1OAQH

Free conformation ab1 of the ige spe-7
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAVY CHAIN
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaqH00
3MLYL 4UILL 5FUCE 4BFGA 3GRWA 1AQKH 1OP9A 1X5YA 2N4IA 4HPOH 5IJKA 4TUOA 1UM6H 5DRWB 4P57A 1UXWB 3ARTA 5KN5A 3VFOB 3FQXB 1DP0A 4ZSOA 1MVFA 4HG4K 3OKLA 2ZOKA 1LK3H 1XIWC 1TNNA 1KB5B 5HYSA 4XT1C 5E2UL 2VIRB 4PREB 1CGTA 2B1HH 2D7OA 3MLXL 1U8IB 3MXWH 5B21A 3BD5A 5DQ9A 5C0BD 4ETQB 3UTQB 1E6OL 3BVNB 3ARWA 4IMLB 4EIGB 2JIXB 1KCSL 1A7QH 3MCG1 3D18B 4JZJC 1C5CL 1F6FB 1W72H 1TPXB 1LWRA 4FQ2H 2VXTH 1ACYH 2AV7B 1N5AA 3JVGC 2XZCH 4AYFA 3P9LB 2DKUA 1R3LA 4K3JL 3FO9B 1U6AL 2YUWA 3N1GC 4G9FB 3O6FD 1JNLH 2HKHH 3GSOA 5GRYA 5IMKA 2MJWA 1EJ6A 4I3SL 4A2MA 1LNUB 4P4KD 2PXYB 3FN9A 4N0FA 4OCRL 5F71A 4AQOA 2J8UA 3FB7B 1JWUA 3ZKMC 5CBAB 5CZVL 1QSFA 3KPLB 4UMGA 3U2SA 4LLUA 3TIEB 2DDQL 3C2SA 1YMME 1U8NB 4L9LC 3IDNA 5IIEB 2XFXB 3B6SA 3QZWG 1EGJL 1JN6A 3EYUL 3H6JA 4MJ5A 5CAYB 3KPMB 3JBG7 5BZDA 3MV8E 3QUYA 2WWMC 2BOCB 2DI7A 2A38A 3D25A 4QF1B 5DUPH 4FZ8L 1KJ2B 1KCRH 3LN5A 5DTFB 1A3RH 5C08A 1IZJA 4APQD 7FABH 5AUMA 2BVQA 4K23L 3AY4A 3D3VD 2EDHA 1KTDA 4Z7UA 4ZPVB 4QRRE 5DJYB 4ZFOA 1JTPA 1KPVB 1J0ZA 2WINB 1D5BA 5FCUH 5BRZE 3QH3B 4KXZH 3VXPA 1J8KA 3RWGA 3X13A 4XP9H 2YBRA 4ELMF 3IDGB 2AJZA 4RGMC 3RWJA 5ALCL 3PV7A 5EZLA 1ONQB 1H8NA 1EHXA 3SCMC 1QSEA 4WV1B 1W8OA 4EXKA 4D9LH 1NFDF 2VC2L 4LKCA 1KEGL 1IGMH 2ID5A 1KF9B 2CK0L 4FG6C 4XTRC 1KELH 4ZS6C 4PV8B 1QRNE 3WJJA 1VKXB 3C08H 4IRSA 1DQDL 3DVGB 2BC4B 3LQAH 4HS3B 4OSUH 5L2JB 1BGXH 3CC5A 2LVEA 3HI6L 1G9MC 4M1DL 3UAJD 5DEGA 4NN7C 3MLVH 2CGRL 1G7QB 2N56A 4BK5A 5C9JA 3PQYB 1OAUH 4RFEA 3UROR 2CPCA 5D7LE 1NC2A 4RGNB 4X5LA 3RWEA 5F7DA 4Y19E 4LFHG 2VAJA 2EDRA 1DEEA 2CIKB 4Y5YC 2IC2A 4WJ5B 5C0FA 4QXGL 2XZAH 4PRID 4POUB 5E00B 4BZYA 1A6VL 1G7LB 3OAUH 1GYAA 4KKBD 1TQBB 3GJFH 3R1GL 3SDDB 3TN0D 2ADIA 1P7KA 2DD8H 3SJVA 3VWJB 3KYMA 3ESVF 1D3CA 2HMIC 4OM1L 3O45A 5TJWK 1BVLA 3PABB 3V5KB 2AJ3A 4TUJB 2WUBL 2D4FA 4H26B 1EIBA 4XCNB 3QIBC 1CIUA 1FFQA 2F53D 2J6EA 5FGCB 5TE4L 1HOCA 4YBLC 5FYJU 2W60B 4PJ7B 1QBMH 2XY2A 1KLUB 5F7LB 5I74C 2HJKB 5D6DA 1FAIH 1WFTA 3F65A 5SV4A 3RUGB 5DJ8B 1TQCC 1MFEL 5E95B 1RURL 1CGWA 4NBYB 1A4JA 4YHZH 3HE6D 5KSUA 3RZCB 4YHIA 4DKEL 2FLRT 1OT2A 4KHXH 4ZPTB 3TPUB 1RZJL 1U58A 4KTYA 4OLWH 5I75B 2GJZB 5KS9A 5FAAA 2PYED 4KK6D 4PJ5B 5E08H 1CYGA 1N0XL 4M6ML 2W1NA 4PGDB 2CUMA 3SDXA 4BQ9A 4X8JA 3GDBA 3UTSD 3LRGA 4K9EH 4NQVB 1L7IL 4LKXA 3TJEH 4LHJB 3RGVD 3QIWA 3QUMH 1UXSB 1NGYB 3BZEB 1EEYA 1S9VB 3FQNB 1M7DB 5EULV 1WBZA 1HHGB 3CVHH 3WEXB 2HT4C 5DURB 3HRZA 5J11B 4CKVX 2F74A 2IANA 4PY8I 3OJDB 3TBVB 4ESKA 1F4HA 1KJMA 3ULVD 3G5XA 1CD8A 2CDFA 4Y4HB 2EH8L 3UYRL 3EOTL 5C0JA 3ZLQC 2H3NB 1FYTD 4M48L 2FIKA 5EU6D 3T08A 5HJ3B 1CBVH 5EG6C 5DI8B 1I7UB 1PAMA 5D7IB 5IBUB 3IAGC 1MELA 3PP4H 4OJFL 3SN6N 4HGWB 3F7QA 2KUTA 4C56A 3T2QA 1CGSL 5HHME 4PRAA 2BNRE 3HAEH 1HNFA 1S7UB 4WI5A 3I6KA 1U2CA 2P5WD 2FR4B 2YPKB 1JPGB 5F1NB 3QNYB 2PTUA 1NUDA 4DQOH 4L4JA 4DZBB 4R3SB 1FE8H 4JRXD 1INEL 4NQXA 1IT9H 3B4NA 3Q5YA 1F3JA 3RTQC 2YSSA 2PN5A 5IWLC 1F4WH 1GGUA 1RUPH 1IBGH 4X6DF 2NNAA 1S7QB 5B8CC 4PJXF 5E9DE 1CZ8L 1A21A 2GW5A 1NEZG 3D2UA 2H6PB 35C8H 1UB5B 5F9OH 4S0SD 1D9KC 1HSBA 3H3BC 1CXFA 1GAFH 1QBAA 4JCMA 1T7ZA 4O2EA 3VXME 3MPCA 1XEDA 3FQRB 3ARVA 4I2XA 4PGBA 4EBQL 5IESL 3N1QC 5EZOH 5E94B 4R4NC 4LLYB 3SE3C 1X5AA 1R5IB 2AABL 3NFPA 5LG1A 4Q0XH 4XAWH 4YFEA 3OZ9L 1YECH 1U8QB 2UY6A 4H8WH 3P4OA 4F33B 5EBLB 2OXGA 1BJMA 3O41A 1JP5A 1U8JB 4F7MA 3P4MA 5JHDB 2FD6H 2HH0H 1JVKA 4PG9B 3IU4L 1XF2B 2EXYD 3CFEA 4NFDA 2J3SA 1I3VA 4XVJH 4QGTA 1LO5B 4HC1H 3LQZA 1OSPH 3NCCB 4JPIA 4JO3L 5FKAB 3VD9A 5A2FA 2J4WL 4BZ1L 3HTLX 2NY4D 5DD6B 2Y23A 3KPSB 2IEPA 4GG8A 2I26N 1TPXC 1FRGH 1A7BA 2BSED 5FKPA 1I1CA 2J8UF 5FO8A 1XCQB 4HIXH 3OKYA 1GJIA 2IQ9L 1F4YH 4R7NA 3SY0A 5KVFH 1G9EA 4PJGA 5ERWA 3WUWB 5E8OA 4ZXBA 1DUZA 1RJCA 1B2WL 4XP1H 4HWBH 1DQML 2YPLB 4AEHH 2YD9A 1BZ7B 3HLAB 4Z7WE 4F7PB 1NMCC 3QPQD 4M5ZH 3FN0H 5F1KC 2I9LB 3QI9B 2PR4L 1LP9E 3MNWA 2PXYC 43C9B 1D6VH 5SX4I 5MENA 4J3OC 3L3DA 2GITB 1OB1B 3ZE0E 4JZNB 2D03H 3FOMB 3VXNA 5LAXB 1TNMA 3GMNB 4K94C 4CVZA 1CLYL 5EOCL 4L3EB 5DHYB 2YRPA 5FO7B 2DQHH 4Z7UF 4HKBA 5HTSA 3ULUC 2Q8BH 2Q20A 4TSBH 1UQSA 5D71L 2Y7QB 4LCIL 2QSTA 3MRHB 4WO4D 5E2UH 4MXQC 3EFDL 4LLQB 2HLAA 3GI9L 2P7TB 4D9QD 2H32A 4ODVL 1U3HC 1A1MA 3OAZH 1EAPA 5DUBB 4Z0BL 4HD9A 1E6OH 5FA4A 1GXEA 4GKZA 1KCSH 1R6VA 2ZUVA 4EZMA 5AAWA 2YC1A 4DCQB 5HVWA 4GO6B 1CGXA 1FVEA 1FL5B 1EBAA 4P2OA 1XR9B 2L4OA 3P30H 2HFEA 5C0GB 5HI4C 1SJHA 3B2UC 5E6IB 4H1LA 2BNQB 3CFKA 5J1AB 1ORQB 3ULVH 1KPUB 4WV1C 1V5JA 2VE6B 5CS7A 2X6MA 5GZOD 5D1ZD 1WAAE 3LCYA 3R0NA 4OCRH 5IFHL 1V05A 3C8DA 3QHFL 4BH7B 4XCCL 2XQBH 1K85A 4HWZB 4PJ8A 5CZVH 4AJ0A 1EFXB 4OUUB 4HKXA 4HW6A 3L9RB 2DDQH 1WCQA 5AZ2L 4MD4B 5ISZA 2JKXA 4G6FB 2FECL 2WSKA 3IFLL 4NQCB 5DRNA 1JHKH 1CF8L 3O3BA 5C09E 1FO0L 2F8VA 4D9RD 3E6HB 3WIFA 1U8OA 1EGJH 1U3JA 4RGNC 5KANI 3QO1B 5KG9B 4NHCH 1MIEL 5JA8B 4JDZA 5HYJE 3PGCA 4HFUH 1CG9A 3MA7B 1ES0A 2EDNA 5C2UB 2WLZA 