1O96B

Structure of electron transferring flavoprotein for methylophilus methylotrophus.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
318
structure length
314
Chain Sequence
SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSRPIADAGWLPKSRQVGQSGKVVGSCKLYVAMGISGSIQHMAGMKHVPTIIAVNTDPGASIFTIAKYGIVADIFDIEEELKAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extensive Conformational Sampling in a Ternary Electron Transfer Complex.
pubmed doi rcsb
source organism Methylophilus methylotrophus
molecule tags Electron transfer
molecule keywords ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
total genus 88
structure length 314
sequence length 318
chains with identical sequence D, F, Z
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
B PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1o96B01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1o96B02
1OZHA 5FO1A 4S1OA 1DNPA 2EL7A 3GMIA 3H9CA 3N2YA 3H97A 1ILEA 2DETA 4IAOA 1GAXA 3VGJA 4BV3A 1MC1A 2PGNA 4MQ6A 4OJMX 2QJTA 3ZJVA 1NUPA 1Q77A 3FZNA 5DB4A 3ZJTA 1S4MA 5H7XA 3SEZA 1N2GA 4AS1A 3CLSD 1SURA 3LE8A 3DO8A 4YP7A 5K0TA 2V0GA 3UY4A 1KP3A 1YULA 4I6GA 4MW1A 5TGTA 5JBNA 3ZXSA 4U63A 1G59A 2BTEA 1U2GC 1E3TA 4MW4A 1H3FA 1J8FA 1J1ZA 3COZA 4U8HA 2R5WA 1VLHA 2WSIA 2Q5JA 4K9MA 1O6BA 3HZRA 4G5YA 4MZXA 4TWIA 1J21A 4Q93A 2JI7A 3P0JA 1EFPA 3GUZA 1UPAA 2BRUC 3X1MA 2X7JA 4UZFA 1NYLA 1T6XA 1MBZA 1QRTA 4IF6A 4EG3A 4EF6A 1M8FA 2E18A 2B7LA 5H16A 1F9AA 3UK2A 4A91A 1N78A 4UTZA 2CV2A 1Y42X 1K4MA 1Q11A 2Z09A 2Q5LA 2WQ7A 3CVUA 4RMJA 2UZ1A 4QRDA 3CR8A 1ZUNA 1IRXA 2A86A 2AG6A 3PXUA 3H9BA 1RQGA 3VU8A 5KHAA 1O95C 3S3TA 4JUCA 2NXWA 3C8ZA 1YI0A 4MUGA 4K9LA 4ZT7A 2EJCA 4UTRA 2O5RA 5EJ8A 4UZEA 1KH3A 3QTTA 3TNJA 4JSRA 1T9GR 4UUAA 1K92A 2J09A 1JZSA 2FR8C 1T9AA 5J5AA 2ZUEA 2PG3A 5F23A 2A7XA 2A84A 1MAWA 1N2EA 3IMGA 4E1AA 1I6KA 4EG7A 4GP9A 3SP1A 4L3OA 4RMIA 3JR3A 5EJ5A 2PZAA 2BYTA 2QQGA 1MOPA 3CA8A 1R6UA 4ZCQA 4HJRA 1GTSA 2WVAA 4GM1A 1XNHA 4H3SA 4F56A 4EGAA 4COKA 1F7UA 5D7NA 4ARIA 1WZ2A 1GTRA 1G8GA 2CUZA 1IQUA 1F4LA 2H2AA 4OUDB 4KR6A 2EZ9A 1YHZA 2WVGA 4MWCA 1Q1AA 3CLTD 1NSYA 3X1JA 2H4FA 4MUNA 4MULA 2H29A 1OWOA 3COVA 4UU8A 4YP5A 2UZ1B 2DR2A 4NAUA 2DXIA 1U31A 2VJYA 4ZCSA 4CT0A 4HDAA 3A04A 1V5GA 2OD9A 1KAMA 4DLPA 1NP7A 1XNGA 3D4BA 3SDBA 4KGDA 1J1UA 1VBKA 1PNOA 1PTJC 4RMHA 4R8MA 1Q6ZA 2DUMA 1TYCA 3RFFA 3ZXIA 4C78A 1A8HA 3PKJA 2VXOA 4V1CI 1LW7A 4DNXA 1JIJA 3N05A 1LI7A 3PNBA 5DGDA 4JFAA 1K4KA 4HPWA 2XRYA 3TZEA 2HJHA 3FSJX 1O5TA 4MVXA 1I2DA 1NUQA 4NATA 4PY2A 2WB2A 1HZZC 1YTLA 4EG1A 4MUJA 1O0CA 1YBHA 1V8FA 5HUHA 2Q5QA 2HMAA 4P2BA 3RIGA 5BNZA 3ZGVA 2J07A 1G8HA 1EXDA 1H3EA 4CQNA 3L92A 2C5SA 2NSYA 1O0BA 1JHDA 5LLTA 1O95D 4RJKA 4DDMA 1IQRA 2H2IA 4MVWA 2FN3A 1EUQA 5MGNA 3ZG6A 4UTVA 1M8PA 2HGZA 3IOEA 1MB2A 1KORA 2DLCX 1R6XA 1U7DA 4I6JA 1PFVA 3RJZA 1NURA 4BN4A 3PDHA 4RJIA 4YMIA 4WSOA 1QQTA 1MB9A 4JT9A 1YC5A 1OBHA 3DV2A 3UC5A 2Q27A 5DEIA 3MLAA 4MVYA 2OORC 1J20A 2CYAA 4JUDX 1WXHA 1J09A 4ZT6A 1QPBA 5K6TA 3ZJUA 3CVXA 1QNFA 4QREA 3P0HA 5K3SA 1YUNA 2AKEA 4NZPA 4K9KA 3FNRA 4F3RA 1T6YA 1D2RA 2E0IA 4JZYA 1V5FA 1M8GA 1TQ8A 1YUMA 3FY4A 1JGTA 3AG5A 1TFUA 4TWJA 2OV4A 4UTXA 1U3CA 3PNYA 3F6BX 1ZJWA 5EKDA 3UOWA 3P52A 5AHWA 2RD2A 4I5IA 5EJ4A 1ICIA 5DEOA 3X1KA 3AIIA 1ZH0A 4JU8A 1GZUA 1ZH6A 1YC2A 1N1DA 4L2IB 1N77A 4JU9A 1O96B 3RHSA 5MF6A 3ZGZA 1DJLA 1Y9DA 5MFPA 3MMXA 4GRIA 1N2JA 1WOYA 1EFPB 5HUJA 1GPMA 1KR2A 1VL2A 2A4MA 3CLSC 4ZT2A 3FOCA 4GM0A 4DE5A 1PI3A 2Q29A 4UU7A 1N75A 2CFOA 4KPUB 2OD2A 1PFYA 2CYCA 4DJAA 3FG9A 2H2FA 2X1LA 1WXIA 3F6EX 3D6UA 1M1ZA 5DGTA 1P7PA 4X3PA 3ND5A 2HZ7A 4D5EA 2ZP1A 4BWVA 1U2DC 1JILA 1XLTC 1GLNA 4FZJA 3IOCA 2EZUA 1O97D 2PANA 3IMEA 1KH1A 2PIDA 3GLVA 4ZCTA 5LM3A 3EYAA 1SZDA 3HWWA 1B6TA 3MXTA 4JD5A 1M83A 2A1TR 4WNYA 4GM4A 3PKIA 2XRZA 3HWX1 1YIDA 4F4UA 4X0EA 1N2HA 4DDKA 4EG4A 1PVDA 4KR7A 3JWPA 3ND6A 1POXA 4EG6A 3GLRA 3TZLA 2OO5C 5FNZA 1X8XA 3DPIA 2QQFA 2VK1A 2CV0A 3KT3A 4MUKA 1PG0A 1VBMA 3TS1A 4K9PA 1EJ2A 3K35A 4BN5A 3D6VA 2RE8A 1FYDA 3CLUC 2VBFA 3IH5A 4XFDA 4JXXA 4MPPA 1XNJA 2DERA 1JMVA 3CLTC 4RJJA 3H05A 4QBTA 2I1LA 2J5BA 2IHUA 2VTBB 3U31A 1WXEA 2IELA 3M5WA 1O94C 3P0IA 4GU5A 1EE1A 4C7BA 3ELBA 4MWDA 1KQPA 3OP1A 1D4OA 1HYBA 2PXHA 2EZ8A 4BUZA 4QPZA 3MLBA 2VTBA 1T9CA 1U28C 4J75A 2PZ8A 1X6VA 3IODA 2JLCA 4J16C 4MUFA 1WKBA 2H2GA 2NZ2A 4QQ8A 1H3NA 1OWMA 1FFYA 4JUBA 2Z3VA 5BWNA 1JIIA 3AKZA 1M8KA 4K9NA 1GN8A 3IVCA 2O8VA 2H2DA 1TYBE 2H4JA 2NYRA 4JUFA 1M8JA 1N2IA 1WQ3A 4PBRA 2QUIA 4Q16A 1COZA 3L93A 4MVCA 1S7GA 2EZ4A 1JIKA 3ZIUA 4ZP1A 3ILVA 2G36A 4J1TC 5EJ9A 4ZCPA 3QTBA 4YBRA 2CT8A 5BWOA 1I6LA 1Q19A 4MW7A 4EG5A 1OBCA 4EG8A 3AL0C 4GPEA 1OWLA 2DPLA 3QE4A 1PYDA 1UFVA 1KQNA 2IHTA 4NAHA 3NBAA 3TQIA 4ZCRA 4RMGA 2TS1A 2GKSA 3FIUA 4I6EA 1KAQA 4CDNA 4MW9A 3GLSA 1U3DA 2YWCA 3SYTA 1T9DA 4K03A 5IMSA 2A1UA 2OQ2A 4X3OA 3INNA 4RPIA 3IUEA 3NBKA 2CV1A 1NUUA 4R2LA 5TEVA 3U1VA 4O8ZA 1OWNA 2YXNA 3TQOA 4ARCA 1O94D 1PT9A 4AQ7A 4BVEA 2QTNA 1NUSA 3RK1A 1I6MA 3CVWA 1N2OA 2X3FA 3I05A 3IMCA 1PO7A 4XFJA 3EA4A 4FEGA 3VRHA 1M2NA 4Q9DA 4FZ3A 4MUEA 1OWPA 2Z08A 1WJGA 2C31A 4D5GA 3IAEA 3N9IA 