1O96B

Structure of electron transferring flavoprotein for methylophilus methylotrophus.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
318
structure length
314
Chain Sequence
SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSRPIADAGWLPKSRQVGQSGKVVGSCKLYVAMGISGSIQHMAGMKHVPTIIAVNTDPGASIFTIAKYGIVADIFDIEEELKAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
publication title Extensive Conformational Sampling in a Ternary Electron Transfer Complex.
pubmed doi rcsb
source organism Methylophilus methylotrophus
molecule tags Electron transfer
total genus 88
structure length 314
sequence length 318
chains with identical sequence D, F, Z
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
B PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1o96B01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1o96B02
3GLVA 4MUFA 1O0CA 1GAXA 3QTBA 2WVHA 2OD7A 2QQFA 1T6ZA 1PTJC 1GLNA 1IVSA 3LE8A 5K6RA 1O0BA 3G5AA 4K9LA 1T9AA 3GLRA 4DE5A 4MPJA 2FR8C 2B7LA 4J76A 4MLPA 4K9PA 3X1MA 3PKIA 2HJHA 1H3FA 3ILVA 4JFAA 4K0RA 4HJXA 1JILA 3ZXIA 2HMAA 4EFKA 4EGAA 2BRUC 4TWIA 3GLTA 1Q17A 1N78A 4E1AA 1K92A 1JIJA 3N05A 1M2GA 1PT9A 1NUUA 5IHXA 3CLSD 5IMSA 3Q12A 1YC2A 3M5WA 3SDBA 5K2OA 1D2RA 2J5BA 4X0EA 1J8FA 3EY9A 4G5FA 4I6EA 4Y6QA 1WQ3A 2Q5QA 2J09A 1PYDA 5K0TA 4EG4A 1WQ4A 2X7JA 4Y6LA 4HK4A 4ZP1A 4YP6A 1U0BB 1KH1A 3RFFA 2V3WA 2H2AA 3K32A 1YTLA 4MWEA 1T6XA 1GTSA 3GLUA 5FNZA 2XRYA 4H3SA 3SYTA 1E3TA 2C31A 2CUZA 2QUHA 3RIYA 3DLAA 1YI8A 4RMHA 1WXHA 3HMQA 4FEGA 2X0KA 4GPEA 4K9OA 4J1TC 1O94C 5DEOA 5DASA 2QTMA 1EXDA 4JU9A 3ND6A 1TYDE 4MW0A 5K6TA 1R6TA 1VBNA 4MVXA 4F56A 4OJMX 2HZ7A 1QRSA 3H05A 2J4DA 1TYAE 4JUDX 1LW7A 4RJJA 1H1TA 3K9WA 4CDNA 1Q15A 4WNYA 5BWLA 1Q77A 1UPAA 4S1OA 1OZFA 4GM1A 5H16A 3RBAA 4BVHA 1O95D 1N2OA 1KQNA 2CV2A 2G36A 4MWCA 3PXUA 4ZT3A 2E21A 2DEUA 2QQGA 2VTBA 5JBNA 1ZH0A 3FHJA 2VTBB 5MF6A 4EG1A 1IQUA 1MC1A 3HWX1 2R5WA 3U3DA 3C8ZA 4MUJA 4MULA 1UPBA 2YWCA 3IOCA 4UTNA 1G8HA 5TEVA 1MRZA 2X3FA 1N2GA 4UTRA 3FOCA 2A88A 4BVBA 2H2GA 1LI5A 1M2JA 3IOBA 1M2HA 4KR9A 3PDHA 3D6VA 1MCZA 5FEMA 4AQ7A 1WKBA 2JA2A 3I05A 3QE4A 2Z08A 3LCJA 3SP1A 3D81A 1MA3A 2J07A 1V5FA 4TS1A 1KAMA 1N2BA 3H9BA 3IDFA 1N2EA 4QQ8A 3E27A 2GOYA 1ZH6A 2CFOA 3IMGA 3RHSA 1QU2A 5DGDA 1MJHA 4QREA 3UY4A 4GM0A 1SZCA 1U28C 3RK1A 1K4MA 3IH5A 1Y42X 3SZGA 4MUNA 3QTTA 1PFUA 1V5EA 3ZGVA 4MVCA 2QJFA 1PG0A 1Z8NA 2FRDC 4JZYA 3NBAA 1JIIA 1PNQA 1O97C 2JI8A 3KT6A 4MW2A 2IHUA 5EJ9A 3F3MA 3FDXA 4O8ZA 4U7JA 1U3DA 1N1DA 1DJLA 1S7GA 3SEZA 1EFVA 4UTZA 1XNJA 4ZCTA 3GUZA 1EFVB 1PFWA 3CVYA 3CVUA 4COKA 5FO0A 1Y9DA 3A2KA 1FYDA 3IAFA 1NUSA 1IH8A 4MWBA 5TGTA 1IQ0A 3G6KA 4EG5A 2DLCX 1PNOA 3CLTD 3UK2A 4R2LA 1VBKA 4I6GA 1T6YA 1HYBA 1U7DA 2H2FA 1ICIA 2A1UA 3ZG6A 4IG9A 2JLAA 3ZUGA 2FSVC 2J08A 3KT0A 2A1UB 4MW7A 1J09A 4JUCA 1QU3A 4MUKA 2CSXA 4MW6A 3UOWA 4JXZA 4X3PA 1ULHA 3U31A 5EJ7A 5FYQA 3IUEA 4JUAA 3AIIA 5EJ6A 1GN8A 3H9CA 1TQ8A 3KFLA 1EFPA 1MAWA 3MLAA 3TZLA 3JR3A 1EFPB 2QJTA 3CLUD 3JXEA 4HJRA 2CT8A 4ZZIA 1OZGA 1POWA 3HV0A 2EL7A 1YNOA 3D4BA 4K03A 1GTRA 5FO1A 4MPRA 3LQ1A 3CLRD 1BS2A 3G59A 4L2IA 2PXHA 5F23A 1KKUA 4L2IB 4CT0A 2JIBA 2VXOA 5LFAA 2EZTA 3FG9A 1X6VA 1F4LA 4RMIA 4J16C 2YWBA 2CYAA 3COWA 2GKSA 3CVWA 5MFPA 2PGOA 4UTVA 4JSRA 1NUPA 4NX2A 3A05A 1EJ2A 1TYBE 2C5SA 1MBZA 1WXEA 3SZ3A 2GM3A 4F4HA 1KORA 1NUQA 4DDKA 1WJGA 4DDHA 3COYA 2WQ6A 4RMJA 2AG0A 3X1JA 4MW5A 4ARIA 1YBHA 5EJ5A 1XJQA 2NZ2A 1ILEA 1U2GC 1N2HA 1ZUNA 2B4YA 4NZPA 3HZRA 2DUMA 4ND7A 1T9BA 4GRIA 1XLTC 2PZBA 2WSIA 1I2DA 2O8VA 3IVXA 1OD6A 3AG5A 1OWMA 3PRHA 4Q16A 4DNXA 4MUIA 3S3TA 4ZT5A 1M8JA 4KGDA 1B6TA 1N77A 2A84A 1WZ2A 4QELA 3FH0A 1WXFA 1LI7A 5HG0A 4Q9DA 5KCMA 4NDAA 3VGJA 3CVVA 4UTXA 3OP1A 4BWVA 4EG8A 4BV2A 2NYRA 4QPZA 1NZJA 1TEZA 4QRDA 4MQ5A 2VBIA 2DXIA 2VJYA 3MXTA 1WXGA 3N8HA 4XFJA 4UUAA 1VL2A 4ZCQA 2A1TS 1T9DA 1KH2A 3IVCA 3IAEA 5EJ4A 3RJZA 1T9GR 3Q4GA 1EUQA 3CF4G 4C7BA 4R0NA 5J58A 1JEDA 2CYCA 3ND7A 2AKEA 1KP2A 5MFZA 4L3OA 1VBMA 4MW9A 1QRTA 2DETA 3CVXA 4ZT6A 2PFSA 5TS2A 1I6MA 2D5BA 4GU5A 1H3NA 4EG6A 2DJIA 4JD5A 4A91A 2PZAA 3D6UA 3ZGOA 2FN3A 2EZUA 3FWKA 1EUYA 2W93A 3NBKA 2IJGX 1BFDA 1YHZA 1M8GA 3INNA 1M2NA 3IMCA 1V8FA 3JWPA 1NM5C 4EF6A 4IAOA 5TEWA 3DO8A 1Q14A 4MVWA 3E9YA 4G1CA 1QNFA 4I6JA 4FEEA 4K9QA 5BWNA 4AS1A 4KPUA 1YUMA 4KPUB 1ZPDA 1G8GA 1J1ZA 4ZT7A 3CA8A 2CV1A 2DERA 1OWPA 4MW1A 2Z3VA 2AG1A 4JU8A 2QUIA 4RJKA 4YBRA 1QQTA 3HFJA 3CLSC 4RUKA 4X3OA 2HGZA 1N2JA 2OD9A 2EJCA 1O94D 4MUEA 2V0GA 4K9KA 4GM4A 2DPLA 3ISJA 3GMIA 4PBRA 2VK4A 3EA4A 1QRUA 4FZ3A 1PFYA 2NSYA 3A04A 1MOPA 3DV2A 2H2HA 2YXNA 3N9IA 3U1VA 3RIGA 2Q5JA 1M1ZA 2WQ7A 4ZCSA 4MW4A 5EJMA 1A8HA 1KR2A 3IOEA 1OZHA 1U3CA 4C78A 1PVDA 2E0IA 5LM3A 2A7XA 2CV0A 4JXXA 4R2MA 2X1MA 5EJ8A 1JEEA 5AHKA 2JLCA 1O5TA 3MMXA 4NAUA 4PBSA 1PI3A 4ND6A 1U31A 4KKVA 1MB2A 2PIDA 1MB9A 2H59A 1Q6ZA 4FZJA 4DLPA 3ELBA 4ARCA 4R8MA 3ZJTA 4BN4A 4F3RA 3NV7A 4JT8A 1NSYA 2AG6A 4MAFA 4Y6OA 3FZNA 1F7UA 4GP9A 5DEIA 2JI7A 1NUTA 3FNRA 3TS1A 1O6BA 3UC5A 4QBTA 1UFVA 2VBGA 1WOYA 4HDAA 2WB2A 4G5YA 2AZXA 1M83A 3F6BX 1OBCA 5DGTA 3PNYA 1GPMA 2JI9A 4I5IA 4BVFA 2H4FA 1FFYA 5HUHA 1PG2A 3SEQA 