1OAQH

Free conformation ab1 of the ige spe-7
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HEAVY CHAIN
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaqH00
3U4AA 1DN0A 1IQDA 4X4XB 5HHVH 4NO2B 2R29L 1IGCL 2EDHA 1UWXH 1YC7A 1QSFA 1YPZA 4YAQB 1JPFA 4IRZH 4JO4L 5IB3A 4R2GD 1X5AA 1FZJB 2DTML 3VGFA 4RMTA 1FE8L 3RZCA 2CLZA 4AT6B 2P5WB 3VI4E 2ZCLH 4U1SA 3BD5A 1BEYL 5IW1B 5LGHH 4DN3H 4MXWH 2NY2C 4CNIB 1RUKH 3CFEA 3H9HB 4JJHA 1A6PA 3UAJC 2H2SC 2VOTA 4KKCC 3P77B 3LRGA 3OAZK 2EDXA 1QBAA 1NBZB 3SPVB 1I3RA 2XWJB 3C60B 3QNYB 1F6LL 5C9JA 1QFUH 3C5SA 1ZT1B 4NN7C 1LDPH 2YD7A 4KVNH 3UXFA 3CXHJ 4RDQF 4ENEC 1HN1A 1U8JA 4JCMA 3WKML 4BSWA 5LCVH 2VLRB 1J5OH 1EJOH 1P4BL 2DJSA 2FHFA 3P9LA 5EH1A 3U6RA 4IRSC 1S9YB 4E42B 5B39A 4MA1B 4WHCA 3G04A 5KVEL 3EYSH 2R2BB 4XCEB 2G75A 4R4FH 1MCOL 4MAYA 4I77L 2VDRL 4PJ5B 4F7CA 4L8DB 4WFHE 5E6IA 1IGIL 3LS5H 1LO3L 1OARL 1DEEB 3EJYD 2W9EH 2Y36L 3QUML 2W9LA 4KV5E 1CFSB 4K94L 4IOIA 1A02N 3MRHB 4NHCH 4AIZB 5GS0C 3DETD 3ESVF 1S3KL 1A3LH 3QWOB 4LSUL 5FUOL 5L9DH 2ZKHH 4F57H 3PG2A 4WEBL 5ITBL 2HTLC 5KS9F 3QI9D 3DX6B 4X6DA 1S7SB 2CLVA 2VDKH 3HR5A 4S0SD 4OI7A 2DKUA 3OWEA 1FNGA 3MRRA 3WFEH 4YEFA 3WFBL 1N4XH 4P23D 2XWTA 1FAIL 1RQ5A 3QUZB 3LQMA 5HVHC 3VXSD 5IQ9B 1EO8L 4Y4HB 3GK8H 3FO1B 3VGHA 4JRYD 4OZGF 1U3ZA 1IEAA 2OS7A 3I3BA 4PRBA 4UIKH 4OLYH 2RCSH 3TBTA 1OCWH 1OHQA 3T2OA 4NO0B 4Z18A 5C0JA 4LNRB 2EDBA 4HHAA 1BLNB 3QIBA 2BNQE 2YUWA 3BFOA 3QHFH 2EDDA 5KG9B 5F88B 5HYFA 2EE9A 5LVEA 5CINL 3MGTB 4NUGL 4AH2B 3D5OF 1EDQA 4TUJB 3MV7A 2JIXD 4APQA 4ZS7L 4F15B 3O2DA 5KVFH 5IHBA 1VFBB 1NEZA 1MCBA 3ET9F 4JFYA 4PRAA 4HKBA 1OAYL 1DUYB 1N0XL 3LV3A 5DURB 3JV6A 5CEXB 1KT2A 4HX1B 1N59A 2DQCH 4YHLH 4HC1H 4M00A 3GSRA 3OKKA 4H88H 4X8XA 4XI5C 5K9OA 3QULA 5FAAA 1F11B 1UZ6F 2BRRH 3WIHL 1G7QA 1DBBL 1JRHH 5DMYA 1URLA 4ELMB 1A0QH 3V6FA 3DI3B 4DVRL 1TFHA 5CJOH 3L3JA 3SCMA 3RX5A 3P4MA 3VFVA 4NFCA 4ZFOL 4JN1H 4YGAB 3WBDA 4JFDE 4LCWD 1SBSH 4G43A 2VXSH 3NCCB 4QGYA 2B1HH 5AWNL 4R4BB 1CDYA 5DVMA 4HUKB 3C8KA 3MRLB 4PJDB 5D7LB 3HC4L 1CK0L 1ZLUK 4U6VL 4XCNA 3FT4B 5I71C 2R1XB 1YEFL 3R8BB 5HDBE 3TJHC 3IF1B 1CDCA 1CLZL 1ORQA 4JFOB 4JREC 1L6XA 4RDQG 3IJSA 1GSMA 5D1QD 3H6JA 5F1IB 1NFDE 1BD2B 4TN9A 2FGWL 1IZJA 3QEGL 4FZEL 4GRWF 5HGDB 1E4KA 4FNLH 3DI2B 4Y19B 4ONFL 4RIRB 5DGRA 5IVXE 3GKWL 1CD9B 1MCJA 1RVFL 1QFHA 5ID1A 5I6XB 1I7ZB 3QDHA 4YIQA 5MEPA 1YY9C 4Z0BH 1KIQA 3P30H 3BZFB 1DFBH 4LSVH 2UZYB 5F9JA 2WINA 2BC4B 1NAKH 1P7HL 2Z93A 4S1RH 5EU7C 2X44D 3ROLA 5LGJA 5DO2C 32C2B 1SYSA 4JFXA 2BSTA 1FH5L 3MA9H 1XGTB 5MP6H 5HHNA 3R4DA 5I18H 3TO4A 4Y2DD 1FG9C 4MS8D 5AYUH 1RI8A 3LD8C 5FYKH 1G84A 4L3CA 4EIZC 2D4DA 5INDB 3X3GL 5DUPL 2VDML 4PLJC 4OUUB 5IJKC 5D2NB 5K9QG 5I1EH 1KC5H 2BK8A 3GSOA 2VDLL 4NM4L 5L2KB 3NA9H 1WITA 2DYPB 3HNVH 1CU4H 1C7TA 1J0YA 2GJZB 1V7NL 4U1IB 5E24E 3R1GH 1MHEB 2CUMA 4YK4C 5IEKB 4FQCL 1MY7A 1IC4L 2AK1H 2ZUQC 2W1NA 3QDJE 4YHZL 5HVWA 1CT8B 2JTDA 4TOYH 1CE6A 2XKUA 4LSTL 4GFTB 5DEGA 3LN9A 4NFBA 1ADQL 2IBBA 2B1AH 3MRBB 4PG9A 4PRPA 1CG9B 4PR5B 5JIHA 2KUTA 3T08A 1C1EL 1LILA 1OAXL 1S78D 3PHOA 4EDWH 3K46A 1J8HE 2YD6A 3IDMA 1H15A 2FX7H 3FMGH 5EU5B 1MREL 1H3XA 3DUUA 1XF2B 3E2HC 4OFPA 2XKNB 3VXUE 3GDBA 1WAAA 4GQ9L 4WW1A 2HLAB 3TVMD 2OJZL 3P9MA 3RVVC 3JXAA 4HIHA 5DJ6B 3KYOA 4GUPA 1G6RH 2CQVA 5CP7A 4FABH 1QRNB 4JPVH 3ZKMC 1N64H 4KDWA 2J2ZA 4A2MA 5HD8C 1PG7L 1EBPA 2GJ6D 4OLWL 3WXVH 1MELA 3HUJE 4YDLC 5C08B 4YGVB 1ZLWH 4UNVA 4MCZB 2OZ4L 3KXFD 2OTUA 1JF6A 1CGVA 3O4OB 1XGRA 4NQCD 1WFUA 5IG7A 2PCPB 2Z4QB 5IVOA 2N1KA 3QXDA 5C0AE 4X4XA 3RGHA 1MF2H 4NO2A 3MFGB 5LQBL 3MYZA 4OCSH 3ARGB 2NLJB 1V05A 1KIRB 3LAFA 3BT2L 4Q2ZB 2QHLA 4YAQA 3O8XB 3U9PH 3OZ9L 1IVLA 1FZJA 4PP1D 4AT6A 1YY8B 3MQIA 4CNIA 2ARWA 2VL5B 2V7NB 3H9HA 5D93C 4PJIB 3P77A 1TTGA 1INEH 1WK0A 5E03A 1IGJB 1IEBB 1KPRB 2LU4A 3FQWA 2GTWB 2H2SD 3QNYA 4M3KB 2DI7A 4Y4KB 