1OAJA

Active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
QDLTVKMTDLQTGKPVGTIELSQNDYGVVFIPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Active-Site Copper and Zinc Ions Modulate the Quaternary Structure of Prokaryotic Cu,Zn Superoxide Dismutase
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Oxidoreductase
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1oajA00
4BCYA 1SRDA 3L9YA 3KBFA 4BCZA 2ZKYA 1SXZA 4OH2A 1S4IA 2E46A 3H2PA 3GZQA 3GZOA 1N19A 3ECUA 4A7GA 1CB4A 4N3UA 3QQDA 1RK7A 2WZ0A 1BA9A 3H2QA 4A7TA 4A7QA 2VR7A 1SPDA 3SODB 1UXLA 2JCWA 3GZPA 1SDYA 2WKOF 2E47A 1BZOA 2WYZA 3PU7A 1B4TA 1E9QB 1HL4A 1OALA 1E9PB 3F7LA 2ZOWA 3KH3A 2WYTA 1F1GA 2WWNA 1SOSA 3KBEA 1Z9NA 2SODB 1UXMA 2WKOA 1OEZW 4B3EA 2APSA 1E9OB 3CE1A 3F7KA 3CQPA 2AF2A 1DSWA 1XSOA 1ESOA 1JCVA 1SXBA 1JK9B 1EJ8A 1B4LA 1OZTG 2Z7WA 2AQPA 1L3NA 2C9UA 4FF9A 1IBHA 1E9QA 2GBTA 1E9PA 3KH4A 3L9EA 1SDAB 3ECWA 4OJAA 2WWOA 2C9SA 1XTLA 1P1VA 1IB5A 3HW7A 1XTMA 4BD4A 5KBMA 1AZVA 1F18A 2GBUA 1E9OA 1KMGA 2C9VA 3MKGA 4N3TA 1YSOA 4U4IA 1JK9A 3KM2A 2JLPA 1N18A 2AQTA 1QUPA 3MNDA 1EQWA 5KBKA 2GBVA 2ZKWA 3K91A 1COBA 2Z7ZA 4A7SA 2K4WA 2R27A 2WZ6A 1HL5A 3S0PA 3HOGA 4A7VA 2VR6A 4L05A 1PZSA 1PU0A 2AQQA 3CQQA 2AQRA 5KBLA 2XJKA 2VR8A 3GTTA 1F1AA 3LTVA 4A7UA 4MCNA 2V0AA 3KM1A 1OZUA 2LU5A 1MFMA 4MCMA 1F1DA 1YAIA 1DO5A 1SXAA 1OAJA 2AEOA 1FUNA 3ECVA 2Q2LA 3T5WA 1TO5A 3RE0A 1Z9PA 3GTVA 1PTZA 1Q0EA 1SXCA 2AQNA 1SXNA 1YAZA 1IBBA 2AQSA 1IBDA 3HFFA 2Z7UA 3QQDB 2ZKXA 3GQFA 1SXSA 1TO4A 4A7GF 1IBFA 1CBJA 2WZ5A 2XJLA 2NNXA 5CU9A 1U3NA 2Z7YA
chains in the Genus database with same CATH superfamily
4PJGB 1GHFL 1BWMA 1LDPL 1KCUH 4Q4EA 4DZ8B 5C0GB 5AVWB 3HI1B 3Q6FB 5ECGA 5E8OA 1L7IH 1Q8MA 4ZQTA 3O8XB 4JO1L 5F8RC 1Q0YH 1N59A 4PGBB 3L5XL 4LVHB 3Q8AA 3DSFL 3Q6GL 3WFCL 4TUOB 5IVNA 3SDXA 3LRLA 1UWEL 3MLYH 3ULVD 3PPSA 3B7RL 5CJQH 1RP8A 2QT6A 2WKOF 2E3VA 1A1NA 2PPAA 2XHNA 1OHZA 4G3YL 4EDWH 3SN6N 1O5DT 4JO8A 4ANUA 2VSKB 3H53A 3CN1A 4XP1H 2XPGB 3B9KB 3FO9A 4PRNA 2ITFA 1UYWL 5GRVK 3F83A 4D0DA 2NX5E 2BSRA 2FLRT 3ARYA 3UJTH 2EDTA 2F6AA 1HZHH 1SMDA 1YA5A 5TF1H 1W6LA 4GB9A 3NIGE 4E0RA 5JHDE 4AEFA 1LE5B 1J10A 3P3RA 4NN6B 4XNZB 5D7JD 1ZK5A 2VIRA 2E86A 3GRBA 3EJZD 4KROD 1P2CB 4HFWB 1DJWA 2IMNA 1THCA 1FC2D 2DH2A 3VWKB 3HC3H 1U8HA 4JHZA 2VERA 1UHVA 5M94B 3F7PC 4NGHL 4KK8C 1YSOA 4JDEB 1PCSA 3TFBA 4PJGE 5A3IC 4HH9A 1OGPA 3QORD 3RVTC 3GT6A 5EA0L 5I28A 3FUIA 2ZCZA 2GK2A 4I4WA 5AZEH 2PP8A 4OLEA 2Q8BH 3U46B 1TZHB 3BAYA 4H1LB 4Z7WA 1OIOA 1DJSA 2Y5EA 2XTJD 3FQ4A 2D03H 4CSPA 4KZDL 4M3JA 3BPCB 2EE6A 3WXVH 3MNMA 2EAEA 2KPNA 3GMRB 1HEHC 4FQ2L 1NWPA 3GSQA 3SO3C 4OZFH 2JMRA 4OCSL 3MPCA 1KXHA 5GISL 4L8BB 1PD1A 3GMNA 4G6KL 3L3KB 2PO6C 2W95A 2W0FB 1JMZA 3DX0A 4Y2OB 2RCSH 5AVQB 2MPAH 4HU8A 5HPMA 4GO6B 1P84J 2YQBA 1UCTA 2I25N 1LWRA 1OSZB 4Q9QH 5FKPA 1GYWA 3GHBL 4NBXB 1G7JB 1YMMB 3FQTB 1A9BB 4Y9BA 5BZDA 4Y19B 3D0VB 3BVUA 5IJVB 1AZBA 3VMOA 4OCYL 1U92B 2V9RA 4AIZB 4HWEH 4KJPC 2EC9U 1JHKL 3U9WA 1FV1B 1CICC 1HQRA 3B7YA 5HJBA 3VB9A 3UPRA 4DAGL 1E28A 4G6FD 1JS4A 4QTFA 5BNXD 4BM7A 5I1DB 2ITCA 2G3MA 3MA7A 5LO7A 4KK5C 4M7KL 2PYEB 5EG6C 4C58B 2RH0A 3JWOL 1MWAB 1T6VN 1OAXH 1EHNA 1XL4A 1HSBA 2ESVA 2GUOB 4H40A 3V6BR 5LXVA 1O6SB 4U1HA 3TCXA 1XIWA 3VD3A 4M1GH 1OTSD 3HPLA 4OGXL 3RI5K 1CZ8L 4WJ5B 3S3BB 3VFRB 4A7TA 3ZTNH 4XVTH 2J7LA 2M8XA 2K8MA 3H6AA 5HHXL 2VT0A 1CI3M 2NTFB 1DQJA 5E2VL 5F9JA 3SGJA 2UZPA 3NPSC 4N0CD 2F8XC 5ABDE 1IBGL 3ETBJ 1IEAB 1IAKB 5BPPA 1NCAH 5EU3A 3FO2B 3NCJL 3BWSA 5C0IB 3D30A 5EF0A 2DQHL 3O9WA 1OP3H 2C1PA 3GDBA 1PPIA 2V8MA 4FL4C 4KNQA 2YAPA 1U8MB 1MHPL 2KLTA 4ZDHA 4B3VA 2YOCA 4FXTA 1E0OB 2F9BT 5I1GL 4P48A 3QGVA 5DJYA 3CX2A 4ZO6A 4E36A 5CGBA 3O11A 3DHMA 5FO7A 2HKFL 4MS6A 4OM0L 3GSNA 4B9CA 1T04A 2AJUL 4HW6A 1UXWB 1KN4H 4AQEB 2ZX9A 2ZAHA 3DVNA 3QUZA 4MJ5B 4OLXL 5BZXA 4Y5XB 2NUPA 4KJWC 5DJXA 3W1ZA 1P5VB 1YMME 4GAGH 1H3UA 3HR6A 3SO3B 2R0WL 1AXSB 4UZUA 1AGEA 4Y19E 2W38A 1NC4A 3K71B 4H26A 4EXPX 2P3YA 3PJSA 5EOTB 3CCHA 1BXXA 3G5YB 1D6EB 2QGCA 3V4PH 2VR3A 4KKBD 1XWVA 3AT0A 4MDRA 4PRPA 3SKNA 5CEXB 2ROYA 5IVXA 3UJJL 4FN0A 4ZQKB 3JZ7A 3RKDC 1GS7A 2G5BA 4ICWA 4H25B 3WNMA 2BFVH 3KWWB 2PYEE 4H1LH 4PCSA 5A7BA 5CCKL 4GBXD 4LU5L 4P9MH 5B3NA 3DIFA 2QR0A 4DP6X 2GTWA 5KVGE 2R59A 1LEGB 3LKOB 3RTQC 1VCBC 2WXJA 5ICZB 5JW4R 3FSVA 2PTTA 3UMNA 4PBWD 2O5ZH 5HJ3B 3V0AC 1WPCA 2MHAB 3MYJA 2VAJA 3S35H 3HNTH 4QOKA 4J8RA 1JPEA 1WUZA 1S9YB 5F7BA 1EAQA 1I9EA 3VFPB 1WHOA 2C7UA 1OM3L 5CUSL 2V2TA 1AZNA 3T77B 3HBQA 4AENB 3PHQA 5L8JB 4E9VA 1P4IH 2YC1B 5E8DH 3TEZA 5HYQB 3ULUL 5EORL 4Z5RA 1WH0A 5HJGA 1RI8A 3AB0B 3LSOB 1A6WL 5IGXL 5DCCA 5DVPA 3QDMD 1AIZA 1BM7A 3JVFC 3NPSB 7FABH 2NXYD 4XMZA 1DLFH 2VWEC 4J6IA 2ZOOA 4L2LA 5IROC 3GUTA 2AFNA 3CK0H 4FFTA 1QD0A 1K4DA 5EULV 1F90H 2Z8VC 5FOJA 3LQAC 5T3ZE 1T5XB 5F1NA 2GKIA 3ZR6A 2G60L 4UDTB 3UC2A 3X12A 5KVGH 3O6KL 3KE0A 4NQEB 1V3MA 2A74A 4H88H 4XWOD 5CP7A 4DGUA 3JXAA 4UNVA 3RI5F 3PP3K 5FGBC 2D7TL 2EIBA 3E6FB 2VZUA 1OGAA 4MA8L 3N42F 2CA3A 4L1HA 5IQOA 3WE6B 1JZ7A 1GTNA 2JI3A 3RUGB 2FBRA 3UZQA 3ATFA 2NZ9D 5C07D 3ZOAA 