4MLIA 2X9WA 4BELD 2ESVB 3I75B 4NRZA 1Q0XL 5I19H 2BVPB 1RZKC 3SDDC 1DQQA 5BW7C 5CCKH 4MNHA 3U0PB 3VWJC 4LVNB 4L29B 3H42L 5J56B 2ED9A 3RVUD 4H88L 3DX7A 3C5ZA 4JPWL 5C0CB 3RIFF 1P7QB 2ICCA 4FTVB 5H37H 2FBJH 5GHWL 2F19H 5DHVA 5IHLB 4KRPC 2DQDL 1P6FA 3S3PA 2EC8A 4JQXC 4O2CA 5ALCH 5KS9F 1HEZA 3R06A 2JB5L 2VC2H 4JFPA 4MDJB 3SDXF 1KEGH 5I1AB 3OKDB 3BP7A 4U6TA 2CK0H 5F88B 1CGVA 3HUJA 2FECI 5IR1A 1AGDA 1K3ZA 2HTKC 1XGRB 5ENWB 3FFCE 3FQWB 3RZCC 2BSSA 3T0EB 5DRXB 3HI6H 4M1DH 3D48R 4Y1AA 2CGRH 3ROLA 5I75C 4ZAKD 1MCPH 1PKOA 2YN3A 4FQQB 4NNXA 3WIHA 5BMFL 3SKNB 3EBAA 4JDVB 1BBDL 3WLBA 3FAWA 3QEQE 2NXZB 1FVCB 3T0DA 4PJCB 4ZUVB 2MQ3A 2X4OA 1M71B 4FMKA 5FGBC 5B38B 1UACL 2VLLA 1S7RB 2V2WB 3D85B 3RWIA 4AIOA 3R1GH 2EDJA 1CL7H 1I8KA 1OAZL 2FX7L 5J11C 3HG1E 5IQ9A 3W11D 4WFHD 3BEVA 1MJ8L 3FQTB 1FIGL 2WUBH 2PW1A 4J23A 4Y4HC 1AQDA 2M1KA 3DI2B 2ORBH 3BKCL 2GCYA 4XGZB 5DVOA 2F8OA 1VENA 5HY9B 3B2VH 4KY1L 3HPLA 4F7TB 3VXOA 5B3JF 5LQBL 5FECB 2Z93B 3KLHC 5C9KA 2AXFB 3ARGA 5E5RB 5EIVA 1PLGL 2FJFB 3DMMB 1HHHA 5JNYB 2EKSA 1S5HA 5DS8A 1U42A 1MFEH 3UEZA 1RURH 4NQED 1BZQK 5SWSA 1BX2A 1JGLH 4G6KH 3ULSB 3BGAA 3T65B 1A9BB 4DKEH 5H94B 3VRJB 4P3CH 4PLKD 2RAMA 4F8QA 5JR1H 3MLTA 4XWGH 4V2CB 3BXNB 3H7BB 1KLGA 4JG1L 3RNQA 3QRGH 3THMH 3KLSA 3V5DA 4OFPA 3TT1H 5IB1A 4BQ8A 2QBWA 1IGYB 3MGOB 4FABL 4JO4H 4EIZC 3BP4B 3AGVA 1CR9L 4AEIL 4HDIB 4KHTL 3L5XL 1UKTA 4DKFL 2Z8SA 3QQNA 1VPOL 3BAEH 2OXHA 4L4VA 1BBJA 3DUUB 3RL2B 4LSDA 1C12B 2DQFA 2EDFA 4AK1A 4NHUA 4KDVA 5HHOB 5KSBA 3JV6B 1VFOA 1NEUA 1WSST 3VFNB 5F8RC 3M17B 3UYRH 2R0KH 4M00A 1RJZB 1PX4A 5CEXA 3EOTH 5F44A 3TGXA 3IJHA 3HC3H 4NKMA 4WDIA 1ZS8B 1A02N 4D9RE 2HTLC 1JK8B 3UTZA 4IHOB 2D9QB 4W6WB 5KZCB 3D39B 5H2BA 1Q0YH 1HHIA 4OJFH 1AC0A 5EBMB 1BPVA 3GGWA 4KJQC 1J0JA 4PJGF 4Z7VA 4UNTA 3U7YL 4XVUD 3WJJC 3T3ME 4IRSC 1HH6A 1TZHA 4P5TB 4YEEA 1YUHB 4DJMA 3BPLB 4OAWB 1J86A 2VLRD 4UINL 1WISA 5T3XL 1MFNA 4YDLB 1P84K 1UA6L 2BCKA 1N59A 4K3EL 5EUKA 1CIDA 2GK0A 3GMMB 1WWCA 4WFED 3IS1X 1CZ8H 2CH8A 4PGCB 3LMJL 3V0VA 3PQYD 4XVSH 3HR5A 3KLAB 3OXSB 1KG0A 3QI9C 5IESH 5ITFA 5INCA 4GMTL 5CJBA 1DBML 4MSWB 5FHBL 3A6CL 4Y5XB 2AABH 5I73B 4RA0C 3LRHA 3EHBC 4RISL 3EYOB 3MUZ1 3STZB 5SX4H 4X98A 3CLEH 1BFOA 5ACMA 1BAFL 1RIVH 2JK5B 3G5VB 3PV6A 5A2LH 1CI5A 1PZUB 1LD9A 3PJSA 2OTWB 4JO3H 5JQ6L 1WFUA 4BZ1H 3BZ4A 5ETUA 3L3JA 3QJHA 3A0OA 5DA0B 1WF5A 2M2DA 4FQ1L 5BCAA 4RMRA 4WFHE 3VXUA 4H5SB 1FNLA 3QIUB 2UZIL 2JE8A 2R0ZH 1JV5A 2IQ9H 2FWOA 4POZD 3AU1A 2D7MA 3WFZA 1I3RB 1B2WH 2F54A 1DQMH 1ZAGA 5E6IC 2DQTH 4NO0A 3KPTA 1RU9L 3I6GB 1RZ8B 2PR4H 1Z5LA 5EPMA 2EH7L 2YD5A 3FMGL 1J10A 4B50A 1Q9WB 3GSQB 2EIBA 1BIHA 2UZXB 4OCWL 4ERSL 2Q8AL 3CIQA 4G9FE 5EOCH 1MQKL 3U9UB 4EQ3A 3IFPB 1S7WB 1QLRB 4LCIH 3VGDA 1DLHA 4R96B 3F7VB 2X4UB 1AD9A 1KB9J 1VFAA 1OP3K 1P53A 3EFDH 4PY8J 1DBJL 3MGTB 3GI9H 4I18B 1HDMA 4PS4H 3STLB 3MV9B 4ODVH 4PJIA 3EYFB 2VISB 4Z0BH 1S9WB 1MF2L 2ED8A 3D0VB 5D7JA 1PYWA 2EO9A 1KIPB 3KPPA 4FXKB 1RUAL 4LVNC 5CZXD 2HJLB 3E2HB 3HUJF 4AL8L 4KMTL 4OGAD 4KJPC 1CICA 4WHCA 5ABDE 4AIZB 5C8JB 4D94A 2A2QT 3ZKSD 5IK3B 3ZKNC 3CZFB 4WIQA 3RKPA 3T2NL 2DM2A 1FC1A 4WEBL 1MCLA 4HUNB 1NANI 2IBZY 3NZ8B 4NC1C 5IFHH 3LKRA 2A83A 3IFNH 3TEUA 3QDJB 1XAUA 1AO7A 5MEQA 5IMMA 3EJYC 2XNAA 1A6ZA 2YD2A 2VDML 5IVXF 1CF8H 1CWVA 4JVUA 4MJ6B 1FO0H 3KYNB 3RWCA 5FB8A 1RY7B 1UG9A 4PB0H 3PGFL 1EO8H 3WFDL 4XXDB 1CE1L 2VRAA 2NXZC 6FABL 3ARDA 4XNMB 1MWAL 4CU6A 1YEJL 4KK5D 4F3FA 3IXTA 5I76B 4ZUSB 3MRRB 2VTFA 4YHPA 7CGTA 5CZKA 4FXGA 5HD8D 3BRFA 1D5IL 3VRLF 4L4TD 3T77B 1Q0XH 3AMLA 1FG9C 3T1WA 3PQYE 5GJTL 5D2LF 4WUKL 3H42H 3LPGA 3EO9L 5EU4B 4RGNE 5M95B 1WBYB 2B4CC 1QYGL 3DRQB 4GRLD 5HHNA 4YJZL 4BSWA 4HG4J 2Y5TA 3KGRA 3V4PL 2E7LC 3HE7A 3VG0L 4P23D 1QRKA 5GHWH 5GGQL 1R3HB 5D1XA 3BZFA 1WEJL 2DQDH 4HSQA 2NQCA 3U4EA 5DVLA 2K1MA 5HGHA 4ZXBC 1MFBL 1VERA 2JB5H 2VWEC 4CBPA 5DVMA 3BKYH 1YEDB 2PTTB 1YQVH 5DGRA 3IJYB 4PJHB 3DMMC 1CFNB 4ZO8A 1OD7A 3WL9A 3E6FA 1P9MC 4U2YA 1I7ZA 5C0NC 1QO3B 1QOKA 3DSFL 3VFWA 3PWPA 2I9TA 3LKNA 1CQYA 2AJSH 2WANA 5JDJA 5FGCE 5F3BA 4XRCA 3RDTB 5JPNB 3O0RL 5T1KA 1LILA 4LEXL 5D7SL 4Z78B 4PJ7E 4NO5B 5CBEA 2IPTH 1BBDH 3MRCB 1J0IA 2IADA 3SKOB 4PP2B 4XAKD 4NQDD 5E03A 1KEML 3RUGE 4XWOC 4JQVC 2AW2A 1T83A 4P5KB 3GIVB 4NQSB 2FRGP 1W2KT 1ZT1B 1B3JA 1OAZH 1E27B 2FX7H 4GKNA 4NQUA 4HHAA 4OLVL 1U95B 1NJ9B 2O5YH 4PJ5E 1BZ9B 2Y4SA 3BKJL 2FB4H 1MJ8H 3WUZA 2Y06L 3HFML 2ZJSL 1N64L 4UBDC 4K7PL 1J7VR 5BVJB 2OR7A 4QNPE 3RY6C 4LARL 2J12B 5E1HB 5T5FH 4LLMA 1L9NA 3L3HB 4KY1H 4DGYL 1M7IB 5LQBH 4PJFF 1KCUL 1ETZB 2O61A 1PLGH 4LU5L 4QRPA 2BNUB 3V79C 4XCYB 1I3GH 3VFTA 5IMOA 1PQZA 1L0YA 3GSVA 2AV1B 2P43B 5CUSL 4P5TC 5C6PB 1IAKA 5CSZA 1IFHL 3VW3L 3BH8B 4LCUA 5EDXA 5DMKA 3KPQA 5D7IE 2GAZA 2C7UA 1DSFH 2D31A 5DJ2B 3BGFB 4YDLC 4FABH 1EFXD 4JAMB 1U8LB 4E0RA 1CR9H 2OJEB 4D3CL 4KHTH 1NAMH 2XRAH 4JM2B 4WUUD 5EOCJ 3L5XH 2IG2L 1HILA 3F58L 3FT2A 3CD4A 4LMQE 4NM4L 4JPKL 4DKFH 4UT7H 3VFUB 1MEXH 2PW2B 5EU5B 5K9QI 3PDOB 5AG8A 4LLWB 5KVMC 4OGXL 4PRHB 1SY6A 1A6PA 2E6PA 4KJWC 3WHE1 3U7WL 1K6QH 1TZIB 5J9PB 4Y5XC 