3TA3B 1ZT1A 3V79C 5C3LD 2ILLA 1TVBB 4LPUA 5DTFA 4CVZB 1CXEA 1LVEA 3SN6N 1X5YA 2VLRA 4OCNC 1U2CA 2OJEB 1S9YA 5JORB 3O9WD 4E42A 2FZ3A 5I17A 3GSVB 1E6OH 4JO3L 3NVQA 2B4CL 2R2BA 4XCEA 5IV2B 1UXWB 3RI5F 3AROA 1W72L 4PJ5A 4ZPTA 4BJLA 1CGYA 3IRPX 4L8DA 4FA8A 4PLNC 4HQQL 3DXAE 2H3NB 4ZOEA 1K9TA 4KPHH 5E4EB 2C26A 1Q0YL 4P2OC 1DEEA 1I9JH 2DN7A 1CFSA 4XNUL 5FO7B 4Q58C 3UTTB 3WSQL 3MRHA 4EIGB 2ERJC 1F6FB 2IPTL 3FO0L 3U7YL 3V8OA 4YNYB 1MFAH 3QWOA 3ELAT 1Y0LA 4X6BA 1UGNA 2FO4B 5C09E 2UV3A 3FCTB 3DX6A 1ZK9A 1S7SA 1WVZA 2OI9B 5KSVB 3IAPA 2HTLD 4JY4A 3HFML 4C4KT 1E4WH 1MCCA 2ZUUA 3FO2B 4V1DE 3UZQA 4PJ8C 4Z7WB 1D6EB 1JL8A 4YX2H 1T83C 1D5IL 1Q9KB 4XNQB 3RKPA 4O4YL 3W11C 2VITB 3QUZA 1LK2B 4Z7VE 4JQXC 3FHQA 3OB8A 3QUYC 5F7HA 4PJCE 2UVFA 5IQ9A 4Y4HA 4LQFH 1A1MA 5ESAB 4M6NH 4YDJB 5A40E 3O6LL 4EI5D 4NO0A 1BLNA 5EUKB 3VFGL 5JLZB 5GJTL 1G0XA 1E4XH 1HEZB 2DQIL 2FX9H 3MGTA 4AH2A 4TUJA 4PD4K 1DANT 4JFZL 1L4IA 3JWDL 1VFBA 2XZQH 3LIZH 1ACZA 4PBVC 4Q9QH 3TT3H 1DUYA 3NACL 4JKKA 4LL9A 4N1CA 2OYPA 1HQ4B 3V5HB 1AGBB 2FIRT 4KQ4L 1SEQH 4ZAKB 4UQ3A 5JIIA 1F11A 4AM0B 3ARED 4XI5D 1YEKH 2G5BA 1KJ2H 4J3OC 4OD2B 3T2PA 4ELMA 1FL5B 5FCSH 4J3WA 5GGUA 2BNQB 3P0YL 2JJSA 4Z8FL 5T1KB 1DQML 1TZHB 2ORBL 4KMQA 1Z3GL 1WQVT 1VCAA 3TZVB 3WJJC 1OP9A 4GBXB 4UBDD 3VD3A 1QFWH 3JTSA 5C6PB 4OIIH 3ARXA 3QIWC 1CIDA 5C2UB 3U79A 3MRLA 5I15H 4PJDA 4OQTH 5D7SH 5D7LA 1KGCE 3FT4A 5FA3B 1NDMA 2R1XA 3L5XH 3IF1A 3PQYD 3DVIA 5F9AC 4XAWH 4JFOA 1MPAH 5FCUH 3TJHD 1NKRA 5F1IA 1BD2A 2PTUA 2R0LL 2W59A 5HGDA 4MQSB 3BVNB 1QFWM 3P3YA 4RIRA 4Y19A 2X4QB 2YMXH 1I7ZA 3MXWL 3MXVH 4JFDB 1HOCA 4WU5B 4LBEB 1YQVH 3RWIB 4ZUTB 4DGYL 3BZFA 5F7EH 1Q9LB 4GMSL 4NCC2 1YY9D 5E6YA 2HRLA 4NOFA 4YXLH 5DMIL 1Z9SA 1D6VH 4KRPB 3ULUF 1JWUA 5TH2A 2V2TB 3KPTA 4FQHB 5CWSB 4WDIB 3MJ9A 2XACC 1EIBA 5DO2D 5GQBA 4LU5L 5ADOL 2AVGA 4EOWL 3GIVB 1DCLA 3GJFH 3MJGX 5BRZE 5KSBE 5H8DA 5INDA 5D71H 4RGNE 3SGKA 2UUDH 4XWOC 5D2NA 2ICWI 3PWPB 3Q5YA 4G7YL 3AC0A 5D7IF 3ULUD 1YDPB 4L9LA 5CEZD 1WT5A 2CKNA 3BP5B 2GJZA 3WD5H 3FQUB 1IZKA 5I1JL 1MHEA 3K2UH 1E4XI 1OTSC 1Q72L 5IEKA 5EU3A 2XZCL 1HE7A 1UB5B 4NZUL 1CT8A 2LE9A 4I0PD 4KXZH 1CF8L 1EGJA 3P73A 3NCYP 4JDTL 4KMTL 2R69H 1AO7D 2DQGH 1T04B 3BO8B 3FRPG 4B0MM 4RGMC 5F9WB 3RIFF 3MRBA 3LSOB 1T1ZA 5IMLB 4MXVE 1CG9A 4KROB 3D3VD 3LKQB 1N7ML 3PABB 3U46B 3G5XB 4M93C 5J9PA 4ALAH 3REVB 1NGPH 5EU5A 2EXWD 5EIVA 1XF2A 3IRZA 1P7QB 2XKNA 3SDYL 4BZ1H 4XPAL 5DJ6A 4TSAL 3W39A 5E5MB 1F3JA 5FYLD 4JO1H 3GJEB 3WO4C 1QRNA 1QFWI 3Q6FB 3HAEG 3HMXL 3LN5B 3QDJB 5HXMA 5HGHB 1I7UB 5E2JA 1RJCA 1XAUA 5T1DH 5GGQL 1JBJA 5HD8D 1UENA 4YGVA 5C08A 2LAGB 3KJ4B 4MCZA 4PGBB 5DD3L 5JOFA 2M2DA 5CJXC 3DVNB 4CADB 4HKJB 1SY6H 1RUPH 3K1DA 1A6VL 5B22A 4XNZB 1PEZA 4G3YH 2PCPA 2Z4QA 2ICEA 4P57B 1SM3H 5FHBL 3M17A 1W2KT 4KZDL 3ARGA 3VXUB 2NLJA 4EUPH 4O5LH 1R3LB 4KAQH 2BHUA 4KVCL 4Q2ZA 4LP4A 3O6FD 3O8XA 1I8MA 2IADB 1ETZB 4B7IA 2BJMH 1Y6NR 2UVEA 4RX4D 1MFDL 3QFJA 4Q7DA 4HIXL 4XP5H 3AAZB 2IG2L 1XF4B 5ADPL 4RFOL 5J7CC 1HH6B 2G2RA 3GSNL 3HUJB 4OZFH 4PJIA 2R0WH 3SQBA 1IEBA 4ZDHB 3OAUL 3KR3L 4Y4KA 4G6ML 1EHXA 4UUJB 4X7EC 4M43H 2AJSH 1B88A 1TVBA 1TJGL 3MACH 4CVZA 5C0AB 1QQDB 4ZTOL 1SMOA 3F7PC 1DQTA 5CHNB 4K8RL 4OCWL 3V6ZA 5JORA 3SDCB 1KLUA 3FB6B 3GSVA 4LHUD 5CFHA 4G6JH 3U9UB 2COQA 1UXWA 3PNWB 4HWZB 5IHUH 2BHYA 1JF5A 1PZ5A 3RWCA 3MRQA 4G8IB 3BJ91 3K4AA 1OPGL 5CGTA 3A0OA 5D70L 1JYWA 5FO7A 4QRSA 4HPOL 4P2OD 3BDYH 4JR9L 4G5ZL 2D7NA 5GRJH 4HFUL 4O2FB 4YNYA 4YBLB 2W38A 3WNNA 4LSPH 2FO4A 3FCTA 1L6ZA 2HFFB 3QEQD 4ZO9A 1A14L 1D6EA 2EDEA 5EOQH 4H1LB 3TO2A 1G9ML 4XNQA 1IE5A 2MHAA 3MJ6A 4PJ8D 5CBEB 1M7XA 4K71C 2AAVA 3K8MA 2VITA 3U1SL 1U8OB 1LK2A 4NKOA 3DYOA 3VDAA 2FATL 3DXAB 4MHHG 2YUVA 4WTXA 5D1ZC 3W11D 2QSCH 3HE7C 3H3KA 4QRRA 2VISB 2Q87A 5ESAA 4NBZB 5E5UB 5C2BH 2HT2D 3T0EC 4OT1H 4Y4FA 5DQDL 3IS0X 4B7LA 1MLCB 5I66B 5KVGL 