1O9AA

Solution structure of the complex of 1f12f1 from fibronectin with b3 from fnbb from s. dysgalactiae
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
93
structure length
93
Chain Sequence
SKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title Pathogenic bacteria attach to human fibronectin through a tandem beta-zipper.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 8
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1o9aA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1o9aA01
2WIIC 1GKGA 2RLQA 4KKDA 4CSYA 1E8BA 1PPQA 2CG6A 2O39C 4WJG2 3CALA 2YBYA 4DJZA 1E88A 2RL0A 3O8EB 1OJYA 4ZH1D 2JRAA 1LY2A 3ZD1A 4LOSA 3NFPI 1H04P 4B2RA 2IZ3A 4J38B 5HYPA 5JPMG 4IGDA 1H2QP 3KXVA 3ZD2A 3OXUD 4JHSA 2B5ID 1GKNA 2EC3A 3T5OA 1ZJKA 3SW0X 2RKZA 1TPMA 4A5WB 1UOTP 4AYIA 1OK9A 1Z92B 4AYMA 4PZ5A 2JGXA 1O9AA 3RJ3D 3M7PA 1FBRA 1CKLA 3R62A 3TVJA 3L89M 5FO8C 2CKUA 1QO6A 1VVDA 2BZMA 2W80A 1SS2A 3KZJA 2XRBA 2IZ4A 1QUBA 1QGBA 2RLPA 2G7IA 1HFHA 4YNXA 2V8EA 3OP8A 2MCZA 3INBC 1MD8A 3MQLA 1HFIA 1OJWA 4AYEA 4AYDA 2YRAA 5HYTB 1GPZA 1TPNA 3IU3I 1H2PP 4MUCA 1TPGA 3IX0A 2KMSA 2XWJI 2LOJA 2JGWA 1MD7A 1U5MA 5I0QB 2UWNA 3GXEA 2RKYA 3OEDC 2W81A 1G4FA 1OJVA 1SRZA 4F4OC 1VVCA 1ELVA 1OK2A 3ERBA 4K12A 5HZPB 1H03P 1E5GA 4C16A 2EHFA 1G4GA 3ZRZA 1OK1A 2QY0A 2XWBF 1C1ZA 1OK3A 3GOVA 2CG7A 4ONTD 1GHQB 2MCYA 4FXGG 4LOTA 2A55A 2XRDA 1NWVA 5HYUB 1HCCA 2ERJA 3EJHA 2KRIA 2XQWC 1Q3XA 4B2SA
chains in the Genus database with same CATH superfamily
3FGRA 5DN4A 4PO7A 2WIIC 1GKGA 2RLQA 4KKDA 4MSLA 4CSYA 1E8BA 1PPQA 2CG6A 2O39C 4WJG2 3CALA 2YBYA 4DJZA 1E88A 2RL0A 3O8EB 1OJYA 4ZH1D 2JRAA 3WSXA 1LY2A 3ZD1A 4LOSA 3NFPI 2Y8RA 3F6KA 1H04P 4B2RA 2IZ3A 4BWCA 4J38B 5HYPA 4YIZA 5JPMG 4IGDA 1H2QP 3KXVA 3ZD2A 3OXUD 4JHSA 2B5ID 1GKNA 2EC3A 3T5OA 1ZJKA 3SW0X 3FGTA 5DN5A 2RKZA 1TPMA 4A5WB 3VWOA 1UOTP 4AYIA 3CI0J 1OK9A 1Z92B 4AYMA 4PZ5A 3NJAA 2JGXA 1O9AA 3RJ3D 3M7PA 1RLHA 1FBRA 1CKLA 3R62A 3TVJA 3L89M 5FO8C 2CKUA 1QO6A 1VVDA 2BZMA 2W80A 1SS2A 3KZJA 2XRBA 