1OAJA

Active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNDYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Active-Site Copper and Zinc Ions Modulate the Quaternary Structure of Prokaryotic Cu,Zn Superoxide Dismutase
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oajA00
3GQFA 1IBDA 1CBJA 2AQPA 3QQDA 4MCMA 2JCWA 2WYZA 1N18A 2V0AA 2WWNA 3F7KA 2AQSA 3H2PA 1Q0EA 1KMGA 3MKGA 1YSOA 4N3UA 1SXZA 1SPDA 4L05A 1UXMA 3HFFA 1BZOA 1U3NA 1IBHA 3HW7A 4A7GF 1DSWA 1XSOA 2XJLA 5KBLA 2GBVA 1B4TA 3CQQA 2WZ5A 1OAJA 1SXNA 3KH3A 1AZVA 1S4IA 1Z9NA 2WZ0A 2Q2LA 1E9QB 4A7SA 1PZSA 1XTLA 2ZKYA 2Z7UA 1QUPA 3KBEA 1SRDA 1PTZA 1YAZA 1JK9A 3SODB 3GTVA 4B3EA 2WKOA 2XJKA 1F1AA 1E9QA 1FUNA 1SXSA 1IBBA 2E47A 4BCZA 2AQRA 1E9PB 1CB4A 1RK7A 2C9SA 1OALA 3ECVA 3H2QA 3GZQA 3F7LA 1DO5A 4A7GA 1EJ8A 1SXBA 4A7VA 2VR8A 1F1DA 4A7UA 1OEZW 1Z9PA 2VR6A 2WZ6A 4N3TA 2GBTA 3S0PA 2K4WA 5KBMA 1HL4A 3KBFA 3T5WA 2VR7A 2AEOA 1P1VA 2C9UA 1EQWA 2ZKWA 1IBFA 1UXLA 1L3NA 2LU5A 4BD4A 3ECWA 1F18A 2APSA 2Z7ZA 3GZPA 3QQDB 2AQQA 3GZOA 2R27A 3KM1A 4BCYA 3LTVA 1TO4A 1BA9A 1OZTG 3KH4A 1E9OB 1SDYA 1IB5A 1OZUA 2C9VA 3PU7A 3ECUA 1SDAB 2E46A 3L9YA 3KM2A 1SXAA 1F1GA 4MCNA 3GTTA 1JCVA 3L9EA 1COBA 1E9OA 2GBUA 2WKOF 2ZKXA 1E9PA 1YAIA 5CU9A 3CQPA 1MFMA 1XTMA 3MNDA 1N19A 3RE0A 1PU0A 3CE1A 4FF9A 1SOSA 1HL5A 2NNXA 2WWOA 1SXCA 3HOGA 1ESOA 2AQTA 5KBKA 4U4IA 1TO5A 2ZOWA 4OH2A 2AF2A 2WYTA 3K91A 4A7TA 4OJAA 1B4LA 1JK9B 2SODB 2AQNA 2JLPA 2Z7WA 4A7QA 2Z7YA
chains in the Genus database with same CATH superfamily
3RY4A 1DBKL 4NI6A 1ETZA 4S2SB 1QUNB 2R9HD 3GSOB 4HLEA 3IMWA 3B5HA 4OM0L 4OZ4B 2Y36H 4ACPA 4FFZH 2E6JA 4DKEL 4R4BB 4JDVB 1MRCH 1YPZA 4I9XA 1CIUA 4MXWL 2HMID 1ETA1 1PJ9A 1G43A 2X40A 4BINA 2JH2A 2Z0UA 4XE0A 3WCYA 4LVOB 3REWA 5AB2A 1TZOA 3AVEA 2CKBH 1R17A 4NC2B 4D0CB 1MHEB 4GRMB 5I26A 1Q90A 3ZHLA 4F7TA 3FOLB 5L2KA 1QYGH 1A1NB 3PPEA 2F61A 3BVWA 1VGKB 1KIQA 1NL0L 4P9HH 2A73A 4UT9H 3VGBA 5CU5A 3AMKA 3DUUB 4Z18A 4OLUH 5EN3A 2E7CA 2PYEB 1MEXH 4PJAF 2VRAA 1AQKH 4WWKC 1NDMB 2LT9A 2IOOA 2VM3A 3NAAH 3HKZA 2PYFA 3B7TA 2VN4A 3M7FB 1I4FA 1VZGA 3F62A 2K70A 3HG5A 5DF0A 5F1IA 1U3ZA 3TU6A 3MO1B 2F15A 2Y7LA 1ND0B 2IBZY 3NSFA 8FABB 1KTBA 1MFBL 1N0XH 2MRYA 1WZKA 1CFNB 2Q7YA 4K9EC 3ZKMC 4JPIB 1ZLDA 5EU6B 1IGIL 2K6WA 4GP4B 2XWTB 3T3PE 2VR6A 3SDCD 3NFPB 1BFVH 1RJZA 4GG6A 1FBIL 1XFPA 2NXYC 1NIDA 3O3DA 1YJDL 2EP6A 2ZCHH 3V52L 5C0FA 2V9UA 3LOWA 4XO4A 2D7OA 2CRYA 3FO2B 2D3LA 1BXXA 1PQZB 5DMIL 3D6GA 4Y5VB 3GK8H 1BOYA 3MREA 3TYGL 4ZUWB 3HI6L 3BHBA 5DWUH 3LZQA 3MOBL 3WLBB 5HDOA 3HZYB 4GAYA 1QLFB 4JUTA 2AHIA 3MBXH 3UDWC 4WO4D 3ZQWA 4U6VH 4Q6KA 1CVRA 5M7QA 3IEAA 3QNZB 3HG0A 3UTQB 3IFLL 3FDWA 4CMMA 3LCYA 5F1NA 2OMTB 4X80L 5AOIA 1EO8H 2Y7OA 4LRIC 5FWQA 4BQCA 2RALA 3K6DA 2IOIA 5EUOF 2DEWX 4OFKA 3UC0H 1I1YA 1AZUA 4W6WB 3ZYJA 4UINL 2DTSA 2O6CA 5ISZD 2QVIA 4OJEH 4AH2A 1NBVL 3SQRA 3BO8B 4EXPX 4I87A 1RZIA 4YX2H 5JW3L 2GB2A 3L3IA 4HS6B 4K9EH 4OCXL 1FYTD 4QOKB 4XVOA 2VC2B 3MUGB 4R0LB 3ZDXB 3CN2A 4CN1A 2OYKA 4QYOB 4OLWL 1QWNA 5B8CA 5I71C 3D34A 5C0AA 3LPWA 4NIYE 2CJUL 3PWLA 1Q0EA 3MKGA 3OLEA 1MJJA 1ZGLP 4ZS6C 1A6WL 4LCWE 1HIML 4DZBA 3GS0A 3SJVD 1FNAA 3TOPA 3RFRA 4M02A 3O6FD 3PFUA 3SKJH 2F74A 3DGGA 3TBYA 4QRQB 4OFYD 1MFAH 5I2IA 1MRDL 4AVIA 4RFNC 4XMPH 2R69H 4NXKA 4R2GB 1B88A 1I31A 1QW9A 2VLRD 1T5WA 2XV0A 3PWPD 1EZSA 1OGAB 3GSWB 1OQOA 1ZA3B 1PDKA 4KJPD 4DPRA 3ILQC 1A8JH 5EO9B 1TLKA 2EH8L 3C6EA 4NZTH 3ZE2F 3D50A 2AQ1A 1S5IL 5IF0A 2EDJA 4NERA 4EZJA 2E9IA 3LKSA 2J25A 2NQDA 3FFOA 4NS0A 1CF8H 4TVPE 2ORBH 5TTRA 1A6AA 4JM2F 3X1BA 4C4KT 4JFPA 4ZOAA 5I6NA 4FQJH 1CB4A 1XB3A 4FP8H 2XG5A 3F7LA 3R06A 5J3HC 3T0AA 1EO5A 3DO4A 4QHLB 2FHFA 1V10A 4NQVB 1SLUA 2WAHA 1WV7T 4M6AA 4A7UA 1CGWA 5HHNA 1WTGT 1AOZA 3HRZC 4KROD 1N0LB 1E4WL 1U8CA 4JPWL 4U3XA 1IBFA 4ZAKC 4PCKA 4LFHD 4O02A 1CXLA 2V6HA 3UGUA 4JO1L 3GIVB 2CBMA 3M46A 3RGVA 5I75C 5JXEA 3OVUB 4YFLF 2HH0L 1CFQA 5JHLL 4X2UA 4MAYC 2AEQH 1LO3H 1T1YB 2VL5A 4MNQE 3RJQB 1HZKA 1XCWA 4G3YH 4KK8D 1BZ7A 2JSFA 4JZOA 4ZXBB 1U3YA 4XCEB 1WHOA 4PI0A 1G6RL 3O11A 5ALCH 4XAKD 1DVSA 3BKYH 1SOKA 3L7FB 1FL6A 3WNKA 5JPMB 3MJ9A 1E9OA 4BKLB 3GMRA 1SJVA 4FZ8L 2NXZD 4LSTL 2YXMA 4S0HA 1LE9B 2KS0A 2YA2A 3L4UA 3NESA 1CI3M 3CHPA 3QEUA 3N04A 3KPOA 5CJQL 5DGRA 1S9WB 1N2RA 3GRWH 1GPOH 3TONA 4QHKI 3EJZD 3L16A 3IDNA 4Y1AA 3FUEA 3QXWA 4PYHA 1ZEAH 3PABA 5ADOH 4EI5A 4GSUA 2F1AA 4XNXL 4JPQA 2R4RL 2ODHA 3O0RH 1JMXA 2Y22A 3BVVA 2DD8L 3S97C 2XIDA 5E95B 1SEQL 4ZK8A 2A6DA 1NCOA 2EQDA 4HWBA 4FQXB 4PWJA 1ZV9A 2YD5A 4I7ZC 3FN0L 2PTTA 1OF0A 1ZLWH 5DJCB 3QO1A 5CZVL 5DJ8B 2ED6A 4MXVE 3SDYL 3OR7A 1BM3L 4K8RC 1Y1DA 4N8UA 2IAMB 4DEUA 1YC7A 4AY0A 2NY2B 3EGDB 4RMQA 3IAQA 4NQDA 3VDBA 4Y4KB 4IDJL 5EBMA 5IFJA 2QEJA 4NQCE 4M61A 3O9WC 3QJFB 2BY2A 4R7DA 2QKSA 4K07A 4KDVA 2R7EB 4W9JC 4M03A 4DCQB 5GS0C 5I1JL 5E8NA 4F9PC 3QCUH 4ABUA 4LAQL 1X5GA 1SN0A 5I5MA 4DUVA 4JG1H 5FIEA 3DYMA 1NSNL 4N8CL 3WE6A 3D39B 2WXKA 4P46B 3V4VA 2A7BA 3BSZA 3WN5B 5GRVL 4GG8B 3WUWA 3CVBA 2CO4A 2WTRA 5FYJL 3KAAA 4K7FB 4DFIA 4KTGA 1FAIL 2C3XA 2NNCA 5EEZA 2UYLB 5AG8A 4HZLA 