1OAEA

Crystal structure of the reduced form of cytochrome c" from methylophilus methylotrophus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
DVTNAEKLVYKYTNIAHSANPMYEAPSITDGKIFFNRKFKTPSGKEAACASCHTNNPANVGKNIVTGKEIPPLAPRVNTKRFTDIDKVEDEFTKHCNDILGADCSPSEKANFIAYLLTETKPTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C"
publication title Structural Evidence for a Proton Transfer Pathway Coupled with Haem Reduction of Cytochrome C" from Methylophilus Methylotrophus.
pubmed doi rcsb
molecule tags Oxidoreductase(cytochrome)
total genus 34
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09086 DUF1924 Domain of unknown function (DUF1924)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1oaeA00
2AI5A 3O20A 3TGUD 1CEDA 2FYUD 5KLIB 3O1YA 1I55A 3SXTA 4Y5RA 3MK7C 1I5TA 3MK7B 1COTA 3WC8A 1CRYA 3HQ6A 4WQDA 1IO3A 1HROA 4J20A 3H1LD 1E29A 1JDLA 2BH4X 2GB8B 3TYIA 4FANA 2BGVX 1CIFA 1A2SA 1SQXD 3NWVA 1YIQA 4FA1A 1H32B 4WQ7A 1ZZHA 4L1QA 1CSXA 1N90A 3VRDA 1I6EA 1NNOA 1YICA 2CE1A 1F1FA 2B0ZB 2PACA 3H1JD 2N9IA 2B12B 1A56A 1ETPA 1GJQA 2C8SA 4D6TD 5GTHV 451CA 3CXHD 1H1OA 1YFCA 1YEAA 2L4DA 3ORVA 1W2LA 2HV4A 2N3BA 2C1UA 1C7MA 3JBTB 2N18C 2N18B 1YTCA 1AKKA 3CWBD 3L73D 1DVHA 351CA 3ZBMA 5CYTR 3SVWA 1QL3A 1HJ4A 1HJ5A 4UB8V 1H31B 1U74B 2EXVA 1GIWA 3DMIA 3HQ9A 1L9BC 3HQ7A 1WEJF 4AANA 1J3SA 4K3IA 4NFGB 1H33B 1L9JC 1SQVD 1CORA 3CYTI 1CC5A 1YCCA 2PCBB 3SWSA 1C6RA 1FJ0A 1OAEA 1NIRA 1CRJA 2YCCA 4L3HA 1KYOD 1CIHA 4EIDA 2BH5X 4U3FD 5B66V 3SLEA 3PXTA 1W5CT 1CCRA 1PP9D 2ZXYA 3RN0A 5CIGB 4WQ8A 1CRGA 2LITA 2PCCB 1CHIA 1MG3D 1CHJA 4EIEA 1SQQD 3VNWA 3OCDB 1CRHA 1LC2A 2OZ1A 3CXHW 5CIEB 2YQBA 3L72D 2JTIB 3WFDC 1CHHA 3WFBC 1EZVD 3L70D 1QKSA 1M70A 1IRWA 1I6DA 155CA 1DW1A 1MZ4A 1CYIA 1HH7A 3WUIA 5DJQC 2C1DB 1EB7A 5DJQB 5C9MA 2BLFB 5DF5A 2QJKB 4KMGA 1FOCA 1H32A 1I8OA 1SQPD 2B4ZA 5CIBB 1GU2A 1L0LD 2DVHA 4FA4A 3H1KD 1FI3A 1BL9A 2QJYB 2VHDA 1CRIA 1BE3D 2GIWA 3PXWA 4O1QA 1KYOW 4FA5A 1HZVA 1WVEC 4PJ0V 1KX2A 1FCDC 1FI9A 1L0ND 1CO6A 2CE0A 1CTJA 1RZ5A 2LIRA 3HQ8A 3L4MA 1AOQA 1I8PA 1DIQC 4XYDB 4AX3A 1FI7A 1CXAA 1PPJD 1NTMD 4WQAA 4XXLA 3RLMA 3VYMA 5KLVD 3A0HV 4PWAA 4JCGA 2AXTV 1DIIC 2ZZS1 4WQBA 1H33A 2ZOOA 3OA8B 1IRVA 4EICA 1BCCD 5CIDB 5H2FV 1CSUA 1QYZA 4GYDA 2CA4B 1F1CA 1NTKD 4LJIA 1CTYA 1CSWA 2MHMA 2ZBOA 4AAOA 3A9FA 1IQCA 2FYNB 4H0JA 4RSZA 4N0KA 1KB0A 2ZONG 1E2RA 1CXCA 2I8FA 5TISV 3WFEC 1AYGA 1C75A 3O0RC 1NTZD 1LFMA 3L74D 1GKSA 1KV9A 4FB1A 1CCHA 2V08A 3OCDA 2D0SA 1C2NA 1HRCA 1I54A 1KX7A 1RAQA 1CRCA 3H1HD 4WQ9A 1CSVA 2B11B 1GDVA 5KAIV 5B6QA 5KKZB 2QJPB 1M60A 3L71D 1HCMA 1YEBA 2CA3B 3CX5D 1DT1A 3ZOXA 5GTIV 2MTAC 2C1DA 1P84D 4EIFA 2BCCD 5CIHB 1S5LV 3L75D 1N9CA 1A8CA 3M97X 4FAVA 2FRCA 1H9XA 3RMZA 2V07A 3L4OA 1N50A 1C6OA 1CYJA 1CIGA 3H1ID 