 3LGSA 4MPPA 4H7FA 4Q39A 3FFWA 1YJBA 4N9QA 3N2KB 2DHEA 2OBFA 3KWFA 3NDBB 3DGFC 1TEZA 4D9EA 1H93A 3AUFA 4KGVA 4BO8A 3ZGXA 1VDZA 2JGDB 2HRCA 2ATIA 2O07A 3QSYA 3L0OA 2XH8A 4S3MA 5BPFA 3W6NA 4CF4A 2HLDA 1NLMA 5B6IA 1I7LA 4M8SA 1WOMA 4IXMA 4MJ3A 4IIJA 1KDOA 1JQEA 3WNVA 3PC4A 1T9KA 3C3KA 3SY8A 3UAOA 3OY2A 1PT6A 1YVPA 5TS2A 3NH6A 1R6UA 3R9IA 1IE3A 2NZUG 4QOHA 3KXLA 1COZA 5BW6B 1FW8A 5KSZA 1GQOA 1QJCA 4HWTA 5I7RA 2IYYA 5M34A 1YNOA 2R6HA 3FPSA 1WIWA 2ECQA 4I1VA 4IFEA 4GPD1 1P4SA 1ZHOA 3G79A 1G60A 1PRYA 1IOWA 3O8DA 3RASA 3UANA 3A06A 4IIVA 3AEUB 3W9SA 1UIMA 3R0VA 2O2SA 2WYOA 5K01A 1OTYA 1C1XB 3HGMA 1LLUA 2YZMA 5L9AA 4BNJA 3KD3A 4WT7A 1FU8A 3ETJA 3E1GA 3MT7A 3E23A 2FK7A 4LTDA 5EQFA 5JCJA 3SBXA 1D2GA 1R4MA 3CVWA 2VYVD 3ZN2A 1OTXA 1KI9A 2YBDA 4DDMA 1R8QA 4BNYA 4X8HA 3EE6A 3SD7A 2EVWX 3PQ6A 4F06A 5FH9A 4K9RA 3CWCA 3I5YA 2PUGA 1JDSA 2WWWA 3R5JA 2AFRA 4NS1A 3HWRA 1F48A 1S4QA 1D1SA 4DA0A 3VO9A 1OWOA 1DQNA 1RWVA 4LBZA 5DT2A 4UAGA 1DBSA 2WTEA 5IK2D 2CDRA 2OD7A 3E8XA 4CU5A 5FPHA 1IM5A 4M9ZA 3HR4A 4RDCA 4QPZA 4RHTA 2HQBA 5B1SA 1XELA 4BJ1A 2HQOA 1T5SA 4RL6A 1E4EA 1JH8A 2HWXA 2LGJA 3UPDA 1UEIA 3KAKA 3HFSA 5FNVB 4YXWA 1T3GA 3ICVA 4MP3A 2DUJA 3STTA 4UOQA 1IN1A 1UFOA 1G9SA 1U5CA 4KMRA 2SNIE 1S6YA 1Q1BA 3U3DA 3OCWA 4A15A 3OJEA 4F1KA 4F4JA 3HCRA 2R2AA 1C4XA 4HBZA 2V9CA 2ZJOA 2Q5LA 3HCNA 2PIDA 5H7XA 4KMMA 4DTCA 1H5QA 2CHGA 2A0KA 3D6FA 4LJ5A 2E5LB 1H4TA 2KLBA 1QIEA 4ZARA 4CFZA 2QJFA 4ER0A 2Q1WA 2KBFA 2VDJA 4TL7A 2HO5A 4G01B 1L5MA 2SICE 1V25A 4IHJA 4Q1EA 2AHOA 4K26A 3K09C 2VDWB 3Q3CA 3KTAA 4RQTA 3UAGA 2VJPA 4XRRA 5C81A 3L4BA 3LZ6A 3ZVNA 2XEXA 4PC6A 2QUBA 3Q87B 2RC5A 4Y0VA 3EFOA 3W06A 4JJEA 4XB6B 4J90A 2BGIA 1J90A 3BJZA 4BJ6A 2Z2KA 2WVJA 3NPAA 1SIUA 3IQDB 4C2TA 2J32A 4YLYA 1TRHA 1ZSVA 4U7PB 3JCZA 1W7AA 1ZM2A 3WWZA 3D8NA 1U7HA 3MUOA 4QASA 2WFLB 1OGJA 2C3MA 2Z9BA 3IJPA 1JECA 3VKWA 3C6KA 3ZZ1A 1QYDA 5F78A 3EIQA 3OIFA 3HPRA 1RBZA 2PT6A 1VHDA 2YY7A 2QTCA 3M4XA 1HRDA 5AOCA 4ZZ1A 3F0TA 1GRVA 2C8JA 2BKUA 2F1KA 3DZHA 3PJDA 4PCVA 2FWIA 3BXGA 3PX2A 1EXNA 3V1YA 4RTPA 1MORA 1CSEE 2J30A 3LYLA 2IZOA 3IPYA 3PIRA 1X9IA 5B1EA 5IABA 4B83A 1TW2A 3LPNA 2FX2A 3TNJA 3KJZA 2WT8A 2GFQA 4ZYTA 3NWEA 1B26A 5I4BA 3PLAE 2PA3A 1E1CB 3DEYX 1F8XA 1HLFA 3EGEA 1ZW1A 3F96A 2G8NA 1L1EA 3KR9A 1GPMA 1XV5A 1T8TA 4L4RA 4W8OA 1PT8A 5DOZA 3DP9A 1QRSA 1N8TA 1SIBE 1UZMA 1X3LA 2NZYA 4OHWA 2YJ5A 3HHPA 3EC1A 1M7BA 3LHDA 3ZNOA 3NO4A 5K8IA 2VA8A 2JK0A 1WF3A 3N8GA 1Z5OA 1QFYA 3O03A 4GOLD 1DC4A 4LWQA 4QXAA 