2OZ4H 3EO9H 4GAGL 3CFKA 4TULH 3Q6GL 1ORSA 3BQUA 3MCKA 4G9FE 4CGUB 3S3DB 1ZMYA 4U1SB 3QIUA 3VG0H 5JW5B 4OF7A 2X4UA 1SN2A 3FCSA 5L0QC 1IGFH 2CH8A 3FO0L 4F15C 1FIEA 4Z7OB 2X6VA 1A6TA 1AO7A 2A0LD 3V8CA 4HSQA 3ARZA 1RZJL 1KG0A 2H0EA 3GZPA 3TXAA 1MCJA 2GUOB 1SJEA 1AFVL 3VW3L 1X5JA 3NPZB 4K8RH 4K5PA 4Q6IB 3FH7A 4Q8BA 2VSCA 2XN0A 3UGXA 3M8OL 3RWJA 4WW2B 2H1PL 4M7JL 4MVBD 1PZ3A 4X8JA 4A6YH 4F58L 5J7CC 2WCGA 3B9VA 2JI1A 1HH9A 3QC6X 3QO0A 2E9GA 2C3VA 4N6QA 5CBAB 5GS0H 5DT1L 1ZTXH 3T1WA 4NO0D 2B39A 2PTVA 4WSGA 2X4NB 4HJJH 4ILDA 5DK0B 1ZANL 2AABH 5DMGC 2F6AA 5FO7B 3TBTB 3KNBB 3PXHA 3MACH 1BAWA 4W68A 3P77A 1UATA 1DEEA 1GY2A 1UM4L 2VR4A 4HWEH 4OZHF 5INCB 3L3OC 1F4HA 2YQ3A 5E2TH 3L3DA 3KJ4C 5C08E 1L9RA 3G6JF 2F58L 5AVWB 1XMEB 3CSFA 1OT2A 1RJLA 1BIIB 2CK0L 2NUPA 3NPSB 5CZRA 1U3JA 4LPCA 2YD9A 4Z8FL 3FUKA 2FATL 5I1GL 2F7PA 2NX5D 3EJRA 1OP5K 4LDLB 2EDWA 1TPXB 4AQEB 3JTTB 3WI9A 3PQYE 1V3JA 4RLDA 5ICYA 1CS6A 3P0GB 4PLNC 4W93A 2BX5A 3PGFH 4IBQA 3IJEB 4WHTA 5AB1A 5FS5A 1U8KB 4KQ4L 3AACA 1A7NL 3FU0A 1IT9H 4RDQF 1HWWA 3ZYIA 2ZP8A 1S3RA 5J06A 5L2JA 3PREA 1I8UA 3P54A 4FNSA 1QR1A 4AW4A 1QNIA 3GWJA 3GXMA 4PGJA 3CN0A 4JFEA 1HHKA 2FT7A 3WNOA 2YPVA 4Z7VF 4HEME 2QMJA 4TXVB 5HYSB 3FOMA 1IC7L 5DK3A 1INDH 4RSVA 3ET9F 1ZGLM 3S5LB 2WD0A 3V4PH 4DN4L 4IYKA 5BV7H 3MLSH 4OFPA 4GO9A 2UY6A 4XAWL 4CMHC 3WU1A 1YN6A 3A4EA 2CLZB 4LF3A 1IAOB 3SDCA 1SHSA 3V0IA 3NJFA 4L1LA 1G7QA 4ZI8A 1QSED 4M93C 4QRPE 1PG7X 2JKIS 4NAMA 2JXMB 2CRMA 3UAAA 4J2XA 2IFGA 4DUXA 1JFQH 4MMZC 4YH6A 2WLYA 3IPFA 3RTQD 3KL3A 3O3EA 1QTSA 3GMLA 4MDIA 2VWEC 4XR8C 5AW4B 5DEFA 5C2UB 3ATDA 2HKHH 4IRJC 1KYOJ 2O5ZL 3ECUA 3LNFA 5F7AA 1YZZA 3WTSA 5I8EB 4CKVX 3G5XA 3SKOA 3H42L 2X3CA 5ETUA 3H3KA 1G7JB 1MCHA 1UD2A 2IXQA 4G8EA 3UJTL 1DQMH 1JRHI 4FMFA 1HKFA 5JYMA 1J9QA 1Q0YL 5F72S 4G9DB 3MRIA 5IWLC 7FABL 1QBML 2WOBA 2EDBA 3F05A 4ZMVA 2EDKA 3CFNA 2EYTA 4M1GL 5ISZA 5DHYA 1IGJB 3L4WA 3CTTA 4HUVB 3S5YA 3RVWC 5HI5C 2WM0A 4YLQT 5CUSH 5GSVB 1BVNT 3VXPA 4XRCA 4NDMB 5AB9A 2RBLA 1FYTA 4F7EA 1BQHA 2AQPA 4KKRA 3IKCA 1CCZA 2XKNA 1WJ3A 3F7KA 4LCCC 5B1JA 3CIQA 4I3SL 3A6BH 1WITA 2P24A 3S35H 4MNQB 1YSOA 4X4YA 3D87B 2JJWA 1L6XA 1NJ9A 5D93B 5IJKA 3BCDA 3GBNH 3RIFK 4AMWA 4DP0X 4UU9B 3BWUF 1BZOA 3LIZH 5HI4C 1E3FA 5DS8A 3KBPA 4OFYA 3SOBH 2X4QA 4UMGA 4IOFC 2CZNA 4KKQA 3BN3B 2VLRA 5HGHB 1EIBA 2Y9RT 1KC5L 1FRGL 3FUNA 3BWSA 3FB6B 3D51A 3NIDB 2QVFB 1DQDH 1PTZA 3FSAA 2Y7QB 1M71A 1AACA 5IW1B 3BPCB 2WY3B 2OTUA 3I6KB 3I3EA 3NIFF 4QWWC 4R90L 2DDQH 4N0YL 2ADIB 1R3IH 1WSST 3GRBA 1OGTA 1PGRB 2WLHA 4TUUA 5LCVH 4HIHB 4D8PB 5JPNB 4D94A 2DQHH 4L8CA 2A6IB 3FTGB 2EE2A 4YAQA 4XPFH 5GRJL 1RIHH 4DKFH 4F20A 2QLYA 1FFPA 32C2A 4CNIB 4ZMZA 1VERA 2ZONA 1R24A 5D2LA 1TYRA 4UAHA 3MLTB 5JOPD 2VXVL 2BHUA 1UXWB 1X4ZA 3WEBA 1O5DT 3GB7B 4MGXA 5EU3B 3IE4A 1HU8A 5DRWA 2CPUA 4MYPA 3LEYH 4IRZH 4NNPL 5D1XB 5E6ZA 3CHRA 4CW1B 5K9OB 1M2VB 4KXDA 5INDA 5IMOA 1T83C 3LKOB 4JG9A 3UPRA 4L8DB 2WXNA 2HRGA 4RMVA 4Z76B 1VDGA 4HH9B 5K5YA 2Z4TA 2Y7NA 3TNMA 3V5HB 3CH1B 3QDGD 3UJIH 3UYRL 1C5DB 2MPAL 3EOBA 5D2NE 2YGOA 2FQFA 3IMTA 4MDJA 3FFCB 2K8MA 2EYRB 4QEGA 3WIHH 1HTYA 3OF6D 3UIYA 1HL5A 1HCZA 3QUZC 1E4XI 4ZPVA 1NCCH 3DX4A 4RQQA 5E4EC 4A68A 5ACZB 4R7NB 3IJHA 2LFGA 4L8SC 1Q9KA 4I0KA 2BVTA 5BMFH 4JO5A 3HAEA 4M5YH 3EYFB 2SEBB 3N91A 5DUPL 3TA3D 3V5KA 3IETA 3HUJB 3K4ZA 3IJYA 2LE9A 2JKJA 1KF9B 4P5KA 2NY6C 4OT1L 4YZFF 1LILA 2IALA 3U1SL 4U1NA 5E1QA 3WXVL 3CVIH 5HDRA 2MHAA 1IGTA 1XF3B 2R29A 4NO2B 4P5TB 4EUPB 4MRBA 5C0RL 3CVDA 4YSUA 1I1RA 3ULUC 1FIGL 3UCQA 2G3NA 2YLHA 1KCUH 3NJJA 4ZO7A 3GXPA 2XV6B 4LDEB 2BHYA 1W0WB 3CCHB 1I8AA 5D1ZC 3DXAE 5JQ6L 2HUHA 1T22B 1T2JA 2YS4A 3HE7C 3UTOA 3MJ8A 3BAXA 1R5IA 3SCMB 1Z5LB 3Q06A 5DFVD 4EE2A 5FCUL 1K6QL 4AK1A 3Q1SH 2A6KA 2VCOA 3HNVL 3P0YH 3MHZA 4DPCX 4JY5L 5EC2A 4I48B 4Z3EA 4DP2X 3OTTA 5C1MB 3EGSA 5CLTA 3ULSB 5CLYA 1RVFH 2BWDA 3LJ3A 5GGUA 4KRLB 3AADB 4KMTH 3CLWA 3TN0D 5J1SC 3FQ4A 4FXKB 4OLVL 5TE4L 2BRQA 2JQMA 2DJMA 3ZKQD 4LNRB 3W82A 4GI9A 4JFXA 1SJMA 4XCNA 3GBLA 1Q9LA 1JNJA 1HL4A 1CL7I 4YE0A 2B7DT 4Y4FD 3EFFA 1I3UA 2VDPB 3QIBD 2JB6B 4X6EB 2OXHB 5BZZA 4WV1A 1ZVNA 1I1AD 3DHPA 3PQYB 5F88B 1CXFA 1OE3A 3V6OE 3D9AH 3HMWH 1F58L 3ULUH 3WFZA 1IQDB 5AD0B 3LRGA 3AM8C 1AR1B 2UV3A 4A1RA 5CINH 2E9WA 4KI5E 3H4FA 3N43F 2Y6SD 1Y6NR 2R83A 2GC7C 3F7PC 1A1OA 4HXBL 3VD7A 2DLHA 2OJZH 2G5UA 3F8UB 1S9VB 1B4JL 1EBPA 2GTWB 1CDUA 2JWYA 1PD0A 1J0KA 2YUXA 3VXQA 2VJ0A 5JMRA 43C9B 3E3QC 5JOFA 4FL4B 5I19H 1U8IB 4OF6A 3SDAB 2HRPH 1B9KA 5KANG 5L8KB 3FSOA 3SSGA 1BVLA 1M05B 4OBSA 4TSCH 4ZSOE 3LD8B 1A2YB 5FYLE 4Z7UB 3FQUB 4XI5D 1WC7B 2E6QA 3D25B 4PGEA 2ZXCA 4MMYB 2WGXA 2P8PA 4S1RL 3S2CA 5IROA 3KW8A 1B9ZA 1ZHLA 1JRHH 3K2UL 4A2GA 2P5EA 4FG6D 5AWNH 2YSSB 3DV6A 4M7LH 4LVOC 1MCPH 4JAMA 3HHSB 4PRBB 5DTFA 3MYJA 2TRYA 3GUTA 1FPTL 2QVMA 1EV2E 2CGYA 4QRPB 2VABB 5EV7A 4NPYA 4IKIA 4F2MA 5BJTA 4JRXB 4YNYA 4H1LG 3HG2A 4EKJA 3V6ZA 4Z3HA 2NX5A 2PW2A 5I1IH 2NZIA 4GKOA 3L81A 5CJ5A 3L2NA 3D3VE 3LKPB 1RZ7H 1XSOA 1RZKC 4O51A 3QUXD 4PJ8B 4Q2ZB 3UG4A 4G7YL 1I7RA 3QA3A 1JNHB 3QCVH 2E7DA 1IARB 3D85D 1T03L 