1GQ1A 3RN1A 3ZOWA 2C2CA 2YK3A 3C2CA 4QAOA 4DY9A 2JQRA 1H9YA 1QN2A 2GC7D 2DGEA 3DP5A 1DW0A 1M6ZA 1CNOA 1K3HA 1FHBA 1C2RA 3X39A 2N3YA 1QL4A 4V2KA 1NMLA 3NBTA 2IBZD 1H31A 3ZOYA 2GC4D 2ORLA 4FA9A 3ZOOA 3BCCD 1NU1D 1KB9D 3PXSA 4AALA 2C1VA 3SJLA 4MU8A 5E79V 1BGYD 1N15A 2C9XB 4AAMA 4UB6V 1U75B 3CU4A 3OA8A 3CX5W 1OCDA 1IZL0 2FWLA 4IL6V 1HJ3A 2YIUB 1LC1A 5EXQA 1HZUA 1R0QA 3ZCFA 1RAPA 1DW2A 5B5EV 5CICB 1C52A 2AIUA 4H0KA 4Q5PA 1AOFA 2BPBB 4L3GA 3WFCC 1CIEA 1E8EA 4GEDB 2XTSB 1RZ6A 2BCNB 4WQCA 3PH2B 2D0WA 1K3GA 1MG2D 3DR0A 1KIBA 1DW3A 2A06D 4P4QB 4PW9B 1DVVA 1ZRTD 3CP5A 1CYCA 4PD4D 2B10B 1B7VA 2CXBA 1SQBD 4O1WA 3WU2V 5KAFV 1CTZA 5IY51 3A0BV 2N9JA 5AURA 1NMIA 1LMSA 4WQEA 3O5CA 1VYDA 5CIFB 4YE1A 5DFSA 5C0ZA 1S6VB 1YNRA 1LS9A 2OZ1B 1C6SA 3KZIV 3NBSA 3ZIYA
chains in the Genus database with same CATH superfamily
2AI5A 3O20A 3TGUD 1CEDA 2FYUD 5KLIB 3O1YA 1I55A 3SXTA 4Y5RA 3MK7C 1I5TA 3MK7B 1COTA 3WC8A 1CRYA 3HQ6A 4WQDA 1IO3A 1HROA 4J20A 3H1LD 1E29A 1JDLA 2BH4X 2GB8B 3TYIA 4FANA 2BGVX 1CIFA 1A2SA 1SQXD 3NWVA 1YIQA 4FA1A 1H32B 4WQ7A 1ZZHA 4L1QA 1CSXA 1N90A 3VRDA 1I6EA 1NNOA 1YICA 2CE1A 1F1FA 2B0ZB 2PACA 3H1JD 2N9IA 2B12B 1A56A 1ETPA 1GJQA 2C8SA 4D6TD 5GTHV 451CA 3CXHD 1H1OA 1YFCA 1YEAA 2L4DA 3ORVA 1W2LA 2HV4A 2N3BA 2C1UA 1C7MA 3JBTB 2N18C 2N18B 1YTCA 1AKKA 3CWBD 3L73D 1DVHA 351CA 3ZBMA 5CYTR 3SVWA 1QL3A 1HJ4A 1HJ5A 4UB8V 1H31B 1U74B 2EXVA 1GIWA 3DMIA 3HQ9A 1L9BC 3HQ7A 1WEJF 4AANA 1J3SA 4K3IA 4NFGB 1H33B 1L9JC 1SQVD 1CORA 3CYTI 1CC5A 1YCCA 2PCBB 3SWSA 1C6RA 1FJ0A 1OAEA 1NIRA 1CRJA 2YCCA 4L3HA 1KYOD 1CIHA 4EIDA 2BH5X 4U3FD 5B66V 3SLEA 3PXTA 1W5CT 1CCRA 1PP9D 2ZXYA 3RN0A 5CIGB 4WQ8A 1CRGA 2LITA 2PCCB 1CHIA 1MG3D 1CHJA 4EIEA 1SQQD 3VNWA 3OCDB 1CRHA 1LC2A 2OZ1A 3CXHW 5CIEB 2YQBA 3L72D 2JTIB 3WFDC 1CHHA 3WFBC 1EZVD 3L70D 1QKSA 1M70A 1IRWA 1I6DA 155CA 1DW1A 1MZ4A 1CYIA 1HH7A 3WUIA 5DJQC 2C1DB 1EB7A 5DJQB 5C9MA 2BLFB 5DF5A 2QJKB 4KMGA 1FOCA 1H32A 1I8OA 1SQPD 2B4ZA 5CIBB 1GU2A 1L0LD 2DVHA 4FA4A 3H1KD 1FI3A 1BL9A 2QJYB 2VHDA 1CRIA 1BE3D 2GIWA 3PXWA 4O1QA 1KYOW 4FA5A 1HZVA 1WVEC 4PJ0V 1KX2A 1FCDC 1FI9A 1L0ND 1CO6A 2CE0A 1CTJA 1RZ5A 2LIRA 3HQ8A 3L4MA 1AOQA 1I8PA 1DIQC 4XYDB 4AX3A 1FI7A 1CXAA 1PPJD 1NTMD 4WQAA 4XXLA 3RLMA 3VYMA 5KLVD 3A0HV 4PWAA 4JCGA 2AXTV 1DIIC 2ZZS1 4WQBA 1H33A 2ZOOA 3OA8B 1IRVA 4EICA 1BCCD 5CIDB 5H2FV 1CSUA 1QYZA 4GYDA 2CA4B 1F1CA 1NTKD 4LJIA 1CTYA 1CSWA 2MHMA 2ZBOA 4AAOA 3A9FA 1IQCA 2FYNB 4H0JA 4RSZA 4N0KA 1KB0A 2ZONG 1E2RA 1CXCA 2I8FA 5TISV 3WFEC 1AYGA 1C75A 3O0RC 1NTZD 1LFMA 3L74D 1GKSA 1KV9A 4FB1A 1CCHA 2V08A 3OCDA 2D0SA 1C2NA 1HRCA 1I54A 1KX7A 1RAQA 1CRCA 3H1HD 4WQ9A 1CSVA 2B11B 1GDVA 5KAIV 5B6QA 5KKZB 2QJPB 1M60A 3L71D 1HCMA 1YEBA 2CA3B 3CX5D 1DT1A 3ZOXA 5GTIV 2MTAC 2C1DA 1P84D 4EIFA 2BCCD 5CIHB 1S5LV 