5I73C 1DN0B 3DUSB 5C0EB 1GOFA 1NBYA 3VD3A 1CFTB 1BOGB 1FH5L 1IVLA 3AAZA 1Y6MR 5JOFB 5E6YA 4DTGL 2DQUH 5IV2B 1AGEB 4Y2DD 4XI5C 2FLBT 2PCPB 4BFIA 2HJFA 4QOKB 5CP7A 3X14A 4U1HB 5ADPH 1MAJA 4EOWL 2FO4B 3VI3E 4Z77B 4EI6B 2R0WL 4RNRA 1X5JA 2H26A 4WU5A 1ZWIB 1RZ7H 1I8IB 3C60B 4F2MA 4YXHL 1OHQA 4L4TE 4V1DD 2QR0B 2WBJA 2P5EB 4PUBL 5JHDE 3DXAD 2HG5A 2QSVA 4PBXA 3QIUC 4G8IB 4L5FL 5CINL 3WN5B 2P8MB 3I02B 1CDIA 3LPWA 4U6XA 4OF5A 4KMQA 2P44B 4QHUB 3T0ED 3LMJH 5IOPA 1MY5A 4OLUL 3X17A 3LN9A 1BVZA 3KPSE 5I1LB 4P9ML 1Q8MA 3EUUA 1W8NA 4IJ3B 5EBWB 3K4ZA 2I07B 4CN4A 5FHBH 5I1JL 1ITBB 3A6CH 3QEGL 4KI5C 1I1RA 1Q9LA 2JLLA 3JV0A 1OT1A 4BH8B 2R1XA 3ZO0A 5D72H 4RISH 1EUUA 5LGKA 4NRXB 2BRRL 4OF6A 3U36B 2W0FB 1HNGA 4MAYA 4PPTA 5J0BA 4ISVA 5F97E 1T21B 4BUHA 1T2JA 2Z91A 4ELMB 2YPLE 2Q3AA 4I48A 1FGVH 4S2SB 1T3FB 2E9JA 2NX5D 1BAFH 1AFVH 1NFDB 4PTUB 2QKIA 1SJVA 3LKQB 1UB6A 3BKMH 3OGCB 2Y07H 3HZKB 3MJ9L 3DRTB 4I18C 5JQ6H 3NGBB 3FFDA 3WE6A 3QFJB 1ZEAH 1O7VA 4D8PB 3VD4A 4L3EE 3O9WD 5C6TH 3O2VL 4HLZH 4JY4A 5HI5D 3E2HC 1NC4B 4X5XA 4ZTPL 4KZDL 4YR6A 3DIFA 4HK3N 3WFBL 4G8EB 2BOBB 1T1WB 3QDGD 4LVHB 4ACPA 5CIPH 2CR3A 2F58H 3BP5B 5IJVA 1P2CB 3VJ6A 3J8F7 1YN6B 1CLZL 1MFAH 4M9OA 1AD0B 4P46A 1H15A 1X5KA 1RU9H 4QHNA 5A16A 4OZIA 2NY6D 1IM3B 5HYQA 1AC6A 4PG2A 3LV3A 5EO9B 4Y4FA 3C8KA 3DROA 4MYWB 4JFFB 5DJ0B 3FMGH 3HZYA 4NZRL 2AJYL 4Y4KC 2CRMA 1NANH 1NMAL 4QHMA 2QLVB 4G42A 1URLA 4KTDH 2Q8AH 2QHRL 2NY3D 1A7OL 4QT5B 1HXMB 5LWYL 1E4XL 4JFDA 1MQKH 3V6OC 1FFRA 1Z3GL 1A7RH 2UV3A 5I66A 3SGKA 5KVGL 4I13B 1IEBA 1Z9LA 2XKNA 4G7YL 3I6LD 1KLFA 3UZQA 2VAAB 2RIKA 4PJ9B 2ADGA 3PHQA 1X6NA 4TPRH 3IU3A 1SEBB 1E4WL 4NKQB 1A7PL 3KWWB 4FMFA 4U6HA 4XC1L 4NQCE 4XHQA 5FYKL 1N3NA 3TT3L 5C92A 3HZVB 2BMKB 3KPRA 5L9DL 4N8CL 3MACL 5GSVA 2NYYC 3QWOB 2DWDB 4LCWB 1H3WM 4ODXB 5BV7B 1TCMA 4OKDA 2PNDA 3PWJB 4JDTL 3C9NA 3T2NH 2X41A 2ESVE 1OVZA 2R56L 3WXVL 4CN1A 4IOFD 4HJ0C 1P69B 1B0GB 2GFBB 3HC0A 5ADOL 2ZUXA 2LABA 5ID1A 2YUXA 3LPFA 3MJ8B 1E4XI 4LHUB 3RVXD 2DQJL 4JFXB 3KHOA 4ODUA 2XICA 1TVHB 2QTEA 4FTVE 2NY1B 2WP3O 1ZLSL 1I1YA 1JGDA 2NCMA 1G9ML 1NPUA 4HK3J 2NW2B 2HA1A 2MOVA 3WFDH 5I18L 4XZUA 4MMZC 1KC5L 2OQJA 2VR5A 6FABH 3WNOA 1DVFD 3H9SD 4NC1E 1TLKA 3AS1A 3ZE1E 3P73A 1YEJH 4FZEL 2OS7A 1TIUA 2XA3A 1A2YA 3O11B 3MR9A 5EOQL 3T0EE 1KJVB 1NGWA 2VDNL 3QXVA 2DIJA 4DK3A 5T3ZD 4MS8C 5ID0B 3MXVL 2VR9A 2PO6A 4S10A 2V5TA 5GJTH 4OB5L 2EDOA 3PHOA 4JB9L 5JTWA 4R90H 1QEWB 1OY3B 5KBNC 4J3TA 3L7FB 4B7IA 3V4PH 4PJCE 1QFOA 4GAGL 4P4RB 5GGQH 3RKDD 3S35H 4X6DB 2VDOH 1P1ZB 3OKMA 4UIMB 5F7WC 3T1FB 4PJXB 1D6EA 4KUCF 1WIOA 2M8XA 4R4FL 2JJUA 2FJHB 1KULA 4KKNA 5T1LA 2G60H 2UVFA 5H35A 4LCYB 2E7BA 3O8XA 1A9EB 5ICXA 3EO0B 3V4VL 3DVNA 1ZHBA 3PWNB 4ONOA 2SEBB 4MA8L 1RAMA 5C70A 4KWUA 3DSFH 1IEHA 1DBAH 1T20B 4LEXH 4MLSA 4WY7L 3JSSA 5C86A 1FZMA 2X1XR 3RWFA 3NTCL 4GG6E 3TBTB 1QLFA 3ISWA 3QDGE 3BGFC 1KEMH 1MHEA 4KTEL 3MRKA 4M7ZB 4JM2C 3QHZL 5DK2B 4Q9CA 1T7VA 3SE8H 4DZ8B 1CE6A 5INDB 1U93B 4EN3A 4RRPA 5E8EA 4OLVH 1A0QL 5I8OL 5I1KL 3BKJH 3GSUA 2E6QA 4OGYL 1B0RB 1NGPL 2Y06H 1CDJA 1FVDA 3H9YA 4WWKB 2CRIA 1QFUL 1IAOA 1LEKB 3MRQB 5SWZB 5FA3A 5TH2A 3K7UA 1I7TA 5B38G 2E7CA 2FL5A 4Q97A 5D2NA 4A6YB 1EXUA 2VLJA 1FFPA 1G7MB 3SDYL 4OCLC 4HULB 3OPZH 1L7TH 1KCUH 3QWRA 5JW4N 4LU5H 4PRPB 4YE4L 5MEOB 2VUYA 1YY9C 3NFSL 5C0DA 1AHWB 5HHOE 3CMOH 3IDYB 3LEYL 4HBCL 5ESQA 3ES6A 2VL5A 5MERA 2X4QA 2YUVA 4Y5VB 2V5YA 2I5YL 5AUMB 1RFDL 5CUSH 5C2BH 1ZTXL 1KNOB 4AEFA 2Z31D 1JTOA 3TBYA 1V8HA 5DZNA 2DOCA 3HZMA 1JPSL 3D39E 3WMSA 2AGJL 3WN5C 2RB8A 2H2SC 5IB5B 4FFVC 5FYKD 1ZGLM 1T89A 3OR6A 4D3CH 3F58H 4FQLL 3IVKB 3BRDA 1BQHA 4JPKH 4PRNB 5IVZA 1F11B 2BRQA 5K9JL 4OGXH 3B83A 4QRTB 4IJ3C 5I2IB 3KXFB 1G7PA 1TJHH 5KSAA 4OFYD 2NZ9C 3QR2A 2UUDK 2EZ0C 3O4LA 4GXVL 1QQDA 3O4OB 3AM8A 5IFJB 1WLHA 4ZUUA 3TF7C 1U8KA 2EDEA 3ARBA 3KVQA 4DTGH 3FZUD 2XN9A 1OGAB 4KUZH 3T09A 1GSMA 3JXAA 1A4KA 2AKRB 1ZHNB 1G0XA 4EOWH 1AGCA 3VH8B 4OZFH 3WFHA 3C6LA 1KB5L 4FFWC 1XR8A 5FIEA 1KT2B 1ZSDB 4LRNH 5EUOB 1UH4A 3UJJL 4QYOA 4LLDA 5T3ZE 1HH9A 5AWNL 4PUBH 4XBEL 4YGVA 1QVOB 2AXJA 3P77B 3E8UL 5FM4A 1CXKA 3HPJA 5ESAB 4PLJD 3FHQA 5CINH 4S1RL 4LVHC 1MFDL 4JM4H 1H0DB 3S96B 1HQ4A 3CGTA 5T5NG 1BVKB 3VE0B 4OZHA 2EE9A 4HZLA 3RDTD 2Y1VA 2IH3B 5DRZA 3UO1L 1DUYB 1MRFL 2BVTA 3NIGE 5F8QC 4KQ3L 1GHFL 4P9MH 3UTTA 4CVXB 3GSNB 5I1JH 5TDPA 3R8QA 1EFQA 3L6FA 4CMHB 4JO2L 3RAJL 4U1NA 1ZVYA 3RVTD 5KSUB 4LSRH 3ARPA 4ZNEA 1LK2A 1ZLWK 4ELKB 4J1UB 3LKSB 4NZJA 1Z6JT 1EVTC 4Y16A 3VCLB 5E7FA 3SDXB 3ETBF 5IBLC 5EIIA 3ULUL 1NCTA 3PWLB 5JORA 1VACB 1F42A 5IKCB 4RZCA 3ARYA 2KQNA 3SHSA 1P4BL 4X6CA 3WHXA 4YFLI 2VLKD 3T0WA 3UBXI 2VZSA 4XB8A 3VGHA 4MQSB 1NL0L 4S1DC 3O2VH 1KCKA 3RHWK 4TQEH 4QXTB 2W65B 3VWKA 1J05A 3DX8A 1JPFA 4M61A 4KZDH 2HVKB 4WI6A 3Q6FA 2O5ZL 4R8WL 4IBLT 2HT4D 3UXFA 3MV9E 4J4PA 3MLRL 5BV7C 2OL3A 2Z4QB 1WBXA 3QDMD 4X5WB 4F57H 4K8RC 2OCFD 3GIZH 4PJBA 4XNXL 4LCCB 4XNYL 4U1JA 2AJYH 2VYRE 4PGZA 2EYTA 3E3QC 3VXSA 2L7UA 1XGTB 2QHRH 4GW4B 2NY1C 5BS0B 4F15B 1I7RA 2X40A 3ZKXB 5LWYH 1P84J 4LGPB 3NIDF 1DANT 4LAJH 1JYWA 