3M17A 3NEXA 4OZGB 2LTQB 4QNPE 1GYVA 1X5XA 4ZDHA 4A7SA 3O4LE 2R0LL 5DJXA 1MN4A 3GPSA 4G7RB 4KHTH 4XOEA 3TH4T 4OVUA 4NO5B 4BDVB 1SY6A 4TUKH 2VMJA 2D7PA 3EF4A 2VLJA 4AYID 3ZTNL 1G9NC 2IEPA 1HYSC 2DIBA 4LLYB 3I6GB 1MCQA 3F5WA 3NRFA 3UAFA 3UTSD 5DC0A 2OMXA 2NTSP 4TNVF 3CX5K 4OV5B 2EC8A 1OAYL 3IRPX 4UM8B 2M8XA 1TJHH 2DIJA 2X9XA 2F19L 3B7UX 1H9DA 5HYQB 3TO4D 1J5HA 2VR8A 2ESVD 1H0DB 5I17A 3EJYC 5DQ9B 1CXKA 3PGDB 1LMKA 2QPEB 1X5FA 2YMOA 4JFHE 1QSEA 3FTXA 4N90D 4ELDA 2HT3D 4S0SD 3GLEA 3HZKB 2DQGH 3Q3GA 2X7LB 4BKTC 2Z8VC 1TVBA 1MI5E 1EMTL 4AC4A 2XZZA 1XAUA 2H26B 5I6OA 1MF2H 3UIZA 1IEAB 2GEQA 3VI4A 3EXJA 2WJ5A 4J3OD 4K5OA 4RBPH 1RZKH 3CFBB 3DJ9A 3L2LA 2EEDA 4PJXE 2VIRA 4E5XB 1GC1L 1SDAB 1E8WA 4KY1L 1W16A 2QZQA 4C56A 3LKRB 2I9LA 1AG0A 1CZ8L 1EJ6A 1WZAA 3ES6A 5GGTH 4YXLH 1HAWA 3A67H 1JZ3A 5I8CA 3UOAB 1R3HB 1OAKH 2NY1B 2XZQL 4GKNB 1WBXA 1OM3L 3ZDXF 2B77A 4APQB 3L9RB 4K71C 1G9NH 1LDPH 3BAJA 4YIQA 2OQJB 2WKLA 5T5FH 4XBPA 2FBJH 2JELH 3KS0H 2BERA 1K8DA 4OQ1A 2N4IA 1MCIA 4KI1A 1E5CA 2JQZA 5DQJA 3WHE0 2ZKHL 2Y1AA 4NQEA 4XWGH 4GT0A 3ARGC 3W11D 4LOEA 3UMNA 3RIAF 1QFUH 4LKXB 1QABA 3GXFA 3NA9H 1E4XH 4HEPA 4K9JA 1KJ3L 3I6SA 3SJVE 3WHXB 4PV9B 4D0DA 3KXFD 4O02L 4R2GC 5ECJE 2XWBB 3LIUA 4XC3L 2FR4A 3LQZA 1CFSB 3H1ZA 1ETJA 4IU2B 1ITBB 2A4CA 5IVXA 2CUAA 3BAWA 4J3BA 4NQXA 1DSWA 3MFFB 4GMTH 5IEKB 5D70L 1MHCB 3WMQA 4PW3A 3T65A 3KPSE 1XGPA 1Y07A 3QPXH 2XWEA 4DQAA 1A6ZA 2QJDA 4IRSA 4ODVL 5D4JA 5D2NB 4UT7L 2W91A 1GAFH 2XG4A 3NJMA 4JDTH 2KUTA 3MJ9L 3LEVL 1IKFH 1JPFB 2X88A 3FQRB 4C8XA 1XGTB 1MZYA 3C5XA 3HCVA 1IFHL 1I85A 4HIPA 4DEPB 2ITDA 2FUQA 4J3OG 4S1SH 1AHWB 4MJJA 4J2QA 2DV6A 4BRJA 3EO0A 5A16A 3MX0A 1HDMA 4U05A 2FEDD 2W0FA 3PNWB 3EIFA 4NQSA 4PSRA 2J73A 3C5ZD 1KTDA 4AIOA 4KK5C 1SYVB 3IRCA 4KTDL 1UOKA 2WVVA 2O26U 4U1KB 4I9WE 3VE0A 1F1DA 3SE4C 3FU8A 1RP9A 1B6UA 3BP5A 1P4LA 1VZHA 3BFWA 3P9MB 4CKQA 3HB3D 5PCYA 4O9HL 1YEFH 5EOTA 1T3FA 4HWBL 3K72B 3QNYB 4F2FA 2K6ZA 3MU3A 2MH4A 2XTJE 5AOMA 4QKXB 1Q4NX 4GNKB 2F54E 2H6UA 3V0FA 2NUTB 4I77L 1CYWA 4Z78B 4UBDD 1MCRA 5DZVA 4EAEA 5HD8D 5JPMC 4XNQB 4N9GB 3DXAB 1X7TA 4OB5H 4JZNB 3V4LA 4MQSB 4ANUA 1F13A 1CL7H 2OW7A 4HUXA 4N2FA 4DTGH 4I2XA 4EQ2A 4F80A 3M1BA 4GQZA 1C08B 3P02A 1M4KA 3NZUA 3L9YA 1HSAA 3H9SA 1GGTA 5I74B 4N5UA 1FNGB 2ENQA 2FWLB 2H6OA 3AAZB 3BUYB 2FLMA 3DVNB 4OGAD 1PZCA 4ONHB 4YDLC 3VTMA 1A7PL 3V4VL 2Z8SA 5AB0A 3ZT6A 3BSZL 2Q20A 3OF6A 4U3HA 2FX8L 3DIDA 3SD5A 5B38B 4FKKA 4HT1H 2ZCKL 3JV4B 3SY0A 4FQXC 3HJ0A 5DEZA 1OP3K 1OSZA 5I18H 5G5DB 3LRLA 2F1BA 4JFFD 4APXB 1RH8A 2WTPA 1DJXA 4WTZA 2WUCH 2QSCH 2ZOLB 3L3JB 5C7ZA 3APDA 4FMVA 4L37B 1F90H 4UMSA 4F8NA 1GS8A 2IAMC 5TJWK 2NY2C 5T1MB 4Y4KC 1JVKA 1EA9C 4NN6B 5E8PB 2A9CA 1TTBA 4OCRH 1J1OH 4FNRA 4KDWA 5IMLA 1GGCH 2ZOOA 2BP3A 1YY8A 3FXIC 1D5ZB 4BK5A 1VGEH 1DBAL 1XF5B 3FBKA 1FG2B 1JGUL 2D0HA 2H3NA 2EIZA 2V3EA 4G5ZL 5E00A 4ZMTA 4LP5A 3WN5C 5GRWA 4L3ED 3MBWB 2FQGA 3ARFC 1G9EA 1QHQA 4GUPB 3P4MA 4PJIA 4IGBB 1Z9OA 4KK9D 3GSUA 1BXUA 3MBEB 3TVMA 3ZKND 1IAKB 1VB9A 4PJ7E 3TWCL 3U9UA 3OPZH 3SKUD 1H8NA 1KFGA 2BSTB 3FB7A 3ELAT 4X5RA 5MHSE 5FHBH 3UTZB 3NFNA 4M1DL 4MDRA 4Z7OF 1AS6A 3VNZA 2O4EA 2GHWB 4G6KL 4PYGA 4BHUA 3X1EA 3NCMA 3QUML 3K5RA 5C8JB 1D5MB 5CXPA 4KDTA 5CEZL 1KB5B 4TUJA 3AT9A 4Q6IC 1GSMA 4LNVA 4PRIA 4WW2F 3L4XA 1QG3A 3S36H 1HXYA 3P4NB 5F7LB 4Y4FA 4WW2C 1IVLA 1DN0B 2DBLL 1L3NA 2ZX6A 4FNTA 5JZ7D 5E8DH 4AUYA 4YPJA 3Q8AA 3C5SB 4X5XB 3QI9D 4S1DC 3D3VB 3NJKA 3GJFK 1N59B 3D06A 3DRTB 3ARBD 1BEYL 2IGTA 2WVUA 4PRDA 4YHML 2ZYIA 3GHEL 3PU7A 5I9QC 4WUKL 3E2HB 1NC2B 4E9QA 4X6CA 3FN3A 1YQVL 3S98A 3EBHA 3NIGB 1JWUB 4YVNA 1A4JA 2VXSH 3QS2A 5F89B 4Y1TA 4RGMC 5DJ2A 2PETA 1AGFA 4OJDH 1NCTA 1PVHA 5E5MB 1SHWA 5FO9B 4JG0H 2RH0A 4HJTA 1ZE3C 3BRFA 1MWAB 5EIVA 1FDLL 2NNXA 4GP8B 5JXAH 1GIGL 2IQ9H 1J0HA 2VH5L 3BKJL 3JV6B 2X2HA 3NPSC 2QT6A 2YPVL 3FQNB 3WS6A 5CFAA 1SVZA 4MA7H 3ZT7A 1W15A 2DYPB 2IWFA 2P47B 3FRUA 4AXWB 1GKEA 2R2EB 4GJTB 4WGWB 2CGRH 3WTVA 4JKNA 2JCCA 5DA4A 1LO2H 3L1FA 1TPXC 4HK0B 2WQUA 5ICXB 2RR3A 1FFRA 3B6SA 5AYUL 3UZQA 3ZKXC 3LH9A 3BXNB 2R56L 1O5PA 1DVTA 4L5FH 2OS7A 4MCYA 2J1XA 3PY9A 4HCRA 3T0BA 3HG1B 5F7KC 1N7MH 4W9EC 6FABL 1QLEH 3MOQA 3MRDA 4N3UA 2J2ZB 1CXEA 4PJ9B 2H8PA 1A9EA 3VG9B 4PJXB 1KENH 4HHAB 1D9KD 3QUXA 4NC1C 4RFOH 1TU2A 2QR0A 3AU1B 3IMRA 2ZUQB 15C8L 2CPCA 4KUCF 4XE5B 2CDEB 4TNVK 1UM6H 1MVUB 3D85A 3NG5A 1NCWL 2J71A 5FYKD 5KJ4A 1DR9A 2FB4H 4LEXH 4AYFB 3WV0A 1O6SA 1LWRA 1BMWA 2PWHA 3LPFA 3SDXB 4NZRH 3RWEA 1TT6A 1OE2A 3HBGA 2BHZA 1UZGA 3B1TA 4ELKB 1JPTH 3G6AA 5I1EL 1YMME 4KY2A 5AOKA 1QWUA 4O2FA 3KGUA 2UZXB 3ATAA 4UQ3A 3IU3A 1BJ8A 4JFZH 1U6AL 1I7ZA 3MQIA 1Z0MA 2OMYB 1PCXA 2WWKT 5CIPH 3P3SA 1T0OA 2HG5B 5D8JH 2AGJH 3HVNA 4BRVA 1I9RH 3Q01A 5AKRA 2KPWA 1L7TL 2X12A 1UD6A 3TO4A 1I7UA 2DWDB 4ZW6A 1HKLH 4A38A 3WMSA 4LIQE 4Q9BA 2W07A 3DMMB 1NA8A 1FA4A 3FUFA 1JFHA 2X4RA 2FO4A 2F8VA 1Z9SA 4TTDC 1F3DH 4BSWA 1UH2A 1NKGA 4QT5B 1UWEH 2G60L 2CLRA 5KSBB 3G5WA 3E80A 1Q0XL 2PW1B 3GYRA 4BA0A 2RQEA 1KNOA 4PJBA 3VFRA 4F7KA 1XAKA 4S10A 1IU1A 2YUWA 5T1KD 5FW6A 2C9VA 1RUAL 2K4AA 1BWWA 4FZEH 