3L75D 1N9CA 1A8CA 3M97X 4FAVA 2FRCA 1H9XA 3RMZA 2V07A 3L4OA 1N50A 1C6OA 1CYJA 1CIGA 3H1ID 1GQ1A 3RN1A 3ZOWA 2C2CA 2YK3A 3C2CA 4QAOA 4DY9A 2JQRA 1H9YA 1QN2A 2GC7D 2DGEA 3DP5A 1DW0A 1M6ZA 1CNOA 1K3HA 1FHBA 1C2RA 3X39A 2N3YA 1QL4A 4V2KA 1NMLA 3NBTA 2IBZD 3D0WA 1H31A 3ZOYA 2GC4D 2ORLA 4FA9A 3ZOOA 3BCCD 1NU1D 1KB9D 3PXSA 4AALA 2C1VA 3SJLA 4MU8A 5E79V 1BGYD 1N15A 2C9XB 4AAMA 4UB6V 1U75B 3CU4A 3OA8A 3CX5W 1OCDA 1IZL0 2FWLA 4IL6V 1HJ3A 2YIUB 1LC1A 5EXQA 1HZUA 1R0QA 3ZCFA 1RAPA 1DW2A 5B5EV 5CICB 1C52A 2AIUA 4H0KA 4Q5PA 1AOFA 2BPBB 4L3GA 3WFCC 1CIEA 1E8EA 4GEDB 2XTSB 1RZ6A 2BCNB 4WQCA 3PH2B 2D0WA 1K3GA 1MG2D 3DR0A 1KIBA 1DW3A 2A06D 4P4QB 4PW9B 1DVVA 1ZRTD 3CP5A 1CYCA 4PD4D 2B10B 1B7VA 2CXBA 1SQBD 4O1WA 3WU2V 5KAFV 1CTZA 5IY51 3A0BV 2N9JA 5AURA 1NMIA 1LMSA 4WQEA 3O5CA 1VYDA 5CIFB 4YE1A 5DFSA 5C0ZA 1S6VB 1YNRA 1LS9A 2OZ1B 1C6SA 3KZIV 3NBSA 3ZIYA
chains in the Genus database with same CATH topology
2AI5A 3O20A 3TGUD 1CEDA 2FYUD 5KLIB 3O1YA 1I55A 3SXTA 4Y5RA 3MK7C 1I5TA 3MK7B 1COTA 3WC8A 1CRYA 3HQ6A 4WQDA 1IO3A 1HROA 4J20A 3H1LD 1E29A 1JDLA 2BH4X 2GB8B 3TYIA 4FANA 2BGVX 1CIFA 1A2SA 1SQXD 3NWVA 1YIQA 4FA1A 1H32B 4WQ7A 1ZZHA 4L1QA 1CSXA 1N90A 3VRDA 1I6EA 1NNOA 1YICA 2CE1A 1F1FA 2B0ZB 2PACA 3H1JD 2N9IA 2B12B 1A56A 1ETPA 1GJQA 2C8SA 4D6TD 5GTHV 451CA 3CXHD 1H1OA 1YFCA 1YEAA 2L4DA 3ORVA 1W2LA 2HV4A 2N3BA 2C1UA 1C7MA 3JBTB 2N18C 2N18B 1YTCA 1AKKA 3CWBD 3L73D 1DVHA 351CA 3ZBMA 5CYTR 3SVWA 1QL3A 1HJ4A 1HJ5A 4UB8V 1H31B 1U74B 2EXVA 1GIWA 3DMIA 3HQ9A 1L9BC 3HQ7A 1WEJF 4AANA 1J3SA 4K3IA 4NFGB 1H33B 1L9JC 1SQVD 1CORA 3CYTI 1CC5A 1YCCA 2PCBB 3SWSA 1C6RA 1FJ0A 1OAEA 1NIRA 1CRJA 2YCCA 4L3HA 1KYOD 1CIHA 4EIDA 2BH5X 4U3FD 5B66V 3SLEA 3PXTA 1W5CT 1CCRA 1PP9D 2ZXYA 3RN0A 5CIGB 4WQ8A 1CRGA 2LITA 2PCCB 1CHIA 1MG3D 1CHJA 4EIEA 1SQQD 3VNWA 3OCDB 1CRHA 1LC2A 2OZ1A 3CXHW 5CIEB 2YQBA 3L72D 2JTIB 3WFDC 1CHHA 3WFBC 1EZVD 3L70D 1QKSA 1M70A 1IRWA 1I6DA 155CA 1DW1A 1MZ4A 1CYIA 1HH7A 3WUIA 5DJQC 2C1DB 1EB7A 5DJQB 5C9MA 2BLFB 5DF5A 2QJKB 4KMGA 1FOCA 1H32A 1I8OA 1SQPD 2B4ZA 5CIBB 1GU2A 1L0LD 2DVHA 4FA4A 3H1KD 1FI3A 1BL9A 2QJYB 2VHDA 1CRIA 1BE3D 2GIWA 3PXWA 4O1QA 1KYOW 4FA5A 1HZVA 1WVEC 4PJ0V 1KX2A 1FCDC 1FI9A 1L0ND 1CO6A 2CE0A 1CTJA 1RZ5A 2LIRA 3HQ8A 3L4MA 1AOQA 1I8PA 1DIQC 4XYDB 4AX3A 1FI7A 1CXAA 1PPJD 1NTMD 4WQAA 4XXLA 3RLMA 3VYMA 5KLVD 3A0HV 4PWAA 4JCGA 2AXTV 1DIIC 2ZZS1 4WQBA 1H33A 2ZOOA 3OA8B 1IRVA 4EICA 1BCCD 5CIDB 5H2FV 1CSUA 1QYZA 4GYDA 2CA4B 1F1CA 1NTKD 4LJIA 1CTYA 1CSWA 2MHMA 2ZBOA 4AAOA 3A9FA 1IQCA 2FYNB 4H0JA 4RSZA 4N0KA 1KB0A 2ZONG 1E2RA 1CXCA 2I8FA 5TISV 3WFEC 1AYGA 1C75A 3O0RC 1NTZD 1LFMA 3L74D 1GKSA 1KV9A 4FB1A 1CCHA 2V08A 3OCDA 2D0SA 1C2NA 1HRCA 1I54A 1KX7A 1RAQA 1CRCA 3H1HD 4WQ9A 1CSVA 2B11B 1GDVA 5KAIV 5B6QA 5KKZB 2QJPB 