1POWA 3ZGOA 2QJFA 4TS1A 1G8FA 4F4HA 2B4YA 3GLUA 1WQ4A 3BL5A 1O97C 4L2IA 2W93A 2ZUFA 3OE1A 3SZ3A 2PGOA 2FSVC 4Y6QA 1H1TA 3PRHA 5IJXA 3ZUGA 5J58A 1M2GA 1S5PA 2Q28A 4JT8A 4BV2A 2JAXA 1WY5A 4PBTA 3CVVA 2JANA 1LI5A 4MWEA 3A4IA 1TYDE 3HFJA 4FVTA 5EJ7A 2GOYA 2FRDC 1TYAE 1T9GS 4ZT4A 1MAUA 1PG2A 3IVXA 2PFSA 4JXZA 2JI8A 5AHKA 1MRZA 2A1UB 2CSXA 2JI9A 3FWKA 3KT0A 2QUJA 1O96A 5FYQA 3LCJA 3SZGA 4QELA 1V47A 1MCZA 3LOQA 1JZQA 4DDHA 1M2JA 4K9OA 4NDAA 5IHXA 3CVYA 1PFWA 3K9WA 3IVGA 1MA3A 2CYBA 1EUYA 2QUKA 3UMVA 1CT9A 1EFVA 2X0KA 3HV0A 4ZT5A 3JXEA 4XSVA 5FO0A 3E27A 2VBGA 1N2BA 1NI5A 2QTRA 2YY5A 1QU2A 5KWVA 1OZGA 1XJQA 1Q15A 5TEWA 2VBIA 3AFHA 3FDXA 4MLPA 4MUIA 2VK4A 5BWLA 3DLAA 4U7JA 1PFUA 2QTMA 1NUTA 1QJCA 3CLRC 4GG1A 4UTNA 4J76A 1IQ0A 1YI8A 3CLRD 4ND7A 3IUBA 1WXFA 1WXGA 1IFXA 1QTQA 2H2HA 1R6TA 4ND6A 1T9BA 3D81A 3D7KA 2V3WA 4BVBA 3E9YA 4R0NA 4V1CA 3Q4GA 2OD7A 3IOBA 4MW2A 2QJOA 3GLTA 2WQ6A 2QUHA 3FLMA 1YIAA 1UPBA 4G6ZA 2PZBA 1NZJA 3CLUD 2J08A 4K0RA 2FWNA 4MAFA 1F7VA 3KT8A 3SEQA 2AZXA 3K32A 1VBNA 2JIBA 1OD6A 4CDMA 4OUDA 3FH0A 4K9QA 3HMQA 3OTWA 5EJMA 3U3DA 3IDFA 3H99A 4V1CB 1N0HA 1Q14A 1V5EA 1YI1A 1M2HA 3KFLA 3LQ1A 4JYZA 1OZFA 1N3LA 5K0SA 4MQ5A 3COYA 3COWA 3Q12A 3PNVA 4BVFA 2YWBA 2E89A 3G6KA 1JECA 4HJXA 1NM5C 3Q10A 2VK8A 1MJHA 3KT6A 3MUEA 1TEZA 4G5FA 5DASA 1IHOA 3F3MA 4KXQA 2GM3A 2A88A 4RUKA 5K6RA 1K97A 4NX2A 1ZPDA 4HD8A 1JSCA 1UPCA 2JLAA 4MW5A 2DEUA 3FETA 1JEDA 1YHYA 4HK4A 2AG0A 4KR9A 1IVSA 4MPRA 4MUHA 5HG0A 4EFKA 2D13A 2WVHA 4BVGA 4ZZIA 5DK4A 3AG6A 1YNOA 5J59A 4IG9A 3FHJA 1BFDA 2H4HA 2JA2A 5MFZA 2D5BA 2E21A 1QRUA 4ZT3A 3ND7A 2IJGX 5KCMA 3G59A 5K2OA 1U0BB 3N8HA 2X1MA 3IAFA 3A05A 4MWBA 2AG1A 1QRSA 4FEEA 4MW6A 4PBSA 5TS2A 1IH8A 3G5AA 3HGMA 1T6ZA 1KH2A 3ISJA 2Q5OA 4G1CA 2EZTA 1M2KA 2JI6A 4Y6LA 4YP6A 5EJAA 3FI0A 5FEMA 1OVMA 5EJ6A 3A2KA 1U7XA 4MPJA 1KKUA 2D54A 2IHVA 2V0CA 4KKVA 3RIYA 3EY9A 1KQOA 5LFAA 1Z8NA 4JUAA 1JEEA 4R2MA 1KP2A 1SZCA 4BVHA 3HL4A 3RK0A 1PNQA 3NV7A 2DJIA 1ULHA 1BS2A 1J70A 2A1TS 4KPUA 2H59A 2J4DA 2IP1A 4UUBA 4MW0A 1Q17A 3CF4G 4Y6OA 1EFVB 1QU3A 3RBAA
chains in the Genus database with same CATH superfamily
4FYJA 4B83A 5C8YB 1MKYA 3W5UA 3BCSA 3MC1A 1K75A 1JYFA 1T5LA 1UXGA 4MRMA 2PGIA 4DJ5X 5JQGF 1U1EA 3R6LA 3SQMA 1QYIA 4C2AA 3LCUA 2GN8A 3ZJVA 1WUYA 2BGRA 4Z4CA 1DP4A 3FZNA 1B1AA 5HIIA 1VMEA 4F12A 4N9QA 3DXYA 2AFIA 2YJ3A 3F96A 5TGTA 4RAOA 3ZXSA 3PPWA 1IOVA 4YNBA 5HTKA 1I10A 2MWMA 5HSGA 1QGOA 5JD4A 4GECA 2IHBA 4OSOA 4BQOA 3COZA 2QW8A 1T9HA 1VLHA 5EZQA 4AS3A 2WJ4A 5ICGA 3SVLA 221PA 1Q0SA 1SNYA 3O93A 3KSRA 4IJWA 3NO4A 4TSFD 4U7WA 1QHHB 3LW8A 2NUBA 3X1MA 3ZBTA 2PMEA 1QCCA 3AINA 1ODCA 1SVKA 4NICA 1SFRA 1WCV1 2AQKA 1CYDA 1FBNA 1D0SA 1N78A 1X42A 1Y1KE 2FVYA 2JJ2D 2VSXA 1CU1A 2GD1O 2C4KA 2BKAA 1X80A 2FH5B 3ZE1B 5J9FA 1PFKA 3TIXB 3T7EA 1ZL0A 2XE7A 1QOZA 3NX4A 4RMJA 4XQCA 4ASUD 1NF2A 5M29A 4E14A 3R2JA 3F49S 2DRIA 1GU1A 2A5FA 3A4TA 1XVIA 1W7AA 2QORA 1OFUA 3I5UA 3K6RA 3MJRA 4LNHA 3T3MB 5F1KA 1N1GA 3WHLA 2N0SA 3H5IA 2BM9A 1QRRA 4Z4IA 2VHZA 2YZMA 4J49A 2CWWA 2FR1A 4KX5A 5HKAA 5D8DA 5FA6A 3DDWA 5LQKA 3WLOA 1Z0DA 4EMSA 5JH7F 2A7XA 4U2BA 4C4OA 2RH9B 1FW6A 5CVDA 3MTQA 3UNXA 2IYSA 4KO8A 4C6HA 4CL8A 1Y8RB 3SXUB 2XT9A 3SP1A 5AUPB 4FFRA 1BDBA 1F6WA 1NBIA 2QU8A 2WF5A 2XPCA 3CA8A 4GPAA 4JYBA 5FAXA 3RUPA 3C24A 3SLRA 4EKGA 4CETA 3S2IA 2PWZA 4AROA 1HEYA 1NN1A 1SUBA 3PUZA 3VOAA 2FPKA 1BX3A 1T2NA 5CCDA 1ZUHA 3MT8A 2CUZA 2H2AA 1LS6A 1YHZA 3X2SA 3CLTD 2AEJA 5BT8A 5THKA 1KVRA 5BURA 4DQLA 3JZIA 4YI3A 1VPDA 1ZEJA 3OG9A 1EHYA 3AZOA 1XHFA 1ND6A 4IOKA 3TO5A 2QLNA 4KLAA 1IHPA 2B35A 3EIFA 4XLZA 3UHPA 2P62A 1Y8ZA 1H0KA 4OA8A 1SIOA 4JSTA 1OAOC 1X1CA 3DL2A 1RPZA 1B14A 4B3XA 3PG5A 4CLOA 2R7KA 5AVWA 3QKSA 4EYQA 1IMJA 1T0HB 4BFTA 3RT7A 3B2QA 5FB3A 2DUMA 2F00A 3DR5A 3JU3A 1NXPA 1CE8B 1S8OA 2KHZA 3H1AA 3EF0A 3MJFA 4LJKA 5EQDA 4C0BA 1RHMA 2RK3A 5FKJA 3P2KA 3KM0A 5ALGA 3QKUA 3RUCA 4CPDA 1NLYA 3AZPA 4M60A 4RTNA 3OQOA 3ETNA 4YRRA 4B6GA 1G5RA 1LBSA 3RUHA 5A5GA 4JLUA 2HJHA 1SHZA 3LDFA 1QB7A 4HYYA 4J2OA 2ZJ0A 2XJ9A 2Y1EA 3ITEA 3MXOA 4REQA 4CUJA 1K7EB 4NATA 2R6JA 3TQQA 1VPEA 2Y4OA 3VPHA 3TRKA 1FOEB 3PGKA 4ZJUA 3SIPA 3AFMA 4K86A 1J1IA 4M9XA 3ZGYA 3VAYA 3OY2A 4IILA 2AE1A 1SVSA 2DPMA 4MUBA 1GL3A 2VHXA 1QR6A 4HS4A 3X3HA 5ALEA 2C1EA 1NZFA 2BSAA 3OX3A 3RODA 1P1BA 2H2IA 4PICA 3DQPA 4RIHA 4Z4HA 2BHLA 5B6IA 3O1LA 4CEJA 2WF9A 1YASA 3ABRB 3IBFA 3QH4A 2HGZA 3DXFA 2B8NA 4AG5A 2DLCX 4XX0B 3V5NA 1U7DA 2CWDA 4B3RB 3C5WP 1NOKA 4M0LA 2ZIGA 1KVSA 2C1ZA 1QQTA 2HUNA 2OHGA 5IVKA 4FQ5A 5IU6A 3MAJA 3A11A 5KNBD 9LDBA 1I2BA 4UBIA 3OIDA 3MD9A 4HMOA 8LDHA 3CN7A 1E5QA 4UE6A 3QP9A 3WGYA 4KOEC 2O0KA 1SD2A 5JFGA 2ZM5A 3FMIA 2PGXA 4BO7A 2AKEA 1QLWA 1JDPA 3DT9A 3O8BA 4YJHB 1DRVA 3BE8A 3KB8A 2H5LA 3NOXA 4YUXA 2WHEA 1AMUA 2Z2JA 4WD3A 4M6WA 5H02A 3ZD8A 2PUHA 3GDHA 5EKDA 4EI9A 3VMMA 4NBNA 5TVGA 3IHKA 4IICA 1WXQA 2L17A 3I6YA 5KTNA 3H4IA 1K6IA 3S7ZA 3PQCA 5KYNA 1D6SA 2I62A 1KOLA 3ZVMA 4HRXA 4WGFA 3O38A 2WE8A 2PH3A 2WHYA 3C7AA 4QSMA 3WGZA 1VB5A 4MV3A 1BVYF 2CMFA 2ZRFA 3MMXA 4BZQA 2J9YB 4FGZA 4B6RA 5KU7A 4CBVA 3ZY4A 1GPMA 2ACEA 2QL9A 2F9FA 4ZYTA 1Q0HA 3KVRA 4LZZA 2EX4A 2Q29A 