3TQIA 2H29A 5HUJA 3ZGZA 1HZZC 3AG6A 2TS1A 3FIUA 1OWOA 4ZT4A 4KR6A 2H4JA 1N3LA 3IODA 4UUBA 1NYLA 3H99A 3VRHA 4Q93A 2D13A 1QTQA 2OD2A 2OORC 2PANA 5MGNA 2JI6A 2FWNA 3ZJUA 1YIAA 1N0HA 4P2BA 1IFXA 1YIDA 1O97D 2IP1A 5KHAA 2UZ1A 1Q1AA 2UZ1B 2BTEA 1JIKA 1OVMA 3BL5A 1NI5A 1PFVA 3X1KA 2H4HA 5EJAA 2ZUFA 1RQGA 1K4KA 2JANA 2QUKA 1M8FA 4V1CA 4ZT2A 1G59A 5J5AA 1IQRA 2D54A 2WVAA 4V1CB 3FLMA 4YP7A 3MUEA 5KWVA 5AHWA 4XSVA 1T9GS 3AFHA 2ZP1A 1Q11A 4JYZA 4UU8A 1M2KA 3ZIUA 3L92A 2RD2A 2IELA 4CDMA 4PBTA 3HWWA 1IRXA 1J1UA 5J59A 1JECA 2PZ8A 1KAQA 2VK1A 2PGNA 5DK4A 5BNZA 1XNHA 5LLTA 4JT9A 3MLBA 2Q28A 2IHVA 2Z09A 1J21A 1CT9A 4MUGA 3CLTC 1VLHA 2Q29A 1EE1A 1YULA 2QUJA 2A4MA 3CR8A 1U2DC 2XRZA 3F6EX 4D5GA 1XNGA 4KXQA 4RJIA 4MQ6A 4UZFA 3LOQA 4DDMA 2Q5OA 1JZSA 5DB4A 1X8XA 3ZJVA 3P0JA 3D7KA 1N2IA 1QPBA 1SURA 1QJCA 3COVA 3HGMA 3P52A 1D4OA 4K9MA 4BVGA 5K0SA 3PNVA 4FVTA 4HD8A 3AL0C 1KQPA 1NP7A 2O5RA 1I6KA 4WSOA 2A1TR 5IJXA 2ZUEA 4RMGA 2E18A 3FETA 5H7XA 2Q5LA 3PKJA 2QTNA 1G8FA 4MWDA 4IF6A 5BWOA 3P0HA 2H2IA 2OO5C 4YP5A 3CLUC 3TNJA 3AKZA 1WXIA 4MUHA 3FY4A 4HPWA 3OE1A 4GG1A 4XFDA 3ZXSA 1K97A 4PY2A 2H2DA 4D5EA 1JHDA 3Q10A 1UPCA 3CLRC 1F9AA 4F4UA 1JGTA 1Q19A 1YUNA 2YY5A 1M8PA 4EG7A 2JAXA 1P7PA 1U7XA 3L93A 4K9NA 1JZQA 3TQOA 2VBFA 1O96A 2EZ4A 3RK0A 4UU7A 2A86A 1O96B 2OV4A 2X1LA 2QJOA 2V0CA 1OWLA 4RPIA 2VK8A 4OUDA 4ZCRA 4NATA 1ZJWA 2I1LA 4OUDB 1R6UA 3ND5A 3FI0A 4JUBA 1I6LA 3P0IA 1COZA 3K35A 1DNPA 1WY5A 3IMEA 1J20A 2Q27A 4V1CI 3N2YA 1GZUA 1V47A 1R6XA 2OQ2A 3UMVA 2PG3A 1YI0A 1KP3A 4U63A 2WVGA 3EYAA 1KH3A 1TFUA 4MPPA 1KQOA 2RE8A 3GLSA 2NXWA 2E89A 1JSCA 1SZDA 1S5PA 1N75A 2BYTA 3FSJX 1J70A 3COZA 4YMIA 2DR2A 1POXA 1YHYA 1F7VA 3DPIA 2IHTA 4CQNA 1TYCA 3KT8A 5D7NA 1OWNA 2QTRA 1H3EA 3IUBA 2EZ9A 4U8HA 1JMVA 3KT3A 4G6ZA 4EG3A 4ZCPA 5EKDA 4MZXA 1M8KA 2CYBA 3H97A 4MVYA 4KR7A 1YI1A 3HL4A 1O95C 4J75A 4JUFA 1PO7A 3IVGA 3PNBA 4BVEA 1OBHA 4NAHA 4BUZA 1YC5A 3TZEA 1S4MA 1V5GA 3OTWA 3A4IA 1NURA 1IHOA 4UZEA 3VU8A 1T9CA 1MAUA 4DJAA 4BV3A 2EZ8A 5K3SA 4BN5A 4TWJA
chains in the Genus database with same CATH superfamily
2WSSA 1UKAA 2HNAA 3PHBE 1BX3A 4F9GA 4F9TA 1VB5A 1OZ0A 2ERCA 5CEFA 1SFRA 3UCEA 1Z83A 3MRSA 4JBHA 1UBOS 2JZOA 2CMGA 3DVQX 5CHYA 3VO9A 1F2UA 3AH8A 1PT7A 4OM7A 1PSWA 5JE8A 2BMDA 2JIZA 4MPJA 5TGDA 1NXWA 2Q46A 4DCPA 1BE6A 4F1JA 3AY7A 3K6SB 4AJLA 4CDRA 1U7PA 4EFKA 3Q7IA 5HOEA 2QENA 4L74A 3AL2A 2J3EA 1K92A 1M2GA 1U1FA 3WP1B 3VYTB 4CKZA 3BBPA 4R5HA 4X90A 4IUCS 4NK5A 4WACA 2ZBPA 2X0NA 3LC2O 5LQKA 2YJ5A 3B7WA 1FSFA 4ZP1A 2Q4TA 1NLMA 3IQZA 4LYAA 4DR5B 3GLUA 3L04A 2PNFA 5DH9A 2RGRA 1I3CA 2ZCUA 2QE6A 3O9ZA 1W88A 1UFRA 1X86B 4OK5A 4XGQA 3ZR4B 2R1VA 4MVJG 4RMHA 1NX9A 4RF2A 3P9PA 3WBKA 3RT9A 4CEJA 1M7HA 5FT9A 4MW0A 1ND6A 3SNKA 4WUVA 4GIBA 5EE0A 4CCWA 3Q0EA 4EJSB 1AMNA 3IP7A 2ZYUX 5IUJC 2H1OA 3AUUA 3RSGA 1UBFA 4HCJA 4L4UA 1QM5A 2E6UX 4EUHA 5KSWB 1U6JA 1LLDA 1FPMA 1WPXA 2AH5A 4Q02A 1BU5A 4UMFA 4DAEA 4DPKA 1GDTA 2A3NA 3JSXA 3A31A 1P75A 1K8RA 4GM1A 3DZ8A 4LF5B 5K9ZA 4ZVLA 4KXVA 2CCKA 5B53A 3IEMA 3JRXA 2BFCB 3ZLJA 3B52X 1OXMA 1M67A 1KYVA 3AF3A 3IIJA 4PPFA 3VPCA 2AJBA 3DTVA 4QJ3A 1FSZA 2WD7A 4WY8A 5LA6F 1VLZA 1A8UA 4NBLA 4PO8A 1J7JA 1SN7A 1BXZA 2KX7A 3BJZA 5C5DA 3K0SA 3BWCA 3CEJA 1IQUA 3EIFA 2Z9BA 2VHYA 2ADMA 2YICA 2WT4A 3GP5A 4GMGA 4RPJA 1RWBA 4CKYA 1K3UB 1N5LA 1ZJ4A 3IPXA 1QK5A 5LPNA 1IMJA 5AI8A 1UZAA 1RCFA 3EUFA 2IEYA 3SFTA 2RK3A 2I3GA 3GLFA 3FCEA 4RVNA 3G23A 1SC4A 3Q98A 4L85A 1I1OA 2FZLA 2G4CA 3SICE 4IBOA 4N0DA 2PWYA 4LI0A 4UHJA 4GZ6A 3M3DA 1IUKA 4U7FA 4TS1A 2C2YA 4QX6A 3L1JA 3NMUF 2SECE 4BIIA 5JATA 1JKJB 1MJHA 1Q20A 2C97A 3IQEA 1HDIA 2TMGA 3KWFA 5KYXB 5BSRA 3SZGA 1UF9A 1HF3A 1M2VA 1U28C 5ICMA 2I8AA 2PS1A 3BXEA 2NACA 3ITDA 4RY2A 4FR0A 4KC0A 3SVLA 4F4FA 4YPVA 4X1IA 2QJFA 3OPYI 4HEJA 4RH0A 2Q3LA 4AG5A 1DQSA 2Y1EA 4JA2A 2CBXA 3SQWA 3FDXA 1K63A 1LSUA 3VNSA 1IY1A 1PR4A 2Z3WA 3NCTA 2PLFA 1VMDA 3EDRA 3QW4B 3TD9A 2G0TA 4P83A 16PKA 3ZQ4A 2BCJQ 4UARA 1V96A 2R11A 3OUZA 5K20A 1NW8A 2OHJA 3ET4A 1XZGA 4CWAA 3LHDA 3RGWS 2ZIZA 2WMYA 3V5NA 5EA2A 4AFNA 4X5OA 1X8KA 4ZAFA 1VE5A 3PQ2A 1Y63A 1HLGA 3ICOA 3CWZA 3NNNA 3ZNNA 4BOYA 4CMCA 4DV0B 3CW9A 5EE3A 1E3LA 4ER0A 1K5PA 2RFLA 3OKPA 4FNGA 1WXDA 3CINA 1L4NA 4NL4H 2XDQA 1XLUA 1MF7A 3GJ5A 4BZQA 1U2EA 3HUTA 3E22B 1D5CA 3MTEA 1SK8A 4G2NA 1S1MA 4W1PA 1MGPA 3HN7A 4YRTA 1Z3CA 2HT1A 4ZO9A 3VUFA 3CUWA 3WQQA 1UBSB 4Z4EA 1KEUA 3TDMA 4DPMA 4KLAA 2CDAA 2ZJOA 1TVKB 4MNTA 4PIPA 3ZE9A 4TKUB 3JWHA 3VNAA 1C3JA 2ZJYA 1ZNQO 5ULLA 2AYYA 5KQMA 5JSYA 3RUPA 5HFNA 4KVAA 3S28A 1XU9A 3WGLA 3S1AA 2JFPA 4P3XA 4LF6B 4N8EA 4ENTA 2FKAA 4ILKA 5P8WA 3COPA 3A6HA 3O2NA 1P6UA 4P98A 4X63A 4L5YA 2I91A 3B1WA 2FJ0A 2QYOA 4E32A 4Q39A 4FC6A 4PPYA 1FFBA 4B84A 1NXXA 2RCYA 3RUFA 3HYNA 5JS2A 1S2DA 3GL9A 3LDAA 4X97A 5I7RA 1FTGA 5IZ4A 2ZSIA 3F5SA 3IP8A 3NHYA 3V4SA 3N2KB 2HD4A 2CJWA 3ACBA 1QLWA 3VNVA 1OA1A 1BIFA 2C5SA 3UNXA 3W1EA 2WV9A 1OU4A 1YS4A 4V0QA 4P7GA 4NYJQ 4C0BA 2X1VA 3UBTA 1QH1B 4NQRA 4UFNA 2I6FA 3WYGA 1JHXA 1XJQA 3GW8A 3JQFA 2QDXA 2ONZA 2O3JA 1ZUNB 1ZOSA 1XLTC 5C9ZA 3PX7A 2DPMA 4DNXA 4RSMA 4DTIA 2IXTA 4Q16A 3R8XA 5DU2A 4QPJC 1N1GA 3W34A 1E6WA 3NVKI 