1M60A 3L71D 1HCMA 1YEBA 2CA3B 3CX5D 1DT1A 3ZOXA 5GTIV 2MTAC 2C1DA 1P84D 4EIFA 2BCCD 5CIHB 1S5LV 3L75D 1N9CA 1A8CA 3M97X 4FAVA 2FRCA 1H9XA 3RMZA 2V07A 3L4OA 1N50A 1C6OA 1CYJA 1CIGA 3H1ID 1GQ1A 3RN1A 3ZOWA 2C2CA 2YK3A 3C2CA 4QAOA 4DY9A 2JQRA 1H9YA 1QN2A 2GC7D 2DGEA 3DP5A 1DW0A 1M6ZA 1CNOA 1K3HA 1FHBA 1C2RA 3X39A 2N3YA 1QL4A 4V2KA 1NMLA 3NBTA 2IBZD 1H31A 3ZOYA 2GC4D 2ORLA 4FA9A 3ZOOA 3BCCD 1NU1D 1KB9D 3PXSA 4AALA 2C1VA 3SJLA 4MU8A 5E79V 1BGYD 1N15A 2C9XB 4AAMA 4UB6V 1U75B 3CU4A 3OA8A 3CX5W 1OCDA 1IZL0 2FWLA 4IL6V 1HJ3A 2YIUB 1LC1A 5EXQA 1HZUA 1R0QA 3ZCFA 1RAPA 1DW2A 5B5EV 5CICB 1C52A 2AIUA 4H0KA 4Q5PA 1AOFA 2BPBB 4L3GA 3WFCC 1CIEA 1E8EA 4GEDB 2XTSB 1RZ6A 2BCNB 4WQCA 3PH2B 2D0WA 1K3GA 1MG2D 3DR0A 1KIBA 1DW3A 2A06D 4P4QB 4PW9B 1DVVA 1ZRTD 3CP5A 1CYCA 4PD4D 2B10B 1B7VA 2CXBA 1SQBD 4O1WA 3WU2V 5KAFV 1CTZA 5IY51 3A0BV 2N9JA 5AURA 1NMIA 1LMSA 4WQEA 3O5CA 1VYDA 5CIFB 4YE1A 5DFSA 5C0ZA 1S6VB 1YNRA 1LS9A 2OZ1B 1C6SA 3KZIV 3NBSA 3ZIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AI5 A;  3O20 A;  3TGU D;  1CED A;  2FYU D;  5KLI B;  3O1Y A;  1I55 A;  3SXT A;  4Y5R A;  3MK7 C;  1I5T A;  3MK7 B;  1COT A;  3WC8 A;  1CRY A;  3HQ6 A;  4WQD A;  1IO3 A;  1HRO A;  4J20 A;  3H1L D;  1E29 A;  1JDL A;  2BH4 X;  2GB8 B;  3TYI A;  4FAN A;  2BGV X;  1CIF A;  1A2S A;  1SQX D;  3NWV A;  1YIQ A;  4FA1 A;  1H32 B;  4WQ7 A;  1ZZH A;  4L1Q A;  1CSX A;  1N90 A;  3VRD A;  1I6E A;  1NNO A;  1YIC A;  2CE1 A;  1F1F A;  2B0Z B;  2PAC A;  3H1J D;  2N9I A;  2B12 B;  1A56 A;  1ETP A;  1GJQ A;  2C8S A;  4D6T D;  5GTH V;  451C A;  3CXH D;  1H1O A;  1YFC A;  1YEA A;  2L4D A;  3ORV A;  1W2L A;  2HV4 A;  2N3B A;  2C1U A;  1C7M A;  3JBT B;  2N18 C;  2N18 B;  1YTC A;  1AKK A;  3CWB D;  3L73 D;  1DVH A;  351C A;  3ZBM A;  5CYT R;  3SVW A;  1QL3 A;  1HJ4 A;  1HJ5 A;  4UB8 V;  1H31 B;  1U74 B;  2EXV A;  1GIW A;  3DMI A;  3HQ9 A;  1L9B C;  3HQ7 A;  1WEJ F;  4AAN A;  1J3S A;  4K3I A;  4NFG B;  1H33 B;  1L9J C;  1SQV D;  1COR A;  3CYT I;  1CC5 A;  1YCC A;  2PCB B;  3SWS A;  1C6R A;  1FJ0 A;  1OAE A;  1NIR A;  1CRJ A;  2YCC A;  4L3H A;  1KYO D;  1CIH A;  4EID A;  2BH5 X;  4U3F D;  5B66 V;  3SLE A;  3PXT A;  1W5C T;  1CCR A;  1PP9 D;  2ZXY A;  3RN0 A;  5CIG B;  4WQ8 A;  1CRG A;  2LIT A;  2PCC B;  1CHI A;  1MG3 D;  1CHJ A;  4EIE A;  1SQQ D;  3VNW A;  3OCD B;  1CRH A;  1LC2 A;  2OZ1 A;  3CXH W;  5CIE B;  2YQB A;  3L72 D;  2JTI B;  3WFD C;  1CHH A;  3WFB C;  1EZV D;  3L70 D;  1QKS A;  1M70 A;  1IRW A;  1I6D A;  155C A;  1DW1 A;  1MZ4 A;  1CYI A;  1HH7 A;  3WUI A;  5DJQ C;  2C1D B;  1EB7 A;  5DJQ B;  5C9M A;  2BLF B;  5DF5 A;  2QJK B;  4KMG A;  1FOC A;  1H32 A;  1I8O A;  1SQP D;  2B4Z A;  5CIB B;  1GU2 A;  1L0L D;  2DVH A;  4FA4 A;  3H1K D;  1FI3 