4U3HA 3VFOA 3NA9H 4Y16D 1KELH 5SWSB 4D0CB 4EI5C 3HJEA 1FYTB 1JRHH 2J5LC 1ORSA 3B3BA 4P2CG 3QPQC 5F9DC 5IVZB 1Q0XL 5ANHA 2WYZA 1J8KA 3HMWL 2B08A 5GRXG 3EGXA 5T1JA 2HT2D 1T0NA 3AUVA 3NCBB 4Z7OB 1TQBC 5KOVC 4WNJA 2FLMA 1HDMA 1DVYA 1HAWA 5IOKA 2AXJA 3RNQA 5I8OH 2WWNA 1AFVL 4LRIC 5D1ZC 3OX8A 5DMIH 2IFFH 1WTLA 3RTQB 3E7JA 4WHTA 4GKNB 1BIIB 3U36B 3BFOA 1OGTA 5EO0A 4QRSB 1Z2KA 1FAIH 3DUUA 1XGZA 1KT2B 1W16A 4X9HA 5JA9A 5EIVA 4HX1A 4GIOA 2PTVA 1KTDB 2YWZA 3EYOA 5FUCE 3TO4C 4QHPA 3LQZB 3MJWA 1ADWA 1J0JA 3HE7C 1XTLA 1LO3H 2XDHA 2ADGA 1QBLH 1HXYB 1G6RB 2JB5L 4RISL 2B2XH 3NSXA 4IBSA 1AJ7L 4WW2F 4PG9B 5E0QA 3G6DL 4MMYA 3RX9A 3S3PA 4NQEE 1MRCH 4ABUA 1P0SE 2KLSA 4OD1H 1BBDL 3K74B 2Z31A 2GTZB 5HDBB 2HJKA 2YPKA 5EZOL 4YMPA 4FP8L 1JJUA 1E8XA 1Q9WA 5CEZE 5E0FA 2Z7ZA 3I6GB 3AT9A 5LGHL 2ZUVA 3L4CA 1FNSL 3RUGE 3ARGA 1H8SA 3UYOD 1QR1B 3BGMA 2L8AA 4LPUA 3HOGA 2Z34A 1H3WM 3E6HA 3MSPA 3VTAA 5SWSE 3WEXB 2K1MA 1I7ZA 5KSAD 1FYTE 5AWNL 4EVNB 1FLRL 4WI2A 3EOTH 3ZMEA 2UUDH 2W0LA 5DD1H 3BJLA 5KYUB 4Z7OE 3B2VL 3TN0A 4K23H 3DDFA 1MVYA 2AQ2A 5FC9A 3VXNA 2Q2LA 3QCUL 4FQLH 4B9KC 5EFIB 4LSTH 3N5AA 5LDUA 1RUAH 2Y07L 2QDVA 3QWOB 5ICYB 4EI5B 4ZD3H 3VFMA 2WQRA 4D9QE 1NLBL 3ESMA 2IJ0C 4HIIB 4ZO7A 2KH2B 4L8SA 1CDCA 4QYOA 4TNEA 3GMPB 5DFTA 3TZVD 3AS3A 4HS6A 1P7KA 1TQBB 3UTSA 2G2RB 3I50H 4JPVH 2I7SA 4NEHB 2R7EA 1WO2A 4GRWF 4G72B 4ZPVA 5D7IA 3TYGH 4ELMB 3RWJB 2YEZB 5C0BB 4WTZA 2XX0A 5GGTL 3D69B 4G5ZH 3WIFB 2B4CL 4KI5C 3DUHA 5CEZH 2ED7A 1IFHL 4NQCA 4XZ4A 3CFCL 1X9UA 3T2PA 2Q1EA 5CKGA 1UB5A 3U7YL 4Q56A 2Y7OA 2I9LA 3VSTA 4ODSH 1D5RA 1G7QA 4HPYL 5HDBE 2R1XB 3TO4B 1QLFB 2WUCH 1L6PA 4GO8A 4HAKA 3SBWA 5KYXB 3HE7B 5DZNA 4QD2E 3UIYA 3KPSA 1LP9F 3V5KA 1DQVA 5I17A 5EZLB 4YLBA 3STLA 2B1AH 1XT5A 4WEBH 3NJGA 4B0MM 3O45B 5HI4C 1E9PB 3IFPB 1JV5B 3PGFH 1NL0L 2CCVA 4KTYA 1QFWL 2E9WA 4FZ8H 1XFPA 4P2YA 4HC1L 4XXCA 4PCKA 1BYOA 3GGWB 1NEPA 3UH8A 2B15A 4IU2A 2GY7B 4RBPK 5C0AA 4Y0GA 5FYJL 1S7XB 2XA8L 4ONOA 4N90D 1BG1A 4PRID 2YQGA 3O6LL 4QNPF 4BFFA 1X5LA 2OKMA 5EO9A 4N2KA 3PNWA 2ENPA 4OCNC 3IDYC 5GSVB 5MP6L 1G6RH 3LZRA 1T5WB 2FT6A 3LRHA 2I60H 4ZW7A 3KGRA 3QR0A 1GYCA 3LS4H 1TNMA 4FFZH 4JG1H 4UV4L 4ELME 1T4KA 5F7EL 5C0BE 2XICA 5DJDB 3S5YA 4GXUN 2E27H 1BG9A 5EOCL 1B2YA 1JZ3A 4OT1H 5D1QA 5ICUA 1ROWA 1YEFL 1D7DA 1TXKA 5GS0H 3P0VH 3POCA 1DVUA 3ZYIA 1G7IA 2MOGA 1R3HA 1J1XL 2H3KA 1UD4A 5KAQF 1SUHA 3C5XA 4J28A 1FL5B 4L3FA 3V0VA 4RRPA 4A39A 2HXAA 4WFHE 5I24A 2CKNA 4GFTB 1VEPA 2QLYA 3VVWA 4OKDA 3VCLA 3MJ9L 3VD5A 4NQXA 2F19H 5IT2H 2DQEL 5FO9B 3HMXH 1F1DA 4OD3L 4GUOA 3ORJA 3PIQA 4FHBD 2WMPB 2QMKA 2YAHA 2XNAB 3VXSD 4YDIL 1IFGA 3PGDA 3TGXA 1CD0A 4RIRB 3ECBB 4POUB 4AIXA 1MN4A 2B9BA 2J12B 1WA2X 1MHCA 2AJ3B 4R4ND 1HINH 4PJ8A 1VLXA 4YSUA 3O0RL 5JLZB 3R8QA 2NY5C 4XCEB 5EIIB 4YSDA 1EZVY 1JGUL 5EOCJ 1CFVL 3IDJA 2VAAB 2WN3A 3MODH 3O41A 5IIEB 2QHRH 5B39G 2UZYB 3OHMB 4JK0D 3BPNC 2FH8A 1F4XL 2ED8A 2CWRA 2GQHA 4WIQA 5AFAA 3U2SB 3UPAA 3DUSB 3W0WD 3ZQXA 3AUWB 1UB6A 3OKEA 3VX1A 4MWFA 4YX2H 1W0WB 3FB6B 3D25B 3IDYB 3IGUA 1ZKAA 2FK9A 1UM4H 4UAOC 3JUYA 4PGJA 1KGXA 3OJDA 4NWUH 1VEMA 2C9PA 3OQ3B 3U1SL 2CRZA 1YJDH 2NZIA 1RJZA 3IAPA 4IRJB 4OFDA 4PJFF 3KPRD 1FFQA 2QSCL 3ARZA 4ZMYA 1DLHB 5L9DL 3IMSA 4IRZH 4UILH 1O7SA 3OXSB 2XETA 5FYLL 1CLYL 3ARFB 4AW4A 2AEPH 4TOYH 5AVYB 3QDJB 3K81A 1PZ2A 1WC7B 4KI5E 1A3RH 4LK4A 3SOBH 3DECA 4YXHL 3ECQA 5DS2A 3L3IB 1RIUH 5T5FL 4JX0A 4XC1L 4ZFZB 3H8NA 2WK2A 3FYIB 3LX9A 5DGRA 3U6XA 5DMGD 3BW9B 3IM1A 4N2GA 4PGZA 2VLRB 4GI9A 3WFHA 4V33A 4MDIA 5F3BB 1O5PA 4KUZL 5IMMA 2ARJA 4HULB 1DQLH 3OKKA 3ZDZB 1YY9D 4WI0A 3QA3A 2WOBA 1BMZA 3LKSA 2PW2A 4DUXA 2ZSVB 5IMLA 2VISA 5ECJE 4F37K 4KAQL 2KI6A 3AG4B 4MNGB 3MLTA 3VXQA 2UWEF 1T20B 4MLIA 3BP7B 4OF3A 3QXAA 4IBTA 1YEHH 1KPRA 5BMFH 2X0VA 3TVMA 2VW7A 3UAJD 2ODIA 3A24A 3GMLA 3BN3B 1TEFA 4W9IC 1UT2A 3G9AB 1NSNL 5J1AA 3QNZA 4QRRD 3V6OC 1CGWA 3DBXB 4MXQC 1XF4A 2JKRM 5LN8A 2NY4D 2NYZA 4Z3GA 2CKBA 4K9JA 2FIKB 5DK0B 5F7KC 4I1NB 5B1AB 1G7MB 4MDJB 3MNWB 1A7PL 3O3DB 4M1DL 4DEPB 1ZHNA 3LIZL 2D0FA 5HGDA 4QTIL 3QDJE 2NX5D 1KCVL 2WO2B 4HEPA 1S8DB 2FDBP 4D2NA 1S46A 1SOQA 1UWYA 4IK7A 5IMOA 1JZHA 1NAMA 3D2UA 4G83A 1Z3GH 3O4LB 4JO3H 4QY8A 5LBSL 5TQ0H 1BD2A 1KPUA 1B0GA 3CZGA 1HYSD 4BK5C 3A0OA 1W91A 4EO5A 3VU1A 3UYPB 3KXFB 1R0AL 4ZXBC 5JQHC 3BUQA 4JFED 4LLQA 4YQXL 5AVVB 2K70A 3ZDZE 1JWUA 4FI7A 3GMOA 1S9VA 1KCBA 4JFHD 1FIEA 2FJFB 4TNWK 5CSBA 3CFJA 2H32B 2FYVA 1EAPA 2RACA 3RJOA 4MNGE 1U8LB 1ZEAH 4NENB 3ZHLA 3ZUNC 4DSYA 5JDSB 5KAQG 5A6IA 5EZJA 3L13A 3SDYH 3TF4A 1N0LB 2NSQA 4PFEA 1VFMA 4U1SA 3MACL 2EXWC 5CWSA 3PUCA 5FM4A 1T22A 2JIXA 3QJVB 4XNMA 4HKXB 2X70B 1ID2A 4IBQA 2TAAA 3HVDA 5EEVA 4N9GB 2IC2A 4ZYKA 4XVJL 2PWFA 4ZO9A 3ZE2F 4P23A 1VFBA 2OL3L 2EH7L 1CK0H 3MLXL 1LYQA 4O4YL 2SODB 4MJ4A 3PRZA 2YLKA 3APCA 4HJ0C 3F65A 2AF2A 3F7VB 3TBTB 5JXAH 1C5CL 5F0PB 1LO5A 5E6IC 4W9CC 1DBML 3RWHB 4J1UB 2J8UF 4P46D 3H2WA 1NUFA 3BZFB 3FCBA 3BH9B 3L3DB 4HIHA 4AWJC 4JANA 3E1F1 3O4LE 4F37F 5DJ2A 2X6VA 1L9PA 1KJMB 3F7YB 3K1DA 1PLAA 3NEEA 3KXFE 4QHLA 1CXHA 4BE5A 5ADOL 1RIVH 4ODXB 1IL1A 4PYGA 3BFWA 5EBWB 