2IZ4A 1QUBA 1QGBA 2RLPA 2G7IA 2Y8TA 1HFHA 4YNXA 2V8EA 3OP8A 2MCZA 3INBC 3K3TA 1MD8A 3MQLA 1HFIA 1OJWA 4AYEA 2Y8SA 4AYDA 2YRAA 5HYTB 1GPZA 1TPNA 3IU3I 1H2PP 4MUCA 1TPGA 3IX0A 2KMSA 2XWJI 2I2LA 2ZYCA 2LOJA 2JGWA 1MD7A 3ZLDA 3WSYA 1U5MA 5I0QB 2UWNA 3GXEA 2RKYA 3OEDC 2W81A 1G4FA 1OJVA 1SRZA 4F4OC 1VVCA 1ELVA 1OK2A 3ERBA 4K12A 5HZPB 1H03P 1E5GA 4C16A 2EHFA 1G4GA 3ZRZA 1OK1A 2QY0A 4APLA 2XWBF 1C1ZA 1OK3A 3GOVA 2CG7A 4ONTD 2X2ZA 1GHQB 2MCYA 4FXGG 4LOTA 2A55A 4N7EA 3ZLEA 2XRDA 1NWVA 5HYUB 1HCCA 2ERJA 3EJHA 2KRIA 2XQWC 1Q3XA 4B2SA
chains in the Genus database with same CATH topology
2WIIC 1GKGA 2RLQA 4KKDA 4CSYA 1E8BA 1PPQA 2CG6A 2O39C 4WJG2 3CALA 2YBYA 4DJZA 1E88A 2RL0A 3O8EB 1OJYA 4ZH1D 2JRAA 1LY2A 3ZD1A 4LOSA 3NFPI 1H04P 4B2RA 2IZ3A 4J38B 5HYPA 5JPMG 4IGDA 1H2QP 3KXVA 3ZD2A 3OXUD 4JHSA 2B5ID 1GKNA 2EC3A 3T5OA 1ZJKA 3SW0X 2RKZA 1TPMA 4A5WB 1UOTP 4AYIA 1OK9A 1Z92B 4AYMA 4PZ5A 2JGXA 1O9AA 3RJ3D 3M7PA 1FBRA 1CKLA 3R62A 3TVJA 3L89M 5FO8C 2CKUA 1QO6A 1VVDA 2BZMA 2W80A 1SS2A 3KZJA 2XRBA 2IZ4A 1QUBA 1QGBA 2RLPA 2G7IA 1HFHA 4YNXA 2V8EA 3OP8A 2MCZA 3INBC 1MD8A 3MQLA 1HFIA 1OJWA 4AYEA 4AYDA 2YRAA 5HYTB 1GPZA 1TPNA 3IU3I 1H2PP 4MUCA 1TPGA 3IX0A 2KMSA 2XWJI 2LOJA 2JGWA 1MD7A 1U5MA 5I0QB 2UWNA 3GXEA 2RKYA 3OEDC 2W81A 1G4FA 1OJVA 1SRZA 4F4OC 1VVCA 1ELVA 1OK2A 3ERBA 4K12A 5HZPB 1H03P 1E5GA 4C16A 2EHFA 1G4GA 3ZRZA 1OK1A 2QY0A 2XWBF 1C1ZA 1OK3A 3GOVA 2CG7A 4ONTD 1GHQB 2MCYA 4FXGG 4LOTA 2A55A 2XRDA 1NWVA 5HYUB 1HCCA 2ERJA 3EJHA 2KRIA 2XQWC 1Q3XA 4B2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WII C;  1GKG A;  2RLQ A;  4KKD A;  4CSY A;  1E8B A;  1PPQ A;  2CG6 A;  2O39 C;  4WJG 2;  3CAL A;  2YBY A;  4DJZ A;  1E88 A;  2RL0 A;  3O8E B;  1OJY A;  4ZH1 D;  2JRA A;  1LY2 A;  3ZD1 A;  4LOS A;  3NFP I;  1H04 P;  4B2R A;  2IZ3 A;  4J38 B;  5HYP A;  5JPM G;  4IGD A;  1H2Q P;  3KXV A;  3ZD2 A;  3OXU D;  4JHS A;  2B5I D;  1GKN A;  2EC3 A;  3T5O A;  1ZJK A;  3SW0 X;  2RKZ A;  1TPM A;  4A5W B;  1UOT P;  4AYI A;  1OK9 A;  1Z92 B;  4AYM