2E6PA 3CUPB 3N50A 4JM2B 4FFZL 3RX8A 5C09B 2VZ3A 5EUKA 5DA0B 3T0VA 3QDGE 1HEZA 1RZGB 4FZ8H 5CLTA 2VZSA 4I9WD 2AJVL 3QXTA 5SWSE 5C0DA 1JI2A 1MFEL 3E6HA 5I1IL 3F6IA 1P9MA 2CKBH 3WXWH 2DBLH 3UJJL 4Z7VB 2G60H 4L4VD 3HG1A 4PJCB 5HI4C 1FBIH 1HQ4A 3V5HA 1H0DA 4BUHA 1C16B 2EC9U 5A16B 5DK2B 1JGLL 4ZAKA 4XH2B 3MRMB 4AM0A 3QEUB 1U8HA 4OD2A 2A77L 4K7PY 4WU7B 5BV7C 1FL5A 3OHXB 1C12A 4PJ9C 3NCJH 4WUKH 2BNQA 4P3CL 3VWJB 4OLXH 1QVOB 5T1KA 4P4RA 1TZHA 4LSSH 4NP4L 1Z5LB 4Z7OE 5I1KH 5F7NC 3P4OB 3TZVA 1WFTA 1LO5B 1BJ1H 4GBXA 2CIKB 5FGBA 4K3GA 4ONGH 3KPMA 3EDKA 4FP8L 1T1WA 1F90L 1CGWA 2BX5A 1P7KB 5FB8B 1MJ7H 2JJTC 4WIQA 1F02I 3QIWD 4HDIB 2AXJA 1HXYA 1QSED 1IKNA 3N1FC 1FORL 2AJXH 4NKDA 4P46A 2ATKB 2IBZY 1L0QA 1JNNL 2OK0L 4FXGB 1UVQA 5HYQB 1MAKA 2R2HB 3I6LD 4P5KB 4GAJH 4U6YB 2JJVA 2MFNA 2LQRA 4DKEL 1MFBH 1BQLH 3OKNB 1KBGH 3JVGA 3L3OB 4JFDA 4JHWH 3RWIA 4PV9B 1YEHL 4ZUTA 4BKLB 4Z7UE 1F6AB 3RHWK 3RUGF 1IKFL 4K7PX 4YXHH 3MSPA 4IOSD 4J6RH 1NL0L 1FZKA 2EYRB 1JK8B 5HTSA 3MV9B 3DVGB 2CRMA 4L3EE 1H3VA 2D7TL 5FUCC 5CJ8A 2W0PA 4WDIA 5CBAB 2W9DL 4FXKB 3WL9A 3D2UD 4ZFZB 1GAFH 3RJQB 3CX5J 1NFDA 1XGQB 4JQIH 3GIVA 5I19H 4ZXBC 3DBXB 3CK0L 2VAJA 4C56D 4OI8A 3EHBC 4GW4B 1IEHA 5T3ZD 3MJ7A 5IVXA 1WZKA 1ZANH 4YQXL 3HRPA 4MXQD 3VRLE 3BHBB 4JFFE 6FABH 5HYSB 2IBZX 1NMCB 3PP4L 2EKSB 1YDPA 4ZD3L 3BQUB 1RZJL 3BP5A 3FQUA 5EO9B 3PL6C 5ACZB 3MLYH 1UB5A 4H25B 2DKMA 3E6FB 3WEXB 1AD9A 1HHGB 1CL7H 1L7TL 1RK1B 3OKMB 3RWEB 3O81A 3EFDL 4I3RH 3BO8A 1T04A 4L3AA 4LEXH 5HHXH 4R8WH 3F5WB 3DJ9A 3SDDC 4X7SL 5DEFB 2VAAA 2CXKA 3H3BC 3LSOA 3U36A 5IMMA 5IMLA 1U91B 4UDUB 3LKQA 5EZOL 1BHGA 3U46A 5GRUH 2A1WL 1FO0L 1P6AB 4DUVA 3REVA 1U8QB 3RZCD 3T09A 3RTQD 4U0RC 5C07D 5GGRY 1JGEB 1S8DB 1IM9B 5FYJU 3SBWC 4ERSL 1NMAL 3G6JF 4YFLI 5HGBA 3EKCA 5SWZE 3D0VB 2ICWB 1KJMA 2VLKE 2UZIH 5KW9L 3GJEA 1NAMH 1HZHH 1TQBB 5ELIA 1OAQH 3Q6FA 4U31A 3LN5A 1F13A 3QDJA 1PEWA 4N90E 5HGHA 1KIPA 1I7UA 3RP1A 3BZEA 5FGRA 2VSDA 3Q3GB 5ILTH 3CU1A 4M7KH 4Q6IC 4QTHB 1MLBB 5GIRB 4M4PA 4PGBA 2X1QA 2X1WL 4MMXC 5BV7H 4CADA 4HKJA 2JJUA 1K6QL 3M8OL 4NOBA 5JHDD 3BH8B 5GRZA 1BJMA 3O2VH 1J8HA 5HVGB 4P57A 4OFYD 4GKZB 2YD8A 3BKYL 5EG6C 4QXUH 3VXUA 3A6BH 1A9BB 3WE6B 3EO0B 3VXRE 1KB5L 2IADA 1WISA 1PBYA 5D96C 3VI3F 1NC2B 3BKMH 5DFVC 1KJ2B 3GMLB 1RK0B 5EU6E 2MSPA 5HI3C 2NMSA 3JTTB 3HTLX 4OM1H 3IFPB 3AAZA 5LXGH 1XF4A 1HH6A 1JWSB 3HUJA 4G80B 1BQHB 4C58B 1RY7B 4X83A 1IBGH 2YKLL 4OD1L 1I7TB 1KELL 2XZAH 4ZDHA 4U0QB 4LMQE 4EN3A 4OF8A 4UUJA 1GGYA 4WRLA 3VD5A 1NBVH 1JPTL 1RIVH 1U93A 1QQDA 5C0AA 5JZ7D 1KCUL 5CHNA 5F7MC 2DQDL 1KXVC 1QBMH 3SDCA 2I07B 2Z9TA 4U1KB 4XGZA 4HWZA 2EDRA 4M5YL 1MCNA 1MSPA 2Z92A 4QNPF 2QKIB 4G8IA 3X3FH 2D2OA 3NZHH 2YRLA 2CMRL 3HZVA 4LAJH 4M4RA 1LE9A 5DWUH 5BVJB 5C92A 3QIBD 2EDYA 1H3TA 3MNWB 4MJ6B 5AD0B 5EC1B 1CL7I 2F8VA 3S37L 5JUEH 1T5WA 4NRXB 5JIKA 3K81A 4JG0L 2HFFA 2DMCA 1KEGL 3W2DL 1R24B 1NDGB 3RKDC 1OAZL 3O6KL 3DMMC 4Z7NF 4H1LA 3VG9B 3ARBC 3LDBC 2OMBA 1A6UL 2MKWA 2VQUA 4FQXB 5CBEA 3L6FA 3I85A 5TE6L 1U8OA 3GJFB 4UILL 3DXAA 2QQNH 3DUSB 3C6LD 2VISA 4MA8L 3TWCH 5D1ZD 4K3EL 3V4PL 4P5TB 1I3GL 5BZWA 4QXGL 4GRWH 3TT1L 4LCIL 1MLCA 3LKRB 5I66A 1MCDA 3T0ED 3QUKB 1ROWA 4P9ML 3CUPA 1S9VB 4JM2A 5B39G 4DW2L 5C7XL 1VGEH 5C09A 3VXNB 2R23A 5DJZB 2R8SH 2X1PA 1OSPL 2CGRL 4JANB 1DUZB 2DMKA 5ALCL 4V1DA 4D2NA 3ULVL 1BBJA 1CIUA 1SQ2N 1UZ8B 3BRFA 3VXSE 4KUCF 3TCLA 4JJ5B 5T33H 5FGCE 4JRYE 1O5DT 1B0RB 4PJ7B 5KS9E 4XP9L 4Z7VA 3KJ6H 2Q7NA 4PJCA 4RRPA 1BIIB 4Y5VB 4IDJL 5EZIH 4M1DL 1C16A 1QACA 4KUZH 1IGML 3OBAA 5A16A 5GGVY 5HI4D 3PGCB 4XH2A 1U3JA 4XVSH 3MRMA 5D4QA 2Z91A 2P43B 3ZDXF 3P9WB 3QEUA 1C5CL 4WU7A 3HLAB 7FABH 3T65B 3SKNB 1REIA 3QNXB 2DQJH 3I2CL 4KUCD 5K9JH 2NY4C 4QRQA 2I5YL 5CKGA 1Z5LA 4LAQH 4OZGE 1T2QL 4PJ9D 3P4OA 4TVSa 5DVLA 4AG4H 3MFFB 3QDGB 1LO5A 2EH7H 3U0WL 1CTOA 2CIKA 1F4XH 1A5FH 5SWSB 3NN8B 