A;  1BL9 A;  2QJY B;  2VHD A;  1CRI A;  1BE3 D;  2GIW A;  3PXW A;  4O1Q A;  1KYO W;  4FA5 A;  1HZV A;  1WVE C;  4PJ0 V;  1KX2 A;  1FCD C;  1FI9 A;  1L0N D;  1CO6 A;  2CE0 A;  1CTJ A;  1RZ5 A;  2LIR A;  3HQ8 A;  3L4M A;  1AOQ A;  1I8P A;  1DIQ C;  4XYD B;  4AX3 A;  1FI7 A;  1CXA A;  1PPJ D;  1NTM D;  4WQA A;  4XXL A;  3RLM A;  3VYM A;  5KLV D;  3A0H V;  4PWA A;  4JCG A;  2AXT V;  1DII C;  2ZZS 1;  4WQB A;  1H33 A;  2ZOO A;  3OA8 B;  1IRV A;  4EIC A;  1BCC D;  5CID B;  5H2F V;  1CSU A;  1QYZ A;  4GYD A;  2CA4 B;  1F1C A;  1NTK D;  4LJI A;  1CTY A;  1CSW A;  2MHM A;  2ZBO A;  4AAO A;  3A9F A;  1IQC A;  2FYN B;  4H0J A;  4RSZ A;  4N0K A;  1KB0 A;  2ZON G;  1E2R A;  1CXC A;  2I8F A;  5TIS V;  3WFE C;  1AYG A;  1C75 A;  3O0R C;  1NTZ D;  1LFM A;  3L74 D;  1GKS A;  1KV9 A;  4FB1 A;  1CCH A;  2V08 A;  3OCD A;  2D0S A;  1C2N A;  1HRC A;  1I54 A;  1KX7 A;  1RAQ A;  1CRC A;  3H1H D;  4WQ9 A;  1CSV A;  2B11 B;  1GDV A;  5KAI V;  5B6Q A;  5KKZ B;  2QJP B;  1M60 A;  3L71 D;  1HCM A;  1YEB A;  2CA3 B;  3CX5 D;  1DT1 A;  3ZOX A;  5GTI V;  2MTA C;  2C1D A;  1P84 D;  4EIF A;  2BCC D;  5CIH B;  1S5L V;  3L75 D;  1N9C A;  1A8C A;  3M97 X;  4FAV A;  2FRC A;  1H9X A;  3RMZ A;  2V07 A;  3L4O A;  1N50 A;  1C6O A;  1CYJ A;  1CIG A;  3H1I D;  1GQ1 A;  3RN1 A;  3ZOW A;  2C2C A;  2YK3 A;  3C2C A;  4QAO A;  4DY9 A;  2JQR A;  1H9Y A;  1QN2 A;  2GC7 D;  2DGE A;  3DP5 A;  1DW0 A;  1M6Z A;  1CNO A;  1K3H A;  1FHB A;  1C2R A;  3X39 A;  2N3Y A;  1QL4 A;  4V2K A;  1NML A;  3NBT A;  2IBZ D;  1H31 A;  3ZOY A;  2GC4 D;  2ORL A;  4FA9 A;  3ZOO A;  3BCC D;  1NU1 D;  1KB9 D;  3PXS A;  4AAL A;  2C1V A;  3SJL A;  4MU8 A;  5E79 V;  1BGY D;  1N15 A;  2C9X B;  4AAM A;  4UB6 V;  1U75 B;  3CU4 A;  3OA8 A;  3CX5 W;  1OCD A;  1IZL 0;  2FWL A;  4IL6 V;  1HJ3 A;  2YIU B;  1LC1 A;  5EXQ A;  1HZU A;  1R0Q A;  3ZCF A;  1RAP A;  1DW2 A;  5B5E V;  5CIC B;  1C52 A;  2AIU A;  4H0K A;  4Q5P A;  1AOF A;  2BPB B;  4L3G A;  3WFC C;  1CIE A;  1E8E A;  4GED B;  2XTS B;  1RZ6 A;  2BCN B;  4WQC A;  3PH2 B;  2D0W A;  1K3G A;  1MG2 D;  3DR0 A;  1KIB A;  1DW3 A;  2A06 D;  4P4Q B;  4PW9 B;  1DVV A;  1ZRT D;  3CP5 A;  1CYC A;  4PD4 D;  2B10 B;  1B7V A;  2CXB A;  1SQB D;  4O1W A;  3WU2 V;  5KAF V;  1CTZ A;  5IY5 1;  3A0B V;  2N9J A;  5AUR A;  1NMI A;  1LMS A;  4WQE A;  3O5C A;  1VYD A;  5CIF B;  4YE1 A;  5DFS A;  5C0Z A;  1S6V B;  1YNR A;  1LS9 A;  2OZ1 B;  1C6S A;  3KZI V;  3NBS A;  3ZIY A; 
#chains in the Genus database with same CATH topology