5G02A 5JAOA 1RLIA 2ZXUA 2CLMB 2NZJA 1UK6A 2CYCA 4U6QA 3WP1B 3QVSA 4DJAA 1T36B 3CBQA 3T1TA 2J0SA 1M1ZA 3MFQA 4KIGA 4KKXB 3OP4A 1QPGA 5JAHA 3ORFA 3CHYA 4RPHA 1KEEB 4UNPA 3VFDA 5KU1A 5A4FS 1V35A 3KFVA 2VSFA 3IOCA 4ZC1A 5JU6A 5DFAA 4IHJB 1ZZEA 3GG9A 1CY0A 3GLVA 3PPIA 5J47A 1UWKA 1PNRA 1K5GA 2ZB3A 3O83A 4YRBA 3MILA 3KAKA 4BNFA 1E6CA 3LI2A 3MMPA 3TAHA 4DMLA 2RJOA 2W83A 3NGLA 5JZVA 1WZCA 4QOJA 5FPPA 1GNRA 1BHJA 1XL1A 4L72A 1QYWA 3JAKA 1P2FA 1U1FA 4RANA 4RD6A 5CU7A 1G6HA 4YUZA 2BEWA 5LYJB 2GMWA 1M76A 3V8EA 1W25A 2VHVA 1L5QA 2VK1A 3BFJA 3IP7A 3AKCA 2EBFX 2BSXA 3LY5A 3Q2KA 1DWUA 1G9TA 1MX9A 1U28A 1XTRA 3B9RA 4EARA 3NEYA 3PVZA 4D9FA 1RYFA 2GRUA 5HF5A 2VBFA 1R3UA 3E7WA 1Z8FA 2RHDA 3NGXA 4PYLA 4TMVA 5GJVC 2JGEA 1GD1O 1JYSA 3G85A 1KARA 3HE3A 4BBZA 2Y2UA 1ZQ1A 1FVOA 1MZPA 1FFDA 2W70A 4N7MA 2PFGA 1EGHA 1E62A 3JZAA 4GMHA 2QW1A 1XEXB 4LGYA 4AJ9A 2E87A 2QYSA 3HUTA 2O0MA 4KWHA 1GPUA 4QASA 2IZ7A 4OYYA 4Z4GA 1P1JA 2X4IA 1H4VB 2QLBA 2R8EA 3ILSA 1NRJB 4FNGA 1T9CA 2QP3A 3K4HA 4LECA 4NS1A 2VJMB 1AKWA 3OMWA 4TMZA 1UP7A 5LXTF 2HRDA 3DOUA 4RO0A 3V9PA 4LDJA 4J16C 3VU0A 3TBKA 5ADUS 1M7GA 3A3NA 5M34A 1NULA 2YL2A 3DEAA 4JQCA 2OL4A 3W9BA 5EHNA 4B7XA 5LVAA 1DTWB 1V3UA 3E84A 1OA0A 4MA0A 5A3SA 4EWLA 3ICCA 3W1WA 2HSEA 1MOQA 4KMOA 1A5ZA 5DX8A 1HDOA 2WF8A 2CZCA 1V6SA 4BVKA 4FGWA 1FRQA 1NVKA 4L16A 5JSKA 5CCXA 1XDDA 4KPGA 4MI9A 3N1UA 4BMXA 2G6BA 3S1SA 4KXVA 2B8WA 2H06A 3M1AA 3R09A 1SHTX 3FUWA 2AA3A 4OLBA 4YBRA 3KXDA 4C3OB 4DR5B 3BGDA 1B2RA 4EUEA 3MMZA 1L6RA 1LK7A 4J0DA 3UMGA 1K3TA 1Z4LA 2VSQA 1Q0TA 4BGDA 1S8FA 2O8BB 4BRZA 5AOBA 1LLQA 3LX4A 1YQEA 4JJKA 4K03A 4KQ9A 3DKVA 4RIIA 4WK4B 4MSUA 1ZD9A 1NUUA 2C9ZA 3KRTA 3HYCA 1YNSA 4HCJA 5FTJA 5TEVA 4DJJA 3N2GB 4ARCA 1O94D 5JROA 1RJ9A 4QUGA 4BE7B 1U9CA 4TMWA 5EUCA 3MTGA 2XEDA 3IAM1 3CVWA 4FEGA 4WCFC 2I0FA 3I05A 4XX0A 4M9ZA 4YBZA 3BT7A 3DLPX 4YA6A 2CB9A 1EE9A 2R7NA 4RQTA 3JYQA 2JS7A 2XQGA 3F9IA 2JCXA 2NPFA 1D4AA 4DFDA 4XYBA 4EZEA 2C31A 2R6CA 2A9FA 3G1UA 2XCLA 4GOOD 3C7DB 5G0SA 5IM4F 1EAMA 4QUDA 2H5IA 1QZZA 2O57A 2JRCA 1TVKA 2G3YA 3H8WA 3N2LA 5A2QA 2DPHA 1AC5A 2CBXA 3Q41A 4YQFA 4Y6QA 4DZZA 3BF7A 3A1CA 3FUUA 2WDPA 3N28A 4AZ3B 1KMMA 2XT0A 2P0AA 1S5PA 3BXXA 1HT3A 1RWVA 4PBTA 4FBGA 2R6GA 3RVKA 1I2MA 4BEBA 4U8GA 5JNWA 1QC5B 1S89A 3KPJA 1E5XA 1G60A 1BC5A 1GWNA 3BXGA 3A7DA 3QVGA 5JWHA 1YMUA 3ABSB 3MGKA 5IAAA 5JSZB 3TX2A 3KETA 3W2TA 1WCIB 1OA1A 3ZQ6A 1L9KA 3T8YA 3QG1A 4KPFC 1ECFA 2FU5C 4DMKA 2P2ZA 1WPXA 1OY1A 2MSKA 4OBEA 4EF5A 1CLUA 3FVVA 5JUWA 1RZRD 4YV0A 4B4OA 4MVJA 3N53A 1LDGA 5CHEA 3IJEB 4UHDA 1IXKA 4RTPA 1P4AA 4MV1A 2I7VA 4S1PA 1MDFA 2JIPA 3MWYW 3DBLB 3QYJA 4ZJPA 1XTPA 3W04A 3E27A 2YX1A 3HACA 1Z0SA 5T7BA 4UUNA 4NYIR 3CV3A 5HRCA 4L4UA 1NE7A 2ORWA 3ASUA 2PQ2A 3PJDA 4KC0A 4E5MA 3FMFA 2QTMA 4ZRNA 2FK7A 4B43A 2Q8NA 3ABQB 1VIVA 4HEQA 4OHRA 3WQHA 3EIUA 4N3CA 1JPNA 2C99A 1RRGA 4RGQA 5BYJA 4CYMA 2FZWA 2FOXA 3CLRD 4QAJA 4UVGA 4EENA 4MR9B 4ND7A 1F2UA 1J2UA 1UK8A 4DQDA 4KL8S 4DSAA 4ND6A 3GD5A 1UQTA 3E9YA 1U0TA 4GGOA 1V6CA 3L3BA 4RVHA 4M9CA 1TJNA 3FM9A 3RVMA 4IQ0A 4E0BA 2YV3A 1XCPA 5T4EA 5L3SB 3LWDA 2OHOA 2PZMA 1EX1A 2CW5A 2Z6AA 3DEHA 2AD5A 2LDXA 3OU2A 4IS3A 3HEAA 2RGCA 1UKEA 1W29A 1OD6A 1Y98A 2EG5A 1SXJD 1A9OA 1DX6A 1U5CA 2XCQA 3HWSA 2WOJA 5FQOA 4ENUA 4ZK2A 2H07A 4PC6A 4K9QA 3FH0A 3FLBA 5MHTA 1LXCA 3SNKA 3KJIA 2YDYA 5A0FA 3IP9A 4DSOA 1M2HA 1Q5PA 2HPAA 2ZQ5A 3NDJA 2C3UA 3LS2A 3ZDFA 4CIXA 4D56A 1QXSA 4PNHA 1OPXA 1T8YA 2V6JA 1GG5A 2FEAA 3COWA 3OESA 1P75A 3OU7A 5HQTA 5HZGA 3CU5A 3C6MA 3K70C 1NU6A 3NBYC 3LPMA 3TVYA 2PT5A 2A0XA 3IE0A 3KT6A 1RMTA 5A5EA 3IHWA 1FQJA 4K3UA 3PD1A 4BO0A 2R7MA 4ZARA 2QTLA 1TZMA 4RZ2A 5IBRA 2GYYA 3E61A 2Q1YA 4ZA2A 1RADA 3UXEA 3ZNNA 5IS2A 1LTHR 4BVGA 5I7EA 4RIEA 2R00C 1ADJA 5I5GA 4CMGA 1QGED 1IXSB 1SAYA 1IIBA 4B7UA 1USGA 1H4SA 1WDWB 3DXXA 1UAYA 3HHPA 3LOPA 2YC2C 1XWFA 4M3NA 4C4ZA 3NCTA 3BPSA 4C08A 3OZGA 1NRWA 2BBTA 4O2BF 3D3QA 2MR5A 3KBBA 1UANA 1JR3D 3QEMB 4GVPA 3TG8A 3P0FA 1ZZGA 2XXAA 2R96A 4IMJB 1NM5A 4X8HA 3SQLA 2GJKA 2D1QA 4BFCA 4YT2A 2Z57A 1XIVA 2M1ZA 2X1MA 2OAEA 1RT9A 1FJGB 3IQIX 1H2WA 3QU5A 1BMFA 1MA0A 5EJAA 1XDWA 2AR0A 1DCFA 2PBLA 2YY6A 4Y6LA 4IH4A 5LZ8A 3W8DA 4B46A 4DBLC 2PUFA 2ISSD 2HQSA 1PVVA 3OZAA 5TARA 5EP4A 1JPVA 4BKPA 1DXOA 2NV2B 1A97A 4FYVA 4Q9KA 3ZLJA 4F5YA 1XEAA 1DIOB 4L02A 4HY3A 4N82A 4DIUA 5CB0A 3TIVA 2JBWA 3AH8A 5HE9A 1E5DA 3G79A 3DBHB 1SZCA 2XBMA 1WX1A 3NHMA 2Q6VA 3OPNA 4FHZA 4NDNE 2HAEA 3I2GA 3ZJ5A 3ESCA 5EERA 5I7AA 4AP6A 1F06A 4OLJA 1PWHA 1GAWA 4UZSA 5IXSA 3FVRA 3WBKA 1XZEA 2OOKA 2VJAA 3VR5D 2B0JA 2GXSA 2QTBA 4L5BA 5KI6A 5DV9A 4AMGA 5I3ZA 2VQEB 2C4HA 5DE3A 1L4LA 1TIKA 2P27A 3BD9A 2D4AA 3PFCA 2XCSB 2IOFA 3MQ2A 2Z3WA 2RHOA 1SXJB 2CL0X 1CZRA 3E15A 2Y92A 2YVUA 3E58A 1RACA 2JAOA 3EN0A 4TV9A 4KN5A 3QFTA 4RFLA 4RVSA 1DQYA 3BMOA 3UY4A 4I6GA 1TKRA 5A6VA 8OHMA 1NXXA 2P40A 4TS3A 4WZZA 5BQXA 5IASA 3KB1A 2OE2A 1VOTA 3E7FA 4Q93A 2RGRA 1XX6A 2RHBA 3B1KA 4BTEA 1NGSA 3AL2A 3HWRA 1VJCA 3EAFA 1RXWA 5FYDA 2P91A 2QRVA 1ECGA 3DBHA 3UXMA 3ZZMA 1NF8A 1P18A 2QZ9A 2X5JO 3L0CA 3WJ7A 3WLQA 4BOYA 3FTNA 4DVGA 2CV2A 1BW9B 1QBKC 1ISIA 2CB0A 4PZDA 2AW3A 2ZETA 3ROTA 1D1QA 