2VGLM 2E6QA 2FJSA 3CZLA 1AZRA 3SDDD 3VGBA 4Q9RH 1JK9A 2JLPA 3AM8C 1MKFA 1EVUA 2EO9A 1BOGB 1PG7X 1A5FH 4PCYA 5MHSE 1I1AC 3GBDA 4KQ3H 1IGTA 4PTTB 1NMAH 2Z92A 5AW0B 5G5DB 4TNFA 1C5DB 4Y2DC 2EILB 3GJFA 2DTMH 4P05A 1II4E 4S1DC 2AJSL 2A4EA 3UTPD 2YA0A 2DI9A 4HK0B 2J5WA 5FW6A 5LAXA 1RXLA 2JI2A 5HYJD 4PMEA 3SE9H 4APQC 1MJ7H 4H20H 1QA9A 1M4KA 2BP5M 3MCLL 1HQ4A 1EV2E 3JV6B 4RMRA 4X4MA 4JO2H 5C70A 3EJUA 1ZA6B 3MCKA 4B9IA 1GZHC 4JMNA 4LSVH 2EC9T 3BKYL 3V4VA 3NA4A 4ONFL 2FJGA 2YK1H 5F7YC 4RGND 4CNIA 3UBXA 4HCRH 2OCJA 1K2DB 1CXFA 4CGUB 1U42A 1YMMD 3DURA 3V6OE 3W56A 3B7SA 4Y19D 5BXFA 2BVUA 2EXYC 4TNWF 1F3JA 2WP3O 2W9EH 2Z1PA 4RX4D 5DZ9A 3QB7C 2J1XA 1SLWA 1HVXA 2Q20A 1F6FB 4XAKE 5DWUH 1WIUA 2DYPA 5E6IB 4LASH 2C4FU 2QADC 4NX0A 3DOSA 4LLMA 4NNXB 5FWQA 4LCUB 5K9KA 4RZKA 2PCPA 5AVUB 1RK7A 2AHIA 1ETA1 4A7QA 3GK8H 1OT4A 3U4AA 4Z7IA 1YYML 2FD6L 3ZYOA 3WXWL 3H0TA 5CNHA 1KBWA 2UY6B 2A73B 3Q8FA 1ZXKA 4AL8L 1IT9L 1MCDA 5A16A 4AYFB 3UO1H 4G9DA 1FVCA 1A7QL 3EJTA 3S48A 4AM0Q 4TTDD 3DOIA 2DY2A 2WXOA 1I1AB 3LKQA 4WU7A 3O3EB 1D2OA 3BP4B 4FFYA 3OR6A 3R1GH 5IW6A 1DN0A 1P9MC 4Y2DB 4ZS6D 5SWZD 1ZLSH 4J6RH 2YSSA 4CVZA 4DJMA 2AGJH 5CD3A 5E2WL 3EUDA 4UQ2A 4Y4HD 1QAWA 4JR9H 4MLSA 4EN2A 1WWBX 1AH1A 1TMQA 1IM9D 4APQB 2GJ6B 2WPGA 5FM5O 3FT2A 4OJAA 2WTOA 2GT9A 3CVHL 5I1AB 2BVOB 1KB9K 5MEOB 3OKLB 3AS0A 1AY1L 2BM3A 3WNPA 4MD4A 1OM9A 5IW1B 1GYVA 3CZJA 3QFDA 5BW7A 3KM2A 1H19A 4ZT1A 4EUPH 2YKLH 3UP1A 1P6AB 1OF0A 2J4WH 5D71L 3KL5A 1XMWA 5I18L 1EH9A 2VABB 1NMBH 4XMTA 4PJXA 3EG9A 1CL7L 3RWEB 2P8MB 4X6DB 1TU2A 3ZTJH 5IB3A 3F6IA 1QUNA 4YPGB 4PR5A 2EEFA 1AD9A 5ACZB 3G04B 2IDCA 1KB5A 3CHQA 4TSBL 2A9AA 4LCCA 2Q7NA 4PMFA 3TWYA 2Q86A 1HZKA 4MA3A 1S78D 4JPWL 3D9AL 3X14A 3L7FA 4X9YA 2Y22A 3UEZA 4N5ED 3S2AA 2W60B 2XVKA 3TPKA 3WV0A 2FX7L 3FQUB 2EE9A 1BGXH 4LLDB 5HGBA 5FWRA 1T03H 3F3HA 4JRYB 4H7VA 2XKNA 3HFFA 1WWAX 1ACYL 2QZ5A 3LVEA 1NBZA 4P5KB 4PW4A 1KDIA 2GJ6E 2NX5A 1BAFL 1W2KT 1SJVA 4ZUUA 4QHKJ 3QZOA 4EZLA 1OSPL 5DQ9A 4WDIB 2CQVA 5JHDA 4ZTOL 2GJJA 4YDKL 1QI5A 3S5LA 1V7MH 4LLVA 3T65B 4IOFD 4G8AC 3SQBA 4IBWA 4YZFF 5CEZD 2UXVA 2W91A 1XF1A 5HGHA 2EEDA 3WIHL 4S0TD 1L4IA 2YD0A 4GMSL 4S10A 1SDYA 4PJGA 4C59B 5B1JC 3P11H 1N64H 3ARVA 3KYNB 4X6DE 5C7XL 1AS6A 4TSCL 2LFEA 5C0GA 5KANG 4DZ8A 4QT5B 3HI1A 2LHAA 3Q6FA 3O8XA 3HI6H 3OKOB 4PGBA 1AO7D 1MCBA 4A2FA 1J5OH 4GAJL 3N43B 1QSED 4TUOA 1DFBH 2J72A 3R18A 3E8UH 3QWNA 1FFOB 3C87A 3FN0L 3N0AA 4AUUA 4XO9A 5DD3L 5GRUL 3M45A 4ABWA 1P4LB 4M7ZC 5CEYB 4MJIB 5ESVB 4N26A 1U4FA 4CADB 5E2UH 1Z66A 4JRYE 3Q9PA 4P9HH 5A6MA 2XPGA 3B9KA 3QJRB 3ZGHA 2QFPA 2CRIA 1P6WA 4HLZG 4QLRA 4Y5VB 5DVLA 3B5TA 2VUKA 2W5PA 3U7WH 4P59H 1NIEA 3T6QC 3FB5B 2WYHA 4DZBB 4JFWA 4FYSA 3LEVL 1P2CA 1MHHA 3IE9A 4HFWA 4UM9D 2IOMA 1I1FB 3NUKA 1KCWA 3FTWA 4BFNA 3VWKA 4ADIA 4P57B 3B56A 1C08B 2K3HA 3CVBA 1KEGL 4OIIL 1WZLA 5GS0D 5B38B 1EPFA 4JDEA 1V27A 2PCFB 2XI9A 3QAZC 3LPFA 4AKQA 4JZJB 1YYLL 3U46A 2ETWA 1TZHA 4CN4A 3EO0B 2BXZA 4ZJ9A 3BPCA 4B7LA 3WHE0 3GMRA 4WLCA 3QJXA 2W9DH 1YAZA 3BQVA 3AACA 3DMMD 1IBDA 2X28A 1A6PA 4L8BA 5ANMB 1YEIH 3MHZA 3U82B 5BRZB 4MJIE 3RNKB 2VDLL 3L3KA 5HI5D 2OULB 5G4NA 5IMKB 2AJYL 2NCEA 2W0FA 2EDMA 2G3XA 2D3VA 4FQXC 4Y2OA 4XMKL 4AIEA 1CN4A 3MUY1 4EAEA 1OSZA 1UVQB 4JO5A 3A3YB 2XZQH 1G7JA 2BS8A 3FQTA 5DJAB 1A9BA 1FE8H 3D0VA 5IJVA 4ZK8A 1U92A 4M7ZB 4YHMH 3BAKA 5I15L 1ZVHA 3FS9A 3N40F 5I1DA 1M7IB 3E9UA 4QHNB 4EIGB 2DKMA 4HCGA 1N4XL 3OAUH 2MCMA 3ZL1A 5L7XL 2PYEA 1BW8A 3I6SA 1MWAA 1B4TA 1WFOA 2BH0A 2I24N 2WLLB 3T0DA 2R4SH 5E94B 5E2JA 2GUOA 4N85A 4F1ZA 1O6SA 4ZTEA 2F2HA 5KJ4A 4FLRA 5EEXA 1X5FA 2FJHB 4PI2A 2F0CA 2XQYA 5HBBA 2KYIA 4WJ5A 1KY6A 3VFRA 3T0XA 4U0RC 3S4SB 4YE4H 2NTFA 2QPFA 3OZLA 5KVMC 3GRWH 4AG4L 1MFAH 3KPMB 1IEAA 4N87A 1IAKA 2VXSH 3FO2A 5BOPA 1AQDB 1JV2B 4I3SL 4NUJB 1YEGL 3QJSB 3QAZB 1U8MA 3FCSB 2IO5A 5ANME 1AZVA 5BRZE 2YXWA 5I8KH 3IJEB 3KPQB 2VDPB 2ATKB 4RETB 1UFGA 1UXWA 4NKIH 5HHQB 2ZUQC 3ZDXF 4AQEA 5AZ2H 1YEJH 4Y5XA 3UERA 1P5VA 2C1OB 1AXSA 2LQRA 4FJYA 2DM7A 3K71A 5EOTA 5AB0A 4JQIL 1J0IA 1D6EA 3G5YA 3K8LA 2OR9L 5FIEA 2O72A 5CEXA 1N5YL 2IXQB 4ZQKA 4H25A 1IQWL 1GGIL 3KWWA 5ILTH 4RFEA 2AXWA 4F7TB 3RB5A 1LEGA 4UT7L 3VSQA 1WDAA 5ICZA 3RIFK 5HJ3A 3SKUD 1YCSA 1AIFB 2MHAA 2WQUA 5GGRY 4P4KB 3WTSA 1JFQL 4OIFA 1OHQA 1ETJA 2PR4H 3RFRA 5T1LD 2E9IA 2NY0C 1S9YA 1SLUA 3K0YA 1FBIL 3VFPA 4DKEL 1RURH 3VGDA 3QCVL 4NKQB 3UC0L 3T77A 4AENA 4MX7B 4P2RB 3ASOB 2Z91B 2YC1A 3CZNA 4EI0A 1CXLA 1T1ZB 5HYQA 3ESVF 1BZ9B 4AITA 1SHSA 4FMVA 4U0RB 1B4JH 3UZVB 3IS1X 1H6UA 4WWKB 4CDHA 2WINB 2VCOA 1QSFB 3QHZL 4ZMWA 4PN6A 4YDLC 2Y69B 5IFAL 1MZZA 1JVOA 4XT1C 3WNOA 1T5XA 4RLDA 4PS4H 4QAMB 5GGSB 4UDTA 3K4ZA 4NQEA 4U3SB 4M6NL 2OK0L 3ASWA 4GW1A 1OALA 2CXGA 3GSOB 3QDGB 1R3IH 3E6FA 1TT6A 2ZUQB 3T0EC 4JFPA 3WE6A 3OKDB 4F80A 3FUKA 2QKIB 5E9AA 3RUGA 5AL0A 4BQCA 2AK4B 4Z1PA 3FFOA 3PWVB 2WQVA 3SE4C 2F53B 2CO4A 5SWSA 2NY1C 4Q89A 4LKXB 2PW1A 4YXLH 4ELDA 1FYTA 3BT2L 5IVZA 4L1LA 3O2WH 1H9DA 1U3HB 4D3CH 3U1PA 2VLRD 1MFCH 2OP4L 3T3MF 4YHLH 3P30L 2VDMB 2WLMA 3GI9H 1N26A 3D39D 3D2TA 4WUUD 2KZWA 4EN3D 3V6FB 2F1EA 3BE1H 