 2AI5 A;  3O20 A;  3TGU D;  1CED A;  2FYU D;  5KLI B;  3O1Y A;  1I55 A;  3SXT A;  4Y5R A;  3MK7 C;  1I5T A;  3MK7 B;  1COT A;  3WC8 A;  1CRY A;  3HQ6 A;  4WQD A;  1IO3 A;  1HRO A;  4J20 A;  3H1L D;  1E29 A;  1JDL A;  2BH4 X;  2GB8 B;  3TYI A;  4FAN A;  2BGV X;  1CIF A;  1A2S A;  1SQX D;  3NWV A;  1YIQ A;  4FA1 A;  1H32 B;  4WQ7 A;  1ZZH A;  4L1Q A;  1CSX A;  1N90 A;  3VRD A;  1I6E A;  1NNO A;  1YIC A;  2CE1 A;  1F1F A;  2B0Z B;  2PAC A;  3H1J D;  2N9I A;  2B12 B;  1A56 A;  1ETP A;  1GJQ A;  2C8S A;  4D6T D;  5GTH V;  451C A;  3CXH D;  1H1O A;  1YFC A;  1YEA A;  2L4D A;  3ORV A;  1W2L A;  2HV4 A;  2N3B A;  2C1U A;  1C7M A;  3JBT B;  2N18 C;  2N18 B;  1YTC A;  1AKK A;  3CWB D;  3L73 D;  1DVH A;  351C A;  3ZBM A;  5CYT R;  3SVW A;  1QL3 A;  1HJ4 A;  1HJ5 A;  4UB8 V;  1H31 B;  1U74 B;  2EXV A;  1GIW A;  3DMI A;  3HQ9 A;  1L9B C;  3HQ7 A;  1WEJ F;  4AAN A;  1J3S A;  4K3I A;  4NFG B;  1H33 B;  1L9J C;  1SQV D;  1COR A;  3CYT I;  1CC5 A;  1YCC A;  2PCB B;  3SWS A;  1C6R A;  1FJ0 A;  1OAE A;  1NIR A;  1CRJ A;  2YCC A;  4L3H A;  1KYO D;  1CIH A;  4EID A;  2BH5 X;  4U3F D;  5B66 V;  3SLE A;  3PXT A;  1W5C T;  1CCR A;  1PP9 D;  2ZXY A;  3RN0 A;  5CIG B;  4WQ8 A;  1CRG A;  2LIT A;  2PCC B;  1CHI A;  1MG3 D;  1CHJ A;  4EIE A;  1SQQ D;  3VNW A;  3OCD B;  1CRH A;  1LC2 A;  2OZ1 A;  3CXH W;  5CIE B;  2YQB A;  3L72 D;  2JTI B;  3WFD C;  1CHH A;  3WFB C;  1EZV D;  3L70 D;  1QKS A;  1M70 A;  1IRW A;  1I6D A;  155C A;  1DW1 A;  1MZ4 A;  1CYI A;  1HH7 A;  3WUI A;  5DJQ C;  2C1D B;  1EB7 A;  5DJQ B;  5C9M A;  2BLF B;  5DF5 A;  2QJK B;  4KMG A;  1FOC A;  1H32 A;  1I8O A;  1SQP D;  2B4Z A;  5CIB B;  1GU2 A;  1L0L D;  2DVH A;  4FA4 A;  3H1K D;  1FI3 A;  1BL9 A;  2QJY B;  2VHD A;  1CRI A;  1BE3 D;  2GIW A;  3PXW A;  4O1Q A;  1KYO W;  4FA5 A;  1HZV A;  1WVE C;  4PJ0 V;  1KX2 A;  1FCD C;  1FI9 A;  1L0N D;  1CO6 A;  2CE0 A;  1CTJ A;  1RZ5 A;  2LIR A;  3HQ8 A;  3L4M A;  1AOQ A;  1I8P A;  1DIQ C;  4XYD B;  4AX3 A;  1FI7 A;  1CXA A;  1PPJ D;  1NTM D;  4WQA A;  4XXL A;  3RLM A;  3VYM A;  5KLV D;  3A0H V;  4PWA A;  4JCG A;  2AXT V;  1DII C;  2ZZS 1;  4WQB A;  1H33 A;  2ZOO A;  3OA8 B;  1IRV A;  4EIC A;  1BCC D;  5CID B;  5H2F V;  1CSU A;  1QYZ A;  4GYD A;  2CA4 B;  1F1C A;  1NTK D;  4LJI A;  1CTY A;  1CSW A;  2MHM A;  2ZBO A;  4AAO A;  3A9F A;  1IQC A;  2FYN B;  4H0J A;  4RSZ A;  4N0K A;  1KB0 A;  2ZON G;  1E2R A;  1CXC A;  2I8F A;  5TIS V;  3WFE C;  1AYG A;  1C75 A;  3O0R C;  1NTZ D;  1LFM A;  3L74 D;  1GKS A;  1KV9 A;  4FB1 A;  1CCH A;  2V08 A;  3OCD A;  2D0S A;  1C2N A;  1HRC A;  1I54 A;  1KX7 A;  1RAQ A;  1CRC A;  3H1H D;  4WQ9 A;  1CSV A;  2B11 B;  1GDV A;  5KAI V;  5B6Q A;  5KKZ B;  2QJP B;  1M60 A;  3L71 D;  1HCM A;  1YEB A;  2CA3 B;  3CX5 D;  1DT1 A;  3ZOX A;  5GTI V;  2MTA C;  2C1D A;  1P84 D;  4EIF A;  2BCC D;  5CIH B;  1S5L V;  3L75 D;  1N9C A;  1A8C A;  3M97 X;  4FAV A;  2FRC A;  1H9X A;  3RMZ A;  2V07 A;  3L4O A;  1N50 A;  1C6O A;  