1JD7A 1QPKA 2X4OB 2XBDA 2Q8AL 3O2VL 5FGCE 1C16A 1SEBA 3QDMA 4K0OA 1RD6A 5E2WL 1QSFB 2PCPA 4L29B 2PWGA 3QZNA 1I9EA 5DWPA 1DJSA 2CM5A 4L48A 5DQDH 3RIAK 5E6IB 5ESQA 5CEXB 1I8IB 4MZ3A 3WFCH 2XA8L 3LZFL 3OM3B 1R3KB 4JKMA 1W80A 5IEHB 3D30A 2ZPKH 2NR6D 3GXNA 2CCLA 4OD3H 5HVHC 2FYYB 4I5BB 5IB2A 5D93C 3MA7A 1AY1H 4XPTH 1TVDA 4XPHL 5AVTB 3OKNB 3RNKA 3HNTH 5TGBA 3PL6B 4RRPG 2XTJB 2OTWB 3TBBA 1ZVHA 2C1OA 3BJLA 3U46A 2H3KA 1URLA 5KYWA 3ARDA 3NIDF 4WSJA 2P1YA 3BVNA 1OTSD 1KPUA 1UOVA 2Q7AA 4FCAA 3PHQB 3B5GA 5D4QA 3GSRA 3ZO9A 4DN3L 3AG2B 3TURA 2ZAGA 2ISDA 4MXQD 2RAMA 4FLRA 4TVPH 4MJ2A 1ZHNB 2WZ5A 5E7FA 3LV3A 5D7IA 1IL1B 3S9DB 1LGVA 1NBZB 2IBBA 2VDKL 2FECI 3N41B 3PYCA 4BXVA 1BW8A 2CHNA 4BQ6A 1OOAA 2Y1VA 4ABWA 3RVVD 3BYYA 5EEWA 4G6JH 4WI7A 1HINL 1VJSA 3G5VA 3TJEL 5JPNC 3KPLA 4WJ5A 4EO5A 5KOMC 5D6CB 1TOXA 1ZDSA 3QR1A 3FQ1A 3MOAL 3GKZA 4WI4A 2OXGA 1FUNA 4ZNEE 3HI5H 2QGDA 4TV3A 1YA5A 4ZJ9A 2XX0A 4LBEA 4ZMWA 3PV6A 4BYHA 3C5ZA 5E23A 3U79A 1BD2D 3AREB 2Z8RA 5FM5M 3U9PH 4J6RH 3VXTB 1JYXA 4G1MB 2XWZA 1WS8A 5D1XC 2NT1A 3G5YB 5LG1A 4DW2L 3IJ9A 4RMBA 5ITBL 4M6NL 2CQVA 3E1ZA 3LZOA 2R29L 3SPHA 1JV5B 1BJMA 1DBMH 1DFXA 4PUBL 5IMMB 3RFZA 2F53B 3RUGE 1EZVX 1TZHA 5LGHL 4P2AA 2NW2B 4XXDB 3HRPA 3O4OB 1OK0A 4JR9L 4MB4A 2JKTM 4XC1H 3EHBD 2Q10A 5DJYA 4M1CD 1WRFA 3QDGE 4X4ZA 2ZYRA 3MLRL 4KJQD 4R26L 1Z5YD 4LOUC 5DC4B 2JIXA 5F9OH 2HPTA 5BS0D 3CPLB 5E94A 1JZ6A 4KO9A 4UUJA 2B0SH 3ZHFA 3D0VB 4GH7B 5GPRA 5AAMA 1YEKH 3GBML 5C0CB 4KJYB 2XX1A 4LCYB 1RK1B 3QRGH 5CU9A 3CZEA 5BO0D 2YZ8A 1EGJH 3SPVA 2R1XA 3MNDA 5FK9A 5C97A 3HUJF 5C07B 2X1PA 1G7MB 4PGBA 4FNLH 1QWHA 1JF1A 2XV3A 4KQ3L 2WWOA 3KL5A 3U4EA 4PJCA 1OTUC 3VMOA 3UL4A 5B3JF 4QGYA 3J27A 4G7VL 1Z5HA 3L3HA 4PBVC 3L95A 1T5XA 4QY8A 4YHIA 1J0YA 5ABZA 5KVDL 5E5LA 3ZMNA 4UT6A 4P5TC 4OU3A 5FA3A 1KULA 2AQNA 3VFSA 3OX8B 1JWSB 1G0YR 5EUKA 3BKCL 3VFGL 4HJ0C 1EEZB 1KJVA 1PAMA 4MCMA 4N0UE 4J3TA 3SHSA 3BSGA 1OD7A 2R0ZL 4WFFE 2DQFA 2K8QA 3U6RB 3ILDA 4UIMB 1T20B 5EU4B 2CRIA 4OI7A 5CF3A 5E08L 1L0YA 1KXVA 3O6KL 1PKQE 1PMYA 1AD0A 4GW1A 2AJSL 2H9GB 4MNHB 2BY3A 1NANI 2H47C 3L2MA 1O6VA 2NNAB 5CZKA 2OK0L 1C7TA 2GFBA 4ZTPL 2PUQT 4O2EB 1CO1A 5CP3H 5EBLA 4AV5A 4ONFL 1OPGL 4Y5YB 3EYVA 1FV1A 2DB8A 1TVHB 1Y6MR 1WWBX 1N4XH 5EDSA 3KWUA 1NOFA 4GAJL 4MJHA 2RGSA 1TTGA 1F6AA 4ORZC 2R1YB 1AKJA 1J8HB 5A2AA 5I24A 3H0TA 1NLBH 3ASNB 2XZCL 5KSAB 4NQTA 1D5BA 1G5GA 1KPVA 4AYEC 2J4WL 4PB9L 1E4HA 4GKSB 5TH2A 4TSAH 3ZGHA 4V1DE 4EXKA 5B39A 2Z91B 4KX8A 1YY9D 4HGWA 1MLBA 1YO4A 4G6ML 5EZIH 1NBQA 3EKCA 3DUSB 1AR1C 2W0PA 2PCFA 3NSJA 4C55A 3BE1H 3GRGA 2Q0ZX 4JPVL 2ATPA 3SYCA 3ECWA 5IBUB 4U1GC 3FC8A 3PF2A 4AMKL 4Q74A 3WN6A 1P84K 3ZHKA 4ZO9A 3GZOA 3QI9A 1TQVA 4FL4C 4G42A 4Z7UF 5DUBB 5LGJB 3O8XA 4AM0B 3LD8C 3ARBA 1RSYA 3RDTB 2ZF9A 5KTEL 3VWJB 2BC4B 2VDLL 4OI9A 1MFEL 2WLIA 3DX9B 3GJEA 3NP3A 3NTCL 1HHHB 3BLPX 1Q9OA 2XN2A 4XNZB 4LPXA 1DCLA 3WJLC 4L4VE 4ZODA 5JHDA 3KLSA 1CYGA 5IG7A 1BXVA 3FT3A 4NKDB 4OLYH 1UXSA 1KYAA 1WFMA 3W0WB 2BSCA 1KGIA 2IGFL 3TCLB 5LDUA 3QCTH 4KNSA 3S96B 3PWVA 2EDFA 2X6CA 1A4AA 2BMKB 4HOZA 1HCVA 1BQKA 1FH5H 2HLFC 4HIEB 2VJ8A 4QRSA 2VDPH 4F8OA 2HTLD 4Q0XH 3RKDC 4QO1A 1LEKA 3B9DA 3R1GL 1Q9WB 3IBOA 4AEIL 5T3XD 5JIIA 3D5OF 3UJJH 4U1MB 1R5VA 2XVKA 2F8IA 4E42B 4PJ8C 1HI6A 2P28B 4M6MH 4JQVC 3DETD 4PR5A 1A14H 2XVBA 1P7QD 5CBEA 4OZGF 1HCFX 3IDUA 3OWEA 4LCIL 4QRFA 2EDRA 2ROXA 1G6RB 1Q94A 2LTQC 1HXMB 1CLCA 4IBYA 2BP8B 2MCPH 1OAXH 4Z7IA 5LGYA 2VDML 1D9KA 3V9EA 1M56B 2BOBB 1YEEL 1EAPA 3GDBA 1E28A 3QJOA 4EF3A 5DMYA 4OM1L 2HX9A 3DSNA 3QAQA 3F7YA 1CD1B 4RISH 1RKRA 4PJHA 1NMAL 1ZLUH 4XHJC 3UTSE 2ZSVB 3OMIB 4GRLB 1RZ8B 1J86A 1L7IL 1NGWA 3G6DH 4BQ8A 1YQ2A 1UJ3B 3EOTH 1DQJA 1KB9K 4DIXA 2BP0A 2ESVE 3RWIA 4QKTA 4ZT1A 1OF2B 4LLMB 3QQ4B 4OCLC 1NEUA 1FZOA 4HD9A 1NFIB 3KLHC 4AQ8A 2IDQA 5FUOH 4KZ0A 3FQ2A 3LZPA 5I6XC 1BYOA 1JUFB 3B37A 3V7AG 1A6UL 3F12A 1KFAL 3EG9A 1LO0L 5DJ6A 3ZSSA 2NDGA 2QZ5A 3UCRA 1SFHA 4OV6F 2EXWC 2QQKH 1PL3A 2DI7A 4AG4L 2ARJA 4PY8J 1BX2B 1JGEB 1U8MB 3UAJC 4OZIA 4NLAA 1UZ8B 3LN4B 2HLAB 1A1MA 2V17H 2Z1KA 2GC4C 2NY1C 1ULVA 2RACA 4KKBC 4WI3A 1T4KB 4FFWC 5DSCA 5E7BA 3IN2A 1ZHKB 4LPYA 4B60A 4NPKA 1KCWA 4H0HB 3MROA 1AGCB 1J5CA 1I1FB 4FXGA 4KVPA 2W59A 3FZUC 3QR2A 4WWKD 2ICEB 3LXBA 2C7UA 2YR3A 4ZMLA 1FC2D 1NBYA 4PD4J 4N2KA 4F7MB 4PJ6A 5L4JA 4H7VA 5JW4Q 1EAJA 1VPOH 5EZOL 3VGFA 4LARL 3NABL 1Z3GL 5I8OH 3HMXH 4YSPA 1S7XB 1NINA 3JWDL 4MZRA 5EO1B 2NR6A 5KWYC 2YFNA 4LL9A 2Y1YA 4LP8A 5IK3A 3ZKMD 3SE3C 2H0FA 3KXFE 5KSVA 1P5VA 1RP8A 4KITB 1QMUA 3R7QA 3CN3A 2VERA 3NDYE 4H5SA 2ZWYA 5TK2A 2I9TA 3BZ4B 3LN5B 5MERA 1O75A 4E41E 3MTRA 2DWEB 2EIJB 4HS8L 4UM9A 2YZ1A 3K7UA 2IDUA 2NY0B 2D31B 1F4XH 2Q76B 4P3CL 3V0WH 5KVEL 5D2NC 3V10A 3GSNB 2B1HL 2HVKA 5DD0H 4HGKC 5EO0A 1N5YL 3HAEG 3E7JA 3L5WA 3UABA 2DPKA 4OGYL 4ZFQA 1IM9D 3I9IA 4Y1SA 4FC3E 3CC1A 4MQXC 1OP4A 5GJSH 1E6JL 1AHWC 4HDIA 1RK0B 5SX5K 3WL9A 2JMRA 3VQ1C 2DQCH 1PLGH 2VQUA 4OKDA 3US0A 3QB7C 1L0XA 1LK3H 1NFDE 3VFPA 2Z7UA 3VWKC 5FO8A 2GCYB 3L5IA 5FGRA 4ADJA 4ELMB 2A2QT 3BOVA 4LLQB 3QXUA 1NANH 2H1LM 5FUZH 3SYPA 1GZHA 