1KAGA 1J49A 2HCRA 3ETLA 3FHCB 4RZUA 5CW2A 3VSDA 3WRXA 1NW4A 2X2PA 3L4SO 4EYEA 4QG3A 4IQ4A 2D1QA 4PZPA 5HM8A 2Y4NA 3OM8A 2FEXA 3E5RA 4UTXA 3ZV6A 3U60B 3P2KA 2XHEA 4FNOA 2AN5A 2VBIA 4DYHA 3I2GA 3W9YA 3OZBA 1WXGA 2C1XA 2R6GA 3C5CA 3N8HA 4Q3AA 4UEJA 5EGNA 4OH7A 2XVAA 2LCQA 4ALJA 4F6RA 5C8VA 4O3FA 2E49A 3TQTA 5T6MA 1C3XA 3Q4GA 4Z49A 5C8YA 1FXWA 3ABQB 3UV3A 1EP9A 1X1SA 4NZ9A 4EB0A 3CLHA 2V74B 1AUPA 4YDSA 5B1SA 3H1FA 3OX2A 2GZAA 4MMZB 2OKGA 2EKLA 3UJCA 3FPBA 1OW3B 1BJTA 1ZR4A 2HPVA 5A3RA 2Y9MB 4KFSA 1E7YA 1EFCA 1LBSA 4RY8A 4DLRA 2X22A 1L4UA 4LMAA 3L7YA 1D8TA 4G3XA 4NNPA 2J3DA 1HE8B 2JGMA 1DO0A 2NZXA 2VUTA 2BI7A 2RHWA 1NZFA 1KGSA 2VHXA 3QWIA 4ZI7A 5F2NA 2C78A 4IOLA 3PI7A 1MT3A 2JIQA 1EUYA 5LOVA 2VT7A 3UYLA 3NO4A 2PH1A 3JD0A 4O1HA 2H63A 3RUAA 4E5PA 3T4EA 3IRUA 4GGMX 3BGSA 4GECA 2JJ2A 2CLSA 6Q21A 5K99A 2CNOA 3FLAA 3WK4A 1TFRA 1N36B 1QZ3A 3AMVA 1CFZA 2FUNB 4WBXC 4W63A 2XUGA 5DI3B 2J3QA 5L7WA 4LF9B 3HDHA 1UK6A 1A9YA 1GFWA 4RD1A 4FYVA 1LPOA 2HWYA 3QF7A 4BXOA 3ZHVA 1EVQA 4RDHA 3FA2A 2WLTA 1QZUA 1KWKA 4FS8A 4M7PA 5FUWA 7AT1A 1Y9ZA 1A97A 4RHEA 5I47A 1PSZA 1ZM3A 2VHWA 3D5QA 5EMHA 5IDQA 2ZUDA 1XVAA 3IR6A 3IPAA 3IP5A 5AI4A 4K9DA 3UB2A 3K0FB 2OE2A 1BMFD 1PGQA 3MJFA 5AJUA 2OD9A 1W73A 2WSMA 3PF8A 4K6OA 5E4YA 5GONA 4DT1B 5M29A 2D3WA 4YJ2B 4K87A 4R81A 3T9EA 4MO9A 1NLFA 1WUTA 1AC5A 1DKPA 5FLEX 2JD2A 3VI4B 3C3PA 5JS6A 1MJGM 1XA4A 2J5RA 2VTEA 4LBZA 3THXB 4TMZA 1KDTA 1SWVA 3EHDA 1L5HB 5F77A 4DPLA 4Y9RA 1PE0A 1YOBA 4MV6A 4FMDB 2YUIA 2Z30A 1FZTA 2NSLA 2FPMA 5CYPA 3G85A 1P4AA 2Q5JA 4Q4HA 3T5BA 2Q2WA 4JP1A 4BB5A 4BWYA 1CUWA 1LDMA 2QR5A 1KR2A 2X3UA 3MCAA 4KQKA 1THTA 2REQB 4QOJA 1N5JA 2YC4C 2UAGA 3AF4A 3ELDA 3LJKA 2P3SA 3GC6A 4D9CA 4CLOA 1YZGA 4HNAB 4DLXA 2CV0A 3SXUB 3S2EA 1T4MA 4ZANA 3I23A 3F78A 4QQFA 3AI1A 4CLRA 3T38A 1PLKA 1RXEA 2ZIXA 3OIYA 5J4LA 3AXSA 1XCGB 4YJDA 2HB6A 1MB2A 1YBMA 5E6SA 2BTQB 2H1SA 1GZVA 2EGGA 1KJJA 1O3YA 2IW3A 3ESBA 3UAZA 4C43A 4E94A 4OB8A 2QZSA 4IGKA 4QGFA 4HRYA 2FPGA 5GINE 1JHUA 1QF6A 2ARKA 2E3JA 2FR1A 3AC0A 4M7RA 4O2RA 1WF6A 1HNZB 2XT0A 2YVQA 1M6VB 4NYIQ 4QSHA 1YCHA 4R1TA 1XZKA 5D5HA 5DNWA 1WV0A 3JQ9C 3F6CA 3T99A 3WLLA 3W5BA 4CW7A 4DARA 1CUHA 4IEEA 2RGYA 4EVRA 4JBNA 2DFDA 1UDBA 3GZ4A 3HJNA 2Y2VA 3PFNA 3PHIA 5ALZA 1DKQA 2WG1A 5ALSA 3DL0A 3JARB 1YRLA 3ILXA 4J3FA 3X1DA 3FMOB 1UZNA 2G1AA 2GH1A 3EFBA 3HU5A 4FW8A 1UT6A 1J6UA 1PS0A 3VQTA 3W6ZA 4DV2B 1TCUA 3MGCA 3UAVA 5DNUA 1WR8A 5FBVB 3K5IA 3TXXA 1EK2A 4M0FA 5REQA 3ROQA 1YFJA 3MINB 2PQ6A 3NKVA 1L7MA 3DYIA 4O2LA 4QL3A 1ESMA 3NWJA 3FWHA 2CLEB 4GQIA 2GEDA 1S2IA 2C4VA 4C4AA 1Y7HA 1ZAKA 2BH9A 2ZM5A 1QC5A 2Q3FA 3AUXA 2VRWA 3M70A 4IJKA 4L4XA 4C4TA 1IN4A 2WT9A 4DEXA 1N8KA 1VPDA 4DQKA 4M4SA 3V9PA 5JRZA 2PUFA 1K4KA 1TLTA 4P4LA 1QHXA 5AOAA 3VHQA 5B1DA 2QT0A 5EWMA 3O3MB 3QWBA 4R1LA 2ISSD 4Z2AA 1W44A 1E2GA 2X9GA 1GCAA 4A8HA 4DIOA 3AUFA 4LXXA 1E3IA 3BGDA 2NX2A 3WLOA 1VHJA 3BRSA 1WKVA 1U4OA 3WYFA 4JGIA 1USUA 4OQQA 1XMOB 1UP6A 2Q6VA 3AJAA 4YP0A 4B71A 4DWWA 1O5OA 1V71A 5D3KA 4CLEA 2H08A 3NJ8A 3F5QA 2BHSA 5SZKB 3MM4A 1VCIA 1NBAA 3R8CA 4JBIA 3FOWA 4RD2A 3TQSA 4HAXA 3UUEA 1LBIA 4ENPA 3CLTC 4MGHA 1Q83A 4DQXA 3VZPA 4FI3F 3T3GA 5H83A 4B3MB 2I4OA 5DBHX 1L8AA 2QW0X 4JEIA 3TF5A 3GGDA 1D9ZA 3ONDA 1UMKA 1VI6A 2DQSA 5A4FS 1V9LA 4DV3B 1CF9A 3OIFA 1BYIA 1TAHA 2AOXA 2HJWA 4H15A 3WWOA 4B32A 2KQUA 4Q1VA 1Q5PA 1VJTA 2RHMA 5FOVA 3U44A 3SC3A 3PNVA 1A9TA 2H9IA 3G0DA 3VZDA 3GN1A 2G7ZA 5B36A 2O8DA 5IJXA 4FFOA 4BL5A 2D59A 4KQFA 4LCJA 1L7NA 1NNSA 3OLVA 1J2JA 5C3UA 3E70C 2GB4A 1B0UA 2WF7A 4L73A 4OHKA 4V2IA 1XRRA 2FLVA 2YWEA 5AVKA 5G2OA 2K4MA 1EHIA 3WZLA 1GRVA 3GPCA 2QWXA 3N0TA 4H3HB 3OE1A 3UPUA 1NNI1 2A9OA 1GNTA 2AVDA 1AGPA 4KUEA 1J06A 2WYHA 3D6NB 4X54A 5IABA 4HDSB 3N53A 3QLEA 3AT1A 4F4UA 3AEUB 2YY5A 1G66A 3OCVA 4WERA 5IAKA 4DMFA 5AW2A 1QHIA 4R2IA 1W0KD 4N48A 3CZPA 2VBFA 2Q4RA 2WAOA 4QRHA 1Y48E 2WYVA 2LIPA 3D1LA 4O4HA 4ZVVA 3L1KA 2QJOA 5DBEX 4W1QA 4EABA 1O9BA 2EKZA 1L5GB 3ZXXA 5EMMA 2X4LA 1C2YA 2NGRA 3JZDA 2Q07A 1PFQA 5F1YA 1NXOA 3RYCB 1QIDA 2DMRA 1IZ7A 4DLLA 2WWTA 2H11A 2OL4A 2YW2A 3RV3A 4WK4B 3A3OA 4MRMB 4F91B 1NSFA 3OLWA 3TCXB 3WGZA 5BMVB 3QPDA 3FTDA 1WXWA 1JSCA 4P84A 3HE3A 3WRYA 1N75A 2BM0A 3DMTC 4GXNA 1Y4DE 4HAOA 1EDEA 5FTJA 3RBXA 3ANXA 2JRLA 4TLMB 3UTDA 4MV8A 3V1LA 4A03A 1L1QA 4CQNA 3GJ0A 1TQ2A 3PEWA 2WWYA 2AXQA 3LW7A 3QMMA 2QSJA 3SYKA 5A02A 5E3IA 4I2VA 5C2JB 2IDJA 1PUXA 3H97A 1HY3A 1LPBB 4C6TA 1GOTA 1SRQA 4UNRA 1J2UA 1HV8A 1R6BX 3P20A 4W6ZA 1IB0A 3FYCA 2WU1A 3MGGA 5G3YA 4BNJA 5BQXA 5GZ3A 1P2SA 3BXOA 5LWHA 1W85B 1BHO1 3EC1A 3BK2A 4BVEA 5TQJA 4NAHA 1M6NA 3MJRA 4UBIA 4WN9B 3BF7A 3RVQA 4ZYUA 1TO2E 2PA0A 3RFXA 1ZGGA 1BC5A 3MHTA 3C3MA 2E85A 2IYSA 1OF1A 2QD4A 3WRVA 1YRHA 3WC4A 4XYBA 4YTEA 1GPJA 4EPTA 1KSGA 1MG5A 2BFWA 4NNJA 4WRRA 3QTBA 3A6ZA 1MW9X 3P5BA 1O58A 3AERA 2P2LA 5FB3A 2J59A 4B3TB 1LSSA 3E2IA 1O0BA 3RAFC 3KEFA 5CDFA 2X23A 4BQQA 3ID6C 1EHYA 3QM1A 4DE5A 1CZRA 1XVLA 3O94A 1JH8A 1VJ5A 1N5DA 2WWHA 1LPNA 3NTUA 2EBWA 4QXPA 3X1MA 1ZNXA 2GZSA 1CY8A 3WMXA 3EVTA 4KREA 3S70A 3LAWA 5CT8A 2C9BA 3O8QB 3GLTA 5KNLA 1AKEA 2D1FA 4EG0A 3MPUA 1CUSA 2FRXA 4H16A 4JSYA 4U2CA 5FAKA 