3MGOB 2E27L 4XCFL 1XIWB 2YPVL 3WS6C 2ZPKL 2FJHA 4BH7A 5A1AA 4HDIA 3NA4A 5I8KL 4JN2B 2IAMA 2JCCF 3IB4A 4NRYB 1J9CT 1BF2A 4FQ1L 5IFJA 5F9OL 2ATKA 3LN4B 2VDQL 1X44A 1EMTL 2X4TB 2IMNA 3T2NH 2YC1B 4EUPB 1WWCA 3IGAB 4LCWE 3PGFH 4LSRH 2R2HA 4P5KA 4UV4L 4NJ9L 4XAKD 3DROA 4U6YA 1FNSL 5TPWH 1NEZG 3CSYB 3BPLB 3S3JA 1VPOH 3L3OA 2OTWB 1NC4B 4E9LA 1FHGA 4PV9A 1UZ6E 4BKLA 2YUZA 4KC3B 2CLRA 4Y5YB 3FOMB 3EDDA 1MCKA 5JO5B 5CD3B 4YR6B 4K3DH 4WO4B 1FG2B 2MTPA 2NY5H 3GSNA 4LIQH 2B5IB 4MAUL 1BVLB 2EYRA 1JK8A 2CDFB 2WBJC 4KTDL 2GK2A 3DVGA 4ESKA 1J1OH 3VWKA 5CBAA 4FXKA 4R0LB 5H37G 4ZFZA 3TM6A 1NUFA 3ME0A 1XGQA 3VA6A 2APXA 5HYJD 3DBXA 3SGJA 1AGDB 1M71B 3BXNA 1NCWL 4GW4A 5I1CL 4NZRL 4K23H 4ZXBD 3B83A 3JWOL 1P4IL 1Q38A 2D7PA 2EDOA 3OL2A 3EHBD 3CU7A 3QCTH 4U1JB 2DM3A 3QG7H 5HYSA 2YSSB 3SE8H 3AGVA 2FX8H 2EKSA 3R06B 3BQUA 4JZJA 4Z7UB 1S7UA 4RMWA 4GRWE 4OIBA 4CAGA 5EO9A 3ZHKA 1OF2B 1GC1C 1KEMH 3IDYB 5ACZA 5EUOF 3BRDA 3E6FA 3KYNB 3WEXA 1KF9B 1HHGA 3PL6D 1RK1A 1QOKA 2ICWJ 3DX7B 3RWEA 4ODVH 1YNTB 4L3EB 1TJIH 4U2YA 4H26B 3F5WA 3LB6C 5FHAL 4WV1C 4IMKA 4KI5C 3X12B 5DEFA 4QT5A 4GMTL 3PV7A 2PNDA 1U91A 4UDUA 2YZ8A 5BRZA 5KSBA 5HVFB 3BESR 1LP9F 2GYSA 2WBKA 1U8QA 3OKDA 5F7LB 1FZMB 1PSKL 1NCDH 3HPJB 3HZKA 4RFNC 4JFFB 4X80L 5GRVL 5L8JB 3PWNB 1JGEA 1S8DA 1Q0XL 3I3DA 1U58B 4K7PH 3QA3B 2X4OA 4JZOB 1ZVYA 3D0VA 5D72L 2NY7H 4NQDD 1G9NL 1A7NH 2WLZA 4BH8B 3PP3H 3MX0A 2I26N 5JHLL 3PXJA 5FA4B 1KN4L 4HWBL 4JQVC 1X5XA 3Q3GA 4LRNL 4IBLT 4TVPL 3TYGL 5A2LH 1EV2E 1DZBA 4NFDA 2YK1L 1WCQA 4YFEA 1PZUB 1ZSDA 1B2WH 1Y18B 1U8IB 4I3SL 2HKFH 4PB0L 3FQXA 4OBRA 4GKZA 4YHNA 4I8DA 2GQHA 2YR3A 1IC7L 1SMAA 2BNUA 4NNXA 4Q9RL 2NZ9C 2VDNH 3HZMB 1A9BA 1JNLL 3VJ6B 3WE6A 3EO0A 1EAPB 2GJ6E 4ZPVB 5SWZB 1NC2A 3GMLA 1RK0A 5AZ2L 5IBLC 2VLKB 2DJUA 5DQJB 3JTTA 2AABH 4MJ5B 3KXFE 4X9IA 3IFPA 3T8XB 1JGUL 3C08L 5D8JH 1JWMB 5F7KC 3WNPA 3HNSH 4XMLH 1JWSA 2EYTB 2Z31C 2FDBP 3QWRA 4NQCE 1BQHA 5SX5H 2VE6B 2A73B 4W6YB 4NQVB 1BFVL 5DUML 4C83B 2Y72A 3W82A 2YXFA 1YECL 4LVEA 1KLGB 5I2IB 3OG4B 4UV7H 4UTAL 3RNKA 3V6OC 1TETH 2X89A 5JW3L 2I9TB 1MI5B 3BISA 3ZMRA 2I07A 4GO6B 1R5VB 1NLDL 1H3UA 3VXRB 5DI8B 1KENL 3P4LA 3QDMD 3MRGB 3ZZ1A 1MJUL 2O5YH 3RDTC 3U30C 1JYNA 2E6QA 1SJVA 3V7MA 2ZUXA 2R4RH 1AIFB 5BVJA 2BXYA 1VENA 4HG4J 2ZCLL 1J0IA 1I9IL 3HAEH 5AD0A 2AKRB 2FGZA 5EC1A 3MLVL 5LGHL 4MXWL 1F4WL 1RUKL 3T0WA 1YN7B 3IAGC 4PRDB 1NDGA 4R2GB 3H9SD 1U8NB 3RKDD 1BVZA 5BXFB 5E1AB 1UEMA 4BQ6A 3ARBD 5LCVL 1CGXA 1U8PB 1EJOL 4U1GC 1CYGA 4LPTA 1MHPL 3AXLA 3ARWA 2B0SH 4EBQH 2QSQA 4ODTL 3EYSL 1S9WA 4A6YL 4M7LH 4G6FD 1RIHH 4R4FL 1FLRH 2XFXB 3LS5L 1S5IL 2X4UB 4MB5A 3SO3C 2F58H 3IJHB 2W9EL 4KQ3L 3LKRA 3QUKA 5HSFA 3VMOA 4NHCL 1L9NA 2RQ8A 3WNLA 2LTQC 1CXLA 3VXNA 2ZUWA 1JHTB 2A9ML 3B5TA 4O9HH 4JANA 5I1HL 2ZKHL 1DQDL 3LS4L 4JLRB 1YJDH 4HXBH 3U0PB 2VDKL 4OCYH 2VR4A 4JJ5A 5FM5M 1B0RA 4HUNB 2R56H 3ULUH 2P8PB 3KDMB 4JG1H 5AZEL 2AXFB 1IAKA 4Y5VA 5EFIA 4YBQD 1GOGA 3VMPA 3ETBF 1AGCB 2Q86A 3PGCA 3CFDB 2VQ1B 1DBML 3RBSA 1CFQA 3VCLB 3GK8L 2EO9A 2MNUA 3RVUD 3HLAA 3SKNA 2PO6C 3QNXA 4Y1AB 3ZE2F 4OLYL 4Z9KB 1OCWL 3VFPB 1NAMB 4UAOB 5FOJA 3EOAB 4P23B 3QDGA 5DK0B 1KCVH 3MRJA 5SWSA 3NN8A 4S1QH 1IGFL 2P8MB 3MGOA 4S2SB 1ODAA 1XIWA 4N0RA 3J7HA 1M7IB 5FGCB 4EXPX 1F4YL 1R3KB 3L5HA 4NRYA 3UYRH 2BFVH 4D0DB 2WM0A 3L7FA 4WW2F 2VZOA 3LN4A 1FNEB 3TF7C 3GO1H 2X4TA 4U6XA 2YC1A 2DQCL 3B9KC 4YHLL 2L7UA 4HC1L 4MQXC 5C6WH 4H88L 3LQZB 3WCYA 1ZLUH 2X05A 1T1YA 2JIXB 2L7JA 3CSYA 5KSAD 2IMMA 2BRRL 2GITB 3RPIB 3RFZC 1KB5A 4OZGB 1G7MB 2OTWA 1UKTA 2W0LA 1XF1A 5CJOL 1LNUB 3E8UH 4HF5L 5FKAB 3WO3B 1IAOB 3PQYE 4X8JA 5JO5A 5IMKA 1A6WH 4YR6A 3G5VB 4O00A 1QSVA 2VXSL 2I24N 4WO4A 1FG2A 5KVMC 3MBEC 2B1HL 5T1MB 4K9EH 2NXZC 3MV8D 3BPNC 3UTZB 2CDFA 1PYWB 1KV3A 4MD4A 1NCUA 2WBJD 4R0LA 5DT1L 3CPLB 3RWJB 4C4KO 4PJFF 3ARPA 2MMXA 1MCEA 4LCWB 2VNCA 4YXKH 3U2SA 