2HFFB 2MIZA 3CUPB 3RP1A 1BVOA 4KO7A 1IGCL 3KPNA 4OD1L 1J5OL 2BFGA 3ISRA 3Q2LA 1FQ9C 5DMKA 3VVWA 5EORH 3NJVA 4HWUA 1GGBL 5GGRB 1X7QA 3MUZ1 5TQ2H 4ZMQA 1A5FL 4N0UB 1OIOA 4ODTL 2A38A 2FTAA 5FFGA 5IM7B 1T04B 2QSTA 4W9CC 5FM5O 2FQDA 1N10A 1FO0H 1OXYA 4OVVA 3CDGB 5C0BD 3FU7B 3V0HA 1BVKB 4NP9A 2WZPA 4EZKA 2N7AA 2QQLL 3LDBB 1M7XA 3EZ8A 4U1IB 4ZS6D 3F01A 3VGAB 5IHUL 5L2KE 3K3QA 5I74C 1OAZH 5C0EA 4OD2A 2R27A 2I85A 2LLNA 1X9LA 2DBJA 3DVIA 3IK2A 4G8AC 3ZBMA 4FQ2L 4ODXA 2NQ3A 4KVCL 4FFTA 4AQOA 5DZOA 3L4TA 2V7HB 2W88A 3RVXD 1N6UA 4NFCA 5TF1H 2L7JA 1AJ7H 3CLEH 5BS0A 2EXSA 3DO7B 1W8EA 1MHPH 2BNQA 1MNUH 2J8UE 2OSWA 5LLIC 1AIFA 5FDWA 1JJUA 3ILQD 2D0GA 4RGOH 5KS9B 3QUKB 5EEXA 1KLGB 1YAIA 4JO2L 2W0LA 2WYIA 2CO1A 2X89D 4Z7AA 2CXKA 1NOAA 1SXCA 4ENEC 2R15A 4A37A 3DPBB 5AQ0A 1NDGA 2HSIA 5E2UL 1KGJA 5JORA 3ZTDC 1T7WA 5CN1A 4V1DB 5CCGE 4J3XA 4Y16B 2Z31B 3N06B 4NZDA 2PXYC 1J8RA 3GHBL 3EH5B 3GMMB 4OCSH 2AXGB 3BVXA 4X7CC 2PN5A 4RVBA 1ET7A 4XHQA 2C3WA 2LW3A 4TQIA 4YJZL 1G7HB 1EFXB 2AW2A 4KI5C 4N8VA 4HBCL 3KWWA 5B1AB 7PCYA 3SBPA 3T2OA 4XVTH 4ZAKD 3OKMB 5HVFB 2XIIA 3KWXA 2Z35B 4F2EA 1X6LA 4FQQB 3GI8H 5E1GA 3VU1A 1H5BB 3I2CL 1JWMB 4PW9A 4MAYD 2H32H 3A4DA 4L3EE 1YNKH 2PNDA 4IGBC 2G3ZA 3RL2A 1H15A 2TRHA 4PJGB 3MBEC 4Z3FA 2X42A 4OUOA 1NGYB 4JFSA 2OMUA 3DV4B 1L9OA 4E2OA 4I1PA 3EYOA 2BDNH 3KCPB 3RIKA 5KYUA 1H3PH 3CXDH 1SXNA 4L4VB 3G9VA 4J7RA 2EH7L 2W65A 5IQLA 3S37X 4GFXA 4JM4L 3HN5A 1S7SB 3VH8B 4FEIA 1HE7A 1V5JA 3NFSH 4HLZG 2FEEL 5AVVB 2BSBA 1RULH 2J72A 2MNJB 2MOVA 2JK5A 1TF4A 4N87A 5DLLA 1FZJA 1MJ8H 5DDHB 1E30A 1M53A 2BINA 3QG7H 5PAZA 1MG2C 1QKZH 1KEGH 4NM4L 4TVUA 5KJRH 1HL9A 4IOSA 3SQBB 5H4ZA 3OGCB 3I9GH 5HHQB 4QXUH 2XQYA 2DLEA 2GABA 3Q43A 5C0AE 2Z93A 1GZQB 4WUUD 1P5UA 3VCLA 3AXLA 3WJJA 4GQ9H 4ETQB 1HNGA 1PG7W 1RZGA 1S9YA 1KLUB 1U8HA 2AANA 2IFFH 4AT6B 3AW5A 4QNPF 5EH1A 3MLPA 3QHTC 5FGBC 1WG3A 1R1CA 5ERWB 1WTLA 1IJNA 4PWHA 4HCRL 3E2HC 3MRGA 4FMKA 3NIGF 1P6AB 1PLBA 1TTAA 2APSA 4PRPB 2XFXA 2Y5EA 2B15A 4K8RD 2OMWA 3K6IA 5FYLH 3H3PL 2HVBA 4XNDA 2AEIT 3VSQA 4HUCA 2Q5BA 2N59A 2A77H 3EOAA 1XGUB 3NN8A 3O9WD 2R59A 4TLKA 1OCOB 5CWSB 2GPZA 5SWSA 3RBSA 4J5VA 1JNLH 2AITA 5GS0D 1IIIA 3DLQR 3K1DA 2R4SH 3MNMA 3CLFH 3THMH 1FZMB 1NC4D 5HYJB 3A6OA 1MUJB 1EHLL 1XEUA 2YOAA 3T2NH 2V37A 3GHPA 3QNFA 1P4IH 1Z32X 3VFMA 1M1XB 5I1HL 2DWYA 2IMNA 1KB5H 2HZHA 2H1XA 4QHMA 3T8XA 1E4KC 4BIKA 2AXWA 5IV2B 3ARUA 1YCSA 4M48H 1MCCA 4GEIA 5T33L 3HC4H 4ODUA 2A74A 6CGTA 5LN8A 2XNAB 3B9KB 1NCHA 4PJXF 2FD6L 2V2XB 3VG9C 4NNYA 4N20A 4OFIA 4N28A 1E6OH 5CSZA 2JTDA 1U95B 4FTVD 3LVTA 3LN9A 4ZX3A 1P7QA 1HNYA 1K5NB 1Y18B 4GAAA 4P5SA 1QNZL 2BVQB 5AVXB 1QRNE 2WXMA 5D7JB 3SDXF 2CBPA 2CKBA 1KGXA 4HD5A 1T0PB 4HPYL 2WXJA 1ZS8B 2L7UA 5GGVH 1OTTC 5A2IH 2NW3B 4MQ7A 1S7TA 2GITA 2NMSA 5GGSA 1XF2A 4Z23A 5IMKB 4UT9A 3FNKA 4LEOA 1CDYA 3RYMA 4OCYH 4FXLA 4PIRF 2V8LA 1KBGL 4JJOA 3UYPA 3V0GA 4H26A 5K9KB 4Y1AE 2OSLB 5SWZD 4DVRL 5DMGD 1H19A 2BVPB 1YN7B 1KCBA 4IIQB 1SM3H 1KIRB 3GBEA 2CM6A 3QG6A 4MMXB 4JHWL 2NY5C 3OKEB 3R8BB 1TTUA 2CO7A 3DMMC 2CJ3A 2AK4B 5H2BA 4JGUA 3SO3B 1C9SA 1AIZA 4Y19D 2HFEA 1BIHA 5J1AA 1AKPA 3UBXG 5KSBF 4MASA 1WFTA 1SXBA 4L4TA 1CXHA 4ODBD 2WMPB 5DVPA 4XXCA 4LLWB 1TJMA 4AGOA 5EPMB 4H2CA 4GW4B 2UXGA 3N50A 1KLFA 5C3LD 4JY6B 5KW9L 1Y0LA 3US1A 2IH3B 1ACXA 3BUPA 4ONOA 2BOCA 1M7DB 1UEMA 1C1EH 1ZGLB 4XN7A 4Y8AA 5AW0B 4NQDE 2ZUTA 4GPVA 1WIUA 4P2OB 2V3FA 1ZT4A 1UUSA 3QXDA 1A3QA 2MOGA 3WO4B 1KN4H 4JUSA 3QUGA 2OCJA 2NLJB 2XKUA 3TIDA 1NCAH 2F5AL 3HI1B 1V8HA 3BZFA 5IVNA 1I3GH 1SYSA 2YBRB 1G9MC 1FLTX 5T1LA 4ZNCD 3DIFA 4GUCA 1DBJH 1ES0A 4KZCA 1JXKA 3GLAA 1IZKA 4IMKC 4NRYA 4QRRE 3V0AC 4JK0D 1IEBA 5TFSH 5TDPA 3HPLA 3KBHE 5F1SA 3PL6C 2XTJC 2BWIA 2PMZA 1ETZB 5ACMA 1FF5A 4A7TA 2RMNA 5L4IA 1TUPA 3BT2L 4UOJA 4XP4H 3RWHA 3OZKA 5LBSH 4J1UA 3QJHA 2YSTA 2EIDA 4IW4C 3WBDA 1XHHA 2Q87A 3UBFA 3ZHNA 4MJ6B 4KMLB 5DJZB 2RCSH 3N41F 5L2KB 3FONA 1K8IA 2WBXA 5E5RB 5F44A 5GGVY 5IHHA 4UAOB 5I0YA 3R0MA 2VN6A 4XP1H 2EEAA 3T2QA 1DQLH 4IMLA 1KIQB 4MLIA 4N2DA 2A73B 4RRPM 3VYPA 3SY6A 1A9VA 5JLZA 2BJML 2HX8A 2EE3A 1ZV5A 4IRJD 1BP3B 4Q6YA 2R69A 1G0XA 1JV2B 2PYFB 3UDWA 1OAJA 1WAEA 4P05A 2DMKA 1I4FB 4FTDA 1PD6A 1X44A 3DX6A 3GMPA 4RAVA 1G9MH 3MNVA 5F1IB 1II4E 2ZKMX 5KSUA 3LVEA 4FN0A 1GTNA 1IGMH 3U2IA 2Q7YB 4H2AA 2Q86B 1HHIA 5KBNC 1Q38A 3CXHJ 4G7QB 4OQTH 2ZWLT 2WIIA 4TLSA 3JTBA 2FVNA 3BKML 4JRYD 1V3MA 5I6KA 3HIZA 1RJZB 2QTEA 4GG6B 3O3DB 2PR9A 2C5DC 5BW7A 5CEZE 3MLYH 4UT6L 3ZJAA 3GZQA 3QIWB 5I0XA 5TE7H 3NJHA 5HI5D 4PP2A 3RVWD 1O0VA 1Q1JL 3JBG7 1NUGA 2JB5L 3FT2A 3MREB 3WEXA 4M5ZH 5GSRA 5G55A 1BQLL 3BHBB 3AT8A 4NP4L 2XU9A 2NZ9C 4GAYB 5C0BA 4F92B 4PEEA 1MFNA 2UWEA 1XVSA 2GTQA 4XMKH 4CMMB 5J57B 3PFQA 5F1NB 5HI4D 4GOSA 3EDFA 1MRFH 1SJHB 4W9HC 4IOFD 3QZWA 3HEIB 5D96B 1WBZA 1I1YB 4QTIH 4XH2A 1YEIL 3PJNA 3RAJH 4R4FL 4CL7A 2OPCA 4RMRA 1YJDC 3T1FA 5I15L 1DQQA 4PTTA 1RZIB 3PAVA 3ABMB 3MJ7A 4WU7A 3VXUA 1HK6A 3L3IB 2FZ3A 4Q9RL 1A6VH 1CE6A 4Y5XB 4FFYA 4QRBA 5CJXC 4QWWD 4K3HA 2WJ7A 2ZOWA 3GRWA 2PPAA 4YHPB 4EJ1C 1E8XA 5B8CB 1KIUA 5C0AB 3PWLB 3PHAA 5MP6L 