2MHAB 3T8XA 1Z3GH 2JF1A 2X4NB 5BOPA 4ZFFA 4PRHD 5C3LD 4JFEB 1MH5A 2EEDA 5L2KD 3GZKA 4LASH 5DSCB 3HNTL 1BD2A 3QDJE 3SE4A 3VA6A 4FQXB 1YPZB 2GTZB 1E4WH 4TVSa 1A7PH 4XC1H 5GGVL 2LFGA 3QXAA 4YO0A 5FYKH 5BO1L 3SQBA 3DX9A 3TT3H 3FB6B 3UZVB 5L9DH 5EOTA 4P5MA 3BDXA 1XZ0B 4EI5A 1RZKL 4FP8L 3MUGA 1YMHA 1TFHA 2Z0BA 3BPOB 3ILPA 2KPNA 1JI2A 2PKDA 3NFPB 4ZOCA 2WWKO 1K9TA 3FO1B 5F1IB 2K9UA 1J18A 4EXPX 4JDTH 3C60D 4JO1H 1LE5A 4OI8A 3WXVH 2R56H 5ANME 5E2VL 4KROB 5ADOH 4PJEF 4JANA 2DWEB 3CFEB 2VKWA 5JXEC 5JIHA 3CFDA 2X4SB 4KC3B 1BHGA 1TITA 2DQJH 3HB3C 3P11L 4ZOBA 4UIKH 3ARFA 4LQ1A 2DB8A 1CGYA 3CFBB 2VQTA 3DTXA 4KDWA 5A3ID 1RUQL 2OZ4L 1MI5A 4K7PY 4JFOA 3S5LA 5JIPA 5GGTL 25C8H 1ZA3A 4YXLL 3QUXA 3GRWL 4XCFL 5GS0D 5I18H 3EYQC 4PJHE 3MRIA 1WUNT 5C6WH 2AK1L 1MCRA 4LF3A 3QQ9D 3VFPB 3BDYH 5E8OB 4OV5A 2VDQL 2P47B 4M7ZC 4JRYB 4NSKB 4U7MA 2VDNH 1UWEL 3GFUA 3MXVH 4MJIA 2XPGB 2GUOB 4ZUTB 1HXYA 3FTGA 4JB9H 4G8FA 5TF1H 1MCEA 4GAJL 4WWKC 3ARSA 4GAGH 4OD3H 4YBQD 3FB5B 2EIZA 3FRPA 4RAUB 2Q86A 1CFQB 2HT3C 1OD9A 3TZVD 2R9HD 1KN2H 3GO1H 4R4FH 1DE4B 2ICEA 1IE5A 4P2QB 1UQSB 4MXWH 5EORL 4GW1B 4OTXL 4QKXB 3REWA 4XBGA 4R6UA 3EO1A 1MHPL 5E1AB 4MHHG 1AHWC 5GGSB 4MA8H 4PG2C 1QD0A 3IDYC 4Y4FC 3DGCR 4UU9B 4HXAL 4Y5VC 4OIIL 4L8DA 3VFVB 3ILQC 3K1DA 3W39A 4Y8AA 4OIAA 4GQ9L 1ZLUK 3JTTB 4YQXH 5D1QB 2GJ6D 2QADB 3NTCH 3RQ3A 4JFFD 4EUPA 3TLRA 3SGKC 1W0VA 1H5BB 4KTEH 3WD5L 3SDCD 4LQFH 3GSRA 2IFGA 4D0DA 4GMSH 3GM8A 5I30H 2FSEA 4PV9A 1N2RB 5I1KH 4WW1B 5E8DH 3IYLW 4OGYH 4DGVH 1NGPH 2A77H 1SEQL 1I8MB 4XBPB 1QFUH 5T33L 2WBKA 5HI4D 2AK4A 4P2RA 5I1IL 1ZT4B 1QR1B 4MQXC 4PJ9D 4JLRA 1U8HB 4ZFOL 3O4OC 2DKSA 4OT1H 4RIRB 3MJ6A 1ZANL 4BKLA 1IC4H 3SDYH 3SGEI 4LAQH 2ED7A 4O2FA 3QUZA 5DGQA 4XMKL 4PRHE 5B22A 3T2PA 4RWYH 3QNZB 3LH2L 4YE4H 4MD5B 4O02L 1ZHLB 3NFSH 4PLNC 4QXWA 2PF6A 1NCBL 4HBCH 5KAQF 4LCWD 5IFAL 1RVFL 4G8GB 4OZHF 3WLWD 1FAKT 3D0LA 4NWUH 4LLVA 4E41D 4U1GB 3PNWA 5I8EA 1ZTXH 3RI5K 2DKMA 2P42B 3LRSB 4IRZL 4OKVA 4ONFL 1X5XA 2DYPB 4QOKE 3RWDA 1JPSH 3MBEA 4U3XA 2AGJH 1HWGB 1GC1L 5IBTL 3ZYIA 3OKKB 2ZG1A 1T66D 1Q94B 5A2KH 3BW9B 3KJ4B 4ODWB 1JZ6A 4O2CB 4Z8FH 1S78C 1ADQL 3WSQL 1IC7L 2WQ8A 3K4AA 3CX2A 3L3KB 1UJ3B 4I0PA 4XHJD 4ZQKB 1E6JL 1NCDL 5DWUL 3TVMA 3OR7B 5BVPL 1IL1B 2EYSA 4KJYA 4CMHC 3A67L 1KGCE 3O3EA 3SBWC 3PL6D 1ZA6B 5K9KA 1J12A 4G43B 4X6CF 2YKLL 1PZ5A 4Y1AB 5GS1C 2D7TL 4PJAF 5BJTA 4IRJA 5HSFA 1FJ1A 4RAVB 1YJDC 2IBZX 3SDAB 2HN7A 4KQ4H 1WFNA 2B0SL 2X5PA 3WV0A 4L8SB 1OP5H 1CDCA 4HIEA 3JTSB 2CKBH 2BERA 3S36L 1D5XB 5GS0H 5LKNA 5DFVD 4I9WE 4LSVH 4KKCD 5IVXB 2C3GA 4M8QA 3UJJH 4GRWF 3MUJA 4MB5A 2ARJQ 4HCRL 4ELME 3QULA 1UVQA 5TE6L 5D6CA 3OF6A 4OF3A 3GBML 4NYLB 3SKMA 3PDDA 3HN3A 4PJBF 1YDPA 1X4YA 1NFDE 4GBXB 3H7LA 1NDGA 1MFDH 2D7PA 5JDSB 1KIQA 4HIHB 4WHTB 3MV8A 3WO3B 4FQHA 2IAMA 4CADA 3IT8D 4YHML 3I9GL 5DA4A 1GZPA 3X3FL 3QFJE 5CKAA 1OTTC 1I1AC 3L1OL 4M7LL 5FYLE 2F5BL 1GHFH 3DBXB 4YWGH 5D2LB 4QRRA 2EDYA 3L7EB 1LDPH 4JZOB 4LCCC 3N85L 3REVB 5EO1A 4MCZB 1ZGLP 5BRZA 4JJ5B 1TVDA 4OCXL 4F15C 3ZKXC 1FNSL 4ZFGH 4TUKL 3K74B 3FHAA 3MRJB 2ITCA 3K2UL 3MLTB 3HI1A 4X9BA 1L0XA 5FFLA 3X11A 5HVFB 2DICA 4R0LB 4X9HA 2GJ6E 3ULUH 5F89A 5C07B 1ZMYA 4JFFE 3ELAT 5L8JB 3CFJA 4ZG1A 3TO4B 1IMHC 5SWZD 1B88A 3H9HA 1QRNA 5CFHA 4FQXC 3MLUL 1WC7B 2EYRB 1U8PA 1HIML 1NL0H 1TVBB 5KTEL 2F5AH 3O2DL 5TQ2H 5D7LA 3MFGB 4KDTA 5HPMB 2WIIB 3Q1SL 4Y19A 5CGYD 3QUYD 4R7DA 5JMRA 2G5BB 2Q87A 2O5ZH 4R8WH 1XF4A 2YUZA 1U36A 3CFIC 5C08D 2EICA 2OJZL 1EPFA 3MLRH 1T89C 3R0MA 4NKMB 3BH9B 2OM5A 4GAYA 3AREB 4UNVA 4KROC 2ATKA 1UH3A 4JHWH 4UUJB 2HLFD 3FOLA 1J87A 3HNSL 3PG2A 3CU7A 4XNYH 3GGWB 1MWAA 4OD2B 5CGTA 3GSWA 4JRWA 3ET9F 3OGOE 5JOPE 1I9EA 1BLNA 1VHPA 3GMPB 4LCWE 1MCJA 1NCAL 1DR9A 2PYFB 4E41E 2VLME 1YYLL 2YA0A 4L8BA 3AS3A 5J3HD 2QSCL 1NUFA 4PR5A 1QSED 3DI3B 4PJFB 5IW3A 1IM9A 1UKQA 3I3BA 1XH3B 5FEBA 3ZDYF 1X7QA 4LPYA 4BSVA 3LAFA 3EYVB 4WHYH 2VDLH 4IRSD 3E3QE 5HBBA 3G6JA 5KVDL 3V0WH 2BSRB 1NAKH 4U1KA 4NJ9L 2X4PA 4XNQA 1NC2D 3DV4A 1F6AA 2CJUL 1WZ1H 4JJHA 4KMLB 1RZIA 2CDEB 3BYYA 4PJDB 5DO2C 4G6AD 4FFZL 1CLOL 1YEHL 5GGUA 2BVOB 12E8H 2JCCB 3O6LL 4M1GH 3W0WB 3CDGB 3F5WA 3FT4A 3QT2A 1W72B 1J1PL 1NEZA 3SJVD 1N4XH 2E9IA 3PV6B 3BYTA 2ZPKH 1F3DH 4P4KA 4UDUB 1XCTA 1QZ1A 4FQIL 3A6OA 3KPOA 4UT9L 5DT1L 1ZHKB 4LSUH 1KBGH 2OZ4H 1EHLL 2NR6D 1M1SA 4X6DE 4PJXE 4LOUD 5BXFA 1CLCA 3GRWH 4LPXA 2DS4A 1VEPA 2EE6A 5D1QC 4ZSOE 1VDGA 5EZIH 2QADC 4Z95L 4QTHB 3W9EB 3ZDZF 5TDNA 5BZWA 4Y16C 3G5ZA 3GSXA 4R4BB 1H5BC 5DD1L 2VDQH 4JFQB 4TVPE 5DMGD 2BNRA 4NCDA 4W68A 3QXDA 2HVJA 3CH1A 1V3LA 4LSQH 5KVEL 4XP5L 4AM0A 1S9YB 2ZWLT 4XVTL 3AS2A 4N1EA 1PKQA 1Q1JL 5FUOL 4ZD3H 4MNGB 5F7FA 4GAJH 1FFNA 1VFBA 3WKML 4L8CA 2XWJA 3QIWD 2VJXA 5LCVH 3U4BL 1ZGLB 5I8CB 3B3IB 2ZZUT 4HUUA 4F7EA 1INDL 1NMBL 2UUDH 3GHEH 3JWDH 3N1MC 5E9DA 1TZGH 1T5XA 3DPBA 4J4PC 3VXMA 2IAND 4ZYKB 2GSIB 1S5IH 5EORH 2MPAL 3TBSB 3QFDA 1DLHB 1E28B 4LSSL 5C1MB 3MYZA 3SGEH 1VFMA 4I3RL 5SWZE 5IEKA 3BQUA 4UDTA 1SQ2N 2FCBA 4S11A 3ZHLA 3BP6A 4QCIB 1QNZL 4K2UL 3CSYB 4U1GC 4GT7A 1TETL 1ZE3C 4I4WA 3TA3A 