4I6EA 3RBZA 3TDKA 3OPYA 3KALA 4EG4A 3HFSA 3MWDA 3AM5A 2CMKA 1M34A 3EGDB 3PTZA 3LHKA 4GSLA 3RUDA 2XB9A 4B45A 3UJDA 1T6XA 5EIAA 4HQ0A 1M1NA 1N9GB 5EXPA 5IKEA 1F4VA 3QV1A 2R6DA 4URYR 2QPAA 2Y68A 4KOAA 2ZCJA 3IT0A 1E4OA 3IKJA 4J1TC 5K6AA 2X0JA 1N92A 3TTXA 1W52X 4ZVOA 1DRUA 5DLYA 4YWJA 2EL9A 4CV0A 2ZAMA 4IYRA 1VBNA 3WR5A 4F56A 2XY4A 2PL5A 1O9GA 1Z37A 2HZ7A 1CLUA 2LGJA 3C6QA 4MUYA 3PYMA 1HTTA 3ZD7A 4CM4B 3JPWA 4MEBA 5I4BA 1UCFA 4REMA 2H00A 5T4BA 2I76A 1VP9A 3W79A 3DO6A 4ITUA 1YD7A 1QFSA 4I9UA 5DMHA 2BFEA 4LHSA 3NW9A 4UXIA 5EHNA 4B3SB 3CV3A 3MRTA 4OQMA 3OY2A 5JJ5A 2G71A 1QR6A 4NBSA 5BT9A 2HBRA 3C8ZA 2YJNA 2ZTUA 1QKIA 2O23A 3FTFA 1E5VA 3QWAA 2OG2A 4BMOB 3BB3A 3T7TA 5FDFA 3E8SA 4AJPA 1US8B 4HFMA 1MKYA 3L6UA 4KQEA 5ALKA 4TPKA 1MRZA 3DULA 1QWSA 4R8LA 4BVBA 2H2GA 2C29D 5EKTA 2BFNA 2F4NA 4RLFA 4PYMA 2HX1A 4KUHA 4YACA 5LB2A 1DAEA 2UZ4A 2CJPA 3LTEA 2W2LD 1XBTA 1MA3A 2Y77A 1V5FA 2AMYA 2XMZA 5LIPA 4DANA 3Q85A 1RI3A 2R1UA 1EH5A 3IMGA 3JD4A 5JD6A 1JFVA 2LPMA 4Y7DA 4HNUA 1NG1A 1LF5A 2JHGA 3N2GA 1IIBA 1RPZA 1N0IA 4PQRA 3RYIB 3PJRA 3H84A 4Y6GB 4DV6B 1IG3A 3GHHA 1CYEA 3HLYA 1V5EA 2AJCA 5CPFA 3WG9A 3ZGVA 1CR0A 2ZQ5A 4MVCA 2KBFA 1Y1TA 2C4NA 5A4KA 1JLHA 2O2SA 1S3SA 3ESCA 3EASA 4IV8A 3R20A 1T8TA 4ENSA 2B78A 2ODBA 3P71T 4LUCA 3VTFA 4QDKA 5A4AA 3S2ZA 2D0DA 1L4KA 3K96A 1VI2A 1NE7A 3QPUA 2ILTA 4OHRA 4ND1A 1V26A 4LFAB 1XI2A 1V2HE 1M6EX 4LYGA 2SNIE 3EARA 3U13A 3E5NA 4YQFA 5I9MA 3KAPA 3P2MA 2OCBA 4G09A 3WOVA 1UANA 2P75A 4ZREA 1N25A 3DMRA 3DBIA 2Z9DA 3NU1A 3AI2A 4Y1RB 4AC9A 2G25A 3OQNA 2JFUA 3DMHA 2AFIB 4DXHA 1W2HA 1DB3A 2NU8A 4S1NA 1Z75A 3AP1A 3BB4A 3LYAA 1RHUA 1EG2A 2YVKA 3OE4A 3V8VA 5KOIA 5THKA 3IX7A 4JBGA 4NJMA 5CXUA 3UAGA 1Y34E 4MW7A 2BLNA 3S7ZA 4HVCA 2QOEA 3OH8A 1RWVA 1T0BA 4CL3A 1QKJA 1NTOA 1S96A 4M8KA 3UK0A 4M89A 4B2YA 4BZXA 3KR1A 2FOXA 4I36A 3JR3A 1U02A 4JJZA 1R7RA 2HF9A 2CKDA 2IU6A 2G1UA 4C3OB 1V1JA 2ZI7A 1RTKA 1U9CA 4RXUA 4AZ3A 1MENA 2EFJA 2P68A 5ALPA 4CTNA 1C7JA 2QU8A 1U8CB 3K0AA 3KR9A 4GZLA 4L2IA 6NULA 2FAXA 1JUDA 3ZZ0A 4BFTA 1GKLA 2G28A 5AM1A 2EFYA 2JIBA 1BEUB 5CX1A 2VF4X 4TVKA 5ECDA 3A1CA 2EZTA 2Q21A 2P69A 1ATZA 3KXLA 2WHEA 3NPAA 3RLIA 4UTVA 2PUBA 1D4ZA 1XKTA 1E0AA 1CPYA 4MRAA 3PNLA 4NX2A 4LJRA 2ZAYA 3CBQA 4W99A 4YLGA 2PSHA 1ZU4A 3T5MA 3B3AA 5F76A 3R77A 2RHJA 3VI3B 1NUQA 4DDHA 3QLUA 3KQPA 2MYNA 4NMXB 2BZGA 5B7QA 1CEXA 1JX6A 1XXHB 1RWPA 4KXXA 1DV2A 1XQYA 1XVUA 4OHXA 3CEPB 4ZV9A 4AN0A 3G5LA 4MV5A 5LDDC 1K3TA 1QIFA 2OWEA 2CJXA 3L84A 1Y7IA 2G08A 4ND7A 1PL8A 3FPSA 4RACA 3VHXA 4N41A 1DE0A 2O8VA 4RWEA 3NOXA 2IITA 4LJYA 2WAAA 1G4AE 1E4EB 1QFJA 2ZIUB 3FKQA 1Z0KA 4OKIA 4GL4A 3VO1A 1K5DA 3K9GA 5LQUA 3D0QA 2C5AA 2BUAA 1Y3IA 2G3YA 3FLEA 1YZVA 2VSNA 3GUUA 1XQ6A 1WG8A 2NYRA 2PX5A 3KEMA 4P8RA 4ARZA 3ROGA 5KJEA 2H0QA 3OZIA 3WLQA 4JQOA 4BNZA 3A2KA 4ZCQA 1FRQA 4NMWA 1EGMB 5AXCA 3VHRA 1VSVA 3QLJA 3JYLA 3R76A 3Q6MA 4KBFA 3PFKA 2H1VA 2GBLC 4MQFB 3TVYA 4HDKB 1N2ZA 2R62A 2FUCA 4L3OA 3V8BA 2XEDA 3GCGA 4DRYA 4JJIA 3AUSA 3FKSD 3F8WA 4Y2SA 3PFIA 5FOQA 2B1GA 2ZVQX 1U28A 2BFBB 1EM8B 2J3HA 5G0WA 4YUYA 4RH1A 4WCVA 3IL2A 3JCZA 1U1GA 3DS8A 3F9CA 3KYCB 5E0OA 3ZWWA 4FX5A 1IXRC 3AP2A 2BE9A 2HA4A 3HJBA 2JCYA 4KIJA 1SWWA 4LGVA 1NT4A 1XELA 2VDKB 4N12A 4XLTA 5IXYA 3TTUA 3IGFA 2N1MA 5FWNA 3FCXA 1LDYA 2IIVA 1Q16A 2WPNA 2ZSHA 4FMCB 2ZB7A 4K2AA 4R3NA 5HW0A 5JW6A 4XSHA 2LIVA 4HQFA 1D5WA 1TA4A 3TOVA 5F21A 1ZMBA 3QMVA 3SR3A 2C07A 4OOFA 5GGYA 5LZ8A 2JIDA 2XGMA 2PKWA 5TEWA 1Z6QA 5E4JA 1T2VA 3DZCA 4RO0A 4EX7A 2XB6A 4RQAA 5FV4A 2C7RA 1I24A 3FX2A 4PV7A 5FI3A 2C0QA 1IATA 3IDAA 3OCZA 4DIKA 2P2CA 1JXQA 2FW6A 3JQEA 3PR3A 5FOTA 1ZXLA 1QBKC 2PTGA 3H9GA 5FBHA 4CMEC 5D85A 4LQ4A 1AN9A 5JFTA 1LF0A 5HR5A 3MT7A 3MCUA 3RU9A 2HU7A 2C88A 4YRNA 1NVTA 3H5IA 4OQLA 2OM6A 5FWYA 2YY7A 3RIXA 1BTOA 3LDHA 1M7BA 1NW6A 1D2GA 3KR0A 3PQFA 2HCJB 1R0SA 4FOSA 4JJ8A 1CV2A 1EK6A 3F90A 4LHWA 4RVCA 1KIMA 4YYEA 4AJNA 5A7HA 3ZWAA 5FIUA 1IN5A 4L5CA 5AJWA 2JDIA 1EDDA 3A70A 3TD6A 1JLRA 1Z2DA 4D92A 3NC4A 2PX0A 4ZC8A 5AK4A 4K28A 3ZZMA 4WEOA 2R6FA 4G1BA 1AMOA 3P9ZA 3GEMA 3VPHA 4XARA 4HTAA 4UUMA 2UUOA 3JQDA 2XQKA 3PD7A 4C78A 3D6HA 3VVLA 4NBUA 4ZYXA 4C6RA 4DCNA 2WTAA 3AUTA 1FW6A 3SKXA 4JXXA 2IS1A 4IDEA 4XDGA 1DDOA 1O6CA 1PI3A 5IAOA 1Q1EA 5CM9C 4O3MA 3G2HA 2XNJA 4KPEC 5JAOA 3HCWA 3GFOA 4WNAA 3ZCSA 2X15A 1Q44A 3A7DA 4I4TF 1HQCA 3K1YA 2CLMB 4ID3A 3UFXA 1VIMA 1FYEA 4E70A 3AVVA 3V1KA 4EENA 3N8IA 4X85A 2GYYA 5DEIA 2EW1A 3GD5A 3QNWA 4QT0A 1SA0A 4UNQA 4RHXA 4AKHA 2FX2A 3AR7A 5I8ZA 1NOKA 2R8ZA 1FS5A 1M83A 4LJSA 4LVNA 5LA6A 1OBCA 2H1HA 1NP3A 3UJ6A 3PNYA 2G72A 3R23A 2HRCA 1VI5A 2N3ZA 1XMSA 3AZQA 4QJ4A 5J9FA 1MVLA 4PG4A 5SYAA 4EZIA 5G0TA 5LP6F 1L7DA 1YZNA 1Q7RA 1R4MA 3AG6A 1YR1A 1XMPA 2ZRLA 3LA8A 4WDRA 3IODA 1NYLA 3VRHA 3FRIA 2I9KA 5BW5A 1RJ9B 1YE3A 4RHTA 2ACKA 3N6VA 2JA1A 3JAWA 3QENA 7GPBA 1KTIA 1YIDA 3PUKA 1D2HA 3L2OB 3OHPA 4YALA 1ZD8A 2VXCA 4MWOA 4NYJR 1ETHA 2UU9B 4GXTA 3GB9A 4C03A 2YZMA 5ECYA 2C20A 4TN5A 5CXXA 2DC1A 1ZA2A 2IHJA 3ND9A 4DLSA 3ZE7A 4LSMA 4Q82A 4YY3B 1Q7CA 1TF7A 2JANA 4KOEC 3BORA 4ZT2A 4B34A 1ZKMA 4RKWA 4BWFB 2VDVE 5B55A 1G7CA 3WLIA 5CYFA 1X7YA 2PZGA 1KO7A 3V1MA 4XCQA 