1JGIA 4P2RE 3RTQA 3KDMB 4UNTA 3WTXA 1FIGL 4GKNA 1BIIA 4RVBA 3U36A 5FFLA 2V5RA 5D4IA 1BFVH 1KYDA 5KBPA 4QRSA 5DI8B 1EQWA 3DO3A 1FFRA 1KT2A 3VGFA 2FATL 5C0DB 1VGKA 4O02B 5HYSB 1KTDA 1LO2L 1QSFE 1I8KB 1XH3B 3LQZA 4HWBH 1WZKA 5CIPB 1YEEL 1HXYA 5E1HB 1G6RA 3FOMA 5F96L 1JRHI 2V17L 4FNLH 3Q44A 4R8WL 1XH2A 2NNAB 4PG9A 3F05A 3FAXA 5F71A 1EO7A 3BUIA 4BZ1H 4Y2LA 2DJMA 4FFZA 3KM1A 3RIFF 3P40A 2DLFL 2GTZA 3NCYS 3RILA 2W92A 4FEIA 2BO0A 1MJUH 1S7TB 3QDGE 3WEAA 1CD8A 2YSTA 4N0UB 5DF0A 3I6GA 4FEMA 4DNLA 4FULA 2AK4E 1E2VA 4PJCF 2YGOA 4ES8A 3JVGA 1J0KA 2F53E 4JM2B 1T6BX 5EDSA 3QQ3B 3HE6D 1EXUB 3VRLF 2B1HH 3WEXA 1MELA 3MV7B 2DMKA 3FAWA 3NZHL 5HDQL 4OV5B 1BWWA 3QQDB 2OMYB 3G5VB 5KYUA 3KYKL 3APFA 1V55B 2WYIA 1OTUD 2ZUUA 4NJ9L 1ONQB 3ZUCA 3VD4A 3QUGA 3ASNB 5EFIA 2KQMA 3JWDC 5ICYA 3QWOA 4OLUH 4EI5A 3MLWH 2BSEA 4HIIA 3TESA 1FHNA 1JD9A 3KLAB 3HG1B 3GMPA 3B2XA 4MCYB 2ENQA 3CSGA 4JFOB 1M7DB 2DDQH 3R8BB 3TYFB 1QHQA 1E6JH 5EU7C 4JHAL 3H9HA 4ELMA 2XZCH 3RWJA 2YEZA 4TULH 5C0BA 4LRIA 5D1ZA 3HZYB 3M46A 3D69A 3Q5TA 3WIFA 5F1KC 2UZIL 4XHJD 3AY4C 3SDCD 4YC2C 4J3OD 4P06A 4XOAA 1DVFC 2WXPA 1VAHA 3HS0C 4ZMVA 4WEUD 3X1GA 2R1XA 3TO4A 1QLFA 4L4TD 4N0UE 2F5BL 3HE7A 5FW8A 5KYXA 1TENA 2CDFB 3RVXC 1D5MB 1J9RA 4EEEA 3HJ0A 5EZLA 5GGVH 2VDMH 3FOLB 5CP3A 3TT3H 3C6LC 3O45A 4NKMB 1BQKA 1E9PA 4CL7A 5TPWL 3FNKA 3IFPA 4JFFD 1JL8A 2PF6A 3CUPB 3KD4A 1JV5A 3MV7E 1AXIB 3ZZQA 1DJHA 3TH3T 3VFUB 4ZX3A 1ZGLM 3V0GA 1AG6A 5C97A 4LQFH 3HA0A 2E4TA 3PWPD 4BELD 1Z32X 3GGWA 4RRPM 4O02H 4IGBD 1S7XA 3IGFA 4K55A 3L3OB 1WGVA 3QUMH 4MD0B 2C9XA 3AMKA 4PIRF 4UQAA 5GSVA 3VXRD 1U8KB 4MA1C 3HG1E 1TJIL 2O6DA 1FO0H 2OCFD 1OSEA 3TA3D 4L05A 3P3TA 1TTFA 4LBEB 4CAGA 3T2NL 3D0LB 5DJDA 3V55A 5CCGE 3T8XB 3INUH 2D7OA 3KHOA 1IKOP 3VH8B 5I1KL 3JBG7 2WD0A 1U8PB 4PH8A 4ALAL 3QI9D 1BHGA 2VXTH 3C60D 2G0KA 1FPTH 5C0JB 3WCYA 1JTPA 1M7XA 1YNLL 1FL5A 1WD9A 5GZOC 1BQUA 1ADQL 2HUHA 3EOAB 4OCWL 5DFVC 1I9RH 3P0YH 3TP4A 1NIFA 2Q7AA 3JTBA 3MUHL 3PWNB 1F4YL 1IAIL 1HCZA 5FO9A 2XRAL 1DANU 4LOEA 3HS0B 4L5FL 3SBQA 2WMPA 3N6YA 2ZG1A 5F70A 4HJJH 2VMEA 2XNAA 4UT9A 3CSYB 1DBAL 4RIRA 1GYUA 5JHBA 1RZKC 1GC1H 2ZNWA 3ECBA 3NTCH 1N19A 1OL0A 2OBGA 1KWKA 1NDMB 3AJ7A 2UVFA 4I0PC 2AJ3A 1AG0A 1R6VA 5CR1A 1NGQL 1EGJL 5JLZA 3V5DB 1H0DB 4XCEA 5EIIA 5I0YA 4E9RA 4IKIA 4ZS7H 3CGTA 3LMJL 4GXVL 2VAAA 4X5XB 4B9PA 5IIEA 4J23A 1GJWA 2UZYA 1GH7A 3QPXH 2WB1A 1MRDL 1EO5A 2K6WA 4YSQA 3F01A 3OSVA 3U2SA 2BW4A 1NZRA 3OJ2C 3EJSA 4JG0H 1IGIH 2Q5BA 3QJHB 4AJVA 1ZY9A 1J12A 3FB6A 3D25A 2FWOB 1GZQB 2ERJC 3CC1A 2KT6A 2VMJA 1JDDA 6FABH 3NCXA 1HWHB 3MV8B 1CDBA 2ILLA 4IRJA 2R51A 4IW4C 3FQ1A 1DLHA 3D07A 1Z5LB 3OXSA 3ARFA 3ILQD 4WWPA 3QDJA 5JW5B 1WC7A 4AUYA 3NRQA 4R2GB 1BVOA 4NZ8A 3WG7B 5F21B 2FEJA 3L3IA 4X8GA 3GZKA 4KMTL 4ZFZA 3BW9A 3WJLA 2R0KH 1XH1A 4XP5H 4OZGB 1OB1B 5F3BA 2EDDA 3QYCA 2HT3C 3FRPB 5D1XC 5J4MA 3DHPA 3VD7A 1J88A 3UOAB 2K4WA 3QQ4B 4IKLA 2ZSVA 1PJWA 3DOHA 3IGAB 1NUGA 1NKGA 4F2MB 2OMUB 4MNGA 3RWGB 5D2NB 1T20A 1S7VB 4UBDD 3BP7A 4ODTH 5DU7A 3TOPA 3ESUF 2HZHA 3KMDA 2VLMD 2V5YA 4I0PB 4RMTA 3QP3A 4AQAB 2ROXA 1A1MB 2J1ZA 2VUOA 5F9AC 5T1KB 3FONB 4WFFD 3DBXA 3MRMB 4K3HA 4A2DA 1DEEB 1PTZA 3AQDA 5DK0A 1WISA 1G7MA 3MV8E 4MDJA 4CDGC 2Z7UA 3GIZH 3MNWA 3O3DA 4XNBA 1N5AB 3JYCA 4M29A 2IGFL 1SF5A 3DV4B 5IR1B 1ZHKB 4HGMA 5AVXB 5KJRL 5AVTB 4L0YA 1ZA3B 4WI7A 4CC4A 3NRFA 1S8DA 1NANH 5AAPA 2ERJB 3SDXF 3L7EB 2OSLB 2P47B 4FLSA 4OFYD 3O4LA 5KVFE 5JPMB 1JSYA 3PWLB 1GHFH 4S1SL 4UIMB 5CJOL 4A67A 3SBRA 1LDPH 3UYPA 2NLJB 3KXFA 4PM1A 5DD6B 5IHHA 4OZGE 3PPEA 4NCC2 1FSKB 1OO2A 5F44A 1KG0B 4JO1H 3L5XH 2J55A 5CZXC 3DSFH 3Q6GH 1CYGA 3WFCH 2RR3A 2FJFA 4WI5A 2H32A 4ZZKA 4FHKA 2GCYB 3H7BB 3TURA 4F2ME 2EP6A 3NJIA 1U8LA 5JDSA 4NENA 5JMOC 2H26B 4JZNB 5D2NE 5D7HA 4XVUC 4G3YH 5J6HB 1QZNA 1PFCA 5MERB 1N0LA 1U95B 5CLZA 5E1IA 5D1XB 1JHTB 3KHQA 1ECYA 4X9BA 5DHMC 1FZMB 3O81A 4F7KA 3GFUA 4QXVA 2Y6SD 5L0QC 1HKLL 1IM3B 2Y4SA 3ZKMC 4HKXA 1UYWH 2PPEA 1PMYA 1FN4B 2VW6A 4N9GA 2RGSA 4W68A 4Y4FB 4K71B 4ZNEE 2O61A 3WKML 1VGEL 4M8VA 5KVFH 1GPOL 2DWSA 3II1A 3KW7A 4POYA 4Z7WF 4AEIL 4FXGC 4GSDL 3F7VA 3TBTA 12E8L 4POZD 1KEML 2XN9B 3FSOA 3RWHA 2YPVL 3V6OA 2DJ4A 3MUGB 4J1UA 5AYTA 4BFEA 3BZFA 4ODWB 3BH9A 3L3DA 4NAMA 4NGHH 4UMGA 4R0LC 1PAMA 4GOSA 2WQSA 2B20A 3FN3A 3US0A 1MUJB 5EA0H 1KJMA 3F7YA 1MI5D 1CGYA 4ODXA 4A7VA 4JQVA 5CLWA 5EBWA 2EVIA 1QRNB 3WJJC 1I8UA 1BFTA 2NY3C 4KZDH 1HN1A 1AQHA 5ELIA 3DVIA 3FZUD 2Y1AA 3BWUF 4U3CA 1BOGA 4FQ2H 1L0QA 4ISVB 1B9KA 4LHQB 2P46B 4PTTA 5G5DA 4OCSH 4BK8A 4YEFA 1C5DA 1MJ8H 1QPKA 2J43A 5GISH 2P5WD 2AEOA 4APXB 1USZA 3JTTB 4D8PB 4G6KH 5D1XE 4YHKL 4HK0A 4BGLA 5I1CL 2WLYA 2V33A 1EDYA 4MAYC 3P2DA 3KLSA 5L4MA 4MD5B 3WTWA 3GI8L 5TDOB 4XN2A 3VWJD 3NCCB 3OMNB 5J6GA 3GHBH 3JV6A 2P8PB 4LBAA 2QQKL 2YIHA 4OCYH 1ZA6A 4R7DB 4OZHB 3KG5A 4OUUB 4ETYA 4P3WA 4KZEL 2MTAA 1OAKH 4JJOA 4DAGH 1NWOA 2ZOKA 3MUUA 4JY5L 5L0QB 2HX8A 3AY2A 5BS0B 1ASOA 3HHMA 2XN9E 4M7KH 1S7QB 32C2B 4CVUA 2YWYA 3K72B 2DWXA 3JWOH 4OFPA 4BV1A 3FUFA 2FR4B 4CMHB 2HG0A 2AMUA 3QIWD 3U7AA 1NBYB 4H8UA 4WU5B 3EYQC 3HB3C 3VACA 3DTDA 5IESL 2OTPA 