3AR5A 4IV0A 1R0YA 1X9HA 1IHOA 4MAMA 4TRNA 4Y2HA 1E4EB 3ANXA 4UOEA 1NVWQ 1E0JA 2EEPA 2VUIB 3K8ZA 3QYAA 4YGXB 1L1QA 1KS9A 2WUGA 2AXPA 1N2ZA 1QQTA 2P1RA 4PR3A 5DN6A 3K1YA 4R9NA 3UM9A 1UZLA 1CQPA 1TVMA 3GFTA 3N70A 4UUQA 3A1EA 3EAFA 2COKA 2I87A 2VXYA 2ZYHA 1G8MA 2WAMA 3CVOA 3IO5A 3X2EA 4AY3A 2IEAA 3HM9A 4E30A 1AH2A 1VE3A 3I3SR 3PWZA 1M3SA 5EWJA 2ZR8A 3PF8A 3LWNA 4PHGA 4JJ7A 4UHDA 1N77A 1FFXA 1PNTA 4IDGA 5CPFA 4ZKEA 1OTHA 3SJ7A 4EUSA 3C41J 4KAAA 2PQMA 1KEZA 4DIKA 4YCCA 4OOFA 1CS0B 4G9BA 2WDPA 3M4YA 5EC8A 5FWDA 4U7DA 1EFDN 2C92A 1WQ3A 3NBMA 4B6FA 2VQFB 3SX4A 5DPMA 1QK4A 2DPXA 2XOEA 1FMJA 1ZEJA 2R1TB 3EK2A 2IU3A 1XTTA 3IOMA 4RWEA 4BNDA 1B1CA 2FFJA 3O21A 3DQQA 1WZUA 3SSAA 1ZRNA 5BUSA 3M0EA 2D7JA 3IPXA 1MAHA 3L5KA 4N0EA 1MVNA 5J4LA 1GG9A 3D4OA 3EQ8A 3PP8A 2P6NA 4UDNA 4GLFA 3V8BA 2Q3LA 1P72A 1CBUA 1W2HA 2CWWA 3ND7A 4MWEA 4X8LA 4YECA 4B46A 3PU6A 1EU1A 4G5YA 4L22A 5ICGA 5CM9C 4PLWA 5CBPA 3N7AA 3I2KA 4KQ6A 4DNXA 1LC3A 2EBWA 1I3NA 2ZETA 4TWBA 3QG5A 4L4UA 4KXMA 1BE0A 2XAUA 1DZ3A 3A1FA 4GBED 4BGEA 3QLJA 1L5WA 3FSEA 3BGOS 3JQDA 1OFUX 3NRCA 3E84A 4V38A 3L1UA 2VSOA 3S1AA 2XCRB 5TPWB 1K4MA 2C2YA 3VPDA 5F9HA 4L9AA 3FPLA 1DC5A 5JD3A 4BGDA 1YCGA 4ZTUB 3NWBA 2H0RA 3GFFA 4TTRA 4RETA 1ZGZA 1IHYA 1LVGA 2GOYA 3CT6A 1CZUA 3QXCA 1LRKA 4ENRA 3BFJA 1P74A 2JC3A 2X7JA 3PEUA 5B2EA 1ETUA 1T10A 1OX5A 1OBFO 4MKIA 4UBMA 2JJYA 2VAWA 3DOFA 3DP7A 4OM7A 4XIIA 2HBRA 2E55A 1IH8A 2GETA 3S7TA 4Y9DA 1V1JA 1U3DA 2YVAA 5FOXA 3N8NA 1WV0A 3BK7A 3JVUA 3ADKA 1SIWA 2OXRA 2HLPA 1BQ3A 3EPKA 2IUFA 2ZJFA 2C3UA 2IZ7A 4IVNA 3I4CA 1QRAA 4ZOBA 3UKJA 1Q12A 1EM6A 1QWOA 3T41A 3Q1LA 1XPUA 4CL0A 1WQ4A 3COPA 5BOSB 4M8LA 4KBYA 2VK2A 2E89A 2PMFA 1DLIA 3BMNA 3TGPA 1BGVA 1BE1A 4LC0A 1NBWB 2JFZA 3OE4A 4AUMA 5JCZA 1N33B 2EWMA 3F3SA 2XRMA 4OUKX 3VOSA 1RWXA 2ZRQA 4I7EA 2BD0A 4X3OA 4FOOA 4E15A 1SQSA 3U4QB 2O3JA 1DFGA 1CLUA 3DDWA 3AF1A 1UJ4A 2YRWA 3KX2A 3LDAA 4PM4A 4LF4B 1JZSA 4LIPD 1M8PA 3IJEB 1HYQA 4IR7A 4L4XA 1FFEA 5L3QA 2KI5A 4H16A 5MF6A 3ZU3A 4HDNB 4UHJA 3SM9A 3AVWA 1FSSA 2OG2A 3DXXA 1XRPA 4HEA1 3R24A 1ARZA 4IIGA 2J3JA 4K40A 1Z22A 2HV9A 2RHHA 1FFSA 1PT9A 3C3MA 3U49A 3B6JA 5G4KB 3HKEA 3FMGA 4LMPA 4MYTA 5FBRB 4O8CA 4DNPA 3BHIA 1PS0A 2NACA 1I1NA 1UOOA 2AC4A 5FWNA 5CXSA 3I2YX 4ZYZA 1ZN2A 4XWKA 2DFKB 1UM9B 4TS1A 1PJ3A 4V0SA 5C8DA 1VB5A 1V5FA 4I4TA 3CBGA 2WWHA 1SPBS 2IDJA 1A8HA 3FIJA 3M49A 5LZ5A 3ZCQA 1XN1A 4Z1OA 2CZCA 4C0XA 3GRPA 1ZIPA 4L8FA 3FLMA 4RTMA 2PX0A 1MO4A 3SVTA 1GKKA 3D6HA 4QARA 2XZTA 2V7QD 3IDFA 