1CYJ A;  1CIG A;  3H1I D;  1GQ1 A;  3RN1 A;  3ZOW A;  2C2C A;  2YK3 A;  3C2C A;  4QAO A;  4DY9 A;  2JQR A;  1H9Y A;  1QN2 A;  2GC7 D;  2DGE A;  3DP5 A;  1DW0 A;  1M6Z A;  1CNO A;  1K3H A;  1FHB A;  1C2R A;  3X39 A;  2N3Y A;  1QL4 A;  4V2K A;  1NML A;  3NBT A;  2IBZ D;  3D0W A;  1H31 A;  3ZOY A;  2GC4 D;  2ORL A;  4FA9 A;  3ZOO A;  3BCC D;  1NU1 D;  1KB9 D;  3PXS A;  4AAL A;  2C1V A;  3SJL A;  4MU8 A;  5E79 V;  1BGY D;  1N15 A;  2C9X B;  4AAM A;  4UB6 V;  1U75 B;  3CU4 A;  3OA8 A;  3CX5 W;  1OCD A;  1IZL 0;  2FWL A;  4IL6 V;  1HJ3 A;  2YIU B;  1LC1 A;  5EXQ A;  1HZU A;  1R0Q A;  3ZCF A;  1RAP A;  1DW2 A;  5B5E V;  5CIC B;  1C52 A;  2AIU A;  4H0K A;  4Q5P A;  1AOF A;  2BPB B;  4L3G A;  3WFC C;  1CIE A;  1E8E A;  4GED B;  2XTS B;  1RZ6 A;  2BCN B;  4WQC A;  3PH2 B;  2D0W A;  1K3G A;  1MG2 D;  3DR0 A;  1KIB A;  1DW3 A;  2A06 D;  4P4Q B;  4PW9 B;  1DVV A;  1ZRT D;  3CP5 A;  1CYC A;  4PD4 D;  2B10 B;  1B7V A;  2CXB A;  1SQB D;  4O1W A;  3WU2 V;  5KAF V;  1CTZ A;  5IY5 1;  3A0B V;  2N9J A;  5AUR A;  1NMI A;  1LMS A;  4WQE A;  3O5C A;  1VYD A;  5CIF B;  4YE1 A;  5DFS A;  5C0Z A;  1S6V B;  1YNR A;  1LS9 A;  2OZ1 B;  1C6S A;  3KZI V;  3NBS A;  3ZIY A; 
#chains in the Genus database with same CATH homology
 2AI5 A;  3O20 A;  3TGU D;  1CED A;  2FYU D;  5KLI B;  3O1Y A;  1I55 A;  3SXT A;  4Y5R A;  3MK7 C;  1I5T A;  3MK7 B;  1COT A;  3WC8 A;  1CRY A;  3HQ6 A;  4WQD A;  1IO3 A;  1HRO A;  4J20 A;  3H1L D;  1E29 A;  1JDL A;  2BH4 X;  2GB8 B;  3TYI A;  4FAN A;  2BGV X;  1CIF A;  1A2S A;  1SQX D;  3NWV A;  1YIQ A;  4FA1 A;  1H32 B;  4WQ7 A;  1ZZH A;  4L1Q A;  1CSX A;  1N90 A;  3VRD A;  1I6E A;  1NNO A;  1YIC A;  2CE1 A;  1F1F A;  2B0Z B;  2PAC A;  3H1J D;  2N9I A;  2B12 B;  1A56 A;  1ETP A;  1GJQ A;  2C8S A;  4D6T D;  5GTH V;  451C A;  3CXH D;  1H1O A;  1YFC A;  1YEA A;  2L4D A;  3ORV A;  1W2L A;  2HV4 A;  2N3B A;  2C1U A;  1C7M A;  3JBT B;  2N18 C;  2N18 B;  1YTC A;  1AKK A;  3CWB D;  3L73 D;  1DVH A;  351C A;  3ZBM A;  5CYT R;  3SVW A;  1QL3 A;  1HJ4 A;  1HJ5 A;  4UB8 V;  1H31 B;  1U74 B;  2EXV A;  1GIW A;  3DMI A;  3HQ9 A;  1L9B C;  3HQ7 A;  1WEJ F;  4AAN A;  1J3S A;  4K3I A;  4NFG B;  1H33 B;  1L9J C;  1SQV D;  1COR A;  3CYT I;  1CC5 A;  1YCC A;  2PCB B;  3SWS A;  1C6R A;  1FJ0 A;  1OAE A;  1NIR A;  1CRJ A;  2YCC A;  4L3H A;  1KYO D;  1CIH A;  4EID A;  2BH5 X;  4U3F D;  5B66 V;  3SLE A;  3PXT A;  1W5C T;  1CCR A;  1PP9 D;  2ZXY A;  3RN0 A;  5CIG B;  4WQ8 A;  1CRG A;  2LIT A;  2PCC B;  1CHI A;  1MG3 D;  1CHJ A;  4EIE A;  1SQQ D;  3VNW A;  3OCD B;  1CRH A;  1LC2 A;  2OZ1 A;  3CXH W;  5CIE B;  2YQB A;  3L72 D;  2JTI B;  3WFD C;  1CHH A;  3WFB C;  1EZV D;  3L70 D;  1QKS A;  1M70 A;  1IRW A;  1I6D A;  155C A;  1DW1 