4XSVA 5J4HA 5T64A 1A5AB 3TOCA 4OBBA 2RAFA 5JCJD 2C7QA 3PE3A 3NP7A 3VC1A 5JMTA 4MWTA 3RFVA 4UUPA 2PMFA 5LDGA 4B2PA 1JDBC 1SBTA 5FA5A 4AD8A 1T1SA 2ZJ8A 5EUBA 3NVAA 1ADCA 2PGNA 4QGSA 1M1YA 1Q0TA 3VYVA 221PA 1XPUA 3DDCA 3WLNA 4BYGA 1XZQA 2A4MA 3LOPA 1OFVA 2XRZA 1J0EA 2MSLA 2XUAA 4TV8F 4WKCA 5G0VA 2V1UA 1OX4B 2QTVA 1SUDA 3FVQA 2H52A 4WZAA 3SFZA 3NH6A 3LOQA 1TNDA 3M6WA 4NR0A 1SURA 4NTZA 4QXMA 2NLOA 3HGMA 3P52A 4K9MA 1UKCA 3O4HA 3ODGA 3EOZA 1USGA 4QIHA 1R8JA 3ZLBA 2HHJA 2VA8A 1QIIA 3SYLA 4BC0A 4WSOA 3CH5A 4OAQA 3PKJA 4MH0R 3VR6H 2RAUA 3OHMA 5TQ2A 4IF6A 4BFUA 4OLBA 4ZJPA 5E4FA 2I34A 3V4RA 4MKXA 3FY4A 3MGAA 3I4LA 1BXRA 1E18A 2OC4A 1GTZA 3DWIA 4N7RA 4XFDA 1YO6A 2FPWA 2YX1A 4YJHB 1WMAA 3RW9A 4MV1A 3PGVA 4N3NA 3D2LA 4LXIA 2QAGA 5KNBA 4D02A 1UPCA 2J46A 6ABPA 2G17A 3V00A 2Q5IA 2P1ZA 3P7MA 4NBWA 3C4JA 2XIQA 5A6SA 3HA2A 3EEQA 4CQMA 5L3ZA 2XF2A 4P0TA 3O84A 5F2KA 1XEXA 1SIUA 721PA 6ADHA 1E2HA 3WGJA 1PDVA 2Y6UA 4HP8A 4OMCA 1S8NA 1F48A 2JAHA 2YZGA 3D59A 2V4ZA 2A35A 4GLFA 4HWGA 3NBFA 4GX0A 4B7XA 2PV0A 3WIDA 3X3HA 4AY2A 4BB0A 2I99A 3PFCA 1IZ8A 2Q5FA 1U6KA 2AF4C 3BHJA 3SDSA 2ZWPA 3MSXA 2WYOA 5IKPA 4RH3A 1MB0A 5J40A 2BYTA 1SKQA 3IPYA 4E4TA 2BGKA 2F90A 1P1RA 3JQ9A 2OENG 5IT9A 4HQRA 4TRRA 5LP6C 5DNYB 1FTSA 2RHGB 3WMRA 5JS7A 2Z95A 3AB7A 1YI1A 5I48A 2IOQA 4Q37A 3X1WA 5BW8A 1PO7A 2PMEA 3PNBA 3NOQA 2VOEA 3UJ8A 3TOXA 1YC5A 3LUCA 1A4UA 1LBHA 3A6FA 4QUKA 3S29A 3K9LA 4NEQA 1DFGA 5IANA 1MAUA 2EKDA 4YV2A 2ZKIA 4M9ZA 2V6MA 4BV3A 1L3CA 3WB0A 2BR3A 4NE2A 4EF4A 5JQGB 1Y8ZA 4XPIB 1XP5A 2DBYA 2DHRA 2W2KA 4JWTA 2P3LA 1FNBA 3EIQA 3KB1A 3WTBA 2CVQA 2WJWA 4LZPA 1JR6A 2VRCA 5TQ0B 4OBWA 3TAXA 4BN0A 4KGXA 4N82A 2QM0A 3WKCA 1IVSA 1P8JA 5BSGA 2W71A 3CT6A 1QCYA 3G5AA 1T9AA 2XYHA 3CZ4A 4G8DA 2R2AA 1LS1A 5F12A 4KE6A 3QE2A 4J29A 1AKTA 4FKMA 3U16A 3PX2A 4PPQA 1YS6A 4C5CA 1NKTA 3DFFA 1U3GA 3PCRB 3QXCA 1QBGA 2MYUA 3ZEAA 2HMAA 4EGAA 1C7FA 2GCGA 1BN6A 2PBLA 1B43A 3HVHA 4MB0A 5KYNA 3EQ9A 4L15A 4G25A 1KKLA 1CVIA 1T2NA 4TL9A 3KZ1E 1X39A 8LDHA 2UXCB 2FSHA 3MELA 3M5WA 3HKBB 4AKGA 4FTWA 1XZLA 3O82A 1Y8CA 1QYDA 2J09A 3GARA 1PYDA 4DXAA 2O3QA 2X7JA 4DWVA 1D4AA 1PGNA 5JAIA 3RFFA 3R3JA 4TTRA 2A8YA 2FX5A 4UCFA 2BBTA 1N6NA 4LDZA 1UP7A 3A1UA 3SSAA 3W1VA 2C82A 2YJ6A 1UM8A 4FYWA 3M1LA 4LC1A 2EQBA 2QUHA 4A0HA 2Y1GA 4GOLD 3OZDA 2QLNA 2WZCA 4L50A 4OTZA 4PZYA 1W36D 5DASA 2DB3A 5HIKA 4FDLA 2P0AA 4HX9A 4A9AA 5K6TA 2OP0A 1R8XA 2G4VA 2CHFA 5AXAA 2YXLA 2P9TA 3JALA 3VBCA 4EPXA 2EQAA 1VPWA 1EI9A 4HPJB 2EGUA 1H9AA 1P7VA 3QBEA 4JUDX 2C7GA 1XQ9A 4PYRA 1ULSA 1HLPA 5G41A 5JAQA 4DF3A 4E3ZA 4OHCA 5C31A 2Y1KA 4WOBA 1JJAA 4HNSA 3V2IA 4RD3A 4DYVA 5JZMA 4OHOA 3M6VA 1KEZA 4MWCA 1OFHA 3G1TA 1LNSA 3M8KA 1BZYA 1NJFA 5DLPA 2GWRA 3TN7A 4AO8A 5JBNA 5JARA 4C2UA 3RU2A 1L4FA 2J3JA 3HTXA 3OJFA 5CVCA 5MF6A 5EWLB 2X58A 2ZB8A 1WZNA 3RS7A 3AHDA 3LY8A 4U2DA 3ZV3A 1GRRA 1A88A 3SZOA 3A11A 1IOWA 4J3NA 3UW1A 3IOCA 4DVJA 3KUCA 3EQ7A 4QPNA 1AKUA 2G1KA 2ZROA 1P2FA 2AFIE 4HXEB 3FOEC 5AW4A 2JFVA 1YV9A 1EVEA 5AW8A 4MIKA 4UEOA 3FOAA 4MS1A 4M8LA 2QVZX 1YJ8A 4RFSB 4UXJA 4Z3DA 1EFRD 2XMSA 3KB6A 3QE4A 4OHYA 4X84A 3MJEA 3IJRA 5NLLA 2W8ZA 2W6ID 1HZJA 5AQ1A 1N2EA 4ZOBA 2YASA 3E27A 3DMTA 1NRIA 4J03A 2PTHA 1RCUA 2DLDA 3G5UA 4B6RA 3A9WA 2QN1A 2V65A 5CITA 1FDSA 5CT5A 1SZCA 2PMKA 1D2EA 3OJXA 6REQA 1T25A 2I4IA 2WSSD 2R00A 5F9MA 3PXXA 5JBQA 5B4TA 1PVOA 1PFUA 1BQ4A 4LHYA 2VDWB 5TS3A 5K5EA 3C2QA 2F59A 3EZ6A 3BJRA 4KK4A 1G0OA 1OE0A 2JIZD 2ZU0C 4AY5A 1OLXB 2NUPA 4JLUA 4U7JA 3IJPA 3A10A 1C41A 4GX1A 1XD2A 2M1XA 3E6AA 1TA9A 3RRNA 4G26A 1PGJA 3K0CC 3DE7X 5JCXA 4XYGA 3KUDA 4HDNA 5ALHA 1P0CA 1JEQA 3JQGB 3STTA 4M54A 2OCLA 2RHRA 3MT0A 4RZIA 3V55A 2PH3A 3BK1A 1PNOA 4PYLA 2J0UB 2Y8EA 3U3MA 1MIOA 3GFRA 1EAYA 4LRTB 2BEWB 4OAPA 3THSA 1TMYA 3TR6A 4Q12A 3IHTA 5LMZA 1UK8A 2K2WA 1A8IA 4FMPA 4GLLA 4D0NA 4UW9A 1XXHE 4TYWA 2P4HX 4E5MA 1SD2A 2BGMA 3AJ8A 3OKFA 4N3BA 3PR2B 1W25A 3L1HA 4ZKEA 3T95A 4B6JA 3OEWA 1QU3A 2KYRA 5JXGA 3BD6A 4YECA 4C6SA 1F51E 1XTKA 5EJ7A 4FKBA 4DW8A 1MA0A 1LBEA 2OT3B 4RIFA 4QUJA 1GN8A 1CJKC 4AZSA 1LZLA 1CDDA 3BRQA 1KRHA 3P9QA 2QL7A 5AK6A 2QRUA 1C4WA 2D1YA 3R7WA 3PVZA 5H8WA 3PQ6A 3ZU4A 1SVIA 1XO1A 2WAMA 3HV0A 1YNOA 2XA9A 4ZPXA 3L6BA 5CA1F 2I33A 1KMHA 4L4SA 1RR6A 2EX4A 2VTKA 1RM0A 4MPRA 3VR4A 3AFNA 5PGMA 3C39A 1E2UA 1N7IA 3D8BA 1NTRA 4XIGS 3DTVD 5BN3A 4LDAA 1Y9EA 2FNAA 3E3OA 1IMOA 1KYYA 3L8EA 5JEEA 2XVMA 5LFAA 3R9XB 4FONA 1Y98A 4WXPA 2LR0A 3HYCA 4J1TA 2YWBA 4PLFA 3P9IA 4EMUA 4M1EA 4ER6A 5KWIA 2XOEA 2WIAA 3TO5A 4EY5A 1EJ2A 5E8RA 3T5AA 1G60A 1WXEA 2WM2A 1J2RA 3RR2A 4WV3A 5ANRB 1OUMA 3U09A 1MC5A 3ST7A 3QVXA 1YL7A 4J91A 1N5OX 2ZUUA 4CQJA 5K3CA 1IPHA 2WR8A 4EYGA 4YWHA 3ZS9A 3ZJ5A 4Z54A 2G9RA 3PUZA 4CKWA 4REQA 1QS0A 2BEVB 1IY9A 1ZIYA 4WL0A 3W0LB 3RAEC 3PRHA 4NQZA 3S3TA 4XQ9A 2F9FA 4WKOA 2HJGA 3LY5A 4ZJUA 4ZHQB 3WGYA 1NUHA 5CDUA 3M33A 1RAAA 1TUBB 2E55A 3D4LA 4MKGA 4JJ7A 3LQKA 3OP1A 4BWVA 4OGFA 8ATCA 2JBAB 2IYAA 5GTDA 3QVLA 2NU9A 3KXKA 5KQSA 1P61B 1WCV1 3C1AA 2XXBA 3LDFA 2R6R1 3NHUA 5I7EA 3IFSA 4BPBA 3DBHA 2B4TO 3OKAA 1TM3E 2GBCA 4JI5B 4Q4AB 2XHZA 4S1TA 1ULAA 4Y2XA 2Z8YA 4MQUA 3F73A 1UADA 1KP2A 2J6IA 1L4YA 