3QPUA 4J0DA 4I5FA 4V0QA 4K8RB 2PUEA 4MS3B 3ECSA 4GR9A 4PC2A 1H0SA 3TVYA 3UOGA 3LQYA 1DMSA 4WADA 5J5VA 16PKA 4G0UA 5JH7F 2PUHA 2ZBQA 1AUXA 3CRMA 2CVOA 4FPXA 4RZXA 1J97A 2GJ4A 4F2DA 2O4CA 2C2KA 3HKCB 1Q91A 4EW6A 1K5HA 1OXTA 5BYBA 2BZSA 4BBJA 1L3BA 4Q03A 4X5OA 3ODPA 3CZAA 4RVNA 3PUYA 2VTDA 4W1QA 1DKLA 3UJ6A 3V7UA 4B71A 2D6FA 3LUJA 1G4HA 3LKDA 2FZEA 4X64B 1E3JA 5EKDA 3TWOA 2Q7XA 2JW5A 1MUUA 2GPNA 2QRPA 1AS2A 1RWWA 3CXRA 3NDJA 4QAQA 4OI1A 5JZ9A 3ZGOA 1K27A 2WQ6A 1IOVA 4R6WA 1CRPA 3KQYA 3GGCA 3MOSA 4US1R 3CLRD 4ZVVA 4NK4A 3S2GA 1KZ1A 2HIGA 2YN2A 5JYDA 1E9FA 2J08A 3VDNB 1UAGA 4WKBA 1VCIA 3KE9A 2YWDA 3D1JA 1W6RA 2XNJA 5LQSA 5F7OA 3HNOA 1ZOIA 3DMNA 5CFLA 3D8UA 1U0LA 3GL9A 4BNIA 3W2GA 1TK3A 5TC4A 2PWPA 4M6WA 4UFNA 2ZAOA 5GOZA 4A6PA 4X3CA 1N1EA 2QD5A 1OPXA 3KRTA 5D85A 2GM9A 1LI7A 1ZMXA 3M8KA 2Y0BA 1R10A 3HE3A 3V42A 3AHJA 2JLWA 3RS4A 4P4SB 4AB1A 4AJ1A 1N7HA 1XKTA 3OMWA 1THZA 3ESXA 2H54A 2IYRA 1J1IA 2J0UB 4BFVA 1XJ5A 1YHYA 1N3YA 1QK5A 2XZPA 1LI4A 1ULTA 3LBFA 3LX4A 1JR3A 4ASUD 1G21A 3SVLA 3WA6A 3WLNA 4FE7A 5F1PA 1SU8A 3DEAA 4C2BA 4DMRA 4C7OA 2WJIA 4MVJI 4G23A 1XAGA 3Q7SA 5P21A 3OJ0A 4PSUA 2PX4A 4YDHB 4ZIRA 2X15A 5BYKA 2F3SA 4CQMB 3ET5A 1HC7A 4O2AF 3EZFA 3R6LA 1LBHA 1JV2B 4OXQA 3UA3A 4BE9A 4OBBA 3DFUA 1SCJA 3SHOA 1ZM3A 4QWMA 4GC9A 3TQTA 3VR6D 4AP6A 1WSAA 4B7XA 1E9BA 2PKXA 4UULA 2BFBA 5EQTA 1MB0A 3B6IA 5E6UB 5TF0A 2A9JA 2VJKA 2WOJA 4CN9A 1FUYB 2NVWA 2R6CA 1BEUB 1EPUA 2R9VA 2Z09A 4KVAA 2XE7A 5HF8A 4FN4A 1XK6A 2OBNA 3U1BA 1M34A 3VNSA 5FWXB 4OA5A 3ER6A 1LDYA 3INNA 1TJPB 2XGGA 3NCHA 4H1VA 1P7WA 3N2LA 2I3AA 3HCCA 2ZI7A 3EVBA 2BH9A 3H5RA 3JWEA 4A6XA 1H6CA 4CTMA 3MFQA 4CG2A 4G07A 2BMAA 5IZ4A 1XX6A 3E1SA 4PNZA 4OMCA 2NYUA 1D2RA 2WG0A 1YT5A 4K9QA 4QA9A 2B34A 3CE9A 1G6KA 4G5RA 4P22A 1NP6A 2J3IA 1CIVA 3ZCRA 3SC6A 3VR2A 4BN4A 2CGEA 3DZGA 1AMOA 2AZTA 5K0NA 1RBQA 3V9PA 5TMBA 4BBZA 1CQIA 3LPMA 4J1SA 1LW6E 1U4OA 2JI7A 3E81A 5C8ZA 3LS2A 3OM8A 1LPAB 1QVWA 2G76A 3WAJA 3HO1A 1EDOA 4MJ7A 2V45A 2QVXX 4LECA 3HPQA 2XKBA 1W30A 1IIRA 4UHEA 2B8EA 1Z3CA 3D7MA 3ONEA 5C3MA 1QKKA 4B3CA 3T1NA 1OE0A 1VSTA 3ZKWA 2PH3A 3O9MA 2X6QA 1C9MA 4ZAYA 1SQ0A 2A7XA 2DX7A 2KLHA 1SQ5A 2XT0A 2WUVA 4I4LA 2YCLA 4NV0A 3HN6A 4PZAA 4Y0NA 1Y9ZA 3EW7A 3SXUA 1GLGA 3QX8A 5FCDA 3TJMA 5IF3A 2OO3A 4MRAA 1V7ZA 4XGQA 4Y6QA 2WM8A 5DCYA 2FK8A 2GN0A 4EENA 4B6PA 2FLVA 3FPAA 5DNUA 3QUBA 1CR6A 1TLLA 3KVRA 3PI7A 3RYFA 3TMAA 3I01A 1SUWA 2G04A 3LD9A 1PD1A 5FT9A 3LP6A 1TQ6A 1C3VA 1IN7A 2FN3A 2HBZA 1TF5A 4IF6A 