5DRXA 5DD5H 4NGHL 5FM4A 1I1AA 3UTPD 2F5BL 4B41A 4FNLL 2GEEA 3KPLA 2CJUL 2ZCKH 2YSSA 5DXWA 3R06A 2A9NH 3HB3D 1XFPA 3HNTL 4Q9BA 4N1HB 2ITDA 5DVNA 1OF2A 3ILPB 4YE4L 1ERNA 3MUHL 4Z0BL 3U7AA 5D1QB 1DFBL 1G0YR 3DX7A 5LGKA 1WTLA 1EEUA 1YNTA 4L3EA 1NAKL 4S1RL 2OP4H 3FQNB 4NKMB 4ONHB 3X12A 5GS0L 2ZCHH 3SKJH 3ULUE 1CD1B 3LEYH 3MA9L 1RUAH 3H9ZA 5CEZE 4IIQC 1G7PA 5EU4B 4L1DA 2V2WA 5FYKL 4FQ2H 2X10A 5IB1B 3QRGH 4YDKL 3PWNA 5D7JD 4JFED 1U58A 3QFJD 2J7LA 3KPPA 3NFSH 4JZOA 1INQB 1U3HC 3G9AB 4GRWB 1PY9A 5I1EL 1AO7E 3MCLH 1UCTA 2BRQA 4QXTB 1KXQE 1HWGB 3NA9L 5I75B 4J3SA 5GJSH 4NRZA 1J10A 1A4JB 4UDTB 5FA4A 3VI4F 4Y2DB 1YNKH 3R1GL 3D3VE 1GYAA 5DJXB 3TBSB 5D7IE 4H0GA 2AK1L 1NANH 5F89B 3D18A 1KYOJ 4TYUA 4TOYL 2OCFD 2V9RA 5MEQB 3FT3B 1Y18A 3F6LA 4KRMB 2VKXA 4HS8H 1PDKA 3RVWD 5MI0C 4X99B 1QRKA 1LDSA 2DIBA 4X5XB 5I73B 1GL4B 5FYLE 4E0RA 4RMUA 1YMMB 1CDBA 3V4UH 1UFUA 3MRNB 3PV6B 3HZMA 5C0BD 3VJ6A 3D39D 3DECA 5CIPH 3AY4A 3CCHB 4ZPVA 5SWZA 4FTVD 2NZ9D 5DD1L 4M8QB 4AL8L 4K2UL 3PE9A 2VLKA 2B8OT 4MJ5A 3GBNH 4KY1H 1G6RL 2FR4B 3OJ2C 5C0FB 1JWMA 3VGBA 4FABL 5I74C 5I0ZA 4V2CB 4JZNA 2EYTA 4JPVL 3QQ9D 1FL3B 1N64L 2H41A 2Y9RT 4RZCA 2VE6A 3TPUB 4BK5A 2Z31D 2A73A 3WXVL 5ISZD 4PTTB 3TVMB 2DLTA 4DTGH 2YWZA 3LQAC 2X4RB 4XVJH 1KLGA 1E28B 3G5ZB 4OF5A 1K8DB 3D1MC 2I9TA 5E8EB 1MRFL 5JPMA 5I8EB 4QRRD 2PXYB 3VXRA 1DQLH 1MF2L 1CFVH 2XOTA 5DI8A 2I27N 4GAYB 5EU6A 4P2QA 3MRGA 3ARFA 4Y4FD 3VE0B 2PN5A 3CVIH 2CXGA 4P3DA 3KXFB 2WUCL 3U9PL 3HE6C 1KIUA 3RDTD 1AIFA 3JUYA 2P1YA 2DQTH 1PKOA 2E9WA 4NQCB 1Q9OB 4HLJA 1HI6B 3GRWL 3B8SA 1DQJB 4Z5RB 2BSSA 3S35X 4IEFB 3OKYA 3OSKA 5BS0A 3QO0B 4PRDA 5IESL 5J12B 1CE1L 3GI8L 1U8NA 5BXFA 1E27A 5E1AA 2WW8A 1OAUL 3HG1D 3QNZB 2HYMA 5T3XL 2A38A 1FGVL 3WFZA 1FFNB 5E7BA 4I0CC 1KPUB 1EX0A 1E6OL 1ES0B 4KU1A 2GKIA 3BH9B 2R0ZH 2XFXA 5E99H 1A4KB 1U8KB 3N85L 2X4UA 5HHOD 3IJHA 1IT9H 3QEQE 3N1PC 2B20A 1I9JL 2IAND 2PKDA 4IS6B 1I8LC 1ZMYA 5E8DH 1X5KA 1SVZA 2GHWB 1N6VA 3O9WB 1NANI 4QTIH 3QIUC 4X6FB 2X4PB 3PXHA 1ULVA 1XGYH 3MODL 1X9QA 4JLRA 4LF3A 4MQTB 5T3ZH 3U0PA 4APQC 2H2PC 5GZOC 1RMFL 3HZYB 1GZQA 4F37K 1T0MB 2VLME 1GHFH 1E4WL 4P9HH 2EH8L 3KDMA 4ZUUB 4YX2L 3RJDA 1R0AH 1Z9MA 4BZ2H 2YBRB 3TN0B 4J7RA 4BFIB 1A2YB 1S7RA 3MLZH 4LCCC 1AGCA 4DAGH 1FSKC 3LKOB 3FO9B 4G9DB 2VQ1A 3QI9A 4KFZC 3HS0B 1GGCL 1LWRA 4XNXL 3QWQB 1B9ZA 1QHPA 1RJYB 2W07A 1CDIA 1NFDF 3DURB 4HZLA 4F7MB 5FFLA 4I9WE 5DMGC 3PWJB 4M6NL 1N5YH 5F96H 2W91A 4PJGF 2O5XL 3VFPA 1NAMA 3AVEA 3A6OA 3EOAA 5T1LD 4P23A 4WWID 1W0WB 3A6CH 1GGBH 5DK0A 1ZHBA 2A6IA 4IOFC 1I85C 4O2CA 1PVHA 2P8MA 4L4VE 4FMFA 3VXSA 1HK6A 2VLLA 4YDIH 1M7IA 1E4XL 1TPXB 2I60H 2FX9L 4JRYA 3DGCR 5KS9A 5FYJH 2FNBA 1BZ7B 5DDHB 1R3KA 2NXYC 2VZTA 4WTWA 2XZQL 4D0DA 4EI5B 2FO1A 4K8RC 5B8CB 1MCQA 3OQ3B 3TT3L 2EKJA 2FJGB 1FNEA 4R9HA 4NQXB 1H8SA 3G6AB 1D7FA 3HI5H 4ZO7A 5GGTA 2N7AA 3LQZA 4O58H 3WKNA 1NFIB 2JIXA 1AHWC 2IJ0C 4XRCA 4MQXD 2GITA 1TZIB 1YEKL 1KJ2L 3RPIA 1CDHA 4OZGA 3IU3A 4XPBH 3MPCA 5IKCB 1LNUA 4YHIB 1QSEE 5FKAA 3EGSB 2GY5A 1IAOA 4TSCL 1A7OH 5CEYA 4DKFH 3G5VA 5I9QC 4DKDC 5ANME 1RURL 4OCRH 2YD2A 43C9B 5T1MA 1JFQL 4OIIL 1XF3B 3UTZA 3AREB 4KK9C 5I15L 4RQQB 1N6UA 1PYWA 3STZA 3X11B 3I6LE 5F1OB 5JW4R 2OL3L 3RWJA 4QRTA 1MCRA 1Q9WA 3L5XL 4G9FA 2X42A 1VFMA 5EORH 3E3QE 4XAWL 1G7IA 3WIFA 4L8BA 4UB0L 2DRUA 3MOBH 1TMCB 3SGDH 2UUDK 4GRLC 1SYVB 2WP3T 5E8OB 1NMBH 1RZFH 2Q3AA 2JELH 3PGDB 4FFVC 1WZ1L 4XBPA 4EVNB 2QADD 3D0LB 3PQYB 3HAEB 3GSQA 1K2DB 3ILPA 4LPVA 5I71B 3SKOA 1ZT4A 4GKNB 2Q8BL 4RA3A 4JVWA 3LEVL 5F7EL 4NJAH 3VH8B 3WFHB 4ELKB 5DRNB 1RUQH 4C56E 2AI0L 5GGSA 3FQNA 5T3ZE 3TC9A 1D6VL 4NKMA 2YPLD 3GM8A 4ONHA 4OCMC 3IDIB 3RUGE 4N5UA 4RNRA 3FAXA 4YO0B 4CW1A 1HHIB 3HHRB 2J5LC 2HTKC 3M1BB 2ZJSH 4GRMB 1OQXA 5GSVB 2Y25A 3VD4A 2V2XB 2NNAB 3O2DH 5CP3H 5IB1A 5GGRB 3SJVB 5D71L 3KS0H 4OJFL 2X41A 1UYWH 2W0FA 3K8KA 3CH1B 