3WJAA 1Y82A 4HNUA 3ZW7A 2ZAGA 4AM8A 2NU6A 2GSDA 3H2BA 1QF9A 3CG4A 3A1DA 3OE7D 1H6CA 1QO7A 4YJKA 2J9ZB 2V7QA 1I36A 1Y7IA 2PRYA 3NCHA 4ABYA 1BSVA 2C00A 3I62A 1TA0A 2H4ZA 3ECSA 1IVYA 1O94A 2ZIFA 3HLTA 1C4WA 5AQEA 3RABA 2B5VA 1KH3A 4FBLA 3NHJA 4UAVA 3ZDDA 1L5HB 3IQDB 4D3YA 5HDQA 2DT5A 4JGGA 2BSQA 1R37A 4Y1GA 5F23A 1AGYA 1EJBA 5JBIA 3FSGD 1E7SA 1BNCA 1G7TA 5AP9A 3IMGA 4GP9A 1MB0A 3H11B 3JR3A 3EXIA 5BSKA 1G8AA 2A6PA 1HUQA 4K40A 4HEA1 4MQEB 4PAWA 1U9JA 4OP2A 1WXXA 2CHGA 4P1ZA 4QTTB 4H7PA 5I47A 5DHSA 4JZKA 4EGAA 1EQAA 2UYHA 1NW4A 3KLMX 2H54A 5D7NA 4COKA 4RDHA 1V8PA 4JP3A 2GBIA 1V45E 3CO5A 1Y48E 5AVZA 2GN6A 3KPYA 4PGMA 3TDKA 1KR5A 4FS3A 5TQ2B 1T0JB 5EMKA 2J9GA 4WPGA 3ZQUA 4HAVA 1E6MA 4ZAXA 1DARA 2AQIA 2WV9A 4MRPA 2XB2A 1KRWA 3EC7A 5DOVA 1QYXA 5B4VA 3H2IA 1BZYA 5GJCA 2NT4A 1V1MA 1J2RA 2QB5A 2OBYA 3LCCA 3LRPA 4G4JA 1IJEA 2UZ1B 4B75A 4BVAA 4C7KA 5A05A 1T5TA 1WXWA 2PGLA 2VJYA 3OEYA 2OPHA 1SRQA 4PN3A 4YTEA 4TZ6A 1XZQA 4J9UE 1PNOA 3W2HA 2QRLA 3N2IA 3CURA 3O73A 5F2NA 2QD1A 3U0BA 2WKPA 4HS9A 3L8HA 1ZW1A 5BRAA 3AR3A 4FSDA 2GHIA 1IEXA 4YH1A 4C88A 1J2EA 2VDWB 2GF2A 1NWHA 1S8NA 4WFIA 5DM60 4CQLA 4MVJP 4ZEWA 2PKWA 4C4YA 1KMNA 1UQRA 4I50B 2FFQA 1Y5IA 4RIGA 3CZPA 4G25A 2DFTA 3GT3A 4F8EA 3LGAA 5AVTA 2ZFUA 1F51E 2PZGA 1U2QA 5B55A 1TF2A 4NEQA 3VJLA 1LDNA 2O7RA 3BKXA 3CZAA 4IM7A 1CY7A 4UUPA 2XAAA 3WL7A 1S2DA 1ZNZA 2NSLA 3DFUA 4EEKA 2KSQA 1Y5MA 1YL7A 1FDTA 1Z4OA 3PVSA 3R4VA 4GSKA 1ESZA 3AUYA 3ORYA 3C3BA 2W90A 2FW7A 5ICFA 2PSHA 4BLSA 5J4YA 1HDRA 4RZ3A 1IG0A 2X6RA 1M33A 2F1IA 4M55A 4S3MA 2HPHA 5HQ3B 3V33A 4IV0A 2GHRA 3G02A 4INOA 4NHEA 4I5DA 4PC3A 5JMWA 3HCWA 3UOAB 1BJTA 2OBBA 3LYAA 4GE3A 4I6JA 4TV8B 4OKSA 1NURA 4R4JA 2HY7A 3PDHA 4ZVTA 1CF4A 2VYFA 3FJYA 1ULBA 2MR6A 2RH8A 4URZR 1YC5A 4RABA 3EPLA 2NACA 4HXGA 4TT8A 3GAMA 1BJKA 2C94A 5C8ZA 4YMUA 4X1YA 3P9YA 3ZLVA 1GUAA 4ZAGA 2AJ8A 1MRSA 2NUPA 1CQIB 1DSSG 1AUOA 1V5FA 2JGKA 4QG7A 1YUMA 3TLMA 5DT9A 1JGTA 5KOIA 5I7RA 3KYCB 1AKTA 2FUG1 4MS4A 4ND1A 1RXUA 3EOAI 4EY5A 2WD8A 3ANXA 2BEWB 3BRCA 3K2EA 2YN2A 4W99A 5LYJA 2WUFA 2WUWE 4I5IA 3QQPA 4BCCA 4PSVA 4F7WA 1JDNA 1YFLA 2Q21A 1JKFA 1ABFA 3CZCA 4OH1A 4DJTA 3QLEA 1KNXA 1YB2A 1DTEA 4RKFA 2XWPA 4G41A 4FNAA 2BISA 1EU1A 3OZ7A 1K7FB 2O2CA 3AEUA 4GPD1 1NYTA 2C3PA 4HN9A 2EGGA 3P9PA 3U3RA 2FB9A 3WP0A 1EWKA 1N75A 3MJ4A 2CHUA 3V8QA 4L8LA 1MHPA 3B9PA 2PMKA 3KR2A 1JR3A 5JT1A 2DPGA 5BV7A 4R1TA 5EQJB 2G9UA 3NGMA 5DGTA 1EB8A 4CV0A 5AKZA 1YUBA 3NYQA 3Q85A 3S2GA 4D5EA 1UFOA 2HJ9A 3I2FA 2FOLA 1Q21A 2QTVB 2BI8A 2JGLA 2P79A 4GX5A 1NNLA 2K2WA 5DI3B 5C31A 2PS0A 3M8KA 3BILA 2EF1A 5TJ9A 4CMHA 3TXYA 3L0OA 2XCOA 3LYLA 1GPJA 4JCCA 1KIFA 3OEEA 3L0PA 4KTTE 1YVRA 5D2CA 1IHXA 3U7IA 4DCCA 4QX6A 5COBA 4WWHA 1NTOA 3FB1A 5B7PA 1PGPA 4AX8A 5BOSA 2QRKA 4HBZA 4NOLA 3KAQA 3ABZA 2BJHA 3EE6A 4P3XA 2QLMA 3FMOB 1B2LA 4G2NA 1GVNB 4PYRA 1YFZA 3LJKA 2OO5C 5IT4A 2RGUA 4B6SA 2O54A 1AE1A 1NX9A 1J2TA 1L1RA 3RBZA 4N12A 3TLZA 4E31A 4ED9A 1K4YA 1KMHB 1P9NA 3M1YA 3P27A 4UM9D 3MRVA 5BSVA 1R0SA 4CLOB 5BN1A 2FQ1A 4UOQA 3U62A 2AOWA 3AHCA 1FDIA 3DPUA 1SIWA 4Z7NB 1DKRA 1HL3A 5CG1A 4RSHA 1IUNA 2HN9A 1GXSB 4G8CA 4KQCA 3WY9A 2YWEA 3BSYA 4B73A 3R5HA 2ZXEA 4NCHA 1FZTA 3GY0A 2BKXA 2PU5A 1XLTA 1UOQA 4LNUB 4UNSA 4RSRA 5FLEX 3RSQA 2R751 1O2DA 4JT2A 1P29A 3VPFA 4WW0A 3WAJA 1IWBB 1WF6A 3AK4A 4OUKX 3EPJA 2QWXA 3QHPA 4GOMD 4UPDA 3URKA 5SZJA 3USZA 5A4MS 1SZJG 2PXHA 3ZCXA 3WA7A 1NAHA 2YS7A 1HT1E 1X15A 3ZDXB 3K72B 4BJ3A 4BFVA 5FFMA 3I61A 4C1BA 1ZX1A 3EZLA 1DJMA 5F7XA 2QHXA 1THMA 2XD4A 3KTAA 4US2R 4DV0B 4DXAA 3IV7A 4KAXA 1JHMA 1I4DD 1ZDMA 2D5IA 2FFHA 4WMLA 3TSOA 1P6UA 4WZBE 4ETNA 3M6UA 1OIVA 5KOJA 3GLFA 2H6EA 2Y9PB 1JIIA 1PZNA 3PNPA 3T7AA 1UEJA 3T4UA 1I4TD 4N7RA 3I9V1 2XUKA 1RIIA 5BVHB 4X65B 3BH0A 4H7KA 1M2WA 3PRKE 2ZWMA 4CM9D 3LPAA 3KQKA 3VYVA 3NP7A 2IBMA 3PC3A 4O4JB 1HT2E 1NVVQ 3LH5A 5JO9A 4TTTS 2X40A 1Q19A 3EEQA 1N32B 3D8RA 4O4HF 3OIUA 3IV6A 1X7GA 1R74A 5CLIA 1TMYA 1NBEA 2WYOA 2GCOB 4KIUA 3JQFA 2ZBFA 4LDAA 3ZHQA 4WAUA 4QBFA 1Z35A 4UBNA 1J97A 2ZJ5A 2X1HA 4NPHA 2CLLB 2FRDA 4OXXA 4RLHA 3SLGA 3BX1A 1VJGA 4C3UA 5JCJD 1MENA 4P0QB 2AC7A 4CRWB 1EVQA 3KYCA 2GF9A 3NBXX 2EFCB 3HCNA 4BNDA 1FS6A 3D6NB 4RK0A 3VX3A 1OU0A 3GRCA 3OCCA 2IH4A 3B1ZA 3EA0A 4FZ3A 4JBHA 2V5UA 2OHJA 3BF8A 1HRKA 4YGXB 2FMHA 1CKEA 4JR0A 5DYWA 4OJTA 3B1XA 4Y18A 2H1RA 4TS1A 3JASB 3UA4A 3ICQB 4EELA 1W4ZA 2W93A 5ADHA 1MOSA 4J3FA 5KPJA 3UGJA 3DEYX 1EWVA 1VLMA 4OBWA 1G5QA 3VZCA 1RM3A 1XZPA 4RKWA 3PPYA 4JT8A 4C03A 2P6UA 3AR2A 3W3AA 5H70A 1G3IA 4O4HA 5E1MA 3ZY5A 2ZPAA 3ZWXA 5EJ7A 1MEOA 3JCZA 4R9UC 4Y67A 4ZT4A 4NAVA 3K1ZA 5JLAA 1H22A 4HB4A 1WDLA 1GKUB 4H18A 4G84A 4KH0A 2PT7A 1GGKA 4RY2A 4F9GA 2QRMA 1FX0A 2P8JA 1R0CA 3CRRA 4G26A 4JQSA 2AK2A 4NDAA 4MWTA 3O1HB 2ZSAA 3FNHA 3OICA 5J5VA 5DLPA 4FGUA 2DBZA 3A1WA 5A0VA 3QPCA 1O54A 1ZNWA 2CFTA 2JK0A 2QGNA 2GBLC 2BAGA 3EVFA 4LYHA 4Q9HA 6NULA 2HU2A 4BO8A 3V7FA 1ISSA 3SWWA 3AV3A 3U4DA 1MJGM 4CG2A 5BUCA 5JMOA 2JH9A 2WYWA 2GAAA 3L4BC 4QRIA 5HOEA 4O1MA 3W7AA 2D2FA 4OFZA 4HUJA 3UWKA 4EMTA 4CJXA 5CFZA 4BQEA 5IK2D 2VBIA 3EZNA 1JFSA 4MLPA 1GNPA 1LZKA 2JGMA 3AUTA 3EWSA 4Q9AA 4RK7A 4WK6A 3NC0C 1FW8A 3VPBA 5LZ9A 