1BM3H 4OGXH 1CZ8H 3NFSL 4FXGB 4Z9KB 4MQTB 4ENZA 1Y1DA 3WNJA 1Q38A 1QRNE 5JIHA 5E2VH 5E6IA 5HHXH 3IMBA 4MQSB 3VX0A 1RPQA 1ROCA 1IBGH 1B88A 2WYTA 4NNXA 1X9QA 4LCUA 5F7FA 4R0LB 3NCJH 1YNKL 5INCA 1GVIA 2DQHH 5I6KA 5IQ9B 4K8RC 3IKCB 2ZUWA 4KMLB 1A14H 1A4JB 1J9QA 1MHPH 2DWEB 2UY6A 2A73A 2CLVA 2WANA 3FPXA 4FOMA 3F12B 5I1GH 5KZCB 4ZMQA 2FUTA 1ZTXE 4AYFA 2HKFH 1Y6KR 2NY3B 4OM0H 4U1MB 1JDAA 2ZX7A 2AJUH 4W6WB 1PJ9A 2WQXA 3SIKA 3FFCB 4PP1D 4OLXH 3NESA 3O2DL 1PFOA 4P3DB 1IB5A 1I1AA 3Q06A 3O3EA 5AD0B 3BP4A 3WS3B 2R0WH 3ULUE 3SJVD 3QIUB 4Y2DA 4LZKA 1S7RB 1P4UA 4OZHE 2VN3A 4Y88A 2QVMA 2O30A 2ZJSH 3O3AB 1EZVX 1U21A 3LRSB 2GC7C 3UJJH 3GBNL 4APQA 2GJ6A 4FQHB 5BS0E 4CSZA 1HZLA 3AG1B 4N9OB 3D1MC 5CCKH 5I1AA 4LU5H 2K0RA 1M3IA 2BVOA 3MLUL 5J57B 5DK2B 4QJ4B 5MEOA 3OKLA 5IW1A 1GZHA 1G1OA 4HGWB 4ZAKC 5AKSA 4I7ZC 4WJG3 4DGYL 1QI3A 2A77L 2IGTA 1D2PA 1OM3H 5HYIA 2VABA 5CUSH 3PYCA 2JNZA 3RWEA 2P8MA 5J0BA 4X6DA 3AWFA 5E56A 2L04A 4MZ3A 3F8UB 3HB3B 1SY6L 4YPGA 5A40E 3B34A 3ULUH 1C7TA 5EORH 1SJMA 5JPNC 4N8PA 1A6WH 3WHXB 5IGXH 5E8PB 4X4YA 4WV1C 4K7PY 4ENED 2F8VA 5JHLA 1EFQA 3MFFB 4HS8L 3S8WA 3FFCE 3KPLB 1NICA 2Z7YA 3MNVB 3MLVL 4JVUA 3GXDA 5JYLA 3FCTB 2CUMA 2CLZA 2W60A 3LPGA 3NAAL 5J89A 3FQUA 3ZRSA 2G60H 4LLDA 5EF2A 4JRYA 3O6KH 4W9LC 2Y6TE 4YSAA 2IAMC 4P5KA 1GOHA 3UXFA 4MA8H 1E5CA 2OJZL 4AK2A 3QPKA 3QJZA 4WDIA 1IQDB 3ES6B 3ARBB 4HUKB 3ARDB 5FF6B 1TYJA 3WI9A 1DE4B 4KTDL 3NSJA 5DUML 5AVRB 4LNVA 1JI1A 4TN9A 3T65A 4JNXA 1Q0XH 2Z4QB 2NR6C 3HMWH 1BOYA 5J11B 4JM0A 4MBRA 4XR8C 3REVB 2CH8A 3BQUB 3QIBD 4YUEH 4C54A 2F53D 5TE6L 3BPLC 1AFVH 5DVKA 5D7LD 2EKSB 3KYNA 4HIEB 3T1WA 5IEHB 4GG8B 1SN0A 4QT5A 3Q9QA 5IQ7L 3DC0A 2A9BA 4ZAKB 3OKOA 4R4BB 3PG2A 3B2UD 4GS7B 4K15A 4K9EC 3U0TB 5I1IL 2FJUB 2JJWA 2XXMB 2FO1A 1CUOA 4I3GA 3OPUA 1FFOA 2YD4A 3KVQA 4G7YL 4NM4L 2JJSC 2JB5H 5ALBL 1T7XA 1TYRA 4RISH 3CN2A 5J8OA 1P4LA 5IOPB 5CEYA 2CGRL 4MJIA 5ESVA 3G6DH 1F3RB 3SE6A 4CADA 3FH8A 5JPNB 2NY6C 3T71A 1BBDH 2BRQA 1RUKL 4G7VL 3WIAA 4M8UA 4YHIB 5IEKB 5EZOH 2VXQL 2P5PA 4FP8H 5LGHH 1PIGA 4YLQT 3HHRB 4Y5VA 4OGAC 1FNSH 5AUMA 3AXIA 2X1WL 3ZIMA 1Q9OA 4OF6A 2MKLC 3LN5B 1KULA 3SYCA 3FB5A 6PAZA 4DZBA 1MAML 4BSWB 3CNKA 1ULVA 2BRRL 5AWNH 3OHXC 1FLRH 3GYRA 5JR1L 3BUTA 1I1FA 3V5HB 1A4KB 3B2VH 2CLRB 4P57A 1C08A 4M43L 1CR9L 5D7IF 1HHHA 2MQGA 3IJSB 5B38A 2DB8A 1AR1C 1MIEL 4GRMB 3QCUH 1FORL 4DN4L 2Y07H 1FG9C 2PCFA 2E7DA 3VRJB 5FFOA 4OFKA 1NLBH 2I32A 4JZJA 5A2LH 5ADPL 2XJLA 5MI0C 2Y7NA 1TVHB 4QRPD 5CU9A 2ATPB 2NDGA 1U3NA 5B4MD 3EO0A 5E23A 5FM5M 2CAKA 1WZ1L 2N3JA 4NUPA 3S37L 1AYOA 2K6ZA 1TCRB 5BV7B 5B1JA 2KZKA 1F5WA 5GGTH 2CBMA 1JN6B 3EH5B 5CLTA 2B4CH 1NKRA 1TJXA 4KXZI 2HTLD 5ANMA 3G6JB 4Z95L 1QQDB 1IFHH 5BRZA 3RNKA 4B27A 3NN8B 3BZDA 2X41A 3CFCH 1XGQB 4BINA 1XCQB 5IMKA 3N50A 3U7YH 5E8EB 4NZUL 3AS2A 1R3KB 1M71A 5MENB 4HPYH 5F72S 3QRFM 1UVQA 3K2UL 5AW7B 4MYPA 5DJAA 2F1BA 2HVBA 3WLWD 4J2XA 3ZZ1A 4K5MA 4LPCA 3DGGB 2M26A 3LHPL 1U8CB 2IV8A 5KS9B 1MVUA 4XN8A 4L18A 1ERNA 4AUJA 1M7IA 5FOBB 3ML8A 3BAIA 5DMJB 1BZ8A 1QFWH 3LXUX 4DT2A 2UV3A 2ZONA 4QJ3B 4Y7OC 5FA4B 1NJ9B 2JKNA 4OLZL 1T1XA 4HC1H 3BVVA 2ZCLL 1NMCC 2DQCL 2WLLA 4K07A 3KH4A 5E94A 1EZSA 1E4XL 3E2HC 5FYJH 2GIMA 1UT9A 2XA8H 2DQFB 3O6LH 1SMAA 2FJHA 4QGTA 5MP6H 1RK0B 4MVBD 3S4SA 1IVLA 1O7VA 1EHLL 2E9GA 3LXBA 4MNQB 4EIUA 4GP5B 3KPMA 4UV4H 1AR1B 3A21A 5F7EH 1HNFA 3V0DA 1A02N 1BPLB 2B5IB 5EOCH 1WTGT 3CXDL 4KU1A 4L3ED 3FCSA 4U1LB 5JXEC 2A4ZA 2BS9A 3G6JE 1Q9KB 2O6PA 2NYYC 3GS0A 1YEFH 4JQXC 4MMZC 4PJHB 5MI0B 4Z0XA 1MG2C 3IFNL 3KPQA 2ATKA 1J1XH 2YN3A 4P2OB 5MENE 3BX7C 2DWTA 4NIKB 5HHQA 4ELKA 2FX8L 2VMFA 4QR7A 4GKSB 3QUKB 3WFDL 4UYPA 2A6JB 3MJ9H 1JPSL 1UEYA 4IRSD 2VR9A 3X13B 5KS9E 2DQEH 3HIZA 3SGEH 4OD3H 4HWBA 2EDEA 2IXQA 2Z8WC 3K46A 5KUMA 1ETB1 1WLHA 1HHIB 4UZGA 4XRCB 3FKUS 2FGWL 4YDIH 3HS8A 3D50A 2LU7A 3H42L 4GP8B 4F7TA 1IC0A 3AU1B 4IM8A 3VXUB 4BZ1A 1H15B 1QFUL 5BV7H 3VFWB 3O0RH 4BCZA 2EICA 2FGZA 1AIFA 2OQJB 1L9QA 4P4KA 4UTBA 2VNCA 1CFVH 2PR9A 1TTUA 4MNQE 3WUZA 2A9DA 2JCCB 3BZ4B 2FZ3B 4M62L 2J6EL 1F4XH 5DS1A 5F9OL 3OC5A 1DJXA 5F6HI 4ETQB 2WXNA 1SPDA 4MX7A 5BJTB 3CC5B 3N9GL 4P2RA 1JHLL 3M07A 2Z91A 3P77B 2E4FA 1T1ZA 1ZSHA 1GGCL 1JZ8A 1BZ9A 1KJ2L 4PJHE 1CPUA 3HC4L 3UZVA 1U8QB 4WWKA 3MREB 3MJ6A 4XHQA 2WINA 3U1SH 2EYTB 1QSFA 1SDDA 1GAFL 2QSCH 1DCEA 4O2CB 5I23A 5L9DH 4Q6YA 4KY2A 4NHUB 1CLYH 3BSZA 4WTZG 5DMKB 2ZYIA 1F58L 4ONHB 5F7AA 1DBJL 4YXHH 5HVHC 4U3SA 4JY4B 5T5NF 1A1OB 5T5FH 4XC1H 1C1EL 1UZGA 3IETB 3QDGA 1TZGH 4JE4B 1JYWA 1XGRB 2YAMA 3OKDA 2M1KA 3VGAC 2AK4A 2CRMA 4KUZH 5H37H 3VXUE 2GI0A 3PWVA 4KK6C 4FHJA 3T6WA 4F8PA 4LKXA 4HXBL 1NGPL 1IU1A 4KAQH 3ZJAA 1VZHA 1U3HA 1V05A 2GBVA 2F7RA 3D85D 5KN5B 4AE1A 2JCCE 1RJLB 4HZLB 3I6LD 2UXGA 1KGCE 5DEJA 4BZ2A 1W72L 4DO6A 5TE7L 3V6FA 3KDMA 4M4RB 1TQTA 2R56L 4GI6A 1NSNH 2IADB 3LB6C 5DI8A 4EQ3A 4G8EB 4L9LC 5C0DA 3N91A 2VJ0A 4UINL 3KEDA 4O02A 4MCMA 5HYSA 4WO4D 1AC0A 3RVTD 1XH3A 3PL6B 1A7PH 1GMIA 2ZAGA 4M1DH 5CIPA 4Z78B 3LIZH 5DO8A 4TLKA 4QTIH 2JKWA 2NNAA 1KCVH 3LZPA 3CHXA 3CFBB 1U93B 4TLSA 3DPDA 4MXVE 2B59B 4KOCA 1YPZB 2DEXX 5LBSH 