1AHHA 4EY8A 3KUCA 3OF2A 1RZRA 1NW5A 5KX5A 2I3BA 2YWEA 4L5AA 3ZXIA 2OFOA 1YJQA 3GP5A 3H65A 3IOCA 3IQEA 3BA1A 3JATB 3P2YA 4YQYA 5ALPA 2CV0A 2JAPA 4KE8A 3DE4X 1U0SY 3C48A 5EWMB 1K2VN 1M0SA 2HWWA 1PGPA 2IZZA 2ZAIA 1UJ5A 3MHPA 3O0TA 4IXNA 4B6OA 4YRNA 4ZDIA 2B7LA 4MYDA 2C4KA 4HPJB 2DM6A 5E7QA 1PK8A 1U2ZA 3TB6A 5J1SB 3ZI4A 1K8RA 4TLAA 4RORA 4OIMA 2GPYA 4EYEA 4O08A 5AHXA 4DV0B 1Y0BA 1EXWA 1F8FA 4K0RA 4KQHA 1HKUA 4YWJA 1YASA 3RYIB 5DSZA 1FZTA 4RZQA 2VNSA 3MW8A 3OX2A 4UUOA 3PEWA 2V7PA 4WKGA 3HDGA 1FVXA 3R7BA 2OYSA 1T5OA 4ZCTA 4UEQA 3RNOA 3O9VA 1NF9A 2B1RA 3Q85A 1CIPA 5BMVF 1F8YA 2AI2A 3L7LA 5MN5A 4X1IB 3I5XA 1FSGA 1NZJA 3QEBZ 1ZR4A 5SYNA 1XEFA 3DDHA 3MPUA 1SKMA 1DEAA 1XYYA 1SKBA 3C3AA 1YOVA 3H5IA 3P9IA 3PZBA 4B47A 1VJTA 3KT0A 2O59A 4MUGA 2AF3C 1TQHA 2VDKB 1T2CA 5CEEA 2Q4TA 5J2TF 1E6UA 4RFLA 3G89A 1LFAA 1Y8RB 1DQYA 5IEJA 8MHTA 1QGED 3BK1A 3VH4A 5BMVA 1RRMA 3ZEIA 4IGAA 4EATA 3KSUA 4WX2B 4IDNA 1DIRA 2ISCA 5JO9A 2BGMA 1SVMA 2GASA 1HOXA 4JUDX 2A3RA 2GXSA 3TEMA 2OMKA 2AZ4A 4D9IA 2Y1CA 3ETEA 1UDRA 2YWCA 1IQ0A 2XGMA 4Y6PA 1MFPA 4WBNF 1FW6A 1T3SA 2HMVA 2C4UA 2EYQA 2MYNA 4FKMA 4EPVA 1EUDB 3BHMA 3K9BA 1NUPA 3I4FA 2BEUB 2DBYA 3E7PA 5AW4A 3ZWQA 4IG9A 2A5JA 2DXIA 3E82A 3O83A 2BM0A 3K31A 4KFTA 5FOVA 2AFVA 1X15A 2XF8A 4LZJA 4RLQA 1XU9A 5H83A 3EPHA 5JLAA 3LF2A 2JA1A 4PWYA 3F74A 1N6LA 5EIFA 4XGKA 3K73O 1IFXA 2PQ0A 4BC0A 1JIUA 1LPBB 3HFGA 3KPYA 4FR2A 5JT1A 2J5KA 4R16A 5HBRA 3U09A 3EOBI 3LH5A 2CCGA 2YASA 1T2NA 3BSSA 3TPFA 3ZVKA 1FRVA 1OC4A 4UAUA 5KCMA 3EA4A 1WB6A 4P80A 3SBOA 4XTCS 3HWX1 2AX3A 2KMLA 1M5TA 3K30A 3ED5A 2Q27A 4WLOA 1R1DA 4Q16A 4W8GA 3OFJA 1OZGA 2HI0A 4NS4A 4FQ7A 1IC6A 5A9SB 1Y1LA 4GAEA 3V1UA 2Q5JA 3QK7A 1N6PA 3KKOA 2L17A 4NZZA 4N49A 4BVHA 3KSBC 1TT5A 3SJUA 2JFWA 4PCUA 2CLEB 3WWCA 1JI0A 1ZNXA 3AZPA 4M88A 2Q8NA 3IUYA 1NXQA 4IIEA 4IHJB 4K2AA 1XJ0A 1KZ7B 2HSDA 3R6TA 1ZM9A 2WR8A 4FGLA 1AQNA 1RI4A 3SP1A 1SRQA 3W78A 4MI9A 1B0ZA 2Q62A 3PJRA 3A6DA 2X14A 4AN1A 3EGXB 3RW9A 4EX6A 3GNLA 3GG2A 3B1VA 1IEWA 3M7IA 1HTTA 2J5RA 3UXEA 4CM6A 2H9AA 1A4UA 2RHGB 2HGSA 4Z4GA 1BVHA 1JEQA 2WNSA 4TTJA 5AI6A 4CGYA 4BRUA 3IBGA 2P2SA 3VYUB 2B35A 5FBKA 3BFPA 4NQZA 1DJQA 1NW6A 5JBQA 1P1IA 1R00A 1X70A 1LU9A 1XDZA 5E4TA 3LU1A 4NULA 2IHZA 4D26A 2X8JB 5CM8B 1FBNA 2RAVA 5JATA 2M6SA 3NALA 4CMIB 1RKQA 1SOWA 4UM8B 2I2DA 3O2JA 1S0UA 2X5XA 2B98A 2DHDA 4P9NA 4DR4B 1KVUA 4CDRA 3M1YA 1NM5C 2EIHA 2DY0A 2IEZA 3H18A 1G3IA 3GXBA 3P5SA 2XX3A 4NCJA 1RMQA 4YPFA 3A1VA 2D62A 3VI4B 1GTRA 4DDUA 