4ZOAA 3ZV7A 1CQZA 3QLUC 4CIDA 2Y05A 1HMPA 1L8LA 2A3RA 4YPOA 5DNCA 5FL7D 3GJQA 2G1PA 3GZ4A 1IXYA 4V38A 1T4CA 4UMVA 4KIFA 1VG0B 4JBNA 2JLXA 2XDQB 4KO1S 2H0AA 4JOSA 4RXTA 4QSHA 3FZEA 1E2DA 4KVZA 2PUVA 3RE1A 3RHTA 1KE2A 3TOSA 1ANKA 1JSXA 3BCHA 1E63A 1VBNA 4H1TA 2JNWA 5EMJA 3GROA 2QM8A 3FCOA 3O7MA 3VR5H 2BM0A 2DFLA 1YOVB 1YR8A 3ETCA 4CDGA 4PRZA 2PMBA 3HFSA 3JYHA 3OO1A 3ICEA 4GX1A 1JB1A 1LTKA 3WMXA 1OI3A 3PGVA 4MB6A 2Q1UA 5K0SA 1HTBA 1XA3A 2F1JA 2ECPA 3COYA 5A4KA 1W0KD 2AD1A 5BSFA 2YWBA 4DLYA 3HBNA 5AIBA 5CD1A 1PQWA 5CDUA 3KTFA 4G5FA 1P5FA 2F1HA 5DASA 3RS7A 4J0EA 1E9EA 1BDMA 4DTCA 2CNWD 1ML3A 4KXMA 1XYGA 2X8AA 4HDCA 1D2EA 1ODFA 2FE4A 4Z3KA 4RUKA 4HB0A 4H16A 2OG1A 1WXDA 1UUFA 3U09A 2WIFA 1RQNA 3BORA 4OSPA 1CLEA 5E7JA 4DJFC 1IVSA 2HA6A 1WS6A 2R4TA 2X1VA 1LY1A 2WW8A 3GVCA 4W7IA 5TMEA 1P80A 3SXUA 1KY2A 1OF1A 1W1WA 2LW7A 2QTHA 1XMJA 5AJYA 1QP8A 2GJ8A 3PHGA 3L0ZA 3LDUA 3CUVA 2NNWB 4OK6A 2WIKA 3FOEC 1JW9B 1KU0A 3ND7A 3V6LA 1VG8A 4HQRA 4H7FA 4J4BA 4A2QA 1TX4B 3ZU3A 3I58A 2V6IA 2TRSB 1OXUA 1RPTA 4BTLA 4HAOA 2E4WA 3FSGA 3DZFA 1GYQA 5TS2A 2IV3A 3RLFA 1ZO8A 3Q3GE 3VSAA 1FE8A 1KH2A 3I53A 3LT0A 4G1CA 2NO4A 5DISB 3H4TA 5FDFA 2A30A 1SVOA 2LD4A 1HMYA 1F20A 4PX5A 2Q5FA 1P0FA 3O92A 1PZFA 1Z18A 2IHVA 4PSAA 5A7FA 2O7VA 3WTBA 5ECGC 2C2GA 3RPEA 3IO3A 5EXTA 4QTXA 1TC1A 2ZE8A 2PLRA 3I5XA 3HRKA 4R9SA 1AN0A 2ZB8A 1YB7A 4JXKA 2Q9BA 5G40A 3SAJA 2WF6A 3OBIA 2A1TS 3AKEA 3D2BA 3DMRA 3O8LA 4B6JA 1GLVA 3DAFA 5ALXA 1QPZA 2PWPA 5LPNA 4DLZA 3HU5A 3U17A 1LRKA 4G65A 3OZEA 4RHEA 1FY2A 1XRMA 4XGRA 3KQHA 3LBHA 1A88A 1W5SA 3H9CA 3AWIA 1V71A 4JGBA 3EF1A 2OWEA 5CJJA 3KR9A 1BXGB 3BS4A 2VJLA 3EVZA 5EGSA 1SOVA 3QV1A 1IZZA 3M6IA 2CXRA 3DDSA 3W4KA 2OUKA 4ERNA 1JALA 2E9SA 2AXNA 2FR8A 2HEGA 3DNMA 3H4VA 4I36A 2G8NA 4K9OA 5FQNA 5JBNA 2A8YA 4XYLA 4IUYA 2IEYA 2Z1NA 4H4EA 1OTXA 4Q00A 3O4FA 3T06B 3GFGA 2WSIA 3UAOA 2PMCA 4R1PA 4JBYA 3WLEA 1EM8B 4N0DA 1J21A 1JVNA 3AOEC 4FDUA 4N65A 2BDEA 2IU3A 4YDSA 4CIVA 3FUTA 2GZSA 1XP8A 1JHUA 4US0R 1X13A 2NXJA 3SVZA 1Y3IA 2AOUA 5E7MA 1ZU5A 3L6DA 1KI4A 5DRYA 5EIFA 5AW8A 1KAOA 4I9GA 4LSMA 1AKNA 2HNKA 2E18A 2I22A 4MV5A 1JPJA 3WXBA 3D2LA 1NVMB 2Q5LA 5AW4A 1NRXA 1NMSA 3OECA 5IW8A 4E6EA 1NY6A 2ODBA 3I1FA 1U90A 1G41A 3TM5A 3BK1A 3I6IA 2BCJQ 4IO1A 4OV6B 5LNK1 1RQGA 3DMNA 4GW3A 1JDBB 2WMYA 4AJPA 4YUWA 4ILKA 1RXSA 4O4LA 2BM1A 3ZCRA 3TVDA 4G4IA 4JDPA 1P62B 1X1AA 5HRUA 2YZNA 4M21A 1LUAA 3MGCA 4QL3A 4FX2A 5HPYB 4MGHA 2FX2A 3GGOA 3QKTA 4K81B 1BU8A 1D5CA 4J0FA 3W6OA 1XC7A 5IT9A 4UUAA 1Z33A 4BBPA 2O48X 4IGEA 4DJDC 3DR3A 4DMCA 1WUIS 4CM8A 1P7CA 4D9NA 5JYDA 2NXNA 4QAQA 2A84A 4LZNA 5FUQA 1QQ5A 2IPMA 1UJNA 4II3A 1SC6A 1C2YA 4QDTA 4BO9A 1F14A 1TECE 2QVBA 3C45A 1KI6A 2ZIXA 3PQ5A 1VFPA 1KKLA 3QYFA 5AKXA 2CVQA 1V8ZA 1X19A 5TQ0B 3F7NA 4JT4A 4NARA 4XRGA 3I9LA 1BXRB 1F7UA 2P6RA 4FFBB 1CG6A 1NATA 3VR4A 1Y6QA 4QOEA 2HFKA 5AJVB 5I4IA 1YE8A 1YB5A 1Z5OA 2PV7A 3HB7A 2WU8A 1Q1GA 2XUOA 1W581 2YZ2A 3QHQA 3QX7A 4MO9A 1W93A 4ARZA 4Z53A 1WW2A 2BBOA 3ELYA 3IV9A 3KSUA 4NOJA 2F8MA 2DAPA 3W1EA 4KPYA 1KI6B 4I99A 2J4FA 4J9VA 1ST3A 1HNXB 5F5XA 1XKTA 2CL6X 4GQIA 3F7MA 3VZSA 4EFNA 1OYOA 3FF4A 5KYKA 4I3HA 1IXRC 4OQLA 1LZLA 1PR4A 3HVHA 4HRYA 3A3PA 4OCZA 3N0XA 4ER5A 3ME5A 3FVTA 4UATA 2RIRA 1QNLA 2VAWA 4OOFA 5JCPA 1XEFA 3JQGA 1Q6ZA 2DC1A 1COWA 3KVVA 4P84A 4DAEA 3KR0A 2HTFA 3U13A 5CVVA 3TLKA 2GK4A 5HBGA 3AJ8A 4MA4A 1OXSC 4P3PA 3GLKA 1KFEB 1LI7A 1TGYA 1KAEA 1HYGA 5GGYA 4BMZA 2BTQA 3FDIA 4NE7A 3SQNA 3AVUA 1XMVA 4F1KA 4HGOA 4GQBA 4V2UA 1YGYA 5FAKA 2EOAA 3AGPA 4NENA 4O1HA 1YTLA 4CCSA 2CLSA 4WDQA 1DJPA 4N47A 5HUHA 5ITSA 1EXNA 3TTTA 5E4TA 1EXDA 4F9TA 4RPKA 1F5SA 4N0MA 4F9EA 4GP6A 1XQWA 5A7GA 1DELA 4YUVA 2ZS9A 1DKQA 5ALMA 3EVNA 1EUQA 2A35A 1V95A 2EFHB 2VNSA 4BFSA 5MGNA 1X38A 3P9ZA 3ODGA 3TBFA 4CI0B 1NOIA 2CF5A 5EQFA 2P9GA 1C8VB 4QNMA 4XPZA 1U02A 3O1JC 1BD4A 1K3FA 3T52A 4FMPA 1E7WA 4EAQA 4O02B 2QMEA 5KTKA 1CRPA 2Q7DA 5MN5A 2OXRA 2A2ZA 3D6JA 1YJ8A 1UMCA 3DV2A 1CJCA 3PHJA 3C87A 3T15A 1H94A 2E5FA 3D3KA 5F7ZA 3A10A 1KQFA 3RVLA 2PUCA 5D5PA 4MMZB 4Z6KA 2UZ0A 1M1NA 1Q95A 5FV4A 1BMTA 4D0SA 3CVXA 2A0UA 3BA1A 3GZJA 1KPGA 1QAOA 5AVJA 1X1DA 2D06A 2VOJA 3V4ZA 3TRJA 3ITNA 2Z30A 1P74A 2VJQA 1ZUIA 2ZJ3A 1UBUS 5FORA 3EIWA 1K88A 3ILYA 1D2GA 1Z15A 2UVQA 1ZJWA 3D7SA 5KVVA 5KTOA 5LOVB 5EFOA 3T3IA 4HUTA 4O63O 3T1YB 3UAGA 5DEOA 3ODPA 2YNMD 1ZH0A 2YVAA 3P9NA 3QPBA 1FX1A 1GZUA 1KGSA 3ZHCA 4JYAB 3WLTA 2EX0A 4Y2JA 1P31A 2J31A 4BE9A 5LMNB 2X5XA 5C32A 1WOYA 4LJRA 1RWOA 3DG9A 4RVNA 4FD2A 3K31A 5T4FA 4DMRA 1F4PA 1NR1A 3ASZA 3DC7A 3ML1A 4DW8A 5BNIA 3WYAA 3QWIA 2H2FA 2XGJA 2DHRA 3LBFA 5KYYA 4BEWA 2YDXA 1EVYA 1NQVA 3C5CA 2YJTD 1ESDA 5BNFA 3U3MA 1FVFA 2CDBA 4GI3A 3WDSA 3W8RA 1L8QA 3F6CA 4KMRA 1PEKE 4D02A 4WUVA 3D7MA 1Q7TA 3ELWA 5LNK6 3VPCA 1VE3A 4WERA 4PLYA 4H15A 3RNOA 4I9HA 5A3JA 3OCXA 2QSYA 3GCWA 3L43A 1AGXA 1QC5A 1ZUNB 4AJOA 5HUQA 1IZ7A 3WIEA 5DBFA 3PKIA 3DMHA 2ID8A 1FPQA 1YIDA 3I76A 4JK3A 2O3SA 1FRVA 4K6CA 5I3CA 1B7GO 3D1JA 3PNOA 3O8CA 5HIJA 2V97A 1VKNA 2B1GA 3IIEA 4BNUA 2WLTA 1QOPB 4P93A 4K2AA 2F48A 2F3QA 2YFKA 3HCBA 1XMIA 2ZSFA 4GZLA 3VHXA 3ELDA 1N6NA 3WFIA 2O8EB 2NVOA 3DEZA 4BC1A 