4Z9YA 2OFPA 4BRZA 1R5BA 4DA7A 3AVUA 4QYXA 2XBLA 3AIMA 1JDVA 4MYUA 1MPXA 4CODB 3F2IA 3B12A 2BFMA 3IKMB 5TS2A 2BFFA 3FXAA 1UEJA 3GUYA 1V16B 2PJUA 3IT2A 3JQ8A 1DUVG 4IQ8A 4JJFA 3QA3E 5JSHA 1Q84A 4Y1FA 4PR3A 3ZGOA 1IHPA 1DEXA 2BDTA 1RXCA 3AF5A 2PRIA 4IZOA 4R05A 4XFKA 2BONA 1L5QA 3AVPA 1I4DD 3CR3C 3I5UA 5B3AA 4KR2A 4CV1A 3B3GA 2WJ4A 3DV0A 3WLAA 5FJJA 2ZJ3A 1UM9A 2FEMA 1R9MA 2NVWA 1F6DA 2HIGA 1I7NA 2QRMA 2X41A 3EE6A 3L82B 2VPXA 1QVVA 1X92A 2FSSA 1KOGA 4ARUA 4NCJA 3IIKA 4DR1B 1F0NA 2A58A 3ZY4A 3S8YA 1W46A 4PLPA 3L7JA 3PZBA 3RV4A 2G67A 4KPUA 5E6UA 2I7XA 1WCIA 3ROMA 3WOHA 5ALWA 2Z8XA 1XU7A 1YQXA 1BWSA 4OHBA 1VL6A 2QLTA 1GUAA 1Y6RA 2WINI 4JLBA 4FHFA 4RAQA 3SK0A 5KUTA 2XKKA 3GNQA 2YIDA 3CSUA 2Q6TA 4ZTUB 4BYMA 4L5BA 4XIYA 2FTKE 4LOAA 5TPWB 2E9SA 1A8QA 3I6BA 3PFGA 3W6UA 2AQKA 2PR7A 2DPLA 5A9RA 2LW7A 4NCXA 2P4SA 3HCOA 3NH9A 1SKBA 2DOKA 3PPVA 4C01A 2NZUG 4GXRA 1VFPA 3F74A 1Z22A 3KYJB 3VSAA 1VECA 1J5PA 1SKUA 2JGIA 3DV2A 3O4GA 3Q2OA 3QOFA 3RYFB 3V4FA 3L01A 3KIPA 3OAAA 2J30A 3MUOA 3C3CA 4J7UA 4QYSA 4JEMA 3R09A 4WASA 1BXKA 1L7RA 5FUQA 1CQIB 2IYUA 2X9LA 3FGPA 1VYUA 1KYWA 4KIGA 1JMYA 2NZVG 1JEEA 2BLLA 3NDIA 3P1JA 1O5TA 4UUOA 4YI5A 3RSZA 5IBCA 5JSUA 5HKLA 2Q50A 2GFQA 4CM5A 2RI1A 2VF5X 1BSVA 1VJDA 5C4MA 4MVJE 4BLPA 3HA3A 4FZJA 1YS2X 4N5NA 4CHGA 3KQUA 1G2OA 1Q0QA 2AG5A 3AL3A 3Q3HA 4ZHSA 3HJTA 4TXMA 1WXQA 1JR4A 2QSZA 2VEOA 4MTCA 1WTAA 3I01A 3NGLA 2JI7A 2ZE6A 3R2JA 3QX7A 1EP2B 3RF6A 1ZJZA 4RD6A 4CTMA 1BFUA 2WB4A 3G1WA 3PICA 3ZE1B 4YT2A 5KYYA 5EGSA 4UM8B 1MMFB 4EPYA 1BFKA 4AX4A 4EMTA 5HQ3B 1G4UR 3A1EA 3AETA 3BAZA 3SEQA 4PYNA 1YB7A 1EMDA 3UN1A 4MV9A 2TS1A 4UUBA 3GROA 4X45A 2GK3A 1ZEMA 3HJUA 4ZCLA 2A5YB 4YXWA 2DQZA 3O2SB 3PDIA 4Q1EA 5TT1A 2QR2A 1PFKA 4DIFA 1XIVA 1T2UA 3H1BA 1UKZA 3FOZA 4Z0PA 3P9YA 4PM4A 4TS3A 2RGNC 1B26A 4BKQA 2BFAA 3CX4A 2EW2A 4GZ5A 1RQXA 2P2GA 3FCUB 3VX4A 4AY3A 5IYZB 5KTNA 2WJ3A 5CTJA 1TU3A 1K2WA 1Y5RA 3U4QB 1VL1A 4GMKA 4KDEA 3R7FA 4AJ9A 2ZUFA 2JJ2D 1Z25A 4KQJA 2YOHA 1P9OA 2WYIA 3O21A 4LK2A 4LZWA 5ENVA 4H7IA 5SY4A 4EB8A 1G59A 1Z56C 3TIGA 1XZBA 1H2BA 2WVAA 3EXFA 1BD3A 3H11B 3QUAA 3U40A 3WLJA 5AHWA 4WQMA 5LR6A 4MVJP 4N3GA 4V0NA 1UBUS 4BO1A 3DDSA 3MK31 1W9HA 1ZP6A 4JYZA 2NUAB 1YS1X 1GYQA 4NYMR 3B6JA 4XCVA 3ZIUA 3GU3A 2M6RA 2W2OA 4H4DA 4NI5A 3ZDRA 3CF6R 2OFWA 3BD8A 3K4HA 4CM6A 3ETEA 5A04A 2XB4A 3A36A 4KDRA 4ZOLF 2WWWA 2RGDA 5L4NA 5LLTA 1VPLA 3MLBA 3TIVA 4MHTA 2GF2A 3TW6A 5I8WA 1KC3A 3ICWA 4OQEA 4XD7A 3CF4A 1E58A 3WK5A 2FPRA 4CKBA 4URXR 3NI2A 3IBFA 1PQUA 4ESVA 3CB4A 4D2IA 4QUBA 3BJMA 5U4QA 3GJYA 4HT3B 2X2FA 1MU0A 3EC2A 3M1IA 1WZCA 4E6EA 5KYUA 5BUQA 3B1XA 1QH0A 1O77A 2GPWA 2IE0A 5J63A 4CMEA 5JZBA 2PN1A 3FMFA 4RD4A 3KDAA 1VSTA 4JKOA 3HP7A 1BMTA 3CZAA 2A1TR 1E5LA 2GLUA 2G9QA 3CRNA 5DM70 1I4EB 1B8PA 1C30B 1VG8A 2EP8A 2RC6A 3B9BA 2IXDA 4MDHA 3SOZA 3TE7A 5I7HA 2E4VA 3LFTA 5KMGB 2WHYA 3D3NA 2GVNA 3OEYA 1HXHA 1XDSA 1WA5A 4O4JF 2P6RA 3EJ6A 3KQLA 1WMEA 1XWIA 3QU4A 1N6PA 2XVYA 3ISTA 4OBXA 2P27A 3DTYA 1SXQA 1N4AA 4EHBA 2E4ZA 2IPAB 1XJCA 1RWKA 4CM8A 3IDZA 3Q10A 2X3YA 2C2HA 4IW3B 1B8OA 1O9HA 3NORA 5JDIC 2JAXA 4J90A 5I7SA 1QG6A 3QA9A 1YONA 3A6LA 3HHPA 3A4TA 3AVTA 4TLCA 1QHFA 4XVQA 2PHZA 1RI5A 2JH8A 4O4IF 2ZYSA 3RTDA 3CZ9A 4CEIB 1MZVA 2WFZA 3DMGA 1E8NA 4WFIA 2G5CA 4XYEA 3LKDA 4IMPA 1LFAA 1Y6ZA 4HGOA 3O9MA 4KV9A 1FRVA 4TMFA 4V1CI 4X60A 3Q1KA 3A1FA 3UMVA 4P7KA 5HZGA 1JAHA 2V59A 1ZD9A 1YWGO 3SX0A 2O8EB 4WINA 5CH3A 5CA0F 1NLUA 2I4NA 3F3SA 2A9PA 5AK5A 3WGGA 1G2IA 1IJKA 2XOXA 3D3WA 4LJ9A 4PFJA 2AJ8A 1K3FA 2WT8A 1LDNA 1POXA 1TM2A 3DZJA 5IH7A 1HQKA 2FMUA 3NNSA 2IHTA 2RB5A 3I6IA 5LQRA 1KJZA 1P9NA 4AY6A 4D56A 1JAYA 2JLSA 4G6ZA 2UVPB 1QDUA 1K7XB 3U3RA 3D6FA 5BV1A 3IQXA 1DRVA 4X8MA 5EKDA 3P2OA 2A0WA 4TUYF 4TOIA 2Z6UA 1R9NA 3OCWA 3AJEA 2CNBA 3ZE0B 3KZNA 3ZWYA 3O1HB 2ZJ6A 2DWPA 4BEJA 5BOSB 2P3QA 5LC1A 1NURA 1IHOA 4NJMB 4DLYA 1IK4A 5B58C 2GASA 2ONYA 4BNUA 3OZWA 2LRHA 3RVKA 2AF3C 3R5XA 3KFXA 3OVMA 4BTVA 3SG0A 3ADBA 1E1LA 4H6XA 4ZOAA 4H7HA 2OD7A 1ZHFA 4G23A 1OC2A 5H02A 5HYVA 1AS0A 1E7MA 2HA3A 5TPZA 3KOYA 5IJAA 2C4TA 2VP5A 4GOXA 5LL6P 4EI7A 2CWWA 4LN1A 2XCQA 3KQTA 1T1GA 4K9PA 5G1NA 5IM4A 3BMQB 2Q0HA 3RIMA 1BXGA 1L5SA 3CVOA 1Y3CE 4GXQA 4IWNA 5JR3A 1AN0A 5E95A 1MNQA 2J7PA 4KMRA 4UCXA 5C46F 4U02A 5K09A 3VV2A 1Y8RB 1JIJA 1PT9A 3O8OA 2ZRKA 4CVNA 1XVIA 2ZR9A 1YC2A 6LDHA 1AURA 1OI7A 3ED1A 2XD9A 5HTOA 3IP6A 5H68A 4I5GA 1VPEA 4Y6LA 4K6FA 4RE6A 2VAXA 4QDUA 4OQNA 1KJYA 4R9NA 1ISSA 2H6EA 4BRWA 2H4ZA 4EY7A 1HKHA 4ZN6A 3MVEA 2BGRA 3C15C 4H3SA 5KO2A 5LQAA 3WS7A 6PFKA 3I01M 3FMPB 1Z8FA 2OG1A 3N76A 3G2OA 3GRCA 4G0XA 1EE2A 4DL9A 4EWLA 4GL2A 5C34B 3NEJA 4AMUA 2FQYA 2HTFA 2Z2IA 4WJKB 5I7FA 1BCSA 3BL6A 2JJYA 2F4VB 3T3OA 4OKNA 4RTQA 4JU9A 5IAJA 1YASA 2CXRA 1PL6A 2HSZA 2DGDA 3H9EO 4MVXA 5DM2A 4OJMX 1ADFA 3HKDA 2H1CA 5DBIA 4OH1A 3ZXYA 2VAVA 4U7WA 1VE7A 3A4YA 4IHJF 5ICCA 1FXSA 3WSVA 4WNYA 1B2RA 4HQKA 5CT6A 3HLTA 1Q77A 3DONA 3HKCA 4RY0A 4BUCA 1YZQA 4XGNA 2C5BA 2ZITA 3BM5A 1Z5ZA 4Y2YA 5KVQA 3PFFA 1UH5A 4JLSA 3V4VB 2VOJA 3GJRA 4RK7A 3CIFA 3QU5A 1UL1X 2G04A 4BU1A 3WXMA 2E21A 3BWBA 5JISA 1ZH0A 2BKVA 3VR2A 5BV7A 1RXWA 1GD1O 3LQYA 1FPQA 