A;  4PZ5 A;  2JGX A;  1O9A A;  3RJ3 D;  3M7P A;  1FBR A;  1CKL A;  3R62 A;  3TVJ A;  3L89 M;  5FO8 C;  2CKU A;  1QO6 A;  1VVD A;  2BZM A;  2W80 A;  1SS2 A;  3KZJ A;  2XRB A;  2IZ4 A;  1QUB A;  1QGB A;  2RLP A;  2G7I A;  1HFH A;  4YNX A;  2V8E A;  3OP8 A;  2MCZ A;  3INB C;  1MD8 A;  3MQL A;  1HFI A;  1OJW A;  4AYE A;  4AYD A;  2YRA A;  5HYT B;  1GPZ A;  1TPN A;  3IU3 I;  1H2P P;  4MUC A;  1TPG A;  3IX0 A;  2KMS A;  2XWJ I;  2LOJ A;  2JGW A;  1MD7 A;  1U5M A;  5I0Q B;  2UWN A;  3GXE A;  2RKY A;  3OED C;  2W81 A;  1G4F A;  1OJV A;  1SRZ A;  4F4O C;  1VVC A;  1ELV A;  1OK2 A;  3ERB A;  4K12 A;  5HZP B;  1H03 P;  1E5G A;  4C16 A;  2EHF A;  1G4G A;  3ZRZ A;  1OK1 A;  2QY0 A;  2XWB F;  1C1Z A;  1OK3 A;  3GOV A;  2CG7 A;  4ONT D;  1GHQ B;  2MCY A;  4FXG G;  4LOT A;  2A55 A;  2XRD A;  1NWV A;  5HYU B;  1HCC A;  2ERJ A;  3EJH A;  2KRI A;  2XQW C;  1Q3X A;  4B2S A; 
#chains in the Genus database with same CATH topology
 3FGR A;  5DN4 A;  4PO7 A;  2WII C;  1GKG A;  2RLQ A;  4KKD A;  4MSL A;  4CSY A;  1E8B A;  1PPQ A;  2CG6 A;  2O39 C;  4WJG 2;  3CAL A;  2YBY A;  4DJZ A;  1E88 A;  2RL0 A;  3O8E B;  1OJY A;  4ZH1 D;  2JRA A;  3WSX A;  1LY2 A;  3ZD1 A;  4LOS A;  3NFP I;  2Y8R A;  3F6K A;  1H04 P;  4B2R A;  2IZ3 A;  4BWC A;  4J38 B;  5HYP A;  4YIZ A;  5JPM G;  4IGD A;  1H2Q P;  3KXV A;  3ZD2 A;  3OXU D;  4JHS A;  2B5I D;  1GKN A;  2EC3 A;  3T5O A;  1ZJK A;  3SW0 X;  3FGT A;  5DN5 A;  2RKZ A;  1TPM A;  4A5W B;  3VWO A;  1UOT P;  4AYI A;  3CI0 J;  1OK9 A;  1Z92 B;  4AYM A;  4PZ5 A;  3NJA A;  2JGX A;  1O9A A;  3RJ3 D;  3M7P A;  1RLH A;  1FBR A;  1CKL A;  3R62 A;  3TVJ A;  3L89 M;  5FO8 C;  2CKU A;  1QO6 A;  1VVD A;  2BZM A;  2W80 A;  1SS2 A;  3KZJ A;  2XRB A;  2IZ4 A;  1QUB A;  1QGB A;  2RLP A;  2G7I A;  2Y8T A;  1HFH A;  4YNX A;  2V8E A;  3OP8 A;  2MCZ A;  3INB C;  3K3T A;  1MD8 A;  3MQL A;  1HFI A;  1OJW A;  4AYE A;  2Y8S A;  4AYD A;  2YRA A;  5HYT B;  1GPZ A;  1TPN A;  3IU3 I;  1H2P P;  4MUC A;  1TPG A;  3IX0 A;  2KMS