A;  1MZ4 A;  1CYI A;  1HH7 A;  3WUI A;  5DJQ C;  2C1D B;  1EB7 A;  5DJQ B;  5C9M A;  2BLF B;  5DF5 A;  2QJK B;  4KMG A;  1FOC A;  1H32 A;  1I8O A;  1SQP D;  2B4Z A;  5CIB B;  1GU2 A;  1L0L D;  2DVH A;  4FA4 A;  3H1K D;  1FI3 A;  1BL9 A;  2QJY B;  2VHD A;  1CRI A;  1BE3 D;  2GIW A;  3PXW A;  4O1Q A;  1KYO W;  4FA5 A;  1HZV A;  1WVE C;  4PJ0 V;  1KX2 A;  1FCD C;  1FI9 A;  1L0N D;  1CO6 A;  2CE0 A;  1CTJ A;  1RZ5 A;  2LIR A;  3HQ8 A;  3L4M A;  1AOQ A;  1I8P A;  1DIQ C;  4XYD B;  4AX3 A;  1FI7 A;  1CXA A;  1PPJ D;  1NTM D;  4WQA A;  4XXL A;  3RLM A;  3VYM A;  5KLV D;  3A0H V;  4PWA A;  4JCG A;  2AXT V;  1DII C;  2ZZS 1;  4WQB A;  1H33 A;  2ZOO A;  3OA8 B;  1IRV A;  4EIC A;  1BCC D;  5CID B;  5H2F V;  1CSU A;  1QYZ A;  4GYD A;  2CA4 B;  1F1C A;  1NTK D;  4LJI A;  1CTY A;  1CSW A;  2MHM A;  2ZBO A;  4AAO A;  3A9F A;  1IQC A;  2FYN B;  4H0J A;  4RSZ A;  4N0K A;  1KB0 A;  2ZON G;  1E2R A;  1CXC A;  2I8F A;  5TIS V;  3WFE C;  1AYG A;  1C75 A;  3O0R C;  1NTZ D;  1LFM A;  3L74 D;  1GKS A;  1KV9 A;  4FB1 A;  1CCH A;  2V08 A;  3OCD A;  2D0S A;  1C2N A;  1HRC A;  1I54 A;  1KX7 A;  1RAQ A;  1CRC A;  3H1H D;  4WQ9 A;  1CSV A;  2B11 B;  1GDV A;  5KAI V;  5B6Q A;  5KKZ B;  2QJP B;  1M60 A;  3L71 D;  1HCM A;  1YEB A;  2CA3 B;  3CX5 D;  1DT1 A;  3ZOX A;  5GTI V;  2MTA C;  2C1D A;  1P84 D;  4EIF A;  2BCC D;  5CIH B;  1S5L V;  3L75 D;  1N9C A;  1A8C A;  3M97 X;  4FAV A;  2FRC A;  1H9X A;  3RMZ A;  2V07 A;  3L4O A;  1N50 A;  1C6O A;  1CYJ A;  1CIG A;  3H1I D;  1GQ1 A;  3RN1 A;  3ZOW A;  2C2C A;  2YK3 A;  3C2C A;  4QAO A;  4DY9 A;  2JQR A;  1H9Y A;  1QN2 A;  2GC7 D;  2DGE A;  3DP5 A;  1DW0 A;  1M6Z A;  1CNO A;  1K3H A;  1FHB A;  1C2R A;  3X39 A;  2N3Y A;  1QL4 A;  4V2K A;  1NML A;  3NBT A;  2IBZ D;  1H31 A;  3ZOY A;  2GC4 D;  2ORL A;  4FA9 A;  3ZOO A;  3BCC D;  1NU1 D;  1KB9 D;  3PXS A;  4AAL A;  2C1V A;  3SJL A;  4MU8 A;  5E79 V;  1BGY D;  1N15 A;  2C9X B;  4AAM A;  4UB6 V;  1U75 B;  3CU4 A;  3OA8 A;  3CX5 W;  1OCD A;  1IZL 0;  2FWL A;  4IL6 V;  1HJ3 A;  2YIU B;  1LC1 A;  5EXQ A;  1HZU A;  1R0Q A;  3ZCF A;  1RAP A;  1DW2 A;  5B5E V;  5CIC B;  1C52 A;  2AIU A;  4H0K A;  4Q5P A;  1AOF A;  2BPB B;  4L3G A;  3WFC C;  1CIE A;  1E8E A;  4GED B;  2XTS B;  1RZ6 A;  2BCN B;  4WQC A;  3PH2 B;  2D0W A;  1K3G A;  1MG2 D;  3DR0 A;  1KIB A;  1DW3 A;  2A06 D;  4P4Q B;  4PW9 B;  1DVV A;  1ZRT D;  3CP5 A;  1CYC A;  4PD4 D;  2B10 B;  1B7V A;  2CXB A;  1SQB D;  4O1W A;  3WU2 V;  5KAF V;  1CTZ A;  5IY5 1;  3A0B V;  2N9J A;  5AUR A;  1NMI A;  1LMS A;  4WQE A;  3O5C A;  1VYD A;  5CIF B;  4YE1 A;  5DFS A;  5C0Z A;  1S6V B;  1YNR A;  1LS9 A;  2OZ1 B;  1C6S A;  3KZI V;  3NBS A;  3ZIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...