4U1LA 4R2GD 1JHTA 3Q5TA 4GQ9H 2QJDA 1OAXL 2MWCA 4EDWL 3WS6C 4XXCA 3BN3B 4YIQA 5CD3B 3TJHC 1PEZA 3H0TA 3DGGB 4PRPE 1QFWL 4C56D 4X7TB 4XNZB 3MNVB 1KCVL 5DZLA 2B8OT 3WD5H 3KJ4C 1OARL 1I4FA 4R97B 4X6EB 2OSLB 1FZKA 5HHVL 1YN7A 2ICWJ 3EZ8A 5E8PB 1Q9OA 1UJ3C 4JFED 3VD5A 1KPRA 1BECA 4C83A 2AEIT 1WJ3A 3EDJA 3LKOA 5T33H 3GKWH 3RPIA 4Q2ZA 3ZKND 2XWTB 1SYSA 2P46B 4YAQB 3M1BB 4UT6H 1CTNA 5EFIB 3QO0B 5DMIL 3D2UD 1AKJA 2EC9T 5FB8B 1EBPA 1G6RA 3B9KA 4Z7WA 5IROC 3GHBL 4KVNL 1I75A 3LH2H 3KXFE 4H25A 2AXGA 4J3UA 3SDAC 3LSOA 5JPMB 5TDOA 2V7NA 1NCBH 4OD1L 4X4YA 2FZ3A 1QR4A 2FGZA 1RVFH 4HKZA 43CAB 2CLRB 1JNJA 5CSBA 3U83A 3OXRA 4FFYL 4FXGB 1R3JA 3GUTA 5HPOA 3NA9L 4HJJL 1HZHH 1ULVA 4ONFH 1OGAE 1JUFA 3RP1A 1EEZA 4GBXC 4NKOA 3OKEA 2YD6A 1GC1H 5L7XH 1IGTA 1U91A 2WZPD 2W38A 1JRHL 1JE6A 2RFXA 1EJOH 1XMWA 2VZ3A 2FX9L 1AP2B 3KDMB 1H3GA 5EUOE 3MRGB 2XQYG 1LDSA 4YPJA 1HE7A 1IC7H 4PY7B 4WW2B 5E8NB 5C0BB 1E6JH 1OSZB 2E7HA 4M6NL 2ZG2A 3A67H 3MFFA 4U1SB 3MJ9A 4M7JH 3RNKB 1XIWA 3QUMB 8FABB 4OZGB 4F9PC 2I9TB 4LSTL 3MRPA 4CVUA 2UYLB 4ZXBD 2YKLH 2HFGL 4HWUA 3CVHB 4MZ3A 4PRDB 4TOYL 4RFNB 4XRCB 5F3BB 4UV4L 3HC4L 3NABL 4AEEA 2D7TH 1DDHB 1OTSD 2UZYB 3HCVB 1CDBA 1X6LA 4CMMB 4CNIB 5I1GL 1FZOA 4R0LC 3BMVA 4QHLA 3O6FB 4JZJA 1RJLA 2J6EH 3WO4B 3WNLA 4MDIA 1WAAA 5MEND 1J1OL 3DO7B 3FONB 3MV7A 3DURA 3JVGA 3S36H 2R2EA 1NBVL 2RCSL 5J6HB 3T4AA 3C5JA 1SYVA 2GKIA 3CUPB 5I15L 1ZVSB 5TE6H 4AENB 1A22B 2LVCA 3GBMH 4HKJB 5C09A 4P2QD 1JRHI 1JZ5A 3KPNB 3QCTL 1BEYH 5JW3L 4KRMB 3CZJA 2AJVL 1F3DJ 3SDXE 3V6ZB 2OTUB 2H2PC 2LE9A 3FB8A 3BWAA 4JFYB 4MZ2A 3VXRA 3NCJL 5HYJA 3HAEB 3RRQA 5FHAL 3S88H 3SOBL 4JGJA 4NRYA 3IRZA 5IW1B 4ZUWB 3I9GH 4MVBC 2N1KA 1LO3L 4LLMB 3X3FH 4A2LA 1MAML 5AZEL 3L1OH 4MNQA 3C09B 2F5BH 3AREC 4NT6A 4DVBA 2QV2A 5GGVY 4NJAL 4M3KB 4AH2B 4APQB 1G7IB 1A6TB 3D3VB 1MLCB 2EIDA 1EERB 2ATPB 3G04B 1YEEL 3N0PB 2P8LB 3C6SA 3G6JF 4P2OD 4OCXH 1PQZB 2FYYA 1FNSH 3TNMB 4TUKH 4XCEA 1JMXA 3ORJA 4HS6A 3WDHA 2IH1A 2NTFB 1AR1C 1C5BL 1HQRA 2DBLH 3IETA 5LGJA 1SBBA 4G6ML 1PY9A 4E5XA 3KPQB 1XGPA 1WCBB 1NLDH 1T0MA 1IGFL 1K4CA 1FG2A 1MUJB 1UZ8B 2C7UB 2D31B 1PSKL 1T4KA 4PJ8D 5DYOA 1NGZA 1UCBL 3P9MB 3FFCA 5BS0E 3TO2B 1CT8B 1HILB 3FT2B 5ISZD 2VXVL 4YDJB 3NZHH 5KTEH 4HK0B 2C1PA 3TNNB 1RD6A 3NAAL 5B3JE 1TTFA 3SCMA 4X6FB 3WS3A 3Q1SH 4JFEE 5IB3A 1V3MA 5DK3A 3QEQA 1KENL 5DEZA 2GTWB 3H9ZA 5F3HA 1PD6A 1S7XB 1MNUL 1NBYB 4G8GD 1YC8A 1YPZE 2C1OA 1G84A 3AAZB 1EMTL 1MCFA 3MV01 2K3TA 3HNVH 1KOAA 5FM5O 4BQCA 4U1MB 3IXAB 1DQJA 1YNLL 3OAYK 3HG1A 4PRIB 2DYPD 3MUY1 4I2XE 5I1DA 1BIIB 1T04A 3HNSH 3C5ZD 2FATL 4AG4L 1P7HL 3TN0B 4H20L 4B53A 1S9KC 4ODSL 1NCAH 4Y5YA 3V8CA 2OMBA 5IB4B 2Y9RT 4NFCA 1IAIL 1Y18A 2W59A 4Z7QE 3L95A 2R4RH 2QSCH 4LIQL 4KFZC 2F53B 1SBSH 1N7ML 3RWHB 2KBGA 5KW9H 5IG7B 3P40A 3DX6B 1K8IA 1K4DB 1LP9B 3QIBA 2WAHA 1R5VA 3NCYS 5GGRA 4OLXH 2GI7A 4W70A 1R5WA 4Y1AD 4PP1D 4YPGB 1VGKA 4ODHH 5ITBH 3HE6B 4NJ9H 3OKOB 2CJUH 2NXYC 1IC1A 1Q9LB 3CH8A 3GJEB 2PYEB 3HRPA 3OHXA 4FFZH 4EDXB 1CLOH 1YEHH 4PJGE 1U41A 3UTSB 3QBTB 3O6LH 8CGTA 4JRYE 2WV3A 3RGVB 4QRSB 1MHCA 2EXWC 3LS5L 1FNEB 3GNML 1QA9A 4KI5D 2X4TA 2IALB 3HMWH 2X70A 1FNFA 5FV2A 1J5OL 2WQRA 3G5YB 1HHJA 4XPHL 5MENE 4FQIH 4YDVA 3LKPA 5DT1H 2QL1A 4GLRI 5D4QA 3EIFA 2RGSA 1JZ3A 3AXLB 3BPCA 3T3PE 3S4SA 2AEPL 1C08A 5DJZA 5TE7L 1KJ3L 3MRLA 4P2QE 3TFKC 2ARWA 3ARGD 3V5HA 3MREA 4Z95H 1FYTB 2A6DA 3MNZA 1SJEB 5EU6B 3LQAC 4ZFZA 5DD1H 4XNZC 4O9HL 4HFWA 5SWQA 4NKIL 2Q76A 2B5IC 4HMEA 3VJ6B 1HYSD 1MVUA 2GQHA 2BSTA 4M4PA 3NN8A 4R97C 3CVIL 4BK4A 1UWGL 5FYJL 5KVEH 4XP5H 5IW6A 1T22A 1EO7A 1A64A 4XVTH 3CCHA 1Q1JH 3ZL4L 2H32H 1KYOK 1DLFL 3LV3B 5FUOH 5HHQB 5ICYB 2P5WB 3LHPL 4RAHA 3QA3B 3WKMH 4ONGL 3TO4D 3O3DA 4JRXB 3L3GA 1NMBH 2VABA 5ILTH 5ACZB 4QGYA 4Y88A 3MODH 2B20A 3FO2A 4L4VD 6CGTA 2MPAH 1JFQL 1T1YA 3GB7A 4Z9KB 2IPKB 3QG6B 4LSSH 1U3YA 1YEGL 5GXBB 1R0AL 4HUWB 4H1LH 5DUML 4JN2A 4I3RH 4MB3A 3RTQA 4ZO7A 3F6LA 5AD0A 5IWLA 2DMBA 3QJFB 1QNZH 2G2RA 5CEYB 4PTTA 1NCWL 1JNNH 4F58H 2QQQA 4HX1B 4KZEL 4EDWH 1NLBL 3BUYA 1D9KA 2R23B 1G7HA 4RBPH 4GKSA 1T03H 2V2TA 2R1WB 4PYGA 4JN1L 2EEAA 2V7HB 3QQ3B 2FGWL 3FQUA 5E5MB 3EFFB 3SE3A 4ZDHB 3WJLC 2ZUUA 4G8GE 4WFGE 1A1OB 1HWHB 5F96L 1OARH 2YK1H 5DRWA 1MIMH 4KVCH 3GMLB 1O5DT 3UDWA 3VFSB 3FQXA 1NKOA 4WW2C 3MCKB 4K9EC 1FYHB 2NY4B 1BJ8A 1KB5A 1EUTA 3SQOL 2VIRA 4PREA 3VGEA 1U8IA 4RFNC 5DMIH 4H1LG 2ZUYA 4ETQA 2AJXL 1NGQL 3UTQA 3BVNA 2DRUA 4IMLA 2FEEI 2JIXA 2XYCA 3NCYP 4DOHB 3D18A 3O6FC 1V7NL 4KVNH 5DHVH 3WO4C 4NCC1 2AV7A 5EA0L 2GSGB 3L5JA 1SMAA 4OD1H 5IMLB 2VXQL 3O6ML 3P9LA 4NDMB 2BFVH 4P4KC 4PD4K 1BQUA 4N9GB 5JW4M 4X99B 3FO9A 1JL8A 4G9FA 4HJGB 4Y1AE 1MLBB 2ADFH 4FQJH 5J4MA 1JF1B 4Q6IB 1U9KA 1G1CA 3GI8L 2PXYA 3BGMB 4XH2B 3E0GA 4O58H 4LNVA 4LL9A 3FB7A 3WIHH 2FX9H 5CMAB 5CBAA 3KPLA 2BDNL 3TV3H 4NZUL 4WO4B 3ALXA 5DQDL 3TIEA 5IVXE 4Q9RL 3C09C 1U8NA 4HWEH 3VXUD 4APQC 5IIEA 1OPGL 2XFXA 4M6NH 3KPMA 1BQLL 4K3GA 4KKLD 3QDAA 3J7HA 4U49A 2FEDD 1AXTL 2BOCA 2HFGH 3IDUA 4QF1A 5CSGA 1IC5L 3G9VA 1KJ2A 2F54D 4UV4H 2OBGA 3NABH 2Q7YB 1EK3A 5I1GH 3S97C 