5DJ8B 4HBCL 5E0QA 4DQOH 4R97C 3I84A 3MNZB 4M7LT 5F7WC 1X4ZA 3VFMB 4QXTA 3HCVB 4G8GB 4LP5A 4JB9L 1U3HD 3SO5A 2Q7YB 5L8KB 1A4JA 4UDTA 3WD5L 4Y2DA 1BWMA 1MCPL 1DE4B 3AUVA 3K2UL 3TBSA 5F89A 3SOBH 2HJLB 1II4E 2H45A 1RHFA 5MEQA 1MOEA 3FT3A 1JPSH 3ARQA 2YRPA 5C07E 4GSDL 2J88L 3ALWA 3GMPB 1HIMH 4OLZH 1N6QH 2JB5H 1A7RL 4X99A 4X5XA 4JGUA 4X4ME 4PRNA 2ADFH 4LVOB 1LK3H 2XQYG 4LCYB 1OGAD 3MRNA 3PV6A 4P49A 5D7KE 4M48H 4I0PB 2DKSA 1NGPL 3C5ZD 3CZFA 4OB5L 4M8QA 1R3HB 2FSEB 1UA6H 3D6GA 1IGTA 4LOUC 3IDXL 2C9AA 3LCYA 3T2QA 1K4DB 4JKMA 2FR4A 5CZXD 3D3VB 4JO1L 5JHDE 5D7IB 1KULA 3G6JE 1EVUA 1FL3A 1EXUB 4S0TD 3TPUA 5FUZH 4K3JH 5T1DL 2DICA 4QHUB 3C60C 5C8JB 2H8PB 3AS2A 3E2HB 2X4RA 1SY6L 3G5ZA 1RUPL 5E8EA 3MUZ1 4U1LB 2NY3D 4G3YL 4E5XB 4KHTL 3SGDI 4F7EB 2XPGA 1SM3L 2GJ6A 3LOWA 4JKWA 4UINL 3BGAA 3MRPA 1DP0A 3VE0A 4LASH 4OV5B 1CDUA 3KXFA 1BAFH 5L88H 4YDLB 1FCCA 4YWGL 3EJZC 1QNZH 2H6PB 1SJEB 3UTSD 4S1SH 3X14B 3HE6D 4NQCA 5HHPB 3VRJA 1Q9OA 1HI6A 3O0RH 5DVKA 3T77B 3VI3E 4XP5L 1UACH 1LO4H 4Z5RA 5D5MF 2EEDA 4JFQB 1TQCB 3ZL4L 1L7IH 5FF6A 1AXIB 2ADGB 3O6FB 5F6IC 3M45A 4KRLB 3GMRA 3KG5A 2JF1A 4Y16C 4RAHA 3MYJB 3MACL 3QNZA 4I2XB 4OGZA 1GIGL 4HWEH 3QUZC 1FFNA 1KPUA 2M8XA 4PRHD 2VC2L 5MEOB 5FV1L 3T0BA 3FOLB 4KTYA 5D93B 1S7VB 1L9MA 1A4KA 1U8KA 1QBLL 5E2UL 1RZ8B 4IS6A 1RHHB 2AJYL 4QNPE 3V7AG 1NSNH 1HH9A 3O9WA 5BQ7B 3NMEA 4LHUB 2X4PA 5L2JB 4TUOB 1X5JA 4LSPL 4Z76B 1X5IA 2W65B 3EOTH 4F15C 2XYCA 3HZYA 4LDLB 4X6CF 3BJLA 1DSFH 2HH0H 1T0MA 1UXSA 2AV1B 2CO7B 5JW5B 1A1NB 2H2PD 5GZOD 2PTTB 5JR1H 3GIZH 4ZUUA 3T0DA 1CQKA 3OJVC 3FQRB 3JV4B 4OLUH 1QG3A 1XF5B 3T0EE 4PREB 5F6HI 1A2YA 2ERJB 5DJYB 4BFIA 4Z7NE 1KLFA 2R0KH 4RA0C 3LKOA 5C0RH 3FO9A 4G9DA 3HS0A 3QB7C 3HMWH 2QSCL 1RJYA 2YOCA 3QEQB 4F7MA 5JQ6L 3PWJA 1TCMA 1ZGLM 2Y5TB 1ZGLP 2EIDA 3CVHB 3L3DA 5DMGD 3N9GH 1U8LB 1W0WA 2BVPB 4LKXB 1AFVH 2KKQA 3WJLC 4IOFD 1T4KB 5TGBB 4FZ8L 5LG1A 3O2WH 3K0WA 2HP4A 1BZ7A 3VGAB 4TSBL 2RGSA 3MMEA 1TVDA 4EI5A 3SQOH 4HJJH 4WI5A 2NXYD 5B8CA 1F58L 2AERT 4KH2A 2CKBL 3QFDB 1ZLVH 1X5LA 2G60L 4K8RD 4NQXA 2IGFH 4PJEF 3G6AA 1FBIL 2HFEA 2V5TA 2YEZB 3CDGA 4D3CH 2FBJL 3MRDA 1TLKA 4NN5C 4G6KH 5BZDB 1UM4H 1MJ8H 1NFIA 4NDMB 3D69A 3PUCA 1E6JL 1FL6B 4OF0A 5KSBF 1TZIA 4TULH 1B4JL 2PW1B 5I6XC 3G08B 2X5PA 3NIGF 4NPYB 4WUKL 3NCJL 5IKCA 4YHIA 1SVCP 2CSPA 1Q1JL 3ZDXE 3EGSA 2B2XL 1ZTXH 4L4VB 1OT2A 1M7DB 4LSSL 1UCBH 5I1KL 5HGGS 3EZJB 2DD8H 4UT7H 4ONGL 1XF3A 3F62A 3AREA 2EC9T 4RQQA 4PS4L 3X11A 1MJ7L 3AU1A 4XAKE 3BE1H 5EPMA 5IQ7H 2YN5A 2BMKB 2KZWA 4YHYC 3L5WB 3UP1A 5DJ2B 2AJXL 2XTJC 2JCCE 3C2SA 3O3DB 4AY0A 4JRXB 2IEPA 1IM3A 4ZTPL 4LVHB 3SGKC 3NFNA 3P0VL 1HYRC 4WI7A 4XXDB 5IBTL 3O6MH 4GAJL 3QIWB 4OGXL 5E8OA 1HDMB 1KJ3H 3DYMA 4HS6A 4Z95L 1QSEB 5J06A 4GRLD 4EVNA 3D0LA 4LFHG 3OJMB 3PQYA 1NCAH 4FFVD 5H94B 2DTSA 1PG7X 4GKNA 3O4LD 4I48B 5ANMB 2VIRB 1HXMB 5FUCE 3VH8A 4ELKA 3WFHA 3ULVC 5DRNA 2VR9A 1AI1H 5HYJE 4UT9L 4QHMB 5ICXB 3TFKD 4XVUC 4YXHL 4BSJA 3TIDB 4POYA 4NBYB 3IDIA 4TRPL 1HHIA 4QO1A 4LLMB 3M1BA 4G7VH 4IMLA 5FK9A 3H7LA 4GRMA 4JQIL 1JHKL 3NH7H 4GAFB 3Q5OA 2NNAA 3OGCA 2DLGA 4GH7B 2RBLA 4QKXB 1ZANL 4WY7H 3CH1A 5DJ8A 3I75A 4XB7A 3MNZA 3S7GA 1WCBB 3HC0A 3VFMA 4JFHD 6FABL 3MBXH 3D2UB 2FH8A 4WENB 3NIFF 2Q7YA 4YHMH 4ZS6C 4GS7C 1CFBA 1GGIH 1J0JA 4ZFFB 4WI4A 1A6TB 4GXUM 1T5XB 4PJAF 4XHQA 1QLFA 3MLYL 5JNYA 1PQZB 3ZTJG 2HJLA 3TBVA 1CL7L 3RUGB 4I3RL 5EUOE 3CIQA 3O4OC 1KG0B 4LEXL 5HHXL 3GMPA 1OTUD 2WV3A 2DQUL 4PGEB 4XTRC 4NQDE 5KZCB 1T22B 4LARL 3KPRD 5GRUL 4PYGA 4YZFF 3ARGC 4ZSOE 4JY5H 4I0PA 4KJQC 3BSZH 5IGXH 5E94B 5E7FA 3BGMB 1R3HA 1AO7A 3RGVC 2P46B 4N68A 4ZNEE 1LP9E 1PX3A 1ZA6B 1K4DA 25C8H 5DEZA 4RMRA 4RGMB 1DN0B 3W5MA 4LOUD 2DLIA 4ACPA 1U3YA 2P5WD 3D3VA 2NY1B 4J23A 3FFCD 4X5WB 5D7IA 1OAQL 4ZG1A 5E2TL 2HFTA 1J88A 3RZCB 2DLFL 4QHUA 4Y89A 1T03H 4XXCA 3RTQB 5C07B 3TA3C 5BV7L 1FGNL 4XNYL 4N8CH 