7REQA 4G85A 3IR6A 3T5BA 3GRFA 3UYKA 2NTJA 3EDOA 4LHWA 5GADl 1GADO 1XRNA 4RH3A 2ET6A 4F6CA 3P4UA 2D59A 1NZDA 2I78A 3JATB 1QRAA 4MPPA 4M1MA 5EWLA 3M6XA 1PD1A 4DEVA 3CISA 5A5DA 1VI6A 4HLDA 4XQGA 3EPRA 2GKOA 3CM0A 3PB3A 3RQSA 3TPFA 1YZ3A 4P92A 2I2FA 2OVFA 5GOZA 3C5VA 3FWYA 4L6IA 3VJMA 4L28A 4UAJA 3QEJA 4FHGA 2N3ZA 1UH5A 3QPAA 3PXEA 1G5TA 4TL6A 3I8OA 2QD3A 2ZAYA 2F2TA 2OSVA 2WM2A 4YXWA 1X7XB 5I4KA 3H1EA 1L4NA 2J3IA 1OXTA 3R3UA 4BDSA 1M6VB 2ETVA 2JBAB 3PQ2A 5DSZA 3VPGA 4QT4A 2XTMA 4PGFA 4O59O 4DA6A 4E5SA 3E3OA 2QT9A 1I4WA 2R5NA 1JB9A 3EHDA 2P8SA 4IH9A 4Q7JB 4LCBA 3UMJA 5JSFA 4OMDA 5DTIA 3OEHD 1ZD3A 1WO8A 1G5PA 2OBLA 1VFNA 2B2CA 3G0IA 4JLAA 4QYXA 2X4LA 2QRHA 4QPJC 5LYYA 1JLMA 2HF7A 3DZIA 3E5HA 1E64A 5EMMA 3FPFA 4EHNA 4RF5A 2NYVA 3D2CA 4HTFB 3HCRA 5ITWA 1OT3A 1WHSB 4HX2A 2FDXA 4Y9RA 4AXBA 3TEFA 1YJCA 4ZOLB 3OWOA 4OHBA 4RESA 1J33A 1I5RA 2BTQB 3MW8A 5FBHA 1BD3A 4DCUA 2XI4A 4Z3DA 2QUAA 3P2JA 3WRXC 1DG1G 4J4TA 3ZGNA 4ETWA 1TJYA 2O14A 3NDIA 1Z37A 4X66B 2ZRAA 4M1KA 2FQQA 4QOFA 3VZPA 2M6RA 4KQGA 4DQXA 2H1OA 3AVTA 1P8AA 2NM0A 4NC9A 2NU9B 2W2LA 3NVKI 2GKSA 1ZRNA 5EE3A 3WGUA 2C2OA 4MW9A 3O5AA 2DQSA 2LIVA 4E1VA 4MIEA 2Z0MA 2V7QD 1YO6A 3H65A 3HY6A 1DG3A 3WFJA 4ECAA 1E96A 4R2LA 1ELOA 5J4VA 4XVCA 2H1WA 1HV8A 3EX7C 5F7JA 1QO0A 3CUUA 3E7PA 3L4SO 4UCWA 3W77A 3HADA 4B0PA 4CF4A 2VJOA 3CMCO 3M9WA 2OCLA 3U3KA 2QG6A 3CZ5A 3FDZA 2M98A 1N6LA 1C3OB 3Q9LA 4Z9FA 4ZQHA 1SUCA 3W8FA 1IZ0A 1OYVA 1NHWA 3GFOA 3MERA 2ESRA 3MJSA 3WNCA 3ZE2B 4MUEA 1DXHA 2YUIA 1E2UA 2IP4A 3MGBA 3PFHA 2EFDB 4I08A 3D5TA 3GDFA 1WJGA 3ORQA 4MDYA 4OI1A 4E30A 1Z06A 5F5LA 2AEEA 3JVDA 1XHLA 4OOEA 3L02A 6ADHA 4DM4A 2CVHA 1IU9A 1GDHA 4WL0A 3FOFC 1MJFA 1IEWA 1H1TA 3UJAA 4YR9A 4AKIA 2GCGA 2K5UA 1G20A 2Q28A 2OHHA 4LWOA 3GJ4A 3THWB 1Z2DA 2L2QA 5DU2A 1JQDA 2PGJA 4W1SA 1EVIA 4HB2A 4JJ6A 4Z0TA 2AGVA 4BKRA 2Q3BA 4DV5B 4GS5A 1OLSB 4CWAA 1UBLS 3WQBA 2FSPA 2B2NA 1M0TA 4LOHA 1I7LA 3OC0A 3LOUA 1U0SY 4JASB 4NYIQ 4WOBA 2OXTA 3D6MA 4LVOA 4CQJA 4KNYA 3MJCA 4TKVB 4LWPA 1QGUB 3EFOB 4IG4A 4Q1AA 5EE5B 2JFVA 4TQGA 1MIHA 5HILA 2GRJA 5AI5A 3LQKA 1H93A 1MCZA 1SJ9A 1VE1A 1M2JA 3WG9A 1A8SA 1MO5A 1CIVA 1M6YA 2AKAB 1OTYA 1PFWA 3L1UA 4BB9A 3HPRA 3MOIA 2KBEA 3O82A 4PVDA 2IITA 2FF7A 2P3QA 2K4MA 3KQTA 3LBAA 1CZUA 2ENUA 4I8IA 2GM9A 4KMSA 3SKVA 2GASA 3S55A 4QQKA 5AVKA 4AO6A 1DEHA 4ALIA 1IXZA 1CX9B 1JQBA 5JDCC 3GH1A 4H27A 2HFJA 4I50A 3ET5A 4N8DA 1ISMA 4OQNA 1Q15A 2HSZA 2A92A 2W6ZA 4K6HA 3TGLA 1PZEA 3HLKA 4YRGA 5BW8A 1E98A 3OX2A 4OQ4A 4HDOB 4K05A 3TSZA 3CEMA 3UMBA 3WMEA 2VHCA 2CEKA 3F7OA 3GA0A 4HLCA 4G97A 3BUSA 3LKZA 3TG2A 2BCEA 3KUKA 5AKGA 4CNQA 2XB8A 3A32A 4RF3A 2RGNA 5I9NA 3VH1A 3ELUA 3HKEA 4AIRA 3PX2A 3UF0A 3ZV4A 2Q4RA 1DBVO 4L22A 1GAEO 2CXPA 3HSSA 2Q0HA 2O3QA 3K1YA 1FUIA 5K9ZA 5DNAA 3MK31 4P4LA 5F21A 4A0SA 1T0BA 4UDOA 2DFPA 3DKPA 5A9RA 2AZXA 16PKA 3K32A 4NLLA 3ZNPA 5EXXA 2EFJA 2YV4A 5IJ9A 1JA1A 2IIQA 3F0TA 4GDFA 1QSGA 1RM0A 3HMQA 4UBJA 1WETA 1AURA 1HKUA 2PA0A 2C61A 1ZN7A 1OGYA 4II2A 1W2WB 3LWZA 1PLKA 2P9BA 4BJHB 4BN0A 4X00A 4NSNA 2RI1A 4P98A 5FA5A 4BBAA 3RTCA 2VWGA 3IJ5A 4P4NA 5IRCD 4BKUA 1SH7A 4NECA 3ZBUA 2CNBA 2H57A 3C39A 4NZOA 1MJHA 3ESBA 3V42A 4YC7A 4DLVA 4D9IA 4F2PA 5KC8A 4HDQB 1TEZA 2CVPA 1KFKB 5EKSA 5K2OA 3H19A 4B85A 5IDQA 2C77A 1F0NA 3F3MA 4HWGA 4YHBA 3QX3A 1L5HA 1UWCA 1RAEA 1JSCA 4JB2A 1YQTA 5EHGA 1Q1ZA 2HO5A 4ADSG 4AUKA 1Z45A 2G9QA 1TTPB 2GUWA 1KI8A 2W0SA 4M8IA 2ORYA 2ZYUX 3VDRA 3IKVA 1E2NA 3ZU6A 1YBVA 3JQAB 3D54D 2IKQA 3ETGA 3IKJA 2C9BA 3MOSA 2IU0A 1T4DA 1XYVA 4RS3A 5MFZA 4QNNA 1Z73A 3BULA 4X71A 3BZBA 3RVQA 3TNYA 4N5HX 4D43A 1QRUA 4EGQA 3CUKA 5AM3A 3MEQA 3V9AA 1P4SA 1JFTA 5IC5A 3ZE7A 4JODA 3DO6A 3L8FA 4I5GA 4N0EA 5KYUB 4D26A 5EP3A 1Q1NA 4OQXA 3UUFA 3ZN2A 3LTNC 4LQ4A 4F1WA 1BOOA 2R8OA 3I04A 3JQAD 1GGFA 2WHRA 2XVZA 3E22A 4N3NA 1P9OA 2IOHA 4BTVA 3ROEA 4F71A 5BN3A 3RAEC 5TMPA 2IUFA 2ZTSA 1A9RA 1TKBA 3F9CA 4QEZA 3WBJA 1KKUA 4AKEA 3ZYZA 4DMFA 2R79A 5ES3A 5DM1A 5H8WA 1RJDA 3FTEA 2QNRA 4GXTA 2NIPA 3NAMA 1LVUA 4B0OA 4MV6A 3CEPB 5D3MB 3B9BA 3HA3A 3NDRA 4KSYA 4OQQA 5KYXB 3W5BA 5A06A 2R3SA 4K88A 1KTVA 2QIPA 2GR9A 1OFVA 1ZGBA 1EQUA 2VRWA 2H59A 3R3WA 1SBCA 4HAZA 2GJSA 4UNQA 3KKLA 3H6HA 4UUBA 5D7BA 1F5NA 4KQEA 1XAHA 1QDLB 1KI3A 1WDKA 3ADPA 3H75A 5HR5A 3H9UA 2WWVD 1K1EA 1Z2AA 1T5DX 3GDWA 3DVAA 4DY6A 3GMIA 3N8NA 4IR7A 2W2QA 4G1FA 1D0VA 3JQBA 1ZS9A 3EA5A 4YB8A 2VUIB 3T4XA 1L4YA 4HWTA 3K4PA 1RKUA 2ZSEA 2CFRA 2GEKA 4Z9BA 3S28A 2QPTA 4JR1A 2F67A 4DWJA 5JDCA 4R83A 1HLGA 3DO8A 4YP7A 5K0TA 2GCNA 1MF7A 4MW1A 1F6BA 1LJUA 2DLNA 1JEJA 1F2VA 1MAVA 3E22B 3L2OB 4TQ9A 5F4ZA 4LYYA 3G7UA 1JQ5A 4CEHA 2FPGA 4NR0A 3UUEA 4K9MA 3SY8A 1DTWA 2DHEA 4FFNA 2Z4SA 1SUPA 1YIOA 2I71A 4YJFA 3P0JA 4PS0A 3LA8A 3HKBA 3ZVRA 4YMVA 3I5YA 3VOBA 5M04A 3DMFA 3UJBA 1WLYA 1L6IA 4TOIA 4MDHA 2EYQA 3BE4A 1PCXA 1DAPA 4LMPA 3JAMA 3WZMA 2Z2IA 4JL8A 4A91A 5K8IA 3BDAA 3RT1A 4EPVA 1Q1QA 5A62A 1ENZA 2F59A 1K4MA 2YRWA 121PA 3FFXA 2NNLD 1RYBA 2QQEA 3G1TA 2HPVA 2WABA 4EH1A 4BB6A 2DWUA 3AI2A 3PEEA 3JQRA 3S4YA 2P1RA 3U40A 4C6RA 4Q7QA 4C7OA 1LKZA 3NT2A 5KUTA 2WPNA 2F1OA 2VAPA 1XD2B 3EF3A 3GI1A 3R6TA 5IX8A 5KBYA 3SIRA 3AFNA 4BE4A 