2PXXA 4MMYB 2H54A 4EH1A 1QSGA 5BQPA 4D8YA 5CBPB 2FPPA 2ST1A 4FGUA 1QIGA 3L41A 1B74A 1SD1A 1SXJC 4UDYX 1YXMA 4DDWA 4POOA 7YASA 4AKIA 1E8MA 2Q4EA 1UDRA 4QYIA 4I4TA 2NPOA 4NKRA 4ZVRA 1FUUA 4B1FA 4AZTA 1JNYA 1M2JA 1VMKA 3I42A 4C0HA 4RADA 3ZLTA 3BMNA 1YF3A 1ZVQA 3Q3JB 2QLFA 2PRYA 5CLHA 5EYPB 1N0VC 3H4MA 3D81A 4JJEA 4JOQA 3RFCA 1ZKDA 2VHVA 1KAMA 2P0YA 1F9EA 3IXQA 2R4QA 1AZLA 2CFOA 1KXJA 2GPYA 3HKEA 1IYZA 3KHTA 3DAPA 4YCNA 5K0EA 3I62A 3QOYA 1E4YA 1NVBA 3BD9A 5LP6A 3DBVO 2H8KA 3W5DA 1KO8A 4F9EA 4ZZ0A 4XCXA 3H5VA 3IQHX 4GOMD 1FLVA 1Y33E 4TMVA 2GYUA 1FP7A 4JZYA 4IIDA 2IVFA 5M3BA 2BY4A 1K9VF 3EF0A 1O97C 3I2KA 4FZRA 5EJ9A 1GLGA 1AUXA 4XH9B 4BMSA 2NPFA 4C05A 1JDJA 4LVUA 4OHVA 3T0IA 2VATA 2YXPX 4UTZA 4MCAA 3LMKA 1I2AA 1PZMA 3FCOA 1NAHA 1PEAA 1OXBB 1F38A 3K5HA 3OF5A 3TLKA 3WLSA 1U2RA 2I8CA 4GWLA 2EJUA 4TLBA 2FSFA 4EKEA 2DLCX 3ZU6A 2C3UA 4B6OA 5D01A 4YJFA 4G67A 2YOGA 4K0KB 2BGGA 3UAWA 2MU1A 4GP6A 1YRWA 5C8ZA 1A1VA 1T4DA 1E2BA 3WLEA 5CVEA 1ICIA 2R5NA 4GH5A 3BXGA 3ZVMA 4TRMA 3R5FA 3HC7A 2FSVC 1E3WA 3VU1A 2IYRA 1P5ZB 2ZUBA 3U3XA 2H5EA 2PGLA 3GP3A 3QXGA 4P93A 4A23A 4DSNA 5IKMA 3UOWA 3TKAA 1JHAA 1JQBA 2WSLA 3KBBA 5B2ZA 1ZL0A 2ZUSA 1F0YA 2BHTA 3IUEA 5K8IA 3PQEA 1AGNA 2IYXA 2PSSA 4DMUB 2XYGA 4CCAA 3TZLA 5JPDA 5LYJF 5GIOE 4TV8A 2Z3ZA 5AW5A 4E12A 3P9SA 2R8BA 3JASA 3ZDZB 3BQ9A 1ZMRA 3HP4A 4AMZA 4N03A 4N7JA 2PXHA 1RNLA 4IIBA 4D9MA 2G5PA 3DL4A 3EODA 4RKQA 5FFNA 1DFIA 2VJLA 3MFQA 1G21A 4M1YA 3DPSA 4EF5A 4R9VA 4R7GA 2K87A 1AXEA 2PVPA 4J16C 4QGAA 3EVZA 3EZ2A 2A5GA 2PGOA 5JH7B 1XZFA 2K5UA 2Y0EA 1CQJA 4QHSA 4UHCA 3FROA 4O2BB 5DW0A 3JQBC 4CMGA 1XTRA 1J9ZA 1X7ZB 1TZ2A 2BGUA 3PK0A 4AG6A 4F3CA 3EWNA 2PZLA 4TXLA 1X87A 1Y4ZA 2IX9A 1IVNA 1E9SA 5LU9A 3KHUA 5IWAB 4D26A 5JZ9A 3WMEA 3ICEA 2C61A 1Z4JA 1CY2A 1OD6A 3BKXA 4MUIA 1G7RA 5JHGB 1YDWA 1FFXA 1UDXA 4OXQA 3FYHA 3UHFA 5B7GA 3KSZO 2E4UA 4LZJA 1U90A 4WZBB 2HL6A 3WMGA 2E7ZA 4L0CA 3RASA 3CGWA 2BCGY 2X2OA 2QF7A 2XAUA 3FSGD 3VOTA 2C57A 1KJ8A 4UNSA 3T9CA 1XAIA 3E05A 3PE6A 4B4DA 1Z4MA 1X1DA 3LWDA 3OPVA 1Q57A 3IVCA 2C2XA 1TIKA 2B9VA 3S2UA 3DW3X 1NT2A 2Q1UA 4H4CA 3U7RA 1DV1A 1CY0A 1NGSA 1QGED 1AHIA 3I04A 3NIBA 4HPXB 3W90A 4KDCA 1FOEB 4RFLA 2ZYWX 1RKUA 3ZBPA 4U7HA 3KETA 4IVPA 1FLDA 3FVTA 4IG4A 4RORA 2R66A 2R60A 4TKMA 1DKNA 1LFDB 1CRLA 4AMYA 4M55A 1SG0A 2A92A 3OTIA 4YRMA 3OPNA 2DJIA 1TVMA 2N75A 3C45A 4YVFA 2O7NA 5DYTA 5KINB 1DTWA 3DMNA 4XVUA 1DC3A 1M0SA 1SGWA 3GY0A 4L8YA 1DZIA 3G8AA 1OXXK 3N2NA 3KKEA 3KTFA 3LUBA 1YL5A 2ID9A 3LQFA 4J49A 3SBDA 1BQEA 4PFQA 4YIKA 3JWPA 5H81A 5BVHA 5I01A 3EIWA 3VISA 3THWA 4IDOA 4TVBA 3KO8A 2BEKA 2V6BA 1RADA 5JNVA 1XXLA 3GGJA 1Q14A 3HUDA 3E9YA 1W30A 2DKOA 4GICA 3MQFA 4I6JA 3UIEA 3WJ7A 1FFHA 1F8UA 4KITB 3GVHA 2AV6A 2QORA 4BFLA 3U37A 2BCEA 3IELA 5DGXA 3OESA 3V7FA 1U8AA 2PUGA 5FBRB 4BJHB 4DRXB 2Q6KA 4G0YA 3E82A 1REQA 2JHPA 2AMFA 1BWRA 2CFCA 2XTMA 4GKJB 1TYZA 3PBKA 3HUUA 1TL7C 5ALMA 4CU5A 3WJ2A 4CMHA 5IWCA 4LHZA 4RFVA 3ADPA 3IV6A 3BL8A 4ZO4A 3USCS 3STUA 4JXJA 2O8CA 1WUKS 5AW3A 3GLIB 5FLKA 1HEUA 2J5QA 4RXMA 3H83A 4JB0A 4U1RA 2AJTA 1KYZA 2ODTX 1MABB 4G4JA 4HY3A 3PEUA 3RTEA 3SHWA 3UWKA 1T6BY 4B7ZA 3VO8A 1VA4A 1UBJS 1D0SA 1XJ0A 1E3DA 3WQHA 3CRRA 3I45A 1H0SA 4GSKA 4D9JA 3ECCA 3M9LA 2VJMB 3OQJA 5TX7A 1PVDA 3I92A 4EYSA 4MRSA 2PD4A 3EPHA 4JLKA 1TJNA 3K05A 3GWZA 4K8OA 4OQPA 3AEZA 3LC0A 1U94A 2IY9A 5HMLA 3NASA 4HEA1 2MINA 1XN4A 4J6FA 4ND6A 5DRYA 4ZXPA 1Y9JA 1U63A 2JFWA 2QQ5A 2RHOA 3ZKAA 1GGHA 3K9NA 2ZBGA 2GRAA 3HNRA 3OFKA 1OOEA 5E2BA 4PGHA 4BN4A 2YYYA 4WVLA 5KKCA 3I76A 3U49A 2AG6A 2WIKA 4LWOA 4Y6OA 5ENDA 1G5FA 4GP9A 1R8QA 2ATVA 3HCDA 1L5ZA 3KC2A 2RH4A 4NG4A 1SK9A 2HW8A 4UUQA 4JLNA 5IPFA 3OFSA 3R5HA 4KYUA 2X5XA 1O57A 1PLJA 1ZC3A 2OGTA 1T2CA 2D4AA 5BN1A 1VHQA 4E2YA 3B3FA 3QX8A 2WUVA 1T4CB 4FGWA 4ARAA 4X3OA 4B2IA 4B5LA 4EPVA 1L7AA 5HUJA 1E64A 3HWRA 4RETA 3G02A 2OORC 4PAOA 4JK3A 5J4KA 4OATA 2GF0A 4KRXA 2HDHA 3KB2A 3RSFA 1JQDA 1OU0A 1QUFA 2FWNA 2L19A 2VNKA 3ABOB 3HFRA 1NQVA 2Z2YA 1OYYA 3ANTA 4JLDA 4LY6A 4P0QB 3K2QA 3PWKA 3DZDA 1S8OA 3KYDB 4H59A 4N0QA 3TXYA 1R27A 1KOLA 1RQGA 5LCXA 2CB9A 1K06A 2ECKA 1QK3A 2YZ2A 3FUVA 4Q00A 5EJGA 2PUCA 1D7AA 4V1CA 1JEJA 3QKSB 1I6WA 3S1SA 1A5ZA 1JZTA 1VJ0A 2WK1A 1JW9B 4L9SA 3G0IA 2J9RA 3CUVA 1EU1A 1MEJA 5E9AA 1Z4KA 2Q8QA 5F64A 5B12A 4BAGA 4OLAA 3WWCA 2DULA 2IOHA 1ZS9A 4YBZA 2H5LA 1K6MA 1DIHA 2VDUE 5K4GA 2IHBA 2IOFK 1O03A 2A2ZA 4PBTA 5AVJA 2J85A 3RK4A 4EB6A 5DSTA 1SC9A 4NBKA 3EMVA 4PQGA 4KAJA 4H7JA 2GAAA 4M0EA 3T12A 5KTTA 3GG2A 3EGEA 1LX6A 2DBRA 2ZUCA 4GKVA 4B3JA 4KK3A 2CL5A 1YIOA 2EERA 1X15A 2X0IA 4O6VA 2QS9A 1GP2A 4FEAA 1GGVA 2JDID 4INZA 2QN2A 3DOHA 4IGFA 1B00A 4D0LB 2NWQA 4CUJA 5KBYA 5KVAA 3P2YA 1M75A 2BM1A 2ZWOA 1NHGA 5I3ZA 3CKMA 3D7KA 5FPPA 2XE6A 3AR6A 4FJ1A 3SR0A 5C5CA 1EEXB 3Q88A 2KB0A 2FI1A 2P8SA 3KK0A 4L4RA 1I7PA 2GEBA 2P90A 2BN4A 1QIJA 1TQDA 3UMFA 4AZVA 3DUFA 3MC1A 2HCBA 4DA8A 2QTNA 1W93A 2CE2X 4EEZA 2PL9A 5IAGA 3T3PB 3MUNA 1Z12A 2QRVA 3SZRA 4E46A 3TWOA 4S05A 2RONA 4I0WB 1WLSA 2ZRJA 4NNOA 4GVXA 3KE8A 4CGZA 1JG7A 4MARA 5EIXA 3RRZA 1T43A 1ZD4A 1LVGA 5B58T 9LDTA 1E3MA 5CA1A 3DXZA 3FDZA 1QHHB 2X5OA 2AKYA 3VTAA 4KSCA 3UWSA 