1JUFB 1S7TA 1OK0A 4XOEA 2CUHA 3LEXB 1T0PB 4RRPG 1AHWB 4KHTH 1R0AH 3B37A 3SKMB 3VFGL 3MRIB 4YQXH 2PO6D 1JOIA 4JM2A 5DQJB 3QQ3A 5LG1A 5DZPA 1R9FA 3ET9F 4ZMOA 3ECUA 2XWEA 5HVHB 1N68A 2A7BA 3MV7A 3F2LA 5D6DC 2IAAC 1K8IB 3ZKXC 4OV5A 3QQDA 2OMYA 3G5VA 4QPEA 4OGQC 3TFKC 4KGLA 4JPSA 5TFSL 5I6NA 1QKZL 2MRYA 3VGAB 2X87A 1ONQA 5LKNA 5CCHE 3GNMH 4UTAL 1SN2A 1E4KC 1YDPB 3B4NA 3LN9A 4KUCD 3AREB 3SE4A 1CICD 2EYRB 3MACH 2J25A 4HT1L 5E70A 2LTQC 4N28A 5CGYD 5DWPA 1BQHB 5KVDL 3TT1L 4B9GA 1CDHA 2DMGA 2X2UA 3HG1A 4DP8X 2VN5A 5C0EB 4MCYA 4UT6A 4DP0X 4XVJH 4JFOA 2H8PB 2HAZA 2A0LC 3TYFA 3HI5L 3IMUA 3C5ZD 2FVNA 4CMMB 2OL3H 4CSSA 2AI0L 4M9PA 4NPYB 4KI1A 2KHAA 5CGMA 5I8EB 3B8YA 3MLXH 3NIFB 4O4YH 3MRKB 5K33A 5I73C 1BXVA 4RMSA 2BHYA 1C5CH 1UJTA 1DBMH 3ATEA 1CMOA 3U6RB 1U36A 2HVKB 1YPZE 3D34A 4DUWA 3W2DH 3X3FL 3JWNH 1BEYL 2CDFA 1M1SA 3K80A 4Q14A 3BVTA 1D5MA 3EAKA 5ID0B 3AMLA 4BFRA 2B16A 5ADOH 3DNKA 1N67A 3H4FA 3FOLA 1NM4A 1BREA 3QFJD 5F97E 4NKMA 3ZHNA 1ET8A 2VLJB 3CUPA 3VFUA 1WEJL 1EVTC 1Y7VA 2NY2B 4WKXA 5B1KA 4KJWD 2XIBA 4XOCA 2WUBL 4FA8A 1J8HB 4M8RA 4RESB 4MA7L 3WMQA 5ERWB 3SE3C 3U9PL 5L2JB 2AJSH 5G4OA 4HALA 4IYKA 1Q72L 4YLCA 3L3OA 4MD0A 1VKXB 2PPFA 3RKDD 5F6IB 1U8KA 1IC7L 4BFOA 1G7LB 1EZLA 3ZKXB 5GZNA 1UM5L 3WN5B 3MCLH 4EZMA 1Z3RA 1OCRB 3NJLA 4PJBB 4X5WA 4M5ZL 5T5NG 5FO8B 43CAB 1A9EB 4LBEA 3D0LA 3MI6A 3KL0A 3BKYH 3NIFE 1WAEA 4ONFH 1A9VA 3T8XA 5E7FA 3VH8A 2C5DC 4JHWL 2OR8A 4X98B 2IALB 4G6JL 3ALPA 2LTQB 3HZMB 4ZOBA 4YBLC 1ZIAA 1JF5A 3IDGB 4JHUA 4PVNA 2VJ8A 5AB2A 5C0JA 2Y5TB 4PJAB 4BCYA 4HFUL 3TEXA 1PZCA 2DI7A 1QACA 3OLEA 3KPOB 3EOAA 3JV4A 4YSPA 1DQDL 2AK1L 5I9QB 3V8CA 3X17A 5DZOA 4ORGB 3AY4A 4LVOB 3TEUA 4BJLA 1ZLUH 5DFAA 1DVFA 2ICEC 1ES0B 3HS0A 2OMBA 1JNLL 2CDGB 2OMZB 2VLJE 4HEPG 4U1IB 5IROD 1BJ8A 4IHBA 2ZZUT 1GS6X 1NCOA 3CSYA 4XX1E 5LWYL 5GS2D 1J8HE 1YYMH 2FD6H 2KKQA 2Z8RA 3Q3GB 1G4RA 1G4MA 3MRQB 1NDMA 4NWTL 4AL8H 1IT9H 1QWNA 2LE9A 4YK4C 2BHFA 1A7QH 5F7MC 3V5DA 1H0DA 1KC5L 1TQUA 2C3GA 5TGBB 3AADB 1NGZB 4HUCA 4HF5L 5CHNB 4FKKA 4XH2B 4YH6A 4X5XA 3I9AA 1MFBH 2FYYA 4PJBE 1TTBA 3NABL 4G80B 3KWTA 2DD8L 1SJHB 3QZPA 3EDFA 4MCZB 1J9CT 1J8SA 4PJ9B 5E2WH 2YD2A 4G8GB 5IF0B 1XSIA 3RDTB 4JFDD 2FT7A 3PCYA 3QJHA 2HG5B 1G7HB 1XD0A 2FWOA 4LHUB 1GZQA 2P45B 1IARB 2OSXA 1NEZB 3CVHH 4CBPA 1KYAA 4PJAE 4DOHB 4R3SB 1TZ8A 4XO3A 4FQ1L 4UQIM 3MV8A 3EHBC 1AY1H 2H1PL 5IBTL 5HHOD 1Z5LA 3D3VB 5FK9B 4TVSa 2OXHB 5JW5A 3BDYL 2DQDL 4X4ZA 3AQYA 2PMZA 3HKZA 4YBLB 3V0EA 5D71H 4PWIA 3HZVB 3CDYA 4JKPL 1A25A 5I18H 2XG4B 2P5EB 3D18B 1CL7H 2C3VB 5GZOA 3KWVA 2X4PB 1URIA 3LOWA 4W9HC 2X1XR 4GPVA 4OZGA 1OB1A 4FNUA 1KTKE 1RZJC 2J2ZB 4H0HB 2MCG1 2QSQA 4A6YB 3FRPA 1ML0A 4WNSA 3K2KA 2ARWA 2BCKB 3CVDA 4TSBH 3QQ4A 4WNQB 1RZ8B 2ICEB 3B8SA 3IGAA 2NSXA 1P7BA 2NMSA 2F15A 1N7ML 4JPWH 4F2MA 1VF5C 2OMUA 1AHMA 3D9AH 4DVBB 6TAAA 3RWGA 1IBBA 2A2QT 3GIVB 5D2NA 3NIGF 2HLAB 3H55A 1S7VA 3UTTB 2I69A 2BNUB 4UF7C 2FX7H 1OOWA 4JPKH 2XV2A 1T1WB 2X42A 4G8GE 4I0PA 3ZLQC 4AQAA 8FABB 1RERA 3R06B 1A1MA 1ACYH 3TV3L 1A21A 4OJEH 4PWJA 5T1KA 4YSOA 3FONA 1BAFH 3FC8A 3P2BA 2EDYA 3KGUA 3MRMA 4M61B 5IJKA 1RUML 1DEEA 1J1PL 1OSPH 4PJGF 4RAUB 4DOHE 1E65A 5EIQA 4XMLL 3H9SD 35C8L 3RZCC 4ZNEA 3GB7B 4QRTB 4KO9A 4BGDA 4ZTOH 1R5WB 3T2OA 1N5AA 4YDKH 4XCNA 3DV4A 5IR1A 1ZHKA 3MRNB 3D3VE 2IH3B 4M93B 1ZA3A 4JFTA 2DS4A 5AAWC 4R96B 3ME0A 3UBXG 3ZL4L 5EN3A 3L7EA 1NBCA 1O75A 2BOCB 2OSLA 3QUXC 3QARA 3WIHH 2AANA 2IBGA 2Q6WB 1T1YB 2X6BA 3ARDD 5JPMA 4GMSH 4U1JB 3PWLA 4AZUA 2P5EE 2XQYK 4UIMA 1W15A 5C7XH 4I8DA 2NLJA 1QPXA 4TSCH 5D72L 5DD6A 3VO0A 4K5OA 4ANVA 4B3EA 1E5BA 2YAOA 4AEHH 1KG0A 1TVBB 3RY6C 1INEL 1D5IL 1UENA 1LWHA 2VM3A 5BZWB 4ZW6A 4H0GA 2GCYA 3H7BA 5KYYA 2OXGB 2AQ3A 2H26A 3FN0H 5E6RB 4JZNA 5DD3H 4W4NA 5GRUH 1A64A 1BX2B 3FH5A 3K6DA 4HWNA 4Y9EA 3VQLA 4F7EB 3UTTE 1XTMA 2LVEA 4F5CE 4QXUL 5MERA 1U95A 3K4DA 1NANI 3SGDH 5D1XA 1JHTA 1NOFA 1FZMA 5FYJD 4IK6A 1PLGL 1IM3A 2XC8A 2Y2WA 3QYNA 1FN4A 1CLOL 3NP4A 4Y4FA 1XCTB 1E4HA 4P4RB 2WIMA 5GHWL 1YYCA 4DQOL 1RHHA 2H7WA 3PWUB 4WGVB 4IDLA 2CDEB 5LXGL 1ZK9A 3LEVH 3R0NA 4WI8A 2J20A 2XN9A 1D7CA 3TEWA 2RBLA 3MUGA 1KEGH 4ODWA 4OIIH 3E8VA 3L9BA 3MV9D 3CJJA 3RZCB 2WLNA 2DJSA 5DC0A 1MUJA 4YHOL 5IB4B 2UVEA 3ZVVA 2DQIL 2XBZA 4BRVA 5DDHB 3D4ZA 1YYLH 1FGNL 1XF2B 1D9KD 1QRNA 4HUMB 4R4FL 3S97C 4BFIB 4ADJA 2H6PB 3RFZC 5JIPA 1KGUA 3QUXB 4IIZA 3KLQA 4ISVA 1PY0A 3STBA 2UUDK 5CKAA 1XIWC 1RKRA 3DVGB 2CBTA 1KWGA 2EDFA 1UC6A 2JKJA 4APXA 1I7RB 3GKWL 3JTTA 4D8PA 4AQ1C 2VDLH 1P5UC 2F58L 3SGJC 3PJLA 2AJYH 2YQ3A 3EYSL 4JDZB 3FUEA 4NHCL 2ADJA 4XMKH 4MD5A 5TDOA 4H8PA 4TV3A 1HFUA 1R5IB 2NYKA 1CS6A 1CE6B 2P8PA 2RAMA 4Y8DC 5IQNA 2JCWA 1M2VB 4R7DA 4OZHA 3ELQA 5F7NC 4OUUA 5I15H 3CDCA 2EC8A 4R6UA 4XB8A 3Q43A 1XO8A 3IMVA 5C6PB 5K9QI 3QVAA 1TZIB 1N4XH 3AG2B 1KACB 4M1CD 5BS0A 1DDHB 1BFOB 1S7QA 32C2A 5L7XH 2HFFB 2JWYA 3K72A 4FCAA 4LIQL 4MB4A 5MEPB 3GSNL 4EI6B 2FR4A 5C09B 3U83A 5BUAA 1OWRM 1L9MA 3VI3B 4WU5A 4F8OA 2K4AA 1W0VA 1KTJA 3WL9B 4FXGA 3S5LG 4NQDD 2GPZA 5FYLD 1BECA 2K9UA 4DPCX 4BZYA 1VENA 5AEAA 4AG4H 4ZX5A 4XE5B 2R1YB 3NOIA 4ZUTA 5JIQA 