1L3IA 1XD8A 3QE4A 4G0PA 1VYHA 2GZDA 4KOEC 1CQIB 2XQVA 3HKBB 4WOBA 4LYEA 2MSWA 1WLYA 3GHHA 1Z45A 1LC0A 1UBFA 2JGIA 3CZ4A 4HGYA 4NG4A 2OG1A 2WAAA 4ROSA 3SLGA 3UUFA 3PFKA 1W73A 3BF8A 5EIWA 1Q44A 2VDQB 3BH0A 3D59A 1U4NA 2CY0A 3GIDA 3CISA 3L5OA 5F9FA 3A32A 5EY5B 3NDIA 3E70C 2ILVA 3IAS6 4EG3A 3UH1A 3PXBA 2V0NA 4MJXA 2ZI4A 3JQ8B 3ZWCA 3IAFA 3K1JA 1DXOA 4TVSA 5B4TA 3LHIA 3FDZB 3OWHA 3BRQA 4I9HA 5LUAA 3HUUA 4RY9A 4A0SA 1ZZEA 4R71A 1YQXA 5I7AA 4P4UA 4X6LA 3RIMA 8ADHA 2NSLA 3UNXA 2XHZA 5AHWA 4F7DA 1OBVA 1GVNB 1YI1A 2FOLA 3MTQA 4KBFA 2DQ4A 2IC5A 1TCCA 3OTGA 5J5AA 2ZJAA 3KBBA 3DC2A 1FEZA 2H1IA 4R3UC 3UKOA 3KOXA 5JPDA 1XZCA 1RLTA 5JBIA 5JI2E 3HYNA 1BYUA 1SHUX 1EJ6A 3P2KA 5AR1A 1ODTC 5C7LO 1PJ4A 1R5NA 1GPUA 2NT4A 1DOAA 5BSMA 1P7PA 1UADA 4A0RA 1K2WA 3UJ3X 1UAAA 1NW9B 3LZDA 3TRHA 4WXMA 3M4ZA 3NNDA 3GLHE 4EDHA 3L02A 4C0JA 1IWOA 1WCIA 2XMSA 3P8ZA 1I9CA 1H2ZA 1Y48E 3D7NA 4YMTA 4HEQA 3R7LA 1WV1A 4IHJF 5HKLA 5K8VA 1XVAA 3NYWA 2CLDX 4HXGA 3S2IA 3BWMA 3OLQA 3ZW9A 1BWPA 5KKCA 2WNHA 3TE6A 4KQJA 3TIGA 1N9GB 1AV7A 1A9OA 3K92A 3FWHA 3UAXA 1P80A 1U94A 4D44A 1XMXA 2L42A 3D7KA 3DLPX 1L7EA 5EG5A 4B32A 4BB5A 1YZGA 5F12A 1XPOA 3PXXA 2V58A 4H59A 5IZCA 4UHKA 1GGMA 2Y4NA 4C7XA 4B7UA 4PBSA 1DG1G 1W5SA 1RCTE 4RTQA 3S2FA 2HA7A 1NYQA 2A59A 1Q0ZA 5G1PA 3GPDG 1J99A 4DG9A 3AV0B 2FOXA 2HCBA 5KQGA 3U4HA 3LCUA 3WMXA 3HYCA 3IODA 5B58T 4DCPA 2XXJA 5IJ0A 4AJIA 1GL7A 4A8TA 5E1DA 4DS3A 1CZHA 2ZYTX 3KZVA 2C4NA 1W49A 3FLBA 5F23A 2ODEA 4FSDA 4CMHA 3WRVA 4IQ4A 1XALA 4S0XA 4EUEA 4BIMA 3PK0A 5JJBA 2CLLB 2WWFA 2P2GA 1NRJB 1XZ8A 1W0KA 5GADl 4TWZA 3O8QB 2BUBA 3I83A 2EKLA 2NTVA 1QNLA 2EZ8A 4AY4A 3JQPA 3G82C 4EIWA 3GA7A 1SOVA 2F3RA 1UP6A 4HX2A 3FKSA 3IUPA 5AVUA 4HDNA 1KWKA 4DCCA 2FN7A 1VG8A 5IUJC 1VLZA 2EJVA 3W5CA 4AZTA 3KC2A 1JKMA 1K7SN 4IGFA 1HF3A 1PFQA 3V2IA 5E1MA 3KWJA 2HF9A 3EVFA 2VRWA 3D6TB 2DFNA 3HRKA 1S89A 4B17A 4HDRA 3AVTA 1GAEO 2WSYB 5FWXA 1ZCBA 1BFKA 1RTKA 3PKIA 1IZ7A 2Y1LA 1LI5A 3BE5A 4IS2A 4JBWA 1CUFA 1PVDA 4R54A 5E3JA 5AYVA 3DPIA 2ZB2A 4DLUA 2HRQA 4W9NA 2OC4A 3WLTA 1XNJA 2VSNA 1ZHHA 5L4SA 2PZJA 3A4MA 1UEXC 2VF5X 2BOVA 2QLFA 4IIJB 3UW1A 2IHKA 4WOJA 4J4HA 4Z53A 1P3JA 1T9DA 3GV0A 3H0KA 4QFMA 3R7WB 3BTSA 4DQVA 4CNBA 3C3WA 2A33A 2N9UA 2ZRDA 4TLDA 3HBFA 1F9EA 2LDBA 2XUGA 1A7UA 3LZCA 1F2UA 3UUWA 1ES9A 2G72A 3W05A 4AU1A 4YXWD 1GGKA 1YOVB 4N5LA 5LP1A 1L5OA 4S1WA 1OASA 1R6AA 3DE1X 3FZNA 5ECGC 1O6BA 3D3JA 5DM1A 1RI5A 1HZZA 1P75A 2ZI3A 3IALA 2Z95A 3B3GA 2GERA 3O4RA 3Q3EA 4IRUB 1E61A 2WTUA 