4R3SA 1MJJB 5AZ2H 4W9LC 5DD6A 2BZCA 3NCCB 1MPAL 1NL0H 2COVD 2ZTBA 1VHPA 5BRZD 4ZMOA 3HRZA 4MNGE 5C09D 3TBYB 2YN5A 5I2IB 2YXFA 4ZAKA 4Y7MA 3BGFB 1UOLA 1MJ7H 4UQBA 1T5WB 3SQOH 3OXSA 2EDHA 4TOYH 4Y5YC 3OXRA 3MA9H 4MAYA 4Y2DA 5EWIH 3W38A 2AI0H 4OY9A 2WXPA 5CLZA 5DUMH 1TENA 3STLA 1OK8A 1Q72H 4AM0Q 4CC4C 1E50A 1WZLA 4IBSA 4EMZA 1MFCH 4DGVL 3LKSB 1P7KA 5KBPA 1CBVL 5K9JL 3PE9A 3QEQA 5KSAC 1NCBL 2VR9A 5D4IA 2EAEA 4LGRB 5FYJU 5C0GB 1A6AB 3I6LD 1FBIH 4JFPB 2C9QA 4X0KA 4XMLH 1YJDH 4H13C 5BQDA 2IDTA 3JWOC 2HTKC 5A2KH 2XG5B 3R06B 4HIJA 5FM8A 5HHNB 1J10A 3QUZD 5DC2A 1NPNA 2AJYL 3HI6H 5F8QC 1OCWH 1U8CB 5M94B 4O02B 3GMNB 2B1AH 3RGVB 2OZ4A 3FRPG 4JVPA 1CFQB 4RX4D 5GRZA 1ZY9A 2VL5B 1V7NL 2J43A 3CJJA 3IRZA 3KBFA 3LZRA 1QA9A 3KPTA 3H3BC 4WUUA 2NY6D 3VXOA 3WXWL 1JZ4A 5AZEH 3RDTC 1BOGA 1GOFA 3VWJC 2FHCA 1BZ7B 4HUUA 1UA6H 4JZOB 3IN0A 1QRKA 1OE1A 5KG9A 5BQ7B 4FNUA 1F56A 3O11B 4XNZC 1GOHA 3B43A 2AV7A 5ALBL 1ILUA 3ULUD 3VDCA 2J88H 3QRBA 1NGPL 3S36X 1FL6B 4U3SB 4YN3A 2PR4L 1LDSA 5GS1A 3QH3A 1E9OB 2OMVB 3KWTA 2WQVA 3GMRB 1RZFL 2EDDA 1NUFA 5D1ZD 3IDGA 5D72H 4A6YA 5HYIA 2VXQH 5KANI 3FQXA 3HE7D 2HJFA 2FJGA 5FM4A 3KPOB 3LNEA 3MLXH 3NJXA 1N2RB 2DQTH 3RY6C 4YHZH 1E5ZA 1K2DA 2BIHA 1NEZA 2ZZUT 3IDNB 4Y1AB 3VACA 5FFLA 2I32A 4C57C 4Q58C 2EYSB 3JWOH 3PABB 5IFAL 3CE1A 4WWNA 3RA7L 3ZZLA 2P7TA 4MWFB 5BVPH 4LSUL 5T3XE 1TO5A 1RUKH 4UOW0 1P2CB 5KOVC 2A6DB 4HAKA 3OLIA 4HWZA 3IGLA 2X9WA 2APBA 4DOHE 3NCWA 3MN8A 4BELD 4U2YA 1F3JA 1ZWIA 1HZHL 2PTTB 3HC3H 4GP5B 1JHLH 4LPWA 4BHUI 3QO1B 1NQBA 3VQ2C 3X12B 2QFRA 3F7QA 4A39A 2VOTA 2BS9A 4BWUA 2AK1H 5C0IA 3H9HA 3VAEA 3UBGA 3LS5H 1OCZB 4NQDB 1XH3B 3I84A 3S7GA 5EBMB 5IFJB 2WNWA 5T1DH 1S5IH 4M61B 5ESVA 3WOVA 3KYKH 2RJMA 3NSXA 3L4VA 2WINA 4Y9BA 3GNMH 1B3IA 5E8NB 1NMCB 1FFNA 4JDZA 4Z95L 4JZJA 2EIBA 3AFLA 2VLKA 25C8L 4YC2B 2OKMA 3WE6B 4AK2A 3AY4C 4LRNH 3V4VB 1UJ3C 3EYQC 3WUWB 12E8L 4KZEL 2M2DA 2WTRB 5F0LB 4TSBL 3GD1C 2OSYA 4QRUB 4MB1A 1CT8A 2FH6A 4AEHL 3W9DB 3ZZSA 3ULVL 4DNLA 3WTTA 2EZ0C 4HZLB 4H88H 3A24A 1UYWL 2I25N 3CFKB 2P80A 4LIQH 1F1AA 5JHLH 1OSEA 4HPOH 4JCLA 2ATAA 1IAIM 1ORSB 3EJTA 3BQUB 3MCKB 1V7ML 4O58H 4LVNC 4XP5H 3FB8A 3QIUB 1DVZA 1WS7A 3FCSB 3L3OA 3U4BL 4Y19A 1A6TB 1AO7B 3CWGA 4X5LA 3V4PA 1GCFA 5CSGA 3ME0A 1YNTA 5D55A 4CUCA 2BK8A 5DJAA 1J9CT 4KX9A 1SJXA 4MLSA 5AVZB 3S34L 3RX5A 5H94B 5ADPH 2FCBA 2AVGA 1UG9A 3RWJB 4X8JB 4LSTH 2NTFA 2QHLA 3QO0B 1FGNL 1FL5A 2C3VB 3ALWA 1WZ1L 3OLGA 3NRPA 4K23L 5CJQH 4N2HA 2PYED 2XKSA 1I75A 5G2NA 1CN4A 3VXRA 2ICEC 3FCBA 3UO1L 3OJVC 2E74C 5I0VA 3TBSA 2E46A 4WEMB 4XNXH 2R4RH 3SZ6A 1FFTB 4R96A 4PGZA 3QE5A 3P77B 1DEEB 1SEQH 1CJYA 1GOGA 1COBA 5JUEH 4BFRA 2O30A 2A1WH 1TQBB 3EH4B 4HFUL 1INQA 1EEYA 3L3GB 2X05A 1I8KA 3L3DB 3V4UL 1MCSA 3KHOA 3N0PB 1HYSD 4M3KB 3BZEA 5A2LH 4LEBA 1RY7B 1TETL 1CDCA 3ETBF 3K6SA 4XN1A 1VEPA 1EUUA 1RJLB 2NUPB 5ANHA 3KJ6L 2NY0C 5KVFE 5GZOC 2BNRA 2ICWI 1VFMA 2HLEB 3NACL 1OV8A 5LKNA 3V0DA 1AE6L 2JJTC 4JW3A 4YGVA 3EJYD 4K73A 5I1JH 4XP6L 2VM4A 2GSIA 4XN8A 4L18A 4LAQH 3NCYS 4QHKJ 1ID2A 5ICYB 1NSNH 4N8CH 1KMGA 5IHZA 3LKQA 2Q6WB 1RZQA 3IM1A 4WHTB 2KBGA 1CTMA 1YDPA 3HFMH 4HSCX 4LAJH 1P7BA 1XV8A 4K5MA 2H0PA 1F0LA 4MMZA 3LIZA 2VDOH 1W0VA 2VERN 4ELMF 4J4PA 2OR9H 3QZPA 5SX4I 1KTLA 1SDDB 2N56A 4C58B 1KCVH 5L2JB 2ERJC 3CQQA 3OAYH 3VTTA 4IRJA 3GKWL 5ICZA 2B8OT 1QR1B 5CP7A 3MLVL 5DC9B 2MWCA 1HH6A 5EUOE 4JFEB 1HHKB 2KYIA 3GXIA 4N1HB 4WWPA 4KVNH 4IOIA 5TE6L 3U7YL 5LG6A 4LU5L 2CMRL 1UCBL 2YA0A 3FOMB 1SRDA 5DK2B 3HTLX 3FO0H 1KCSH 1JK9A 4C4BA 2ZWZA 4QOKD 5IWLA 4KTEH 4OCWL 2UY6B 1X3DA 1MVYA 2P5EE 1H6FA 1XMWA 4LF3B 4XPGH 5DJ0A 4JRYA 3SDCB 1OD9A 3MV8A 2CHWA 4MYWB 4F8PA 1DP0A 2Y7MA 2VN5A 4TQ8A 3M8OH 1I3RA 4GSDL 5AVYB 5LCVA 2H1PH 3LDBC 2F7OA 4ORGA 2FYVA 3ARGD 4NJ9H 3ESNA 1XCXA 3U9WA 2Y06H 1JTOA 4H0GA 5J9PA 2WLNA 3O3EB 5JIHA 3GMLB 4MDIB 5JDSA 4H8WH 3WY4A 5IBTH 4R2GD 4HCIA 5DEFB 4C59B 1E7UA 1SF5A 2Y07L 1OGAD 3SKOB 5KS9F 5ETUB 5L8LB 5C0DA 4G8EB 4IRZA 3AGWA 2IXQB 5IZ7A 1UM4H 2ZSWA 2YD1A 2J5LB 5DR5H 1S5HA 4RESB 1DZ0A 4ZX5A 3BIAX 3W2DL 4U6YA 3MRIB 4UI2A 4ZFGH 1CVSC 4JO3H 3L13A 1DLHA 3MRBA 1GJUA 4IDLA 5HHPA 4GYBA 2F58H 2L04A 1KXQE 3KYNA 3ZE2E 2A83A 2EYTB 4R5XA 1AH1A 1FHGA 1TSRA 4G8FA 1PY0A 1GRWA 2FJHA 4Y16C 5DHYB 3MXWH 4HZAA 4BSVA 2A9NH 4Z8FH 3NZSA 4YHOH 2V9TA 5FB8B 1IRAY 1E40A 3WIHA 1I7TA 5HHOE 2QGBA 3FCTA 3VXPB 4XRCB 5B22A 4F7EB 1IFGA 1BQHB 1NCUA 5LJYH 1BAGA 4WY7H 3IKCB 3SGKA 2XKNB 2XV2A 1G0DA 4KK5D 4GSQA 3S88H 2P24B 1H5BC 5DLML 4PJGF 2Z7WA 1NJ9B 2EEFA 4DK5A 3OHXA 2ADFH 3VFWA 2D2CC 4H20L 4ZD3L 5DS8B 3HNSL 5C09A 3WDJA 1EERB 1HOCA 2X4QB 3VI4E 1PSKH 1N6QL 2NY4B 3RZCB 2Z4QA 3FT4A 2EDNA 4M43L 3ZRFC 4H1LH 4RA3A 4C56E 2WQRA 3BD5A 1XCTA 4PJFA 4DN4H 3TFKC 4QPEA 5AZUA 1WA2X 2P46B 5ILTH 3UXFA 2OTUB 2FGWL 1BYNA 1F4YL 4FS0A 2WBJA 4O5LL 2CIKA 5B3NA 1OGTB 2P5WE 5BO1H 2F18A 3VXME 5D7LA 4L8CB 5C9JA 2C9PA 4NQEE 4YAQB 5FCSH 2CBTA 2XQBL 4ZS7H 3QUZA 3W5NA 3KZ8A 4FQXD 5DVLA 1XIWA 32C2B 4J3VA 3RPBA 4N2NA 1XEDA 4YXKL 1R24B 3T0EA 3LAFA 1ZCRA 1J1XH 5AKSA 5AAWA 5EOCH 4GBXC 3H42H 3QP3A 5DRWB 4RX4A 3T77A 5D5MA 2IAMD 