1RK1B 3VFGH 2ZSVB 4X6BA 5D2LE 4ZPVA 3IAPA 4PJEB 2J8HA 5CHNB 5DJYA 1YY8B 3V4UH 1KPVA 2WINA 3QEUB 5FO9B 3QAZB 2K7QA 5EN2B 1IKFL 3NH7H 1XGQB 3QG7L 3QH3A 5D1ZB 1HYRC 3VRIB 3BIKB 2EECA 1B4RA 4K7PX 1K5NB 1ORSB 3IDGA 2CMRL 4NO3B 3QCTH 5TPWL 1T1ZB 3CSPA 1ONQA 4CW1B 2NY5H 2AJVH 2A0LC 4WV1A 4JHZA 3R4DA 1DQLL 3UAJC 5JZ7D 1BWMA 5C07E 2DQCL 4UB0H 3QDHA 5FYJD 2XZQL 1UADC 5TH2B 1WGOA 3NCJH 3DETD 1MFCL 4PIRF 4PV8A 2HT2D 4O4YH 1A7NL 3DVGA 2BC4A 4XNUL 3WCYA 3CFCL 4DEPB 1LO3H 4HS3A 3U6RB 5L2JA 1GPOH 1MAMH 5D7JD 3IDJB 1G7QA 2Z35B 3PQYA 1J9CT 4C55A 5L6YH 4KKBC 4K8RL 1YEEH 2EDXA 1CICD 1Q9KB 5JW4R 4WRLA 1RK0B 4JGMA 4WFFE 2CIKA 2E9BA 4DKAA 4WJ5A 2ZUQB 3MLWL 4K3DL 3NFNB 5E00A 3BMWA 2VDPL 1G7LA 3K81A 1MCQA 3RY4A 3SDDA 5L88L 3VWJA 1IGFH 5J57B 3IF1B 3PABA 1PSKH 1AO7D 4TUJA 4WWID 4QXUL 4H26A 4XCNA 2X4RB 3HMXL 1CD1B 2VXVH 1MCOL 2MNUA 1JI1A 3HE6C 4JQXA 3WFCL 2W60A 4PJ7A 4OLYL 2VITB 4PJFE 1ZVHA 5EIQA 3MMEB 4UTAH 3ARDD 4NNPL 2HJKA 4XMPH 4ZAKB 4DK6A 4KK6C 1TDQA 3RUGA 5MEPB 1MNUH 5DJ8A 2OZ4A 3H2WA 1EMTH 3RZCA 3M8OL 3U82B 3RGVC 4UQ2B 5GGTA 2MSPA 1YNLH 4ZPTA 3TPUA 1RUKL 2GJZA 4PJ5A 4U6VL 1CN4A 4PGDA 2FATH 4AG4H 1JZ8A 4H20H 5HVHB 3HE7D 3MRDB 4NQVA 4PJDE 2DLHA 4XMLH 4ODSH 5FGBA 4KK8D 1UXSA 3BZEA 5D1XD 1S9VA 3FQNA 1NDMB 1M7DA 2JCCE 1OF2B 3MRMB 4I77L 3ULVC 1HHGA 4LIQH 3W0WE 3WEXA 1OAQL 3BX7C 1N7MH 4QTIL 1RIUL 4XPAL 3VXQB 4F9LC 5DD3L 4N90E 3TBVA 2P49B 2B1AL 1AIFB 3PWPD 5HGBB 2DI8A 4Y4HA 2VDRH 2GT9B 2P4AB 5T1KD 4J2XA 4NQEB 4R26L 2H3NA 5GSRB 4LPUA 5HJ3A 1D5MB 5DI8A 2CR6A 2DLFH 1F4XH 5D7IA 3IFOB 3MOBL 4ZS7L 3T4YB 1T2XA 4HGWA 1NCCL 2UVEA 4ENED 2YS4A 1WT5C 3LEXB 1S7UA 5FUZL 1XF3B 2YXFA 2FR4A 3LS5H 2YPKA 1JPGA 1P4LB 2ZCKL 4A6YL 3QNYA 3IJSB 1A8JH 2ZNWA 4DZBA 2J8OA 4R3SA 1EZVY 4MNGE 1J5OH 4RMQA 2GK2A 4GSDH 4JY5L 2V6HA 3QCVH 4HUXB 2DM7A 5CJ5A 2H45A 1T2QL 1KFAH 4NZTH 1MREL 1Q72L 1S7QA 4Q9QL 4XPGH 1X4XA 2H6PA 1UB5A 1KJ3H 4PJAB 2CLZB 2YD3A 4D0BB 4G7VL 4M4RA 4QRPD 3FQRA 4G5ZL 3OJMB 3OB8A 4P48A 3P0YL 1UM4H 3I50L 1UGNA 5E94A 5FOBB 4LLYA 1R5IA 4LBEB 4O5LL 4HUVB 2ZCHL 1OOAA 4S1DD 3Q48A 1C7SA 5F1SA 4MWFB 3CVIH 1FO0B 1UWGH 4ZTOL 4WU7B 1U8QA 2QQLH 4GRWB 4KUCD 5FYJH 4F33A 4YFLF 1FGNL 5EBLA 3ZL4H 1AY1L 1U8JA 5JHDA 1P4IL 3LHPH 2WW8A 2AP2A 3EJJX 4PG9A 4XPBL 1R3KB 1XF2A 4I0KA 1KXTB 1I9IL 1LO5A 4LPVA 2VLRB 5FKAA 1K8DB 3ZHDA 5HDQL 3MRNB 1LO0L 2E7MA 5T1DL 5DD6A 1JFQH 1C5DB 3KPSA 2N7BA 1GGTA 2IFFL 2J2ZA 5D9SB 4TTDD 1CD0A 1R0AH 5D93B 5DUMH 1GGBL 3QPQC 4KKAD 2R2BB 1XCQA 4L1DA 1KTLB 1QFPA 1LGVA 4WNQB 3WUWA 1Y0LB 2CO6B 4N0CD 4YXKH 2AEQL 1ADQA 3ZZ1A 3CPLB 2YPLA 4IDJL 1BZ7A 3HLAA 4F7PA 5DJDB 3RBGA 3ULUF 3P4NB 2D7NA 3MUGB 3L3OB 4JN1H 1OTUD 2I9LA 5HGDB 3QI9A 4MA3B 2FGWH 4YX2L 4M62L 1HKLL 43C9A 4M3JA 3B9AA 2GITA 1JWSB 1OB1A 2W9DL 4JZNA 2G75B 3FOMA 5F96H 4WO4C 5LAXA 5HI3D 1YEKH 5IUSA 2WBJD 4M93B 1AI1H 4L3EA 5DHYA 5FO7A 1G6VK 1M4KA 1UYWH 3GKZA 5DJAB 1FORL 2Y7QA 2IPUK 3RA7L 1YEFH 3RZWA 3MRHA 4IOIB 4NOBA 3GSNL 3BOVA 3K4DA 4N1HB 2EE2A 3SQOH 4WENB 4LLQA 2H41A 1MI5B 5C0RL 2P7TA 5JO5B 1JHLH 4HCRA 2A9NL 2B2XL 5DUBA 2AJXH 1NGQH 2R4SH 1GL4B 4B0MM 1H3VA 4CAGA 5I6XB 1V7NH 1B9ZA 5C0BE 1OAKH 4Z7OF 1YJDL 4DCQA 3VDBA 2UWEF 4OZGE 4DAGL 1FL5A 5GZOC 5D1ZC 1XR9A 2LV4A 4MAYD 5ALBL 4Z7NF 1EH9A 5C0GA 5F6IB 5E6IA 4GRMA 4OF8A 2BNQA 5K9OA 5J1AA 3KHQA 1ORQA 2J1KA 1KPUA 4LSPL 3QNXB 1R3IL 2VE6A 2ZCLL 3GI8H 4MAUL 3CMGA 2VN4A 4BH7A 5ICZB 4WTZG 4HWZA 1EFXA 4OUUA 4E42B 2BDNH 4DEPC 4NZUH 2FX8L 2JELH 2R29H 3L9RA 1HSAB 4PRBB 3W9DB 4RGOL 5IP4A 4MD4A 5F7UA 4NQCA 3VG9B 2WUCL 3KJ6H 4XBGB 1OPGH 4ZOAA 4MCYB 2EDKA 3QO1A 5E5UB 5KG9A 1UZ6E 4X9FA 4KAQL 1P5UA 3SPVB 2NTSP 1A47A 1G1YA 3QEHB 4U7KA 1NAMB 3RVUC 1IC5H 3MA7A 3PIQB 5IB2B 2ZUQC 3KG5A 3BI9X 4P46D 5F9JB 4PJ7F 2R2CA 3TWCL 1OL0A 2ESVA 3I75A 2XI9A 3O2DA 2YEZB 4TULL 3MUHL 4TSCL 4L29A 3VFMB 4EUPB 2R69H 3D3VE 4BUGA 3FCTB 4X7SL 3C5SB 4Z76B 5C0CA 3L5IA 1CXLA 4JE4B 1K2DB 4XB7A 1P7QA 3IRPX 4FTVA 3HR6A 1MY7A 2NY0D 3S37L 1MCCA 4JFDD 4UV7H 5KSVB 2FSEB 1FCCA 2CMRH 3E1F1 3JWOH 5FGRA 1SMOA 1DQLH 4YLQT 5B39B 4MDJA 5I1AA 3OKDA 1WZLA 4ZAKC 4YDIL 5D70L 1N6QL 3WIIL 5F88A 3BUTA 4P2RB 4L3AA 5B3NA 1MFCH 4U6YB 2YRLA 1XGRA 1LE9B 4TNWK 1AJ7L 2XTJD 3CFCH 3FQWA 5CJXC 3CXDL 4Z0XB 3W2DL 3T0EA 5DRXA 3B9EA 3DLQR 4XPTH 1HHKB 1BM3L 1I85A 4FQQA 3SKNA 3UDWC 4L4TB 4JDVA 4JHAL 1HI6B 5HVHC 1FVCA 5GRUH 3HAEG 4PJCA 3BESR 4ZUVA 1M71A 5MP6H 3W11C 5IHZB 1T1XB 1SY6H 1AGFB 4XP6L 4GRLB 3L3IB 3MLWH 5B38A 1S7RA 2V2WA 2G5RA 3D85A 1G7JB 2V5RA 4P23B 4MA1B 3VA2C 2R1YA 3QISA 3RBSA 2L7JA 4PRIE 5D7IF 4F7CB 4AIXA 5DMJB 1KV3A 1S7SB 3QCUH 1HKFA 2G9HB 4QXUH 4WI9A 2E7LA 5HGAB 1MRDH 5GQBA 1QBLL 1GZQB 3QQ4B 4XGZA 1B6DA 3WNPA 5HY9A 3WFCH 3IGAA 4NP4L 4F7TA 1X5HA 2AI0L 2F53E 3GMOB 5FECA 1INQB 2Z93A 4J6RL 3O2WL 2AXFA 2HP4A 4M43H 4PLKC 4ZODA 2FJFA 3DMMA 5JNYA 4P9HC 2OK0L 1OW0C 1P9MA 1M05B 1TMCB 3ULSA 5T1MB 3M8OH 3T65A 1A9BA 4NQDB 3MLYH 4UILH 4ALAL 5H94A 3VRJA 2PO6D 1JWMB 1QKZL 5GRZA 3BXNA 2GJJA 3UTOA 3H7BA 5CIPB 1J0YA 3VI3F 4N8PA 4PGEB 2PYEE 4MQTB 3X12B 1IGYA 3MGOA 3W5NA 4JQVA 3K46A 3UTSE 2MCPL 4HDIA 1KN4L 4I77H 3G6AB 