5BVGB 5JS8A 1HT1E 4RGQA 1OB2A 1MHTA 3PNMA 2JKYA 2ISQA 2VR1A 4IGIA 3ONWA 1DX6A 1QOQB 3RE1A 4I1YA 2ZETA 4NATA 4MYTA 2I1LA 4HTFA 3NBMA 1EE9A 3ND5A 3U0VA 1K66A 2OGZA 5I4CA 2KHZA 2O0HA 5K1ZA 3GJ3A 4OXXA 4IJQA 3P0EA 2KM1A 3IMEA 5CYGA 1RLMA 3MTJA 1V9CA 4FBLA 1QO7A 2JK1A 2ZYIA 3INYA 3AVQA 1B8UA 1E77A 1Y5NA 2P40A 2UYGA 1T2FA 2GJSA 2JGKA 4PHGA 4B4WA 1NVWQ 2IGTA 5EP2A 5B6JA 2BI4A 2IZZA 3PDJA 3Q8WA 2VNSA 4MKRA 5FTMA 2P9YA 3W6NA 1GGEA 1YHYA 3ETJA 3H2IA 4RPLA 3E7FA 1RJDA 1DBRA 1YQ9A 1VSQA 2ZIFA 1H2YA 4TWRA 3IUBA 4D9FA 3OZFA 4CTOA 4EG3A 1Y3HA 1VPTA 3C4QA 4X1YA 1QF7A 3RVBA 4O2AB 3HNPA 3G9UA 1JTVA 5BSWA 3IKLA 3OMWA 4XB6B 4OMDA 5A9SB 1Z0AA 2CHVA 3PUIA 4PC6A 1L5VA 2EVWX 2ILVA 1QKKA 4YGYA 4CFYA 1SBYA 4RZXA 2RGNA 3A4IA 5K8UA 2AR7A 5EQDA 3SI7A 3FB4A 2I54A 5B3KA 1X14A 4QBHA 2J67A 4AICA 3L7DA 1PR3A 1RXSA 2NVOA 3HCBA 1Z73A 4Q1BA 2WHPB 3OBBA 1O0CA 1WB5A 3AUYA 3E3MA 4HAIA 5T67A 3HB0A 4I4LA 4PCVA 3VX3A 1JMKC 1KVQA 1KSHA 1PTJC 1T6ZA 1OXSC 1X7XB 1YDMA 4EQ6A 1BCRB 3R7WB 1ZIDA 5IZCC 5FBQB 3CNLA 3ZZTA 4NCKA 5ALYA 1Y1PA 3U7GA 4A0SA 5CLQA 2XUZA 2ZOSA 2F62A 1SOAA 1V11B 2OK7A 2E87A 3V8MA 1T2DA 2Q3JA 2XMPA 2ZVPX 3F67A 1U2ZA 3DL2A 2ZTVA 3Q40A 4TLAA 4YJ2F 4E1AA 4C3ZA 1TA0A 1AE1A 1JJFA 5CYOA 1M5TA 3TECE 4LMRA 1D2RA 4WCFA 3VH2A 1NHWA 1YRQA 4G5FA 4U7GA 3ZLVA 3ZW7A 1QHYA 3GOHA 4MCJA 4HZGA 3SJZA 3LG2A 1GVNB 1N3IA 2Z0MA 1QANA 2R4UA 3C3DA 4HFRA 5KNBD 2QXYA 3B5JA 3GP8A 4A5SA 3SYTA 4OREX 1G8JA 1HYQA 1ZH8A 4KO3S 5F4ZA 4ADSG 2XE8A 3GT7A 1ZVMA 4FZ5A 3SHFA 4BX3A 2FP4A 4GI5A 4PRYA 1ZOLA 2P62A 2PD3A 3H4VA 3L9XA 5DEOA 5EN4A 4CMIB 1BDIA 3V2UA 1EXDA 5A0TA 4XRGA 1SOVA 1B2LA 3H5TA 3PPWA 4ZZ3A 2GZ3A 1V0JA 1CEQA 3UJ9A 4F3NA 3SQNA 2WJPA 2HXYA 3OZVA 2C2ZA 1FFAA 5EWJA 3SQOA 3FPEA 3E5HA 1MC4A 3L8DA 3FMVA 3NXSA 1X1RA 1Z3IX 2H7XA 3FFAA 2H92A 3GCZA 1Z17A 1P2UA 1RLJA 1ZDMA 2JIRA 3PGKA 1C2TA 3R9IA 4YLEA 1KQNA 3FF1A 2IZ1A 5HCIA 4NZOA 4TTTS 5EIOA 4AWBA 4Q5IA 5F9FA 3F46A 4PNHA 3VZCA 1KJNA 4PHTA 2DHDA 4G01B 4H31A 2C3PA 4OHFA 5EUMA 5CFPA 3JZFA 4DBLC 4IEFB 2VTBB 2QVBA 4NU0A 2YINC 2P4QA 4XB2A 1HMPA 3H17A 2WUFA 3GPBA 2Q2NA 3IQWA 4IKPA 1Y6FA 2WW8A 4J2HA 4LZZA 1NVMB 1P18A 3LP8A 3O26A 2ZYRA 3LCVB 1N9ZA 4IH1A 5DX0A 3KQNA 4ASUD 2YHBA 4PW0A 4I14A 1M2HA 4X8OA 4Q9JA 1BS1A 4IUYA 4YV1A 3SJUA 4HN4B 1XZAA 1WWKA 2JVJA 3GDGA 1HLDA 5F7OA 4RVOA 3ZZNA 2N9UA 4A0GA 1QU2A 5DO9A 1TDJA 1ISIA 1MO2A 4CG3A 1XJWA 3UK1A 3JQPA 2DTXA 1EEHA 1KVTA 1Y42X 2VRCD 2WNHA 3L0DA 3ODPA 3ABSB 4MUNA 1G18A 4NP6A 4KSYA 5AM5A 3HRIA 3PNQA 1Z8NA 5AUNB 1EUCA 2PGJA 3HR4A 4P54A 2C00A 1H0RA 2A0XA 4FEYA 4FT2A 4HXGA 4DQLA 5JXHA 3ACDA 3B89A 4M9UA 4YAJA 2Q9AA 3NYWA 4D43A 3BSFA 3GFBA 4A36A 5I7UA 1EFVA 1O6FA 3LCMA 5AD1A 1JBKA 2IZ7A 1GGFA 4JQZA 3T52A 5F5LA 3UH0A 3PNPA 4G5RA 5DM0A 1P4RA 2GCIA 2VP4A 2E6KA 3IAFA 2EJBA 1JRLA 1W76A 3HO8A 4JI6B 4C3VA 2D7DA 3DD5A 3C98A 3CLTD 1NVDA 2R5FA 3LT4A 4OI2A 3DXXA 4U6QA 4UM9B 2IU0A 1ZN8A 3KVNA 4PLYA 2W2XA 4Z9FA 1QYXA 2ZIGA 4CR7A 4PPNA 2HREA 4JOBA 4AJEA 4ZFNA 3NJRA 1OYOA 2P30A 5IF9A 1MJFA 2H18A 3MILA 1FP4A 3A9CA 3EG9A 4DUGA 3PL1A 4UVDA 4R3WA 4F1KA 4ZOLA 4JY7A 4JP5A 1V5IA 3B6MA 5CJJA 3EA5A 2PUJA 2QK4A 4FFPA 5EZ5A 3FHTA 3I5XA 1OJ7A 1T1IA 4L8GA 3H9CA 1QJ4A 1ZX1A 1QGUA 4CZ2A 3EPKA 1MAWA 2BELA 2P77A 4WZBE 1R0RE 3CM0A 4QULA 3H86A 1UXGA 4N7MA 1RU3A 4YCSA 4PZ0A 5KHLB 5LJIA 1V41E 1CZUA 2QJRA 3RYTC 1DS6A 4DNFA 2B92A 4K6GA 4NZNA 1BW9A 2CXXA 3VJKA 3UXEA 1CUVA 1ZW1A 2R1TB 2W8BA 3SIXA 3NWEA 4P3PA 4G0MA 2XVZA 2C9OA 1CIVA 2R751 1I5EA 4MITA 2VYFA 1QP8A 4QM7A 3COJA 5FWXB 1F2DA 1EDZA 3I3SR 4OIFA 3TRHA 3LFUA 3TQHA 3WZ2A 3NB0A 3GELA 3IPLA 5CIQA 1FNNA 10MHA 2P9JA 2SCUA 5DSXA 4EYKA 3O4RA 1ENPA 4O4JA 4MGEA 4G0WA 1EXMA 1RYNA 3K1AA 1UMBB 2O1EA 5BMVF 3DPUA 2V7PA 4KL8S 3IUYA 1WJGA 3H5NA 1WP9A 2JEYA 3A4VA 1BE1A 1J56A 2NUBA 4MEJA 4O0MA 1QGAA 1DDGA 3N8DA 2IBTA 4DIEA 2JG3A 4WLFA 4Y9TA 1M72A 1UK7A 2ZRQA 3J7AC 4E5DA 1IOLA 2RHHA 3HA7A 4JX8A 3A8TA 4FT4A 1L5WA 4OP2A 5L7YA 4Y6PA 1Z62A 4O4IA 2FCRA 4GBJA 1T0UA 5CB4B 3ZY2A 4N0PA 3QFFA 4JQYA 3W5CA 3GUCA 4EP1A 4ZQBA 3SQXA 2D00A 3SEFA 1L7BA 4D57A 1AO0A 3VAYA 4MLCA 1TIBA 3VGJA 3L6EA 1XDGA 3NTQA 4ZTBA 4BV2A 2ES4A 4UEQA 1TEZA 3PXAA 1QG0A 3DC7A 1Q1BA 3MXTA 4L78A 1JQAA 1I36A 2UYHA 4LRWA 2GNPA 1BHSA 1RXUA 1SZPA 5CA0A 5JO0A 1U8EA 3TPCA 1ZJYA 2QL6A 2XAAA 4Q34A 3O1LA 2EJVA 3EXHB 3MQ4A 4ND8B 4QATA 4NCIA 1EWQA 3FYTA 2YWRA 3H2KA 2AFHB 3MTQA 3EZNA 4YH1A 4MW9A 2ZQZA 4LXHA 1H2FA 4OM8A 1JBEA 1EINA 4QYTA 4BEWA 3OE7A 5G4KB 3GLIE 1ENOA 5LIRA 4ZT6A 3LT2A 4OAOA 4YRGA 4PEVA 1P2BA 4NFHA 4L3WA 4U7TB 4BHTA 2XXAB 4ALKA 1NYTA 4GU5A 4JD5A 2V97A 3JVIA 1ZD5A 3D6UA 4TUYA 3LVFO 4I4CA 3HY4A 3NTVA 1T36B 5TVKA 2VWPA 2EZUA 4G1VA 4EZBA 1VKRA 4ZAZA 3FYDA 2IJGX 1E62A 4CMBA 4QO8A 1M8GA 1XC7A 4HAYA 4CMKA 1OXUA 3TLAA 4ZODA 4F97A 3L8CA 3WGKA 3UGJA 3RODA 4AJKA 4BECA 1U0OC 4IDBA 5K2MA 1NC3A 5EAIA 3I1FA 5A1JA 1L1RA 4YRIA 5H5JA 1RYHA 5T3YA 1N3YA 1W5FA 1V1MA 1QG2A 4DBVO 1ZPDA 2RHCA 3TX6A 1G6OA 3VR4D 2DH5A 1AO3A 2VDOB 4M6WA 5T8KC 4WN3A 1CRPA 2BC9A 1KOJA 2CY0A 4JU8A 3N7TA 4M37A 4FGSA 4YDQA 3ENZA 1DKUA 3ZV4A 3CLSC 3WIVA 4Q47A 5KYVA 5JYBA 2FSVA 5KYWB 3WP0A 3FFTA 1FMCA 3I9LA 3V8RA 3A9UA 1JXOA 4FCWA 1L6IA