1YUHB 2VZUA 3PWNA 2NY2D 1JHTA 3AS2A 2AJZB 4D0BB 4Y4KD 1ZPLA 2Y36L 4YBLC 5IMOB 1IZJA 1MRCL 3AQZA 3LNDA 5GGQH 3MJ6A 2D4FA 3UPRB 1QBMH 2WXLA 3PXLA 4YDIH 1RFDL 4YSSA 2VDKB 3EJJX 4FI7A 3TNMB 2CKBL 3EOBB 4NHCL 4CADA 3D39D 4MDJB 3ZQXA 1QYGL 2XTLA 3BVTA 4AITA 2E7MA 4WU5A 3OQRA 3TV3L 2ENSA 4I18A 1AGBA 1XX9C 4P9HL 3ARFD 4UT9L 5DZAA 5F0JB 4ZPVB 2X2IA 4RQQB 4OLUL 4MJIA 3IJHB 1MEXL 3OAZK 1AQKL 1Q9KB 1TMQA 3NAAL 3HAEB 4U3CA 4BEIA 4FX5A 4HUWA 3P3RA 2WLLA 5DZPA 2CJSA 3V5KB 3IETB 4FGMA 1OKEA 3IJYB 4JQXC 4DVBA 2O6EA 1CD8A 2IALB 1U30A 4MB5A 2EVIA 1TIUA 4U1NB 1N0XL 5HDQH 3RX7A 3MPCA 3WFDL 4L3CA 3MRQA 3Q8CA 5SWQA 4E0RA 4JHZA 1I9IH 3PWJA 1BFVL 1FRGH 1BWMA 1JNNL 1JZJA 2ZCHL 3DJSA 5JA9A 1M3IA 2CHDA 3DJRA 1KN2H 4X50A 4IBWA 3WY3A 4PTUB 2WVSA 3MJ8B 1R5IB 2HJKA 1G1YA 5EC1A 4S1DD 3BP4A 3L5XH 4PJEA 5DWUL 2QMKA 4N0YH 5ESAA 3H9SE 2A6KB 2AJ3B 1QEWA 3MBXL 1WE5A 5IHWA 1PG7H 3OZ9L 4U6VL 2WZAA 3LHAA 4N2IA 5I30H 3N1MC 4DUWA 5EC2B 2QV2A 2YEZA 2XY2A 4MMXC 4PN6A 4FQIH 2CD0A 5GGUB 1ZKAA 1FORH 2CALA 2ZQKA 4X99B 1EO8L 5DVMA 1KGCE 5E1HB 3SO3C 2QVKA 1UWGL 2X09A 2EO1A 2A9BA 5SX4H 4OZHE 4JFXB 5ACLA 1F2QA 1UM5H 4XZUA 1JYWA 2CKNA 1KPRA 3TESA 1F42A 1B2YA 3M1CA 5CCJA 2VDNL 4WTQA 4P23A 4X4MA 5AW7B 5ES4B 3EFFB 3F00A 4J3OH 1OALA 4NCDA 3QUYA 4YX2L 1KEMH 4FLOA 4PLJC 3H56A 1RAMA 1MAMH 4WV1B 1S46A 4P2OC 4KFZC 4Z7WA 2N0KA 4R5TA 4BJLA 2EJ1A 2MPAH 4M8UA 3WO4C 4OI8A 2V9QA 3FO1A 4GRMA 2UZYA 3QEGH 3U2SA 3WEAA 2DIEA 3NCEB 2WOYA 3ERXA 35C8H 1GY1A 3ZRCC 1EZUA 1A1OB 5DJDA 4EN3C 2P26A 2WNGA 3WNMA 3I75A 1QQDA 3TEYA 4BCYA 1GYUA 3SKJL 1NH6A 3VXQB 4HOWA 2ZUSA 2J1WA 3T3MB 5JOFB 2R2CA 1A4CA 1RPQA 1MFAL 1BVLB 1NDMA 4Z3TA 1GGUA 4XMPL 4NAQA 3Q7JA 1CGYA 1FNHA 1DVXA 3C6LA 4B7LA 1NICA 3I9AA 4ZFOL 3ARQA 4KUCD 1BCIA 2ZX5A 4HJGA 5GGTA 2O5XH 2D9CA 3U1SH 3B8SA 4NZTL 2P8PB 3WXVH 5I23A 1XTMA 1ZHLB 1CFNA 1KDIA 2EKSA 4JPIA 2P5EB 3B7RL 4Z7VE 3IPEA 5C0RH 1CF8L 1N8OE 4KFMA 1NOLA 2ORBL 5DTFB 4JAMB 3MYJB 2L7QA 3GUTB 2JVUA 2XN9A 5T5FA 1F8TL 3GTNA 3F84A 4FQJL 4NPYB 4F2MB 1V54B 4FP8L 4R5VA 4LCWD 2IH9A 5BJTB 4YNYB 1JZGA 5IB1A 4YDVA 4UAOC 2DOCA 4J39A 2WANA 4A7QA 3V6ZB 4LQFH 2NX5B 2ZG2A 2PW2B 1GYCA 1RJCA 2O1AA 2DICA 4JLRA 1FFQA 4O51B 3HNVH 1I7RB 2VDLB 3BT0A 3QA3B 4TTDD 1UTDA 1QBBA 4JY5H 3QNZA 2AEQL 1LO3L 4JCMA 4L05A 3SBQA 1IGYA 3X3FH 4ZDHB 1G9HA 5DJXB 1URZA 4YDJA 3ARVA 3FU3A 3CU7A 3HBQA 4TVPD 2PWFA 4K7PX 4GG6F 2VLJB 2D3VA 3BGMA 5ALCL 1H3WM 2BP5M 3BKYL 3F5WB 5BRPA 5AFAA 2W9DH 3LXUX 4I0PB 1EEQA 3QIWC 4JPKH 4BWTA 4WJKB 3K71A 4DPAX 4IEFA 1KJ2L 1W91A 3PUUA 4NJAH 4QOKA 5I17B 4FFYL 4H0IA 4N2AA 5E56A 3GRWL 1REIA 4QYOA 1DO6A 4FRWA 4N5EC 4H44C 1A66A 1G1CA 5HYSG 1QSEB 1ZEAL 4MNQD 1UD8A 3RL1A 1L4IA 5ADOL 3QZBA 4HULB 3O0RL 3S5LG 4HXBH 2B9BA 4DP5X 1TVBB 3ARGA 3PDOA 3POCA 2X1WL 1U93B 1KWKA 3ESPA 4AKQA 1P1VA 2W38A 1DL7H 2IBGA 3C8KA 3VI4B 4CJ1A 1NCGA 3MNZA 2VDMB 5D96C 2VIRB 2AP2A 4FLSA 1OGAA 3VI3A 4C56B 2I9LB 4NC0B 3ZDZB 5JDJA 5FECB 3ES6B 5CAYB 4GLRI 5I8CB 2J55A 4IKNA 1BQRA 4S1RH 3N40F 4WF7A 1VZIA 3K2UH 3LRSA 2YQ2A 4A2FA 1WBXB 3Q6FA 4Y5XC 3RU8H 2QKIC 5EU5B 3S8GB 4E36A 5J6HA 4YIQB 3D07A 2Y72A 3QCUL 1EVUA 4XBPB 3I02A 1K8DB 1W6LA 4JO8A 4JG1L 4G80A 5FEBA 5L4FA 1U8OA 3VXMB 5DQJB 2CAKA 3NIFE 1CGSH 2BVOA 4NQVA 2ZP0T 4OLXL 4NQEB 4ODHL 1E67A 2GI7A 1S8DA 3HOGA 2KQNA 4J8RA 1JN6A 2UZIH 5J11B 1N0LA 3MRJB 1KCKA 4D0DB 5BRZE 2B3IA 3BGFC 4L9LA 3IXTA 5DS1A 2SODB 3W1ZA 3GIVA 5CJOH 4A66A 2OZ4L 3EO9L 1RHFA 4BGLA 2FR4B 5E9DA 1FVDA 1T03H 1T1YA 4NN5B 2E27H 5D1XD 3SE4A 3U4AA 2AKRB 3MRLA 1I9JL 1N26A 1SQMA 1ZS2A 3UZVA 1ZRUA 5IVXB 1HEHC 3BRGC 4PJ5A 3VG0L 3EJCA 1BZ9B 1IGFL 3KLQA 3MRHA 3T65B 4G8GE 4XCEA 3QXTA 2W1NA 1A6ZB 4IRSB 4ZMXA 4U1HA 3QJQB 4LHUA 2XG4B 1SN5A 3V6FA 5EF1A 4MAZA 4K8RL 3SBRA 3BDBA 4FG0A 4N6RA 2VZ3A 2EE9A 3QDME 3UBXB 3ZE0E 3FFCD 1MIEH 3BMVA 4Y2OA 3SPIA 3M6DA 4A6YL 2P52A 1JI2A 1PY4A 4LOUD 2ITDB 5K1NA 4ZFFA 4WW1A 1A3ZA 1FVEB 1DTUA 4LOVA 4X7FC 3SO5A 5HPOA 3EO0B 4P57A 1ZTXL 3MX0B 2OULB 2DQUH 3O6LH 4TPRH 4Z0BH 1N6VA 4NQSB 3U0WH 1KTDB 5GXBB 1G4MA 3NH7H 4HJJL 3RGVC 2AABL 2IANE 4G9FD 1DSFH 3VE0B 3MACL 1LD9A 2X10A 3DX1A 3LPGA 1OTUD 1B3JA 3N1GC 3QFJE 3BP5B 1P4LB 2B16A 1QI3A 4HWEL 3BI9X 2UUDK 2FIKA 5EOTB 1T3FB 4L2LA 4P5TD 5E2TL 1VRSA 5HBBA 4WK4B 2A6JA 3F6IA 5GZNC 3UROR 4AC2A 5C70A 4HJ0D 5K93A 1X6NA 3T5WA 4P9MH 1G7LA 2YJLA 3QORA 2FT8A 2VYRE 1DJHA 1YC8A 2K45A 1CGUA 2ZXDA 4HUXB 4Y4KA 5TPWH 1R47A 4I2XB 4BXSV 3M1BB 1OPOA 3IMBA 2ADGA 1HSAB 1VESA 5J56B 1PZAA 3H9SB 2CO2A 1ECYA 2BS8A 3B3IA 1QAWA 4R83A 1NPJA 2AS5M 2BY1A 2H7WA 4MBRA 4NRZA 3U83A 3BIKA 3D39A 1JK8A 3PGFL 4BZ2H 2B2XH 3WN5A 5E8OA 4JQIH 3VYOA 3ARFA 4XGZA 1IT9L 2GBUA 3QZOA 5C08D 3SY0B 1QVOA 1XSKA 4NUGH 3QYNA 2OX5A 1BLNA 2O93L 3TBWA 2MOQA 1MXGA 1JF6A 5C92A 1INEH 4ECNA 5JQHC 4WK2B 5E6RB 2PCXA 4U1SA 2WYTA 2ZAIA 4YEFA 2BVYA 2YRLA 5D70H 1DVFC 1T1WA 1INDL 3N44B 3M86A 3D4ZA 3V4PL 5BV7L 5IMLB 3PQYD 2Z7YA 4QI3A 1N70A 4PREB 3CBRA 1YY8B 3DVGA 5FYKH 1TEGA 1CBJA 1AMYA 1AR1D 3VJ6A 1N3NA 3ETTA 4GSXA 4M4PA 4YC2C 1JGLL 3B2XA 4Z7QB 2GW5A 3RLSA 2Z65C 3MV7A 1LEIA 2H3NB 1RURL 2EIZB 4G8IB 5DI8A 5E00B 2O61B 4EUPG 