3V0AC 5GS3A 3MLXH 1C7TA 1OAQH 1RV6X 3O8XD 4OBRA 4ODTL 3N9GL 1JYVA 4XPAH 3RL2A 3DNKA 3V6OE 2XZZA 1MCWW 1C12A 1T7WA 1C5CH 5HHOA 3JV6A 5E4EB 4PYHA 1UEMA 5GRXG 4CJ1A 3VFNA 3M17A 1RJZA 1GOHA 3RY6A 2XT1B 4NNYB 3F7YB 3PWUB 4K7FA 3ULVE 4K3JH 1ZS8A 1U6AH 1JK8A 1HCFX 4XVUC 3RHWF 4IHOA 4FNLL 3D39A 1FYTE 4TYUA 1Z0MA 3MOBH 5E2JA 4M03A 5EBMA 5EU6E 4I3SH 5HHXL 4C4KT 1DFBL 4BYHA 1YQ2A 2P8PB 5FUZH 1GRWA 2DQEL 4EN3D 1OCWL 4M9PA 2A6KB 5A1AA 5FK9B 4P5TA 2ZNXA 4MD0B 4WUUB 1YUHA 5HDBF 1X3DA 4HS8L 4OAWA 2P5WE 3SE9L 4YZFF 5D93C 3PHSA 3F6IA 2OL3L 3CXHK 3OX8B 1JNHB 5C7XL 1T2QH 4JRXE 4KRLB 1JGUL 3EYUH 4GXUM 4NKDB 3ZT5A 1LEIB 3KNBA 4WEUD 3NCMA 5CWSB 3BHBB 3GMMA 1WICA 1S9XB 2J88L 4Q9QH 2VLJD 5GJSL 3P9WB 3MZTA 4PGCA 5CEZL 4FQCL 4FZ8H 3QWRD 2JB6B 1MCIA 4U4BA 1UWXK 3KLAA 1AXIB 3OXSA 1NFIB 4K23H 1TQBC 1EHAA 3H8NA 1GGCL 4MSWA 4Y2DB 4Y5XA 2VQ1B 1IQDB 1GOGA 3F7PC 2HWZL 1F00I 3D69B 3LB6D 3EYOA 5E7BA 3STZA 2ZKHL 4M93C 4JREB 3EAKA 4UNUA 2PUQT 2D0FA 4HIIB 2H8PB 3EOBB 3FT3B 2JK5A 3G5VA 1S7TB 4V1DB 2CIIB 1H8OA 1FN4B 1I9IH 3DXAB 4HQQL 4NUJB 4L8BB 1C16B 1LO0H 4QRQB 4POZC 1DQDH 2HFTA 5I6XC 4BZ2L 5KSAD 2BY2A 4H5SA 2Y5EA 1GGBH 3QIUA 3O6KL 3O4LD 1DANU 5TGBB 1I3RA 3BEWB 4RMSA 4KK9D 3P0GB 1MCWM 2AEQH 3ARBD 5D5MB 5JW5B 4YHKL 4FRWA 1V7ML 2XN9D 5F6IC 4OUOA 2WIMA 4QXGH 4TNVK 4CL7A 5C0AA 4DOHE 4JG0L 1A6VH 1RZ8A 3I6GA 4YX2H 1NBZB 4M62H 1HKLH 5H37G 1Q9WA 2NX5B 3C6LD 3GSQA 3MYJB 4ONHB 4HH8A 4OM1H 2ADJB 3NIDE 5KOMC 4QHKI 2ENYA 1GVIA 2B39A 3VG9C 3U9UA 2Z8RA 3IFPA 3V6FB 1R24B 1S7WA 1QLRA 4GW5B 1FORH 5TE4H 4R96A 2H1PL 1BWWA 3O9WB 3F7VA 2X4UA 3TIDB 3WFEL 5CZXC 5C0RH 3BT2L 3MGTA 3LD8B 4I18A 4GG6B 1ND0B 3GJFK 3STLA 3KR3L 3MV9A 3B8YA 4YGAB 2A9NH 2B2XH 4OGAC 3EYFA 3QDGB 2VISA 2DI9A 3NPZB 1LEGB 1S9WA 3DYPA 3D0VA 3NMEA 4D9QE 1MJ7L 5E6ZA 1IZKA 1KIPA 3Q3GA 4FXKA 2DTML 4JKKA 4OGZA 1RZJH 2HJLA 5BZWB 3JUYA 2NY6B 1N0XH 2X1PA 4M6MH 4MB4A 4DAGH 5FDWB 5C8JA 2F8XC 1L7IH 2DL2A 5IK3A 3U30B 3CZFA 4N0YL 2NY3B 4PB9L 1PKQB 4PJEE 1VFBB 4C57C 4MAUH 3NZ8A 4PBWD 4WI3A 1PBYA 3QDJA 4Y4KA 4OQTA 2A6IB 2FX8H 2ITDB 4NBZB 4KK5C 1FL3B 1U8MB 3V6OA 4MJ6A 2EH8H 3IDMB 3VWKD 3DYMA 2EDLA 4QRUB 5HD8C 5DEFB 4YDKL 1UFUA 4XXDA 4M48H 4OCYL 5CJOL 2CXGA 4KAQH 3L5HA 2MKWA 2CLVA 4XNMA 1N8ZB 4GRLC 5DJXB 4QY8B 4ZUSA 5I76A 3MRRA 1UEYA 2APVA 2WLYA 2BJML 1VADB 3U0TB 1CGSH 4RDQF 4U31A 3TWCH 3T77A 4P23C 1MJUL 1WTGT 3G08B 4MA1C 3NA4A 2R8SL 1S3KL 4TSCH 5EU4A 5IVNA 1WBYA 3NACL 4X7SH 3DRQA 1FCGA 3VXSD 1INEH 2CKNA 1AQKL 4HPOL 1R3HA 3TJHD 3RVWD 2DAVA 3RI5F 5HYEA 5E2WL 1FFOB 1YEDA 1IILE 4J7RA 2PTTA 1GH7A 3IJYA 3SKJL 4PJHA 3A6BL 1BD2D 4OZFB 4YDIH 3WIIH 1CFNA 4M1CD 3TH3T 3UMTA 1QO3A 2B1HL 4EBQH 3MXWL 2XOTA 1DVFB 3H9SB 3W2DH 3JV4B 5DC9B 1KTRL 2EE3A 1BM3H 5JPNA 1JJUA 4Z78A 1A7QL 3OZ9H 4EI5D 1W72L 1RZGB 4NO5A 4X4XB 4FQ2L 2VXTL 1ACYL 4JHAH 3S3SA 3MRCA 3EYSL 2XWBB 4S0TD 2XZCL 3SKOA 3IU4H 4XP6H 3GIVA 4LK4A 3BJLA 3IKKA 4NQSA 1ZT1A 1WK0A 2A6JB 1E27A 5C0IA 1A14L 2J4WH 1U95A 1NJ9A 1BZ9A 3ARFD 5E4EC 2C3HA 4X0KB 5DQJB 5T5NF 2A74B 1MI5D 3STBA 5BVJA 5DC4B 1MHHB 1VB9A 1I1FB 4OCSL 1E0OB 3L3HA 3OSKA 3QUXD 4NP4H 1M7IA 2PETA 4I5BB 15C8L 1ETZA 2LQRA 1QHOA 3O2WH 1RHHB 2BNUA 2CDGB 3F62A 2OK0H 4XCYA 3BSZL 1MJJB 1KCRL 4LDLB 3NCBB 3S36X 7FABL 2AV1A 2W92A 4MJID 4NQEE 1QKZH 3DYOA 4GAFB 1CLYH 4MDIB 2X9YA 32C2B 3BH8A 2IWGA 1IRAY 3GK8L 3RY5A 3MV7B 2VZVA 3DURB 3CX5J 2V17L 5D71H 3K2MC 1FIEA 5DJ2A 4RX4A 4JAMA 1U8LA 4E9LA 1H3TA 1XGUB 2OJEA 4P3DB 3GMRB 4JM2A 2VL4A 4JKWA 4DFHA 1KIUA 3VFUA 2PW2A 4IS6B 3PDOA 4J3SA 3N9GH 4LLWA 4JEGB 5F7KC 4PRHA 1Y6KR 1IGML 4Y2DC 5DF0A 3VXRB 3PWVB 1TZIA 5J9PA 1W0WB 1DN0A 3DUSA 1J0HA 5C0EA 3C08L 3LQAL 4W6YB 1VA9A 3SO5A 1CFTA 1BOGA 1VCAA 3NBNA 4MNQB 5JOFA 3C8HA 4JREC 3QUKB 3MLVL 3SKUD 2YA2A 1ZT7B 4L9LB 5IV2A 4PJAE 1AGEA 1OAUL 2PCPA 4FQPA 4P99A 4QOKA 4FNLH 2XIDA 3TYFB 4BSJA 1QBBA 2Z31B 1F90L 4U1HA 2FJGB 2BVYA 2FO4A 5HHXH 4Z77A 4EI6A 1FNGB 2XZAL 1CDUA 3QHFH 1F97A 1ZWIA 4XCCH 2DQEH 1CFVL 1I8IA 3OAUL 4GRWE 1OCWH 5J13B 2W9LA 3VDAA 2QR0A 3RVVD 5CP3A 5EZJB 1RJYB 2BZDA 2DD8L 2P5EA 3T0EC 4KXZI 5AZ2H 3SE9H 4DUVA 1AXSB 3IFLH 2DQGL 3D9AL 1I85C 4Y8DC 2DN7A 2OL3H 2HFFA 4KI5F 5KANG 4GRWH 2X7LB 2AK4D 4P2RD 3WN5A 5C7XH 2P8MA 3I02A 5IF0B 2X1WL 2VNCA 1UENA 2VLRE 3F12B 2BP3A 1MIEH 2J88H 4QHUA 5DDHB 2VKXA 1VGEL 2CSPA 4U1IA 4FQCH 4RGMB 3N1FC 3QUZD 4JY6B 1QBML 5I1LA 5T3XD 4WFEE 1A3LL 1A5FL 5EBWA 5ANMB 1FAIL 1GGCH 2I07A 5F3HB 3ZYZA 4GOSA 3OG4B 4N5ED 4BH8A 2KKQA 4H88H 4LDOB 4YHZL 3Q2CA 4JPWH 2Z92B 4NRXA 4MA7L 3U36A 2W0FA 4HGKC 2CD0A 4N8VB 2BHUA 4KHXL 1T21A 4ELMA 4OLWL 1A6AA 4S2SA 2YD7A 1T3FA 3UPRA 2NW3B 3MBED 1NFDA 1NFKA 4DKDC 4PTUA 3O9WC 4BQ6A 1F13A 3LKQA 2V2XB 5JLZB 3TJEL 3OGCA 4HQQH 3HZKA 5HI5C 3DRTA 2VN7A 4O00A 3EJZD 3QFJA 3L5WB 1ED3B 4JGUA 4D8PA 2MKLC 2DLTA 2A73B 4HH9B 4AT6A 4I0PD 1WIPA 3WXWL 3TVMD 1F6LL 1NC4A 4WTXA 2NY6C 4OFIA 4G8EA 2BOBA 1T1WA 5BMFH 1WVZA 3QIBB 3BP5A 1MI5E 2Z9TA 5KSBF 4KGJA 1P2CA 5J7CC 1PJ9A 1YN6A 3T0AA 4YHKH 4RFOL 1V7MH 5EC1B 3U30C 4YNYB 1AD0A 4IRJD 4GUPB 2NY3C 5DJCB 3JZ7A 1UACH 5J1TC 1IM3A 2VMFA 3OQ3B 4V2BA 2BXZA 5GRVK 