3K6FA 4R0LA 4L37B 3FBKA 1M1XB 2D0GA 3IGLA 1MAJA 4I3SH 5IQ9A 2NSMA 3IKCA 1YEGH 4N6QA 1RVFL 1A4JA 2DWEA 1CU4L 1IE5A 3F12A 3CBRA 2R2EB 4AGQA 1OF2B 2BNRD 2WB7A 1L6ZA 4U1MA 3BLPX 3M88A 3RFZB 1JZDC 3DGCR 3FFCA 4V2BA 1WAAE 5E5MB 1ZGLP 1P7QB 4EOWL 4FLOA 4P3DA 5AD0A 4JGUA 3WS3A 4H8WL 3APDA 5I75C 5JZ7D 3MRDB 3QIUA 4TUJB 1S7RA 3C5JA 2VSCA 4PRHB 4AQ1B 1P5UB 4JQIH 4X7TB 2OR9H 3O3AA 1T21B 3VJ6B 3LRSA 1JDCA 4TRPL 2UYLB 3DHUA 4FQHA 5IV2B 2GEQA 5F0LB 1IQWH 1GGIH 2WBXA 2BDNL 3H56A 3OC8A 4C56D 5DK2A 5C09E 2X3BA 4KY1L 2MSPA 4UT7H 5D70L 3BZ5A 5DD5L 4HUXB 5DJZB 5GJTL 3VI3E 3CV5A 3WO4C 3J27A 1UD2A 3GBLA 1MCHA 3EJRA 4HGWA 2N7BA 1U30A 4WKZB 3RGBA 2HLFC 1JFQH 1IFRA 3J07A 1KDJA 3L5WB 5ID1B 3MQIA 1FBIH 4MAUL 2BSCA 1FZOB 4DKEH 3QNYB 4N22A 1T3FB 3OWRA 3QCVH 3QISA 3UC0H 4BRJA 1XX9C 1SXZA 2TRHA 1ZT4B 1YC7A 4WTQA 1ZS8B 3GZQA 5BZZA 4OLYL 3HFML 2Z0UA 3WHXA 2SEBB 4H1LG 5E8PA 5K1VA 4DFHA 4AYMC 5D93C 1Y0LB 1CF8L 3MFFA 5FHBL 1LNUB 4AGLA 4M6OL 3QHZH 3KPLA 4KZCA 3ZRFC 4YSEA 3RUGF 3VFTB 3ULVC 2PWHA 1D3CA 3MNVA 4XWGL 5CJXA 3LRKA 4LGRB 1E42A 5IFAH 3FCTA 4WZ9A 4ZXBD 1G87A 4UAHA 5D4QA 2YQ2A 2EE0A 4DERA 1DBBL 4PRHE 4WWOA 2IWEA 4P49A 2J8OA 2EJ1A 2L7JA 1LJMA 1CDYA 1WBZB 1YEKL 4M6NH 4WK4B 2OAAA 2OK0H 4FQIL 4Z7OF 3FCGA 2CIIB 2X1PA 4LL4A 3MRJA 1G9ML 3C2AL 1SVCP 1EJOL 3IPBA 1NCNA 3WY3A 2WBJB 4HKZB 2CM5A 5I75B 1IQDA 4FGMA 3ARBA 5A7EA 5FF6A 1P4BL 5EU6B 1DE4A 4FZEL 5D7JC 2H0FA 1NCBL 3A4FA 1CFQB 3EJZC 3BT2H 4OI8A 2Z4QA 3VXMD 4Q4IA 1SZNA 4FMFA 4JFYB 2N01B 2YGVA 4JJHA 2OP4H 3REVA 3BQUA 3P30H 4C57C 2WXQA 3B2DC 3HAEB 2F1AA 2DIEA 4HIEA 4ZTPL 3KS0H 5IEHA 1FIGH 4ZI8A 4GG8A 4TQEH 3WO4B 3PHOB 4X50A 4KWUA 1HWWA 1UOKA 2XQYG 4ZAKA 1DSYA 3DYMA 4HC1A 2XTJC 4R4BA 2FATH 3U0TA 2IIJA 5HDBF 1XGUB 4LSRL 4JGJA 1SBBA 1LO2H 3EUUA 3AWGA 1Q1JH 3FSWA 1REIA 5IHZB 3WNKA 5C0CD 1YEEH 1F1AA 5F96H 3ARRA 2V17H 4R8WH 4LGSB 5D2LB 5LNGA 1JI2A 4L8SC 5IOPA 3M6DA 5KYNA 1S7SB 4WAFA 4QIRA 1O7DC 2QV4A 5JPNA 4Z7NB 2QPUA 1RJYB 2DM3A 2O6CA 2DLFH 4EKJA 1TG8A 3PL6D 5IEKA 3MNZB 3NCMA 3RIKA 3S98A 3FO1B 1Y1UA 2FWSA 2YGNA 5K1NA 1E50A 2CU9A 1SXNA 4PYHA 1CFBA 4OV6F 4S1DD 2BX5A 1ZE3H 4L8DB 3LN5A 5EU6E 5C9KA 3V9CA 1U41A 4W9FC 1NFIB 4BSWA 1AI1L 3ALWA 5HDQH 3NZHH 3WGUB 4FTDA 4O58L 4OTXL 2WCSA 4F33B 5BO1L 3V5HA 3KBFA 3KYKH 1A4KA 1DN2A 1OQXA 2CLRA 4JFZL 4FQQB 3MJ9A 4GAYB 4NJ9H 4ELMF 3IJSA 2F8OA 1E4WL 2VN7A 1HSAB 3P02A 4LLYA 2Z65C 1CB4A 2VRKA 3Q7JA 5D7JB 4GRWH 3KR3L 1OTSC 1SFHA 2VR7A 1BZQK 1KPVB 3AFLA 3BSGA 3GC3A 3QNXB 4KROB 1TVHA 2ATPA 1OGSA 4LCWD 3L4UA 2KDYA 4N0CC 4Z77B 5D8JL 4AH2B 4BWTA 2PXYD 5C9JB 2F68X 4L4VD 4KKZA 4JHAH 4TTGA 1TCRA 3ESPA 4HK3N 3QORB 3UBFA 1C5BL 1JXKA 3SCMD 1JN6A 4M8QB 2UZIH 5D2LE 4X5RA 4YWGL 3CXHK 3G6JA 1QQDA 4DEWA 3P9MB 4WI6A 2EIZB 3NN8A 4X9FA 3F7RA 1XGQA 2KPWA 2QADD 4XNUH 1XCQA 2BOLA 1A7OL 2XTJB 4Z7NE 5CN1A 5E8EA 3ULAB 1H6FA 1I8IB 2BXYA 1R3KA 4KKNA 3VYPA 4CJ1A 5MENA 2FEEI 4AKOA 2A38A 3ULVE 3FTSA 5F7DB 2F5BH 5D1QC 1D5BB 1GKOA 3HBZA 3DGGA 1U8CA 4KKLC 5KS9A 1OAUL 1G6VK 1Z9SB 3Q0HA 4WY7L 5TPWH 5I71C 3HAEH 4KKBC 3ZDYB 5FOBA 2CMRL 2BP3A 1BVLB 3DO7B 4B96A 3HEIB 5FA4A 2EUVA 3SDAD 3HN5A 1I75A 1NJ9A 2FQFA 2IFGA 4ZMPA 1SHWA 2ZKWA 4AIOA 1S9XB 2DQFA 4EKXA 3QS3A 2B39A 4GRLD 4G6FB 1RK0A 3AXLB 2QFRA 4K4KA 1PKOA 3OHXA 4W4OC 4ICXA 3N41B 4HV8B 4U0QB 1TJIH 4MNQA 2J1KA 5C08A 2W81C 3FN9A 4AKPA 4S1QL 2X6AA 5E9NA 1OZUA 2ZP8A 3Q1SL 5E4AA 3L3GA 2G0LA 3MZTA 3T2NH 2WHVA 2D4DA 2WGXA 5E9DD 5FGCB 3RG1C 4KI5F 5L4IA 2V3EA 3GD1C 2VL5B 5CJBA 5I1KH 4U1LA 4ALAH 4DUVA 3VA2C 1M7UA 1YHPA 1XQ4A 2Y2TA 2XTJE 5EN2B 3BEVA 4PPTA 4P2OA 2MFNA 3FFDB 1I8AA 1YNLH 2YD6A 2F74B 5DEZA 4BH7B 3NSDA 3EYFB 4OCWH 4ZMXA 4GKSA 3QUKA 3HRPA 1SOKA 2A6JA 1OCWL 5DO2D 1HILB 4RDBA 4X9GA 1F4YH 1IAIH 3QXDB 3DX7B 4YZWA 3V52L 3X13A 2XRAH 4GT7A 8CGTA 2BSSB 1IV8A 1YNTB 5BOZG 3ZDYE 4L5FH 2Q10A 2VMDA 1HCYA 4OZ4B 1HHIA 3LIZA 3D06A 4XRCA 3FJTA 2F8IA 1DBAH 1WCQA 3OZ9L 3AU1A 3VXUA 2NZ9C 3II2A 3CDZB 4U2ZA 1LK2B 4QI3A 1H15A 1NGQH 3VFWA 2WKGA 1EGJH 5LBSA 5I71B 3S8GB 4HUVB 3DROA 2OQJA 2Y1VA 3ZT5A 2HT2C 3LMJH 4GXVH 3OLGA 3NJVA 2NXZC 4HDIB 2X38A 4NZTL 3TM6A 2JCCA 1KCKA 2JF1A 2FZ3A 2J1WA 1USQA 3BZ4A 2VYRE 3MC0A 4GBXB 1MRDH 1HKFA 3PNRB 3BGFC 4ETQA 5BJTA 1PDKB 3U30C 1NC2D 3CC5A 5FGCE 3SGEI 4YFLI 1AGCB 3P77A 3VYOA 3D7PA 1PZ3A 2GUYA 1F45A 2OI9C 1HEZB 1U8QA 4MAZA 3GEFA 3MREA 4RBPH 1DJYA 3L9EA 2EYTA 1ICTA 3WTYA 1RQ5A 1VHPA 3C2SA 3TVMC 4O2CA 4NHUA 1C16B 4HOZA 1CDIA 4J27A 4QXTB 2IAND 3ZDZF 5I0ZA 5DMKA 5JXEA 1R17A 1DP0A 4ONHA 4JQXA 3LH2L 2G3NA 4K7PX 1WZMA 4JY4A 4ABQA 4KMTH 3L4VA 2DM4A 3QDMB 3TJPA 4F58L 2CPUA 2NXYB 3S36X 3IETA 3AGVA 2K45A 1ZLVH 1TPXC 1HL9A 2CR0A 4LSQL 5AOZA 3W3BA 1XGRA 3BIBX 1PZ5B 4UYQA 1U0QA 2CKBL 3F84A 4HIXL 3T6VA 2XZAL 5F6HJ 5KSAC 1O6VA 3TBSB 1JMXA 2B1OA 5JUEL 3OF6A 3WFEL 4Z7QB 4KXDA 2OS7A 1U2YA 4EXKA 5BQ7B 5KN5A 4N0RA 1RJLA 4HZLA 1NAML 3UG5A 3PQYD 5IM7B 1S3KL 2VDOB 5C07B 1V3KA 4Y4KB 2R29A 4Y16B 5SX5H 2V8LA 2GIXA 4M4RA 4RWHA 4K7FB 3GBML 2WJ5A 2IADA 5EU4B 3QHFL 2WCGA 4FTVB 3TZVC 4G8EA 3S5ZA 4BUGA 1NOAA 2XWRA 4J8QA 1TIUA 4LEXL 4TUUA 3D05A 4OB5L 3K6SB 3O6FD 5GQBA 4Z78A 3QW9A 1IGFL 