4WY5A 4IX1A 2AEFA 2CYBA 3VKHA 2AXNA 2GWRA 1KU0A 1F0KA 4MQEB 2FPLA 4G0NA 3K4QA 2FUG1 4OAOA 4C0AC 4W5HA 3KK0A 4EJSA 4PVDA 5CT6A 1LNQA 4I55A 5F7ZA 3JWIA 1NVDA 2ZTSA 3QKRA 1F2UB 4CLHA 2HLHA 3V7NA 3PF9A 4IXTA 3PDHA 2YZGA 2PBRA 5CTJA 4U2BA 3WK5A 3ZQUA 3CKLA 1IG3A 4IDBA 1NP3A 3AGQA 4DSZA 2G07A 4BFLA 2PUAA 1IJBA 3C1TA 3RUFA 3WZMA 2MU1A 1OBOA 3PFWO 1SKAA 1CE8A 5EHQA 4ZGWA 1Y1KE 4FNOA 1OYWA 2RKBA 5I4KA 2QZSA 1OFTA 2ZE8A 5DHPA 3HXMA 4KH0A 1Z29A 1EDZA 3OCUA 3MD0A 4FD3A 3QY0A 3ZLJA 2XZLA 1VHJA 4QJBA 3LTNC 3K1ZA 2FWMX 2NNWB 2YC4C 4RK0A 2B1JA 5AVVA 4F6LA 4FCWA 5CNKA 2I71A 1KE2A 3O1IC 4NFLA 4A0GA 4DA7A 5ISMA 5EHXA 1VL1A 1SQGA 4XWTA 3RU3A 1Z9BA 3SFVA 4DCMA 5TV2A 1LLFA 4HDKB 1T9HA 1TDJA 2NSJA 2POCA 4FSHA 3TOVA 5HKKD 3BN3A 2YIJA 3VU3A 1TU0A 3H1BA 5JO0A 3A3PA 4WECA 3FD8A 4C0BA 5HQ3A 1VBKA 3WK8A 2Q6LA 4GX2A 3KU4A 3LFUA 1Z12A 3HABA 2CMGA 2VBIA 1ACLA 3C6YA 3DL7A 1FDOA 3GJRA 1X87A 3HBAA 4JDPA 1ESZA 4QECA 3R7SA 1KQFA 4BMVA 4L1KA 4KI0A 2CMDA 4BFSA 4RJJA 3QXXA 3PSHA 1INLA 4C03A 4J0IA 2ZRFA 2ZJ1A 4JITA 4XCQA 1Q1NA 2KYRA 3QITA 1UK7A 3K0BA 4WXHA 3UWOA 2CHUA 4QHTA 4BN0A 4D82A 2G9UA 4TWRA 3CJQA 1PBTA 4C14A 2XW6A 3JVDA 4L95C 1YQEA 2TMKA 4KRYA 4LGCA 2RHWA 1VL6A 3FHJA 1WUTA 3HYLA 1JFSA 4B31A 5KSPA 4HNTA 1I2MA 2PFGA 1DX4A 2Q3JA 1E1QD 2QRMA 4J3JA 2LDXA 3PWKA 4XM2A 5T4FA 4AJOA 4BX8A 4MLCA 3VVCA 5GZ1A 1GYPA 1X42A 2I1LA 4LOAA 2AN5A 2ETXA 3F2VA 5A6SB 3LPDA 4LXUA 3VHLB 4RA9B 1W8IA 3T1YB 5KNBD 4WN9B 2OQRA 4FBMA 5EP3A 4EI2A 1QB7A 1JR6A 2WK1A 1ZVMA 2W2KA 2IYUA 3KPWA 3KU1A 4O6VA 1B6GA 2BT4A 1DG9A 1SNYA 1ZQ9A 3H8JA 2GGSA 4L28A 4ONEA 5EIBC 3W5DA 3LVBA 2ZK7A 3DYIA 2W43A 5E95A 2Y2UA 3KOYA 1UQRA 1U8XX 3QVGA 3K5PA 3UJCA 3K1TA 3ZWXA 1PFYA 3PE3A 3QF4A 5ESDA 5IZCC 3AJRA 4M21A 1USKA 2BGKA 1AQLA 2Q9BA 2RBEA 2QAIA 4MW7A 3TRJA 4L07A 4C9BA 5K9ZA 3CX7A 4URHA 1YVDA 3ENKA 2ZUSA 4NOLA 4KZPA 4FFSA 3WWOA 1JT9A 3LFHA 3A6EA 4CL8A 2A9OA 1J0BA 3G0OA 4OQLA 4M53A 1W96A 4XQ9A 4YCDA 4JBGA 4NYMQ 3S2ZA 1OT3A 2H07A 3GJTA 2P90A 4CM9D 4DMKA 4WBNA 1NVTA 2X6RA 3PC6A 3L7JA 5D01A 4UTPA 3ZI0A 3F67A 1FDTA 4RHUA 5DHSA 4M7OA 4BEVA 4JFRA 4Q9IA 5IM5A 1F0NA 1OX4B 1PFKA 3GDHA 3H2IA 4E2FA 4DZZA 3L2OB 2WRZA 3A36A 1I7NA 3K8QA 2BJVA 4ALMA 2QI9F 2RGAA 3A9VA 3ORFA 3ZIAD 2EGUA 3MJHA 5JNRA 2EW8A 1WXHA 1QYIA 4M60A 1G7RA 1JWBB 2QY9A 4KFUA 4N47A 3PX7A 4MI6A 4RPGA 2J6IA 1RRKA 2FRXA 2KE5A 2H5JA 2R7KA 4KL8S 4NIMA 1FLAA 4B85A 4GMDA 1P1FA 4Q00A 2QG6A 3OU6A 4HQNA 4BWYA 1E8DA 1K8YB 2OSBA 1RXIA 4GPIB 1YB4A 5F1YA 4F38A 4YJFA 3ER9A 