1CBVL 5EO9A 5I74B 4RQQA 4JFFA 5DJ0A 2XA8L 1DEDA 1AGBB 3PP4L 4LGSB 1U92A 2NY2D 1FIGH 3DV6B 3WKNA 4QT5A 1HXMA 5IGXL 4Z7VF 3OF6D 1J8HB 3BKCH 1OQOA 1FE8L 2VLKB 2DLGA 1IT9L 2R2HB 2H1PH 4O51B 3ZDYE 3MV8D 4LFHD 2VAAA 1FP5A 1F4WL 2IAMD 4L1HA 4MMXC 1IBGL 1YYML 1SEBA 1FZJB 2DLEA 3KWWA 35C8L 5F9OL 1MJ7H 1GAFL 3QPXL 3HZVA 4GQPH 4QRRD 5DK0A 3I85A 2BMKA 1DQTA 4PJHF 2HAZA 4HAFA 3QDMB 5EZOL 5BRZD 1JF5A 3BPLC 4IOFC 3V95A 1SJXA 3QWOA 4JG1H 2DWDA 4NUGL 4Q0XL 1MVUB 4Z5RB 1QFHA 1S8DB 4XAWL 4EVNB 3ROOB 3RVXC 1DN2A 3PWJA 4JFZL 4N0YH 4AEIH 3IB4A 3MSPA 1H8SA 3V8OA 2FD6L 1B0GA 2GFBA 3KYOB 1VPOH 3K8LA 4W4OC 4MJ2A 3MJ8A 4XVJL 4LHUA 1IQWL 1QRND 4HC1L 5JHLL 3O3AB 5JIKA 4JFXA 5L2KB 1TVHA 3D5OF 4PFEA 5AAMA 1DVFC 2FHCA 4EUPH 4YHNA 5F7HA 4G9DB 4HZAA 1PEWA 3VFRB 5D7LD 4YDKH 2NW2A 3WDJA 4TRPL 4Y19D 3ZDZE 5HGGS 4P2RE 5K59F 3FRPG 5I16B 1EEQA 5KVFL 1KIRB 3HMXA 3S9DB 3O11A 3MO1B 5B8CB 1KJVA 2BJMH 2FH8A 5LJYH 3QXTA 4HWBL 2X9XA 1NH6A 3U7YH 5ID0A 1S3KH 4M5ZL 3RKDC 2MFNA 3FN0L 2ZOLA 1EZVX 1M6OB 1QEWA 3L7FA 1G6RL 1O0VA 1RMFL 3HS0A 3JV5A 2D03L 4GH7B 4W6XB 4UINH 5BOZG 2FH6A 4P4RA 5T3XH 5GGSY 1YNTB 4X6DA 4UIMA 1P1ZA 3T1FA 4PJXA 1UA6H 4DUXA 2AQ2A 4K3EH 4HV8B 2F15A 2DQHL 2LU7A 5E2WH 2FJHA 1IM9D 1QFWM 2Q8BL 1P5VA 5B4MD 4TSBL 4EUPG 4LCYA 1JTTA 3SKJH 1A9EA 3A6BH 3EO0A 1JGEB 5JXEA 3EOAB 3PWNA 5LVEA 2CKBB 4JVPA 2SEBA 3IKCB 4LEOB 4CJ0A 2BXYA 1J11A 2YOCA 4GMTH 5SX5K 1DBMH 4JM2F 4NPYB 4HLJA 1T20A 1DTUA 2Q6WB 2O5XL 4NO2B 4FA8A 4PJIF 5GZND 5DD0L 3UBXB 5B39G 1MSPA 1JYXA 3TM6A 1DZBA 1JPTL 3TCLB 5J6GB 3TBTA 3EYSH 2VH5L 2Q3ZA 4G80B 2EC9U 1CDHA 3P30L 4NC2B 1V3JA 2I24N 5DK2A 4XAKE 4NQDE 4DZ8A 1IGJB 5INDA 1U93A 1NMCB 3ULVL 1A14H 3KAAA 3TZVB 4QHKJ 4CUCA 1KCLA 3LN4B 1B0RA 5FDYA 4WWKA 1UWXH 4FQ1H 3MC0A 2XQBL 5SWZA 5DR5L 3MRQA 1LEKA 2UZIH 4OCSH 2D7QA 2ZSWB 1CFSB 2ICWB 5F7MC 4A6YA 1FL6B 2C3VB 1JHKL 1G7MA 5JW4Q 2ZUWA 15C8H 4PRPA 3S8WA 4NHCL 2Z31C 3CLFL 5MEOA 2KDGA 3FO0L 1AHWA 1N5YL 2GJ6B 3MTRA 4HFUL 5HHMD 1A1NB 2EH7H 3BSZH 4HEME 2BNRD 4CU7A 3B5HA 1U3HB 4Y5VA 4POYA 4OZ4B 3GMQB 3OMZA 4OCWH 4ERSH 5J13C 1KNOA 2CUHA 2H9GB 3OKNB 5I19L 4LNRB 5CCKL 4X6BB 3W81A 4HIJB 3SDCB 2V9TA 1SVCP 3GK8H 3RX8A 2V17H 5GISL 4Z6AT 5IB5A 4D0CB 2FBJL 2F19L 5E9DD 1D5ZB 5ESVB 3P3YA 3ARXA 3IVKA 5IEHB 1DBJH 4HLZG 4PRNA 1MCSA 2R0LL 3VXMD 2ARJB 3BISA 4WGVB 4H0HB 1F11A 4WUUE 1OGTB 3G6DL 4IIQB 1MF2H 2VZTA 4QRTA 2NY7L 4UQ3B 5I2IA 3KXFA 3U46B 3FZUC 1RUAH 4OF7A 3BQUD 2UWEB 1RPQA 5GRVL 3MJ7B 3FRUB 4AL8H 4ORGA 3FAXA 3TA3D 4KMTH 2A0LD 5IFJA 2IF7A 2FIRT 1MCPL 3SGJC 1T7XA 1OGAA 4E41B 3ECBB 2APXA 2AKRA 1ZHNA 4WEBH 1F90H 3CNKA 2EIEA 4DW2L 3VH8A 4YC2B 4NN5B 3KYAA 5A40E 4PLJC 2ZG3A 1IARB 1KT2A 1ZSDA 5EUOA 4X7FC 1LVEA 1CFVH 3BO8B 1JPST 4MQ7B 1CL7L 4OCNC 2VDMH 2DQGH 1D7FA 2HYMA 1QSZA 1QVOA 3D9AH 3P77A 3RDTC 1EX0A 4V1DE 5ESAA 3PGFH 3BN9D 1T5WB 5IM7B 3DXAE 3EDKA 1QP1A 1H0DA 3S96A 4MX7B 1CE1H 2DJSA 4X4ME 1BVKA 1CVSC 1S7VB 3VE0A 2BHZA 2ORBL 1AKJD 4R9HA 1MWAH 1VGEH 3PL6B 4KRPB 5BQ7B 2NLJB 3RVTC 3B9KD 3B2VL 2IH3A 4N0UB 1DUYA 1NGXB 1A3LH 1D5IH 1A5FH 3D87B 4CVXA 3TBWB 3GSNA 4NIKB 3RL1B 4WUKH 3EO9H 3SBWA 3G6JE 1QYGH 1JGLL 4G6KL 4MA7H 5D5ME 4ELKA 4J1UA 3VG0H 4P3CL 3LKSA 5GS1A 4TUOB 5JR1L 4P57B 4XWGL 3VXTA 3RX7A 5J06A 1WEJH 3VCLA 5KN5B 4OM0L 3QRGL 3THML 4X4ZA 1MFBH 3TT1L 3CJJA 3DUHA 4ZSOB 3OKLB 2NX5E 1BP3B 3PWLA 1G0DA 2ZOKB 4JO4L 1VACA 4DN3L 1CL7I 4LPTA 5IKCA 3P0VL 5HYSB 3BAEL 1ZV5A 5DQ9B 4S1QL 4QXTA 4LVOB 2W65A 3WXWH 3O0RH 5D7SH 3U4AA 2HVKA 4FN0A 1XIWD 3QYCA 4QLRA 1IAIM 2R0KL 2I27N 1N5AB 4RFOH 3HC3L 1MCDA 1R3LB 2Z4QA 1I1AA 4U2ZA 4X5WA 3GSOB 5IMKB 1NQBA 1Q0YL 2XA8H 3CDCA 4LCCA 3MV7D 3BD3A 3CK0L 1XT5A 3CXHJ 4EKXA 1XGTA 1WWAX 4GW4A 4N0FB 4OV6F 5BS0A 1E4JA 3HFMH 1LQSR 2J8UB 2ZJSH 5IGXH 1JWUB 1N64H 2MHAA 4K7PH 2DBJA 4KH2A 1QSFB 4BA8A 5C09D 3U2SB 4LLUB 1OWRM 2X4NA 3FL7A 4LARH 1PKQE 5JIIA 4LLAA 4JFEA 4DGYH 4WCYL 1AE6L 5JQHC 5DSCA 3IDNB 1DJSA 3VXRD 3B6SB 1QSVA 1JN6B 2EO1A 3VDCA 2QQKL 5HYJD 1I9JL 4MJ5B 3ZKMD 3I6LE 4FQXA 1YPZA 5BZDB 1YYMH 1JGVL 2GTZA 3QUYB 4MNQD 3D25B 4RA3A 5C08B 3LN5B 3QPXH 3FB6A 4XVSL 1IEAA 2BVQB 3C60C 1XZ0A 1H9VA 2GIYA 2YMXL 1KTDB 5KJRL 4Z7UB 2DMKA 2AXHA 5F9AC 1IFHH 4ZFOB 3VW3H 2WWMD 4NUGH 3P2TA 3FO1A 1D5BB 5F1IA 2VXSL 3VXPB 3CLEL 4JFZH 3RWGB 2OMNA 5A3IC 4DN4L 1FPTL 3X13B 2YD8A 3UCRA 2YBRB 2IG2H 4NM4H 5K9QG 1RIVL 2AJZB 2DWEA 3RWJB 4WI7A 3BDBA 5EZLB 4CGTA 2X4SA 1QSEB 2ZP0T 1TCRA 3LZFL 1IQWH 5JHLH 4LKCB 5GS0C 3BPNB 2D4DA 3FFCD 4M02A 3U7WH 2BK8A 3CFBA 2C3WA 4K3HA 4IRSB 3QQ9C 1A3QA 1BF8A 3SCMD 1FH5H 3CC5B 5DEGB 3W82A 4TRPH 5HDOA 3QEQD 5C9JB 4FG6D 2VUOA 4RFEB 2R0ZL 4XTRD 1NC2B 4ZS6D 3RWEB 5F7DB 3VFPA 2XKSA 3PUCA 3H9SE 3LDBB 4JRYA 4NSKA 1DEEB 2DL9A 1TJIL 2DQTL 4YBQC 5C0FB 2R0WH 3NGBC 4YK4B 3HG1D 2XPGA 1OP3H 2GUOA 3TZVC 4ZUTA 2APTA 2R9HC 4YXHH 4OZIF 2DLIA 4X9GA 2ADIB 1P7KB 1G6RH 3SJVB 1F58L 3KYMB 1RMFH 3H3KA 3O45B 1L4IA 1BVLB 3U9PL 3FB5A 2AJ3B 4L5FH 4RAUA 1CFQA 1ITCA 1RQ5A 2CUIA 1DE4A 4P2QA 4GW1A 1RHFA 2HMID 1HOCB 5EO0A 4OLUH 4F80A 1VEOA 5E1AA 3MZGB 2Q7NA 5GGSA 3QHTC 3QIBD 4P9HL 4PS4L 3NIFF 4UU9A 1FNAA 3QEGH