A;  2XWJ I;  2I2L A;  2ZYC A;  2LOJ A;  2JGW A;  1MD7 A;  3ZLD A;  3WSY A;  1U5M A;  5I0Q B;  2UWN A;  3GXE A;  2RKY A;  3OED C;  2W81 A;  1G4F A;  1OJV A;  1SRZ A;  4F4O C;  1VVC A;  1ELV A;  1OK2 A;  3ERB A;  4K12 A;  5HZP B;  1H03 P;  1E5G A;  4C16 A;  2EHF A;  1G4G A;  3ZRZ A;  1OK1 A;  2QY0 A;  4APL A;  2XWB F;  1C1Z A;  1OK3 A;  3GOV A;  2CG7 A;  4ONT D;  2X2Z A;  1GHQ B;  2MCY A;  4FXG G;  4LOT A;  2A55 A;  4N7E A;  3ZLE A;  2XRD A;  1NWV A;  5HYU B;  1HCC A;  2ERJ A;  3EJH A;  2KRI A;  2XQW C;  1Q3X A;  4B2S A; 
#chains in the Genus database with same CATH homology
 2WII C;  1GKG A;  2RLQ A;  4KKD A;  4CSY A;  1E8B A;  1PPQ A;  2CG6 A;  2O39 C;  4WJG 2;  3CAL A;  2YBY A;  4DJZ A;  1E88 A;  2RL0 A;  3O8E B;  1OJY A;  4ZH1 D;  2JRA A;  1LY2 A;  3ZD1 A;  4LOS A;  3NFP I;  1H04 P;  4B2R A;  2IZ3 A;  4J38 B;  5HYP A;  5JPM G;  4IGD A;  1H2Q P;  3KXV A;  3ZD2 A;  3OXU D;  4JHS A;  2B5I D;  1GKN A;  2EC3 A;  3T5O A;  1ZJK A;  3SW0 X;  2RKZ A;  1TPM A;  4A5W B;  1UOT P;  4AYI A;  1OK9 A;  1Z92 B;  4AYM A;  4PZ5 A;  2JGX A;  1O9A A;  3RJ3 D;  3M7P A;  1FBR A;  1CKL A;  3R62 A;  3TVJ A;  3L89 M;  5FO8 C;  2CKU A;  1QO6 A;  1VVD A;  2BZM A;  2W80 A;  1SS2 A;  3KZJ A;  2XRB A;  2IZ4 A;  1QUB A;  1QGB A;  2RLP A;  2G7I A;  1HFH A;  4YNX A;  2V8E A;  3OP8 A;  2MCZ A;  3INB C;  1MD8 A;  3MQL A;  1HFI A;  1OJW A;  4AYE A;  4AYD A;  2YRA A;  5HYT B;  1GPZ A;  1TPN A;  3IU3 I;  1H2P P;  4MUC A;  1TPG A;  3IX0 A;  2KMS A;  2XWJ I;  2LOJ A;  2JGW A;  1MD7 A;  1U5M A;  5I0Q B;  2UWN A;  3GXE A;  2RKY A;  3OED C;  2W81 A;  1G4F A;  1OJV A;  1SRZ A;  4F4O C;  1VVC A;  1ELV A;  1OK2 A;  3ERB A;  4K12 A;  5HZP B;  1H03 P;  1E5G A;  4C16 A;  2EHF A;  1G4G A;  3ZRZ A;  1OK1 A;  2QY0 A;  2XWB F;  1C1Z A;  1OK3 A;  3GOV A;  2CG7 A;  4ONT D;  1GHQ B;  2MCY A;  4FXG G;  4LOT A;  2A55 A;  2XRD A;  1NWV A;  5HYU B;  1HCC A;  2ERJ A;  3EJH A;  2KRI A;  2XQW C;  1Q3X A;  4B2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...