1JFQL 5CBAA 3WKML 1PX4A 3ZZ1A 3QDJA 3P4MB 2ID5A 4PJIB 1B0IA 4D8OA 1KV3A 1R75A 3GSUB 3JSSA 3TVMB 4K3GA 4KBPA 4KTDH 1IAII 5F6HJ 3KPRE 4Z7NE 2AAVA 2WSDA 4M5TA 3U9UB 2E86A 3FMGL 3BQUC 3QSKB 3NFNB 2YN3A 3U2JA 1DQML 2D7NA 3LHPH 4PWIA 5INCA 4ZYKA 1P84J 3VGDA 3TLRA 2BNUB 1V3KA 4I77H 4RAHA 3RDJA 3BDXA 1ZLVK 5GS3A 5I8KH 1JZ5A 4QRPD 4TUJB 4X8GA 3TTSA 2VDRH 4PRIB 4TLUA 2H4EA 2HLFD 1QR4A 2LR4A 3DHUA 1CLOH 4JRXD 3KDPB 4M3HA 1I8LA 5CIPA 2VUOA 2E9BA 4OLZH 3RKDD 1IBGH 5CUSL 4AE1A 4A7VA 4D7BA 4U0RC 1WVZA 1WUNT 1HL8A 1QD0A 2ALAA 5FR3A 4NB7A 3NBNA 2Y7SA 4PJ8D 4HX1A 2I27N 4KRMB 4PRDB 3NCXA 1WFJA 1ACCA 1F3DJ 2DI8A 1JGVL 3A6BL 2VISB 3S35L 1CLZH 4OF5A 1U4FA 4XMVA 3GC3A 1NIBA 4N2EA 3ZIYA 2G5BA 3GBNL 3RJDA 2NSXA 1TQBC 1A7BA 1A4JB 3LRHA 3H6AA 3TYFA 4L8BA 5IIEA 5EU6E 2DQDL 5FLUA 1PZUB 2DQJL 3RPKA 1WFNA 4DP4X 4XHJD 1DQDL 3FRUB 5KVGE 1FN4A 3PWUA 3AUVA 3TA4D 3MR9B 5DXWA 4GLRH 2CO3A 4XVUC 2JCCB 2N1TE 4ZO8A 4HVBA 3L7EA 3B6SB 1LP9A 5DO2C 3TGXA 5L9DH 2R8SH 3UZQB 1JGDA 2DDQL 1EJFA 1R3IL 2B3RA 4JFWA 5LCVL 4LCWA 2XZAH 1KELL 3PJLA 3KLHD 1JXGA 1RUML 3QFGA 2DQHL 1FSKC 3MRDB 3MMEA 3FSWA 4XPFL 2HRLA 4DKFL 1RIHL 4DPBX 2WVTA 1JD9A 3IPBA 1A9EB 3NJLA 2AQSA 3JZYA 5BXFB 4OIFA 2EXWD 4NWTH 1KB9J 3QUXB 2YOCA 4HKZA 1TU2B 2QR0B 1AI1H 3C5JA 5I8EA 3KMDA 3D2UA 3UAJD 4M6OL 2K6YA 3D85B 3HFFA 2LLGA 2HT4C 3LEYL 3C08L 4IRZL 3WTWA 3IDXH 2Y2YA 1HC1A 1O6SB 4P4KA 2NY1D 4KKBD 1CDBA 3QUMH 3RWEB 43CAA 3QPKA 4FFWD 1SVBA 3C60B 3IS1X 1EVTC 4O2FB 3VD9A 4M00A 4CSSA 4F5CA 4UQ3B 3IU3B 3OSKA 3UJIL 3ZDXE 1I7ZB 1JZHA 3W39A 5IUCA 3FZUD 1TJGH 2AEWA 1HVXA 5HYEA 5FO2A 5F7MC 5AEAA 2ED7A 3QEHA 5IOPA 3SBWA 1U0QA 1YYLH 3TO4B 3GI9H 1BAFH 1BEYH 2W07B 3H53A 4QTFA 1PPIA 4F27A 1P6FA 1Z9SB 4XCCH 5BMFL 4M5YL 4MNQA 4PS3A 4CSTA 4BSWB 1Z9PA 1VCAA 2CLRB 5I5RA 1NCJA 4AWJC 1U4EA 4GS7C 4PJBB 1IQWH 1KNOB 1A4KA 2ZXAA 3CVIL 2VSMB 2FQEA 4F57H 3W56A 1BF5A 3V9FA 1PEZA 4XCYA 3VFOA 5HGHA 1K3ZA 1YEHL 1U58A 1GIGH 1C16B 1SEBB 2VH5H 3QDMB 1KCUL 4WNQA 3ZE0B 1BA9A 2PCPB 2PPDA 2WWMC 1BFOA 3ML9A 1NMBL 4MQXD 2Y7QA 3CSYA 3X14A 5ESQB 3DIVA 4FQ1H 4E5XG 4LE8A 2FWOA 4GINA 5LWYH 5F96H 3Q1SL 1TEYA 3VWKD 1EGJA 4X5WA 3P0YL 2DY2A 4D8PA 4P2QA 1HHGA 3QFJB 4UV4H 4PRNA 5IB2B 1Y6KR 3MA7B 5IJKC 3A22A 1FGVL 9CGTA 3RNKB 1JP5A 1O7VA 4FI6A 3BAIA 4WZ9A 2MQ0A 5I1DA 4KMTL 3RVUC 1ONQA 2C1OB 3VSUA 2GK2A 3QQ3A 1EHNA 2V5YA 3MODL 4TQEH 3U46B 5IGXH 2NY4C 3TZVA 3CQFA 5IBLC 3RZCC 5KYWB 1Q8MA 3ARDB 5AENA 3BVNB 5T3ZD 1KPUB 1NCWH 2F1EA 3DXAD 1WAPA 2PO6A 3KW7A 4G71B 3SGJC 1M2VA 4NQCA 3GSRB 4PLKC 2YAPA 1L9QA 3P4OA 4LMQE 3QQXA 3WKYA 5FOBA 4Z76A 5D7IB 3D9AL 3HMWL 5AW9B 3ULUL 3K0YA 1R0AH 4MA3A 3J7HA 3RB7A 4JRFA 1JHKH 1FYHB 5KUKA 3KPLB 4WJ5B 3ETSA 2FJFA 4KMQA 4NNXA 2YGPA 2OJZL 1L7TH 2Q3XA 5AW8B 3VUAA 5CP3A 3MSPA 2OXGB 4YHLH 3ZSTA 3F2LA 1PFCA 5I19L 1N12A 4K3DL 2HRPL 3ARTA 4IKJA 4LBEB 1TZ8A 3PV6B 4TSCL 5GS2H 3C5ZB 3KYAA 3BFOA 1FHNA 2H6PA 1HEZA 1IIKA 2BSRA 1IAIH 4G9FA 4P04A 4ENED 4Y4HC 1OLLA 2W8CA 4OJFL 2P49B 5CS7A 1XSJA 1RK7A 1D5IH 5E99H 4TNWK 5F9JA 4ZX6A 3OJDB 1JRHL 2YRBA 2PXYD 4KPHH 4F1ZA 4I88A 1RUAH 1ORQB 4NUJA 4QHUA 3FF8A 3L1OL 5AWNL 1AQHA 3RFZB 2RFXA 1TZHB 4M7LL 1MCPL 3O2VH 4Q9QH 3MCLH 4KI5D 5FA4A 1JCKA 1D2OA 4UOZA 1JDAA 4QF1A 3FYIB 3CCHA 1O7SA 5DJYB 4FA7B 3T0DA 4Y0GA 1GL4B 2JIXB 2YMXL 4OTXL 3TM6A 5E94B 1TZAA 4UUJB 1AZZC 2XA8H 5I1IL 2C7FA 4IGBD 1YYCA 1XGQB 3MBED 2ZWSA 1RZ7L 2DLFH 4Z7NB 3SPVB 2R1XB 5FK9B 3H54A 5AAPA 3QGVA 4PGBB 5T3XH 1JZIA 1PNCA 3GJFB 4JKWA 4YFLI 1JTTA 3QCVL 2ED9A 3WHE1 4JPSA 3U4EB 4B6ZA 4RMTA 4KXZI 4XPHH 2VB5A 3WNIA 3WFBH 3DO3A 2E9JA 4DFHA 3L95B 4KHTL 3DK0A 4QY8B 1TTCA 4YHIB 3NT0A 1GZPB 5C08A 2NY7H 1XH2A 3N0AA 1EFQA 5FA3B 4Z7OE 5L7XL 4TUKL 4LNRA 3RE0A 3VFSB 1NDTA 2GAZB 4HGMA 3B34A 1KJVB 3IYLW 1Y7VA 2J3SA 5B38G 1CFBA 4L9DA 2DQFB 4OZFA 1TJHL 1JZDC 5LNGA 3BWZA 3MJGX 5HY9A 3EDDA 3TS8A 3KYOB 4PRHE 3D3VD 2DLGA 3JXAA 1ZA6B 2GTZA 2I24N 1YNLH 2ENJA 2VDKH 3P11H 3VRJA 4BZYA 5KAQF 1AD0B 2V0AA 1EXUA 4GW1B 5AUMA 4JHAH 1IE4A 2C4FT 3G04A 1H8SA 2AV1B 2DQGL 4UQ2B 1H3GA 1NC2D 4M8RA 3O4LD 3WKNA 1FG9C 4QRAA 1MREL 3EFDH 4XVSH 3LNHA 5EBLB 2GY7B 4R97B 4X9FA 3EYVB 4PP1C 1FV1B 4X6DA 2E5EA 3VA6A 1YHPA 2AXFA 5EFIA 3MRPA 2BNQE 1M05A 1RZKL 1TQCB 1WO2A 4NQQA 2QPUA 2X1OA 1F6AB 1NFKA 1AKJB 4HEMA 4FDWA 2G3XA 2MQGA 3H0TB 3JZ7A 5IQNA 1F41A 5GGTL 1D5BB 3A67L 3II3A 4LVHB 2K3TA 2KMWA 4ZFOA 5ITBH 5H37G 1KPVB 2R29H 5B39B 1OAKL 3QT2A 3C75A 4WV1C 5TH2B 3K81A 3GTVA 2N3JA 3W81A 3UG3A 1LDPL 4HGWB 1MLBB 3HHSA 2VW4A 5KYNA 1ZV2A 4JFHD 1PEWA 1MHHB 4JR9H 5T5FL 3ZUNC 3L9BA 4LL1A 2PCFB 4Q97A 2JELL 2H2PC 3W37A 1KCLA 3X1FA 1PNDA 4ES8A 1MI5D 3MLRH 4BWWA 3P0VL 4FEMA 4XWGL 2ADJA 4HKBB 3T3MF 2O72A 1QFUL 4FHBD 3QI9B 4G42B 5F71A 3NCFB 4I13B 3NA9L 4B96A 1E4XL 3O8XB 5EOQH 1OP5H 1T7YA 4ATTA 3WSQH 1T80A 5F7WC 4X4KA 3OKOB 4BD4A 2WLIB 2LAGB 3GJEB 2O6PA 4NC1E 5T5NF 1Q9OB 4WWID 2V2TB 3D0LA 4WEUD 5DRNA 4JFDE 3TX4A 5JHDB 2R23A 5IROC 3FT3B 5EIIA 1UXSB 4NO5A 2OMNA 4CILA 3QPXL 1OTTD 4P49A 3II1A 3PWVB 3X3GH 1QBLH 2J6WA 3VFGH 1GAFL 3I6GA 4P5RA 5KVFH 4JDTL 2VMEA 2M26A 3MRFB 3D18A 1IKFL 3DHMA 4QRSB 4OV5A 1AGDA