3C60D 4U1SB 4JDVB 2DDQH 5HPMA 4MWFB 4U1LA 5B4MC 1BEYH 4E5XA 3O2VL 4F7EA 2EDNA 1I3RB 1GGUA 3EOBA 3FONA 5C0GA 4QXUL 3GM0A 4LVNB 5E4EC 3MOAL 2NY0D 1U8JB 4BSWB 3BKML 3MJ9H 3ARSA 3P9LB 5JHDB 2H6PA 4LDOB 3G6JB 4DUWA 4OM1L 3GFUA 3WKMH 5HHPA 3EJZD 3T77A 1P4BH 5ESQB 5LXGL 4HCRA 3WN5B 4MAYB 4BQ8A 1VKXB 2LU7A 4AQOA 5E6IB 2OI9C 2ADGA 4IM8A 4W70A 1MCOH 4KRNA 4URTB 1IGIH 4IOIB 1LO3H 3QDME 4PJHF 1RD6A 4RX4A 1OARH 4PIRF 3KLHC 4Y88A 3QUMH 1NBVL 2H1PL 2V9TA 4Y16D 1BQHG 2ESVD 3UROR 1QBML 1J1PH 1S3KH 1EGJH 3HR5B 1LGVA 5FUOH 5MEOA 5HDOA 1FNGB 3FOLA 4OI9A 4WEBH 4BFBD 5ITBH 4HK0B 1S7VA 1IAMA 1G9NC 3P11H 1X5FA 2VYRE 5DWUL 3H9SE 1RHHA 4N8VA 1BX2A 2AGJL 2JKXA 3MLWL 4LHUA 3CSPA 3NCMA 2OSLB 1X5HA 3N06B 1S5HA 2AK4A 3V0AC 3PDDA 4Z76A 2W65A 1EO8H 1PJ9A 2PUQT 2G5RA 4LK4A 2F53D 4BUGA 2D7MA 4N0CC 4OSUL 2AV1A 1A1NA 4HHAB 3U0TB 4G6AC 1YEJL 3QIBB 4P2OA 3FQRA 4CU6A 1F3RB 3JV4A 1BQSA 4LDEB 4PREA 5DJYA 2V5SA 3EYQD 4TPRH 3UYOD 1I1CA 2YD1A 4HMDA 3GMNB 2QQNL 1JZ8A 5E08H 3QEQA 2HAZA 4ZS7H 3TWCL 1CXFA 3RY6C 3S5LA 5I76B 4PRID 2Y5TA 3CVHA 4I5BA 5CSBA 3LV3B 4PJ8A 3JV6B 3O3UN 3S3SA 5F93C 3T1WA 1U8LA 2WMPA 4NZTH 4WGVB 1YEGH 4GBXC 4ODWB 3QISA 3HI6H 4LKXA 1U9KA 4K71B 2R8SL 3C6LB 3O45B 3O41B 3KNBB 4JQXA 3QUYA 1AQDB 5TGBA 3V6FB 4P0DA 1ND0B 3WIHH 3P4MB 1IKNC 2X4SA 2D7QA 5T33L 3T0EB 4KK8D 3W9DB 4Y5XB 1JN6A 3WUWA 5F70A 1B0WA 4QOKA 5DD6B 5K93A 2YEZA 5AWNH 5BZDA 3TBYA 3PWVB 4XVSL 2EDWA 1FL6A 2ZWLT 1UM5L 3HC4H 4GOSA 4U6VH 2PW1A 3C6SB 4PGJA 3JVGC 4UOW1 4Y8DC 1QZ1A 7FABL 3X13B 4RMSA 1FDLH 1UH3A 2WSKA 5K9JL 4L4VA 1CWVA 1M7DA 5KANG 1CLZH 4AG4L 4XT1C 3ZE2E 5IW3A 2DS4A 1HWHB 12E8L 1A5FL 5J6HA 2FGWH 1OSZA 3KPSD 3QEGH 4LLVB 5C0CD 4ONFH 1HQRB 2BMKA 1TZGH 2Y07L 5GS1B 4PJ9B 2LFGA 2QL1A 1MHCA 3ZT7A 3MZGB 3O3DA 3ULVF 1QPXA 2XTJD 3OB0H 3C09C 3WJJA 1VHPA 4D9LH 3PGFL 2ARJQ 4XXDA 1SYSB 2X4NA 3QIWA 1H5BB 5DFTA 5TPWL 5LBSL 3MV8E 1QSEA 2BSTB 3B6SB 3CSGA 5L2KD 3QQ3B 4XPGH 1FH5H 2DYPD 3W0WD 5ANMA 2VIRA 3SE4C 2C3XA 5J6GB 3BKJH 4WHDA 1OWRM 4K3DL 4JGJA 3ULVD 2NY5L 3ZYIA 5DUPH 1MQ8A 2VDMH 3OPZH 5F9WC 4XVUD 3UTPE 2FLRT 3E0GA 3AFLA 1U42A 4NM4H 3P4NB 4M5ZL 4KROC 5I0DA 1KACB 2JCCB 1OWWA 1V7NH 1T89A 2VZUA 3UTQB 1CE6B 4CMHC 4MSWB 4PJFE 5DEGB 2DQEH 2J8OA 4NWUL 3RI5K 4PJBE 4NKIL 4M1GL 3VFUA 1MFNA 1RZKC 4QHKJ 2DBJA 2FLBT 1WCBA 3QG7L 3PP3K 4PD4J 3D2UA 2FX8L 3PHOB 3IDMB 2E7BA 4UNUA 4ZFFA 2ZUSA 4P5MB 5HYJB 1A6TA 1KEML 1T5XA 2NY6B 1C1EH 2EXYC 4C56A 1WLHA 4X9FA 3GSWA 1T2JA 3S6CA 4ZXBB 4HIHB 3LRSB 4GUPB 1ZGLB 4ODVL 3RUGA 4KHXL 1RIUH 3T3PF 5BOPA 1TJIL 3LHPH 4DWHA 4GQ9H 1KG0A 2OJZH 4R96B 4JFEE 3QFJE 3TGXA 4FRWA 2GAZB 4PGEA 3OTTA 3ZTNH 3JBG7 4MB4A 1T22A 5ALBL 2UY7A 4P2QD 3PL6B 5E94A 2NR6D 3BGMA 5DMKA 1XGRB 1NCDL 4PB9L 4KJQD 1ZEAL 1U6AH 1AXSB 3VXOA 4M9PA 1X4YA 3ORJA 5IG7B 3RGVD 3QXDB 4CKVX 4H0HB 2NY7L 4MDJB 1B6DA 4X5WA 3S36L 3RWDA 5BS0D 5JDJA 5SX5K 3BPOB 4HUUA 5LQBH 1RFDH 1T7XA 1VEPA 5EDXA 5EUOB 1YYMH 4ETQB 3RTQA 1IQWL 5C07A 3BT2H 4Z77B 1FNLA 3Q0HA 5C0BE 3D39E 5HJ3A 3OZ9H 4U0RB 4FTVE 4ISVB 4JDVA 4X4MA 4U1NB 1B2WL 4MWFA 2EICA 4DEPC 1L0YA 4ZSOB 2HKFL 3SDCC 3TH3T 2ZUYA 3SKMA 4W81A 3FQWB 1QA9A 2NTFB 1LP9B 4G42B 3ZDYF 5DTFB 4JY6A 5L0QB 2R9HC 2EEBA 4Q6IB 3ROOB 3TV3H 1SHMA 5ISZE 1T7WA 5JHDA 2DM7A 3G6JA 4GXVH 4MMZC 5I17B 3FZUD 1LHZA 2FZ3B 4TNWF 3UTTD 4OFYA 4YBLC 1MH5B 5ESQA 3WN5A 3HNSL 4XMLL 2J8UE 4ZPTB 1VKXA 2B4CH 3BYYA 4QRRE 3V6OE 3ZYJA 5F3HB 5IFAL 4I1NB 3F7VB 4HQQH 1C5BL 1Q0YH 1N0LA 4PLKC 3VGEA 3MOQA 2VERN 2AJ3A 4F9PA 1XCQB 4UV7L 1NEUA 1Y0LB 4X6BB 2Z35B 3FO0H 3U7YH 2XRAH 1VGKB 2A74A 3L95B 3LY6A 4JY4B 1A7PL 4HK0A 1NCBL 5TQ0H 2XXMB 3KPOB 3HFMH 1DDHB 2GK0B 2F8XC 3DO3A 2R4RL 2FECL 4JM2C 1FVCA 3KS0J 3HG1E 4O4YH 2OSLA 4J12A 2Q8AH 1A1MB 3ARDC 1F97A 2Y7QB 4W4OC 4TVPD 4F7TB 1RZKH 1HHJB 2QSTA 4JHBA 2R2EB 3O3AB 2BVQB 2BP3A 3B2UC 3G6DH 4N0CD 3U0TA 4JVPA 5EB9A 5HHOE 1YNLH 5TQ2H 3BEVB 4JKLA 