3KZNA 4FMDF 5HBGA 4YRMA 1C4WA 2A92A 3MCWA 3E7DA 2PYIA 5K6TA 3CEAA 2HXGA 3H1PA 1JKJB 1QMPA 1EP1B 4YMUA 1L5RA 5HTOA 3KB1A 2D7CA 2AE2A 2WYVA 2YVKA 4M22A 1UMKA 2Z8ZA 4QRHA 1S2OA 1H9AA 3O4HA 5CU7A 3ZDQA 4A1OA 4L7VA 4LSGA 4DV5B 1EFUA 1CPYA 5AK4A 4C3VA 5AW7A 3ILSA 3GT7A 4DLBA 3GHYA 4G81A 4I46A 3BRSA 2DR3A 2TYSB 3UO8B 4HLUC 4MKXA 1PG2A 2OCAA 4R8VA 4EHLA 2AQKA 5JS8A 1LA2A 4KR9A 4HUQB 1FP2A 4PX5A 3S68A 3ELUA 3WMEA 2YRXA 2VXOA 3EFOB 4KQKA 1Q95A 2AG0A 2BKXA 2J0EA 2QN2A 3PTLA 1VCOA 3A4LA 1ZL0A 2FN4A 3IOYA 4TV9B 4U02A 4U39A 3U40A 3GLIA 1KC1A 2RH8A 2C88A 5P8WA 2WJHA 2NUTB 3LUDA 3HQ4O 4CTJA 3GLIE 3PFFA 3U31A 2BCGY 3V8VA 1HDIA 2YHIA 4E08A 4F96A 4M7RA 2G40A 2JAOA 5I45A 3UBMA 4GLJA 1E6LA 5DNDA 2AEJA 1WB5A 2XUAA 4LWOA 2IH5A 1KJ8A 4K3VA 3U6BA 5FL3A 1KO4A 1R9GA 3B48A 4G4SP 1G8JA 3SJCA 3T3EA 4EY5A 3O8RA 2P11A 4F71A 1UBEA 3ZGYA 3EPLA 1VJCA 3OFSA 4F97A 3HDTA 4WACA 4UEWA 5L3VA 1VJ0A 5IXSA 1ZGJA 1QS0A 1R5OA 2EU8A 4P3YA 5C5IA 3VXKA 4B81A 3C4JA 5CM2Z 4F84A 4ZYXA 4L0CA 1H8ED 2JZNA 3ZG6A 2QM8A 4BQEA 3D5TA 2GJ8A 4MR7B 3SZOA 1RM5A 1CTQA 4ENQA 1DGQA 3T5TA 4C30A 3A28A 1JFTA 5LU8A 1FLVA 1Q3TA 1Y3DE 2WVHA 1JXOA 4HWSA 5HNKA 1E99A 4QYTA 3H9QA 1G21B 4MICA 2G9VA 3NVAA 2W37A 3UFBA 1E1RA 2FWJA 2BGNA 4PNHA 4YBZA 1XNHA 2NVOA 2HHAA 3U7QB 2IXBA 1XBTA 4EJ6A 1I01A 1M1YA 2CB9A 2ZRCA 3NTLA 4O3MA 3RS2A 3EN0A 1GWNA 1O94A 4OLAA 1NF8A 3LQFA 1QZUA 5D2CA 1Q19A 1OA1A 1L7NA 2XLCA 3PGJA 2PGIA 5K3DA 4FMDB 3SAJA 2QR3A 4EG0A 1NIJA 2D1QA 2AD1A 3FE2A 4X8OA 2GTPA 4A5OA 2FEMA 4BNFA 3ZE1B 5HJ5A 3COSA 2W2LA 4PO3X 5JS1A 2B30A 3MBOA 1TPZA 3FOBA 4BECA 1SOMA 3CZPA 2R0QC 4RZ2A 3KT6A 5DKFA 4BJ3A 2ALJA 3BILA 2IHUA 4Q4JA 3UB3A 4L9SA 1YI0A 3WYNA 2QNBA 3REQA 4BTLA 3PVZA 2V6BA 2JI4A 4Q3LA 1T4MA 4P2GA 5IK2A 4OHFA 5IULC 3JWGA 4BO1A 1A8QA 1KI6B 1RZ3A 1SUEA 1P5ZB 3PZRA 1OJ7A 3PWTA 4HDAA 5FEMA 1O87A 3JSAA 2YL2A 4KTVE 5ICFA 5ALVA 4L6IA 1E2UA 5A3SA 3OKCA 1ULUA 2BKVA 2GJAA 3QU5A 4O29A 5KWIA 3DHWC 3HY4A 4PG5A 3U7JA 2PBLA 1L5HA 3RYHB 3LJKA 5GPBA 1O8BA 1SUPA 2GO7A 2QVZX 2R8XA 1G3RA 1X1RA 5DLEA 3TD6A 4JL5A 4EW2A 3ECAA 1GM5A 4DADA 4RPCA 1M74A 3PIDA 2LRHA 5LQNA 1Q77A 4HVAA 2EP5A 5KUTA 2FDXA 1UPXA 3P7MA 3SDSA 5MN6A 3QVSA 3C1UA 3CM0A 3E5HA 3CB4A 1Y5RA 4K9DA 4XB2A 5FORA 4URUR 4I81A 4X61A 1I0IA 3ABIA 2VH1A 2RGNC 1E2FA 2FR0A 1MAUA 2REQA 4P4LA 1Z6GA 1U2DC 5AWFC 2V9ZA 3TD9A 3CF6R 1FS5A 2NUAB 3GFVA 3G9TA 4HKTA 4BUCA 2OQIA 1JU9A 3H5AA 4GI2A 2GKGA 2RGDA 5KOJA 3WMFA 2ZJ6A 3QPBA 4JUAA 4NESA 1G5QA 2QTLA 3GXOA 3HG7A 1NJSA 4BN5A 