1P44A 1N7IA 3EQZA 1LW6E 3T6KA 1MOZA 4AN4A 3QFHA 2ODWA 1LI4A 1ZMXA 1FU8A 1XVAA 1NMXA 3JVUA 4XVQA 1BRMA 1U7ZA 1XCBA 3A9VA 1EFLA 3NH9A 3CUYA 3CXUA 5DHFA 3WNDA 2NPOA 4XRRA 1E79D 4PG7A 4QHYA 4DLSA 2ASVA 3TEMA 4X90A 5T3YA 4EG7A 4XB6B 4RLSA 3K0CC 5FOQA 3HM9A 2Q3EA 1F2TB 1N9GB 4CKXA 4NK5A 2R44A 4QXPA 3UOGA 3THXB 3T3NA 4V0RA 5CFPA 4ZXPA 4LTNA 4MKZA 4IIHA 2Z8YM 3KWLA 5EHQA 3NYWA 4RCYA 2FUG6 3NFRA 4PHFA 3VX4A 2RJ3A 4TSRA 3B6IA 2IHYA 1LV8A 2IEAA 3U1BA 2XQVA 2CXXA 3ADOA 3IA7A 4H7HA 3EZGA 1LDEA 3X1ZA 1AG9A 1K0FA 5M2QA 4M8KA 4XW2A 2PCJA 4R2JA 3UJHA 1ZI8A 4OJQA 3MTEA 5JJ5A 4COOA 1NFQA 1HETA 4DWWA 3E5RA 1TO1E 2OD9A 4OG2A 2X8JB 1A71A 1BTOA 1NP7A 1SCIA 4LMRA 2IHZA 5EKXA 1AA6A 3U61B 4P0PB 2VS1A 1CZOA 1KMHA 3D3WA 1DXYA 3HUEA 3N2NA 3NUGA 3STXA 4P7JA 4OKIA 3OLZA 4YAWA 1Y3CE 1GUZA 3VC2A 2IODA 5G3YA 4C4RA 3OQJA 4P4GA 4LRYA 4IEEA 2BKEA 5DCYA 4V1CI 1L2TA 1HNNA 1T8RA 2ECOA 5GGXA 4KITB 5ELLA 2F43A 4E46A 4PSDA 4KDFA 2R0QC 2Y71A 4TMFA 1QTRA 1SD1A 3GVXA 1O03A 2C7RA 1F6DA 3W7BA 4UCFA 2Q4TA 2WB2A 4G5GA 1J22A 3EVBA 4CT4B 1YZYA 5ER6A 2ODNA 3LT1A 3I6ZA 3PR3A 5EXDA 2J07A 3N0WA 4PZEA 2G88A 1IWPB 1R5BA 1JHDA 1R8SA 1Z5VA 2R1TB 3ASYA 4RA6A 3RKRA 3WK4A 1Q1BA 3ROFA 2H0QA 2JLUA 4N5LA 1NNSA 2O50A 3DD1A 5FL7A 3WOHA 1QH1B 1LA2A 1RAFA 2PAFA 3SE7A 3VVBA 4KG7A 3BWXA 3RC8A 3SC2A 5K0CA 1M8PA 4C29A 3B1YA 5BRNA 1ECCA 3Q9UA 2VUUA 4MV7A 4WDRA 2XMSA 2NU7B 1ORTA 3OPYA 4LJAA 4CMJA 3ZDEA 1O8BA 1PGNA 1LPAB 2W4IA 2Z4RA 4IVRA 1GZSA 1OBHA 1Y7TA 3IXMA 3G2IA 2GDZA 2OORC 2GD0A 1AHNA 3R0IA 2N46A 2OV2A 2YZKA 3ZOZA 3HDTA 1RQPA 5T64A 5BXYA 1CRWG 1XN4A 4Z0NA 1SVIA 1XP5A 3L04A 1DHTA 4BJ6A 3EIOA 3FY4A 5F78A 1JHVA 4UHHA 2R6R1 3H2HA 2AMJA 1T5OA 2EL9A 2QTCA 3KSDO 5LUBA 5ITZA 3TGPA 4PLWA 4M38A 3ZC3A 4K8RB 4ZAVA 1NWCA 3CNEA 2I7XA 5AHWA 4PZZA 3CVOA 1II0A 2I2AA 2OBNA 2JLVA 3RLIA 1ZY2A 3GLHB 3HN6A 3ASVA 1NVVR 3UK1A 1O4VA 4L2IB 3DWEX 1AGPA 2DHCA 1A69A 3VI4B 3UUWA 5LD2C 2CNWA 3RSFA 3IQXA 1W6UA 4NCKA 3RRZA 2O2EA 1KXJA 3CS3A 4MVJG 1VL2A 3I9V6 5IKMA 3RBVA 1IULA 1DPFA 2OD2A 3E3LA 2QX9A 1OBFO 4M8LA 1PX0A 2JARA 2VJMA 1Z7YA 1J9ZA 4DNOA 3T5AA 3G0HA 4EUNA 2HNBA 3M4ZA 3ZQ4A 4EVRA 5CLFA 3L4BA 3REOA 4OI4A 4QQNA 1DBPA 5E6RB 4ZO7A 3OKCA 4OK3A 5FULA 3FYCA 5CJ2A 1NDQA 2ZUTA 5FA8A 3QVGB 2I6SA 2XMPA 5A9SB 5IHPA 1Z38A 4WN9B 4ECEA 2Y1XA 2N1MA 4WA8A 2CCKA 1JAYA 5CG2A 3CSDA 3MXTA 2O2ZA 4ARZB 3IP3A 1JSRA 1GQ2A 4X0EA 2PUAA 5AH0A 4WBNA 1V11A 2W6ID 4DDKA 3FTCA 3HR4A 1P4GA 5IK2A 5DTQA 3KQNA 3H18A 5CYFA 1KFJB 3DPIA 3K0KA 3ANTA 1WZNA 3D64A 4ZEVA 4FPXA 1EE2A 4L51A 2XVYA 1Z82A 2HRBA 5FWXA 2F1RA 4FIZA 2YH2A 3D6VA 4P82A 4GKBA 1O3YA 4Q4HB 2CHQA 4E4YA 4XGNA 4JXXA 3T3PB 3I30X 4EUSA 2BMAA 3K9HA 3PNQA 3JYOA 1FRNA 1P2VA 3H05A 3HKDB 4D3XA 3L7DA 5C8VA 3WDKA 2HBRA 7REQB 5FPKA 1J9EA 5F76A 4BC0A 1GT91 2V7BA 4UBKA 5G41A 2IWHA 1XZJA 3NJRA 2P11A 4PAQA 4H7DA 1JHRA 1G0OA 1O94C 4GU5A 2JCGA 3GO4A 3DB2A 1XJWA 2JGAA 3WRYA 4PLFA 5THXA 1KYWA 3TLGA 2JLQA 3KP1A 4IRXA 5EKTA 3Q5GA 5IG2A 5LWQA 4DR4B 4QEDA 1P4RA 4W4TA 1T2FA 4NENB 1L5LA 4PC7A 1A5TA 3KL2A 4Q39A 1BHQ1 1ZN9A 3RVRA 1U28C 2AR7A 2W2TA 3C6QA 3ZCSA 4YACA 2PZLA 1XZKA 1KU6A 1M3SA 2CJPA 2XOKD 2HOQA 4GNRA 1GRQA 4PG4A 4CFYA 5DP2A 2IQ5A 3NVDA 4PE5B 4RADA 1OXMA 2YWFA 4NU8X 2XNKA 1Y3DE 1OWMA 4LGCA 5H59A 3K16A 1ULZA 4MUYA 2C9DA 2OLEA 4JUBA 3VSCA 4HWKA 1KY5A 5D3ZA 3KHTA 4S05A 3C1UA 1PJ8A 1ZCZA 3WK9A 1U7TA 4JUFA 1M8JA 2I03A 1THGA 2B78A 4PBRA 1A9TA 1S9DA 2EZ4A 2JJ1A 3PC7A 4IXWA 3THXA 5D6NA 1H9AA 3BYZA 3EQ7A 3H83A 3VHRA 1C7FA 2G36A 3L6BA 3NC1C 1ONSA 4YCMA 4ZCPA 1HOTA 4LWZA 4LF7B 1GM5A 1NKSA 2Z2KA 3TK1A 2ZDHA 1U3TA 3ETDA 1YSCA 1GUDA 1C3EA 3U7HB 2ERYA 3KV3O 2OMKA 3L1VA 5ALSA 3E4DA 4D96A 3R40A 3SI7A 3W1VA 1ZMTA 1Y1RA 1P3Y1 1QGUA 3EFOA 2MDTA 2OGZA 3EXHC 1T9DA 4IX9A 4FOLA 4NRDA 4CDNA 2A1UA 3B3GA 2DE0X 1OYWA 4RTOA 3MWDB 3NBKA 3P9XA 5HKLA 1JAZA 3OHPA 1ULUA 3RIEA 4JI8B 1KFCB 2YXNA 2ZVDA 3H6GA 4FD3A 4XKJA 1SC4A 4CGYA 2GPSA 6Q21A 2XODA 2UYOA 3G8BA 2OCXA 1NIPA 3JR7A 4B7CA 1VE7A 4MMXB 4RZUA 1TD9A 2FEOA 4B7AA 4LMAA 1ZUD1 2D3WA 3BHJA 3H5VA 2XEXA 1M2NA 4F1JA 2G28A 4B3BA 2VN8A 3QYPA 5AW2A 4Q82A 1ZR2A 1PJ2A 3FJ1A 5F7OA 1POWA 1YRBA 1YMQA 1X7WB 4FT2A 3WYCA 5JV5A 2B4YA 3U56A 4Y9TA 3GLUA 4YDHB 1HDIA 4OX9Y 3AONB 4X7PA 4I46A 4FE7A 3W8EA 2R8YA 4HDNB 4XWOA 5MN4A 4F8YA 3HYTA 2X5NA 3KU1A 1Q57A 3FMVA 4F6RB 2YN0A 2GK6A 3AVPA 1M2GA 1PZGA 2HB6A 3F4BA 5F2OA 1IMOA 2OGUA 4O0MA 3RFCA 3MN1A 2JANA 4IDGA 4MEBA 4MWEA 4X1OA 1TYDE 2R48A 3LX8A 2JRLA 3MOGA 4PANA 3O3CA 1U0EA 5FOVA 1LDBA 1N5RA 2C2HA 2GHQA 4AS2A 2UUCB 1ZH8A 1QH1A 1Z5PA 1KEEA 1E94E 2ZYVX 5B3KA 1U5BB 3GLGE 1G16A 3SBOA 1RBYA 2OXFA 1G7SA 2ZCVA 3M4JA 2F64A 3EVDA 4B2YA 5HJEA 2J30A 3LCVB 3C3KA 5K3FA 1MB3A 2R8ZA 5ALWA 3UMVA 1HF3A 1E1QD 2AFHB 1WV0A 2AOTA 2HQ1A 4KNWA 4QDKA 1GZ4A 1COWD 5E8JA 4ZT5A 3HP1A 4EHLA 1T0UA 4LJSA 3HY3A 1IN8A 2V7PA 2VBGA 1XYYA 3HBAA 4O4LB 1DJOA 3TAXA 4YRNA 6CHYA 2C83A 5CT6A 3RG2A 1X8KA 4TYPA 3HGTA 3D31A 2OMEA 4YJ3B 4D4GA 2OQIA 1QVAA 2F43B 4R0VA 2E82A 4J1SA 4EI7A 1Z4NA 4KOAA 2AJTA 2WMOB 2ZYIA 4MUAA 1R8XA 1VSQA 5DYYA 4ZZ3A 3NIFB 5JALA 2DTEA 2Y77A 4LDNA 1PZXA 4TYMA 621PA 1PN3A 4MHSA 1S3SA 3GARA 3O3NB 1ONNA 1ZJ4A 2DECA 3JASA 5DM0A 4E32A 