2BSDA 2IGFH 3U30B 5KJRH 4HS3B 2EH8L 4MKMA 4K94C 3PHAA 4P04A 1U93A 4KDVA 1MH5A 4P23C 2OI9B 3QJUB 2WZ0A 3QDME 4H2CA 1EDQA 2B59A 1A6UL 1YPZA 3FUDA 4ZOAA 1JUFA 4S1SH 5CJOH 3LEXA 4JN2A 2RQEA 3BKML 1AHWA 2F7IA 3SKMA 5LDSA 3MRIA 5DQJA 2WXRA 3CSTA 2HT4C 3A6OA 4FQXD 5BO0D 4NRXB 5C1MB 1EUTA 4OCLC 1QFHA 2ZWKA 3VD9A 1K8IA 1SLXA 5E24E 3B7UX 1TTRA 2QVFB 4S11A 2H1LM 4Z7QE 3DX4A 1BAWA 2AVGA 2WJ7A 1RK1A 4H8QA 5INDB 1SXBA 3CIAA 3K6OA 1YDPA 5C07E 3AREA 1PEWA 2EYRA 4H44C 3D4CA 1NCGA 1X4ZA 4U6XB 3WNNA 3FBQA 3CH8A 1HKLH 5KSAB 25C8L 4WI4A 1BQHA 4WHCA 5HHMD 4FTVE 1M05B 5EIIG 3NCFB 5C0EA 2H8PA 3GXPA 3T3PB 4CMMA 2ZG3A 4YS4A 1MY7A 4NPYA 3WKMH 5I8EA 3DETD 1X9RA 1GPOH 1ANUA 3MRKA 3S96B 3Q01A 1IIKA 4GSDH 2M83A 1Y6MR 4YNYA 4AEIH 2VDKB 12E8H 1JZGA 3SPGA 3T0BA 2WVTA 1KEMH 1PX3A 2EDHA 2C8NA 2RFXB 4NUGL 1KGWA 2D2CC 2OSYA 4L9LA 3TZVB 3I75B 3U6RA 2HVKA 2R27A 5I6MA 2ZQKA 2GI7A 5F9WB 5A43C 3CQQA 3ZHKA 5ID0A 1XR8B 4IIQB 1V7NL 3TTYA 1XGPB 2Q7YA 5FYKD 3SKJL 2VLJA 4HMCA 2AJZB 1JVKA 4X5LA 1CXKA 1TO5A 3CX5K 1J8HA 4NFBA 4BHUI 1E6OL 1FNGB 2V7NB 5EOQL 5IB2A 1MG3C 5L2JA 2LV4A 5E4IA 4KO7A 4R4NC 2GJRA 4YHKH 5I1CH 5B8CC 3MLSL 5CZRA 3M17B 3PFQA 2P24B 5IHUL 4JCLA 3GI8H 3T1FB 3ZO9A 1UWXK 1VKXA 1UA6L 5D6DA 5E99L 1G7LA 4C83B 1CO1A 1KXQE 3WN5A 4GXFA 4PJBA 4B5ZA 5I6LA 2CO7A 3T3PE 4GG6B 2QQKH 4J3UA 5FO8A 2ALAA 43CAA 4O5LL 1A9EA 2VM9A 1E4KA 1RUQL 4KZEH 4PRIB 5IP4A 1OT2A 1TEYA 3BUPA 4NSKB 4X98A 5I74C 2IALA 3L4YA 3HZMA 2R69L 1KLFB 1ITCA 3IPEA 1VACB 3IDGA 1L7TL 2ZP0T 3GZPA 5CF3A 2NY0D 4KFMA 3FT3B 4PJAA 4FADA 1HNGA 2EACA 2E59A 3PGCB 4YIQB 5ENWB 4HLZH 3KPOA 1KCUL 3F6LA 3UCRA 1L0PA 5IESH 1I8LA 4FFYL 4L8CB 2W0KA 2NRDA 2ZWZA 3NFSH 4MHHG 4PGCB 4JRXD 3IAQA 4ORGA 2ODHA 3O4OC 1I3UA 5SV3A 3EO9L 4CC1A 1HHGB 3CQPA 1ES0A 5D7SL 3VXOB 1LHZA 1LO0L 1TQCB 2CDGA 2OMZA 4U1IA 5EF3A 2QPEB 1YNKH 1PGRB 5DMGC 4YVUA 5H8DA 2VMCA 4ZOEA 4PJ6A 5BW7C 3MRCB 4KKCD 3QRLA 4ZUVB 4XPFL 5I6OA 3VRIB 3MRQA 3OKMB 4HOMA 1YY9C 3WIHA 4A2MA 4A38A 3U4BL 4P2QA 2WVVB 5TGBA 6CGTA 1NGZA 5GGRA 3SKOB 4XNQB 5CHNA 3T0ED 3O2DH 4XH2A 4ZX6A 3VXSB 1ZCRA 5IUSA 2K7QA 3V4LA 5FCUH 2VOTA 1ZWIB 4GG6E 1ILSA 5KG9B 4G80A 1ZT1B 1QLEL 1PD0A 2QPDB 3SE3A 1SJHA 1KZYA 3JYBA 2NY1D 4MCZA 4PJ9A 4LCCC 4G8GA 2I85A 4PRIE 4AYBA 3RDTA 5IF0A 5F0JB 4ATWA 3A47A 5B8CB 3ABGA 2HG5A 3GBNH 1G7HA 4LHUA 1KB5L 1S5IL 4OZIB 1CVSC 2RA1A 5F89B 5AB1A 1NEZA 2AQQA 3MLUH 3L1GA 2H2SC 4KRPD 4R3SA 4X6DF 3DK2A 4X6BB 3BT0A 4DP2X 4Z3TA 3O6ML 5AZEL 2DQMA 2O6EA 3W0WB 1JCKA 3D3VA 5FK9A 1ZDQA 2OXHA 1PIFA 4F7MB 1U2HA 3WNLA 1G9NL 4DGYH 2WXMA 3FQWB 1B6UA 1MCPL 4YZFE 2XN2A 3HZVA 4EJ1C 4N2HA 1FL6B 1L0YA 2A77H 2XG4A 1HYSC 2A9ML 2P5EA 3D18A 2C3VA 3VSUA 3KPRB 1LXMA 2X4PA 1FCCA 1SY6H 1HEJC 4IOSD 4BQ9A 4BQBA 4A6YA 4PB0L 1EANA 1LM8V 2BCKA 1M53A 4N2MA 3A4DA 4WNQA 1RZ8A 2ICEA 4QYAA 3NFPB 1EK3A 5KSBB 4JKKA 3B9DA 3AT8A 4HS8H 2BOBB 4NPKA 5J1SC 1ORQB 3RPIB 4DVBA 3IU3B 3VXSE 3MLVH 3GIVA 2GY5A 7CGTA 4IEFB 2HLAA 4HWEL 3UTTA 3NAAH 2BNUA 2YRLA 4KKAC 4QHKI 2WLKA 4F5CA 4LVHC 1AS7A 1T1WA 5MEQB 2Q3AA 1K5WA 4P5MB 2AZAA 1U3ZA 4J4PA 4PJIB 8FABA 3R06A 4FABL 5DYOB 5L88L 3ILPB 4OZIE 1J1OL 2OJZH 4M61A 2ISDA 2J88L 3ZTJG 4DESA 4RAUA 4F91B 1SQ2N 5HY9B 5EBMB 2CHDA 1V3LA 5A2JH 3GB7A 4QRTA 1R5WA 4KTDH 4PY7B 5DUMH 3AC0A 3W0WE 5JIMA 3MRNA 5AW4B 2IH3A 2ZT9C 4BEIA 3N43F 4R96A 5TK2A 2DPKA 2IEPA 3MOAL 4OUOA 4QRRB 3QRGL 4G7QB 4NI3A 5GRWA 3H3KA 1BQLL 4P46C 1YN6B 4AVIA 2BOCA 2NY4B 3IMTA 1NCAL 3N3EA 1T1YA 2Q6WA 5TE6H 4U1JA 1EA9C 4NN6C 4XNZC 2B0SL 5GGSY 5ABAA 4B0MB 3KPRE 2G9HB 3FTYA 5IQ7H 4OZFB 3LPWA 1JAEA 1TVBA 2A4CA 1MREL 5I1IH 1OW0C 4I3RL 2C7FA 5KSBE 2GAZB 1SN5A 5H2BB 3LAFA 2QGEA 4G7YH 2OXGA 4NM4H 3D6GA 3QE5A 4X6FB 5ALBH 5BVJB 5C92A 4F7EA 1GY1A 4OM1H 4L29B 2VLKD 2CGRH 4JFEB 3C6LD 4BXSV 4ECNA 1I8MB 4OBRA 4GEJA 5GGVY 3LS5L 3FQNB 4PJIE 2O1AA 1XH0A 4JHVA 1RUKH 4G7VH 2VXQH 1OLZA 3L1OL 4XBMA 2VZ3A 1XCTA 4P4RA 4RMBA 4ODUB 2DN7A 4XBGB 3PWUA 2G2NA 2Q2EB 3DBSA 4RGNC 1WCBB 2BRRH 1BEXA 2CDEA 4NZFA 1MPAL 2FAUA 4YBHA 5JR1H 4QRRE 4Q2ZB 5ISZD 1LL1A 4M43H 2ZSWB 1CR9H 3BHBB 4U4BA 5IBUB 4X6CB 2WZ5A 1MIEH 3RZCA 3SGDI 2DLEA 1FORH 4DN4H 1RFDL 2COVD 5IB4A 4HOWA 4R26L 4XNXL 1E30A 5DDHA 3WU1A 5ADPH 1VESA 4NO2B 3H9YA 2H3NB 1HXMB 1HWGB 5AAWA 3WTTA 4BFIA 2VW4A 1WZ1H 2H6PA 3MTXA 5DHVH 3BD5A 4P46B 3S34L 3S37H 3QUXA 5E6YA 2O6FA 4I9XA 3MRBB 4MMXB 3DVGA 1JD7A 2EINB 1MCIA 2AC0A 2YUWA 1MWAL 4Z95H 1I7RA 4JFEE 3RY6A 4JDZA 3SDDB 1BP3B 2ZCHL 1CF1A 4PVLA 4NZUH 3T9WA 4JFHE 1KCLA 2WXKA 4KVNL 4TTDC 2H3XC 5B1CA 2X05A 3ZDWA 1J5DA 1R5IA 1O9VA 1WAAA 2VSDA 3V4PB 3L2NA 3K2UH 5E08L 2X2YA 1CE6A 4LHJB 4HHAB 3WSQL 1KJ2B 1TMCB 2VR4A 4GP4B 4ZUSB 2P9RA 1M2VA 3LHPH 4N2DA 4IJ3C 4K3EH 4Y4HC 5DJ8B 3ZO0A 3I9GL 1R46A 5D55A 1IGJA 1AC6A 3EGDB 5CJ8A 5HYJB 2HMID 3N06B 1TZIA 4H5SB 4RSYA 4Y5XC 4K3DL 2A83A 2Y25A 1DDHA 1BFOA 4OLZH 4NAQA 4CA4A 2HFFA 4M7JL 2DQCH 5MEPA 4HKJB 3MUZ1 1IIIA 4X6CE 1E4XH 4Z18A 5C09A 2OYLA 2KMWA 2X4RB 4GW5A 4NO0D 5D96B 3VI3A 1CDUA 1E7UA 2JFCA 3L9RB 1FAIL 1NGYA 4RGNB 3HC0B 2OZ4A 3WL9A 4NC1C 2FHFA 1DUYB 5T3ZL 2C9QA 1EHLH 3S35X 1MCJA 2GITB 3EF7A 4I9WD 2R1YA 3P0GB 4L37A 1X5HA