3PUXA 5K0CA 3ZV7A 1EE9A 1Z4IA 3JQGA 1KTVA 4F5YA 5K8LA 2GS9A 2L69A 5JZVA 3MWLA 3DBIA 1X38A 4DNFA 1GILA 1ORVA 4FYPA 2ZJ0A 3PQ7A 4KPYA 3H87A 4HEA6 2OOKA 5EXPA 1D9XA 4BGIA 3ESCA 1PP4A 4ZCLA 4TWJA 1QIJA 1UP7A 2JLQA 2JIMA 5G0VA 2C2XA 4ES6A 3MGBA 4NWIA 4DY6A 1II8A 2XY4A 2BTQB 5IBCA 1BFDA 4P3XA 4XSGA 1M2OA 3L77A 3RJMA 3RRMA 2X6TA 1J00A 1U1DA 3L8EA 4OF4A 3SYNA 1E7SA 3JQ7B 2IQ5A 3AL0C 1V7PC 3FNIA 1OI4A 2A1TS 2BFDA 2HT6A 4P4NA 5CFZA 2XE4A 3BXEA 5GQSA 5IP5A 3CR3C 1QWSA 4EHKA 2DKOA 1H2AS 1CUJA 3G7UA 4IOMA 1PWZA 2CUZA 3Q41A 3I04M 4OXNA 1LFDB 2I54A 3ICWA 2ZCJA 3ZCSA 4LEIA 3CRZA 3DZFA 4ZI7B 2HCFA 3GUUA 5SYMA 3A04A 4MH0R 1DRUA 3RC9A 5AKXA 3CZ9A 3EUEA 2R6R1 3D7SA 1E3EA 3PT9A 4HEJA 3RYCB 3AHGA 2VUTA 1TYAE 2HADA 2Y0EA 3QU2A 4EPYA 2ZJ5A 1W4BA 1ETHA 3L0PA 1JKFA 2FMUA 1TKBA 3KLMX 4O2AB 5C5DA 5LZ2A 5GINE 4RTKA 3TJRA 4D43A 1OB5A 3LDFA 1ODLA 2XUOA 4U5QA 1E5QA 2L82A 4IIXA 1T8PA 1AMUA 2DOKA 4DR1B 2ZYVX 5LA6B 5EKXA 2XB8A 1V9SA 3DMYA 1O54A 3HCWA 3L7YA 1D8AA 3KOMA 4G0YA 4IS3A 4O0LA 1KZ9A 4WEOA 4ZAVA 3RIHA 3ZD6A 3Q9SA 1UP4A 1E9VA 3K9NA 2EKDA 5KYYA 1S9DA 4ZEOA 1I7QB 3C8ZA 4MUJA 3KKLA 4UTXA 2A4KA 1MJHA 1UBHS 3GRUA 3KZMA 4URWR 5GONF 1JVSA 5IX8A 3F1KA 1P2UA 1D7AA 1ZGGA 1ZK4A 5HM8A 3AKZA 2QM0A 1R66A 4I6GA 4JIMA 5E6RA 1QXSA 4ZXFA 3RHSA 5A5DA 4GQBA 4MS4A 4OX9Y 2B2CA 3R9KA 1E2DA 2H4WA 4KDCA 3JZFA 5CBPB 4S2UA 3WKDA 1UKAA 1LLCA 2XUFA 3D4IA 4XEHA 3B9BA 4Z0PA 2OAGA 2BL4A 4MUBA 1QBKC 2RI0A 1TE2A 3B53X 1TL7C 2IZ0A 4XJXA 2PXAA 4IUCS 5CLHA 3LKVA 1UMDA 1HZZC 2FJPA 3B6EA 4CCWA 5ERGB 2I99A 1G5PA 1U8ZA 4UMVA 1BKYA 1FP1D 3ITDA 3TR5A 5L40A 1FXWA 1QX3A 4QZVA 1N7IA 2VKTA 3CFYA 5THXA 1N6IA 4I3FA 3KS9A 2XDQA 4OSPA 3ZWYA 3CUYA 1HOTA 5K8UA 2K87A 4LV6A 3EZ7A 3KL2A 5E8RA 3WV4A 1PHRA 3V80A 4JDUA 2HCJB 3SE0A 1W581 3K9LA 3RLFA 2VSYA 5HJEA 3O1HB 4OKNA 4DLNA 1GZ6A 3X1XA 3FTEA 3L6UA 4R1LA 5EGSA 4WLFA 1U31A 1P5JA 3R4CA 2OD2A 4QNMA 4A36A 4FZJA 5DW0A 2WQ7A 1BNCA 2NQTA 3FUWA 2YMQA 3I61A 1N78A 3RTGA 4LJRA 4LJ8A 4L27A 4BB6A 3GQVA 4RIHA 1ZZGA 5BSUA 1A2KC 4NV3A 1MZVA 4EOGA 4QOGA 1H0KA 4F12A 2H4JA 5HDBB 5B4VA 3RVRA 2WKRA 3IX7A 3OAAD 3QF4B 5FBWB 3P9CA 2Z0MA 2WFAA 1PW7A 3AEQB 1ACMA 1IHUA 3MPOA 4MITA 4QNNA 3RNLA 3UJHA 4LF6B 1K4KA 1RADA 2ODWA 5KQMA 2QTWB 1AZLA 2FPOA 3CLRC 4Y2GA 4IGEA 4ZOLF 3T5MA 2BMDA 3QQ5A 5AICA 1HDGO 4I1OA 4BCBA 3FVQA 2IYTA 3DM5A 3GEBA 3PHIA 3T7KA 1YAJA 2P91A 2PAFA 2BF7A 1RYDA 2V6MA 1KY4A 3QYPA 3ZTTA 4I55F 3GJ0A 4I5IA 4NFYA 3IT0A 1AK1A 1KK0A 1D5CA 2PUTA 3BKXA 3FYUC 3V9AA 2R5FA 3FYCA 2MYUA