2VA9A 3OZXA 3CW8X 3FMPB 3OLQA 4IDQA 2GAJA 3Q4GA 5HZKA 4LFBB 3WLRA 1CK4A 3PPVA 3HCFA 4K7JA 1CUXA 5EMNA 4D97A 2EW1A 2IL1A 2B92A 3BD7A 2J08A 1STOA 3M6AA 2AI3A 1Z5NA 4EW1A 5DBHX 3FMGA 2IYNA 2AN5A 4MAFA 4LK2A 4CTMA 3SN6A 1V4NA 1DC8A 4EUHA 2IS2A 1D7AA 4ZODA 3GPLA 2EERA 4LRQA 4QVKA 1AZWA 1RZ3A 4FR2A 3F8TA 1MABB 3LP6A 3VZRA 4EQ6A 1LLUA 4G1MB 1BX0A 1RQXA 2X8BA 2Z2YA 2O6HA 3AO0B 4PZUA 4WKGA 3U3OA 4ENSA 1G6KA 3WIVA 4MQ5A 1YDGA 1N8KA 1XZLA 2ZIEA 3FLEA 1WD5A 1ZSNA 3LAWA 3WWYA 3PNVA 3WLPA 3ED1A 3BIWA 3WL5A 3AIKA 3GLFE 3RH0A 4IGIA 4HDSA 2JIOA 2X0JA 3BD6A 1MABA 1G63A 5KSWB 2J41A 3RJTA 3NTQA 5C7OO 4O6VA 2NUTA 1FU7A 3BJZA 1H2EA 5K2MA 4CV1A 4MW5A 2HT1A 4FUTA 4AY2A 3KSBC 4JB3A 4QBKA 3ROMA 2W43A 3OFJA 5D51S 5HG0A 3KE8A 4ZZIA 2D13A 4P53A 4Q6BA 4WZAA 5CH5A 3KDPA 2AOVA 3PQ4A 1QMPA 2WF7A 4XLLA 5B6PA 1BKDR 4NBKA 4YRQA 2P5UA 5DM70 2FW6A 2C8VA 1F8FA 3FDZB 3JQ9C 3UCXA 4Y9UA 4CFSA 5JS2A 4PPNA 3NWBA 5ALHA 3QWBA 1YBAA 3KKKA 4ZT3A 2NLOA 1EZZA 1O5IA 1GILA 2X8JA 4U4AA 3EUAA 4FYWA 1XJ5A 3GU3A 4LY0A 3UVEA 5DWDA 2AYXA 4QOGA 3SKXA 5DNUA 4H6XA 2FYTA 3RC7A 3RI3A 2RHMA 1VQ1A 4MLDA 3VR2A 5U1PA 3RR2A 1OIWA 1REQA 3AM3A 4AMUA 1J42A 5G0UA 1FB5A 2V54A 3ECAA 1UZNA 3A1SA 1YZHA 2JHFA 1NN3A 521PA 3CVJA 1YAJA 4Q4AB 2A5JA 5AKHA 4IJ5A 4Y98A 4HQLA 3CY6A 4UHJA 5ALNA 4XWYA 1J7KA 3PDCA 4WI1A 2CZQA 2D54A 4NYJR 1PK7A 4HDSB 3B6JA 4P9NA 2BBSA 1BROA 1DO8A 2P9JA 2VLIA 3HCCA 5ANRB 3UV7A 2GN4A 4UNRA 3ZVNA 4AAYA 4NCJA 1XQ1A 2WYUA 3A6EA 1P2SA 5JO0A 5ALDA 1HLDA 2BMWA 2RAPA 5HKKA 1XOIA 3R7WB 3LPLA 3OCZA 1FTGA 1UM9A 4Q18A 4BNDB 2VJNA 3OJWA 5G4KA 2E4AA 1P0CA 3DHWC 5FWXB 2VRCD 1VP3A 5IAKA 3HYLA 2OQRA 3QMMA 1ILEA 1GSIA 3MJHA 1MC1A 4C20A 2KQUA 2QJTA 1P6XA 4NS4A 3SMVA 1NI4B 3OLWA 4WK2B 1DAHA 4OAQA 4C07A 4F0JA 2ZJZA 1W49A 2JHAA 2YOHA 5JZBA 5BXQC 4MRNA 3LLCA 3AVOA 4ZWNA 3SG0A 3V8MA 5AVRA 3ONNA 4MW4A 2Q6IA 4PYIA 1PKEA 3ZTWA 5FI5A 2GZ2A 2Q5JA 3HBMA 4KV7A 3GK3A 1GGVA 4TWIA 3Q11A 3H1TA 2D3TA 3NTVA 2A4KA 3AUAA 3ANSA 5TQ2A 1G3MA 3PNSA 5JD6A 1WMFA 1DQZA 4Y8VA 4TUYB 4LXHA 2JJ1D 3Q9NA 1M0WA 3OEHA 1QP7A 1V8OA 1WA5A 1ZJJA 1VMDA 1F38A 4E5UA 1XJ0A 3TJRA 3WV5A 3CKMA 3REQB 1XMOB 4DABA 1M8FA 3UK2A 3VC3A 2WUGA 4IZIA 4M87A 3T4EA 4ZANA 4N4AA 3KBOA 3DEKA 1NPTO 2Z09A 2JG3A 2WD9A 3CX4A 4U7GA 1DQRA 5L4NA 3TECE 2BGTA 4PXAA 5I01A 3NAGA 2VP2A 4P3OA 5A1TA 3E9EA 2CXSA 1P7WA 4JEIA 1PGQA 2W2XA 4EPYA 3S3TA 4AMYA 3WADA 3C8ZA 2XNSA 5B30A 5DLYA 1CF2O 1QYRA 1UODA 4BMOB 4PGHA 1TAUA 2EG9A 2RHTA 1CIJA 2A9JA 3G5LA 3QBTA 2EJCA 3UGTA 2IOQA 4FJ2A 3G68A 1YQXA 5IJWA 1UOPA 4GKKB 3DOOA 1R10A 5LCXA 1SC3A 4MB0A 5BSEA 3MCWA 4HHEA 1Q6YA 1OX6A 1U7UA 1QHEA 3TB6A 2SCUA 1L5RA 1R88A 1QV7A 3L7LA 1A4IA 2BY4A 1N2EA 1PYOA 5TF4A 1ZJZA 4DC0A 1A9YA 1T3SA 2OORA 3O1IC 4H0CA 2ZCUA 1JR6A 2B69A 1HG0A 2Q1SA 5KNCA 2QN9A 1RIFA 2ZBUA 3BAFA 5JNUA 4G5HA 4LEIA 4BLUA 3PC8C 4P58A 3PHIA 4F4JA 4R05A 3MTAA 1XL0A 3FFTA 3SIWA 5G4LA 2C9OA 2XDAA 2PTHA 2ZTLA 2AQ8A 4B4DA 3TLGB 4RHFA 5BMVF 2FSUA 3HB5X 3D1LA 3KQOA 3JQ9A 1P2UA 4KXLA 4XQ9A 4CODB 3V1UA 5BW5A 1U0RA 4QUHA 4LHEA 1C29B 1JDUA 5B1IA 2ZRGA 3C8HA 2PKQP 3EGOA 2H29A 3JARA 3IILA 4PFQA 2XXJA 3T7DA 5FLXA 1HDYA 1U9IC 1YVEI 2V4MA 5FR2A 1FRFS 3DCJA 2AYYA 1Y37A 4TTAA 3K6SB 4ZICA 1QJ4A 4LXQA 1RRVA 2ID7A 4HDRA 4M7RA 2ZJ2A 4OF4A 1VHTA 5JAZA 4F9FA 3EMBA 3PQ8A 3FAZA 5AJUA 4UTPA 3ESDA 3OETA 2G7ZA 4KGDA 3SHTA 4KXUA 3R9IA 4DQVA 1HE4A 2PBFA 3GJXC 2PUGA 1UQUA 3CLHA 4BLPA 4YV2A 2QGFA 4D3ZA 3T7KA 4V0MA 3KQQA 1KPHA 2RH5A 1L7PA 1OSNA 1TUGA 3L8CA 2IYLD 5EWLB 3SS7X 3T0IA 1M6WA 2WFMA 3EGCA 1V39A 1FLAA 1PQPA 1FYEA 4RNCA 2V58A 5DGDA 4NBLA 5DTEA 4CM8B 1M1YA 4UD2A 3TN7A 3L8DA 5CAEB 1WV1A 4IVQA 2BFWA 3OJCA 2RGAA 1FMCA 1FC0A 1XXHA 1YBHA 4ROSA 5EE1A 3NATA 3VSEA 2VDUE 1A8PA 1G6OA 3I64A 1GCGA 2WI8A 3O74A 5DTMA 4BU0A 1G1AA 4EFDA 3HHEA 3W9UA 2GESA 3LHIA 3WNVA 4JI3B 4MRMB 1IONA 1YHNA 3ETHA 3MWGA 1DKPA 1U1IA 1Z6TA 2AFRA 2J8ZA 2W8ZA 1NW8A 1ZHFA 5IVIA 3UV3A 3AU8A 1CQJB 1Y4SA 2QN2A 3PLNA 4IGFA 4X1YB 4R7GA 1MNAA 4WKNA 1IDN1 2I7TA 1R6XA 4HEJA 4UEJA 3WMFA 5K7SA 3HUUA 4IDBA 1LWNA 5GJBA 4JJ4A 2HWKA 4OXIA 2QT0A 4I5FA 1LJLA 4E3ZA 3H8JA 4UDYX 2CHEA 4B48A 1V7ZA 2D0PB 3HO8A 4DPKA 5JD5A 1Y81A 5TNXA 1FTQA 2DMRA 5BQPA 2Y1OA 4Y0AA 1QPBA 2XOKA 5K6TA 2PKXA 2B0CA 3HKCA 3JZMA 4QT0A 1IL0A 1K9VF 3GGDA 2GERA 2FE1A 1E1RD 3AOEA 2VT2A 4YIKA 4C0WA 4GLLA 4ND8B 3JX9A 4RGVA 4MP8A 5E9WA 4D0GA 5KNBA 1Y3BE 4UU1A 1E18A 2AB0A 1T35A 1FRZA 1EM6A 5KQSA 4K87A 1YL5A 3WMRA 1SWWA 5T6BA 1JYEA 4YRCA 4AJNA 1TZ2A 2PD3A 2QF7A 2AKYA 2II6A 3QVUA 3S44A 5IKPA 3AIIA 4A16A 4OGWA 4I4CA 4S2UA 3QSYA 3KSZO 1SXHA 3A8TA 1JJBA 5JECA 2HCBA 3U6BA 3MUNA 4GKJB 1G8MA 1TW2A 3ZVLA 4QTYA 4LQDA 3AT1A 5G0VA 4D81A 2SECE 1FUEA 1N2JA 2GBCA 2XWQA 1IY0A 3WRWA 5JXIA 3I1YA 1CRZA 2RKBA 3NHFA 2P2GA 4MQFB 4CM1A 3G0DA 4FUQA 1AVTA 4UU7A 3IALA 4WXEA 4WLOA 3RYIB 4B3GA 5TIIA 5KYGA 4PIVA 1LBTA 2Q50A 2JBAA 1P7PA 5FNVF 2X9NA 5DIFA 5SYNA 3CYFA 5ILQA 2PLAA 4Z9AA 1OE0A 1WP9A 2YRXA 3VKHA 2J48A 1CJTC 1DCMA 3V55A 1JBKA 3N6RA 2PIDA 4R98A 4JENA 3UJ9A 2P6PA 3G9ZA 4G9EA 1KK3A 3ANLA 5JPIA 4DMMA 2OV1A 3K9FC 4ZJYA 4UEOA 3KUDA 1BN7A 5LM3A 1SXJE 1UXIA 4RA9A 1WF3A 3O4GA 3H0KA 4KYTA 2G4VA 4B2IA 3R5XA 4BO6A 3LPNA