1GC1L 5E6ZA 4G6AD 2IANE 3UPAA 3VFGH 2B0SL 5CP3A 5GJTH 3GMNA 2ZOKA 4M7LL 5J1SC 4I13B 1FLRL 3H9SB 1AE6L 5E9DA 2A6DA 3DYPA 5I76A 3JWDH 3VWJC 2F58L 1PG7W 1D5ZB 3MA7A 1CICD 1A7QH 4J3TA 3ARBB 4ODWA 1Z9OA 4UQ3B 5F1KC 4GW5B 5EBLB 3C6LA 3O45A 4O9HL 3O41A 2G5BB 1LEGA 3KNBA 5D9SA 1AQDA 4G6FB 5D1ZA 1YJDL 4HXBL 3HE7A 3RPKA 5GGUB 1ND0A 4OCYL 4DFIA 1TDQA 4G9FD 5IB5B 3T0EA 4PBXA 3W9DA 3RIFK 4B5EA 4Y5XA 3IVKB 1JTPA 3JTSB 2MOVA 2ADJB 5EOCH 3UX9B 2ORBH 5C6TH 4D0CA 5DD6A 5DC4B 4KTEH 3BAEH 3ZSTA 2C3VA 4XC1H 3PWVA 4NSKB 5GRYA 1NDMB 4PPTA 2EECA 2A83B 1WIOA 2R1WB 3C6SA 1K5NB 4NQED 2JJWA 5LAXB 3X13A 2BVTA 3EO9H 3BN9C 1B6UA 4P2RA 4KKAC 1TJHH 4DGVH 1JV5B 1U95B 4A2LA 4PJGE 4KWUA 3QG6A 3RVTD 5E8NA 3H3PL 4FFYL 4LLVA 1HOCB 3Q1SH 4F9LA 1HQRA 2LU3A 2NCMA 5J3HC 1FFRA 3UYRL 2BFVL 5GS1A 5F3BB 4PJ9A 1T66C 3SGJC 3MR9A 3EDFA 3GO1L 4XP4L 4GMSH 3S34H 2D4FA 4QCIB 3UO1H 1JWUB 1RZ7H 5EN2B 5TH2B 4H1LH 5CCKH 1H5BA 2EE3A 4DGIH 1RPQA 3V0WL 1ACYL 5E00A 2KZ1B 1NMCC 4Z0XB 3B6SA 4OGYL 3OR7A 2FRGP 5IB2B 1BJ8A 3PWPD 4YLQT 2W60A 4JGMA 3QQ3A 2XG4A 3L3HA 3E8UL 4LU5H 5ADOH 4EOWH 5J6GA 4F3FB 4UT6L 2MQ0A 1A6WL 3ULSB 2E9BA 1QLRA 3HI1B 4K9EL 1VERA 2UYLB 1QR1A 5KSAB 4L9LB 1F3DH 4G7YH 3P4NA 3QUMB 4LSQL 2J6EA 5JXAL 5EU3B 2JCCA 3H42H 2CK2A 1CFNB 4YDVA 1ITCA 5IVZB 5I1JH 4U05A 3UTQA 2QHRL 4WW2B 1Z0MA 4XBGB 4CDGC 4CU7A 4IRJC 2XZCH 3P73B 3AS3A 4MSWA 2BOCB 4NZUH 1HCFX 3GHBH 4DK6A 1CF8H 5C0IB 3BZ4B 4JDTH 4KMTH 1AR1D 1T1ZB 1PGRB 2J8HA 4GAGH 3SE3C 3CAFA 2WBJB 3H7BB 1XR9B 1TQBC 2YPLE 2IQ9L 5ETUB 2X70B 2QQLH 3F12A 1N7MH 5J9PB 4N0YL 4P5MA 1BM3L 5HYJA 3GHEL 1JRHI 5F1SA 1RJLA 3PWLB 4ZXBA 2SEBA 3LRSA 1ZGLA 3W39B 3STLB 4HEME 2VDOH 1KCLA 5I8CA 3IDGB 1F3JB 3S88H 4R96A 4TSAH 3QJHA 2GAZA 3ARZA 4J2XA 5GISH 1RJZA 1ZHKB 4M7JH 1WBZB 2HT4C 4AEEA 1JZ5A 1EEQA 3LEYL 4PJFB 3PL6A 5JOFB 4POZC 4FQ2L 2LV4A 3DSFH 4PY7A 5DSCB 1AXSA 3NFSL 1AR2A 2ICEB 1A6VH 4FFWC 4WV1B 4MDJA 5TF0A 3S37X 3M17B 1CVRA 4XP6H 1MIEH 5GJSL 1R5IB 1GPOL 5IW6B 3V7AE 2FYYB 1I3VA 1I8MB 1FFPA 2W0KA 5EUOA 4ETQA 2BXZA 4DVBB 1OGAE 2ZSVB 4Z77A 1P84K 1CLCA 4JFEB 5D7JB 1CBVH 3QFJB 1D5XB 1N8ZA 4RFNB 2FB4L 4ISVA 5BOZG 4NQDA 3SBWA 3A67L 3B2VH 4U1NA 4BFEA 4UZGA 2G2RB 4HIXH 4HS8L 4YPGB 4ZSOA 5J56B 2NY2D 4ZFOB 1S9XB 2IG2H 4U6HA 5ADPH 3DUHA 2ZUTA 1YZZA 3GSNH 3UAJD 4KKCD 1BMGA 3V4UL 5CZVL 2NTFA 3ALXA 4ZNEA 1LP9A 4G42A 2CR6A 4QYOB 4Y2OA 1ZVHA 4G6MH 1V5JA 1YEIL 4Q6IA 3ROOA 2AQ1A 5E1HB 1CTNA 3U48A 1TJGH 2R9HD 2WP3O 3V6ZB 4ENED 2O93L 4XMKL 1P4LA 3GBNL 3F65A 1KLUB 2JB6A 2MCG1 3TCXA 4IRSD 1MH5A 4O02L 4OCWH 5DRZB 1JTTA 5FDWA 3MLXH 1PZ5B 3RWCB 3MRQB 3D39B 1QEWB 5F3HA 1P1ZB 2QBWA 2YUXA 4U49A 3IFOB 4FTVB 1V3MA 2ARJB 3F7VA 4MGXA 4QRSB 1IAIL 2X9YA 4LGRB 5KSUB 1EK3A 4HK3J 2P7TB 3VG9C 1OPGH 1I1FB 5CILL 5D70H 4DTGL 4FQXC 5TDNB 5GS0D 1BZ9B 4PLKD 4JR9H 1XCQA 4G5ZH 4HFUH 2Z35A 3UTSE 1VGKA 3L95A 5IF0B 2F54D 3DHJA 5IK3A 2Z31B 1DQLL 5FYKD 3WDJA 2OQJA 2R4SL 5ISZB 3TO2B 4P5TC 4BELD 3KPOA 1JMXA 5GZNC 2MHAB 1DDHA 3QCUL 3V52L 1D5MB 3VRIA 4KK5C 2GK0A 1I9RH 1QFOA 1J0ZA 1QLEL 2DQTL 4NKOB 3H2WA 4M9OA 1ZV5A 2FCBA 4MJID 1YYLH 4QRRB 2RR3A 2HMIC 5JA9A 3LH2H 3V2AR 2GTZB 2Y7QA 2FATH 2DWEB 3QDMA 4F7TA 5FEBA 4F58H 1E0OB 4Y4FB 4PRHE 1HHJA 3ARDD 4KDTA 2R2EA 2MJWA 3O3AA 5D5ME 5FXCH 2BVQA 1AXTL 3IDJB 1T6VN 5DQDH 3U30B 3BEVA 1R6VA 3B2UD 1LD9A 3IFLH 3JZ7A 4FFZH 3JUZA 4N1EA 1JPGA 1V8HA 5C0DB 1J18A 3E6HB 4X7DC 4LPXA 4EXKA 2AJVH 2BDNH 3H9SA 2C4FU 2XA8H 1D5ZA 3HG1B 3L3GA 1ED3B 5SV3A 1H0DB 3ARBA 4J1UA 3VWJD 4H0IA 3NPSC 1C5DB 4GW5A 2AJUL 5EBLA 3LKSB 1A8JH 1U8HB 1JGLH 2BCKB 4OCXH 1AQKL 1C12B 2C7UA 4PG2C 5HHOB 2AQ3A 2A77H 4P4RB 4U4BA 5IB5A 1GHFL 2IANB 4P9HL 4W6WB 4X6CE 3IVKA 1R0AL 2ADJA 1MWAL 1ZT7B 1ZKAA 2HFGL 3KYMB 3LMJH 3KPMB 4H5SB 5J13B 1T1WB 3EYVB 3MLZL 4LCUB 1RU9H 4FP8H 3GMQA 4NSKA 1HXYB 1MIML 1PFCA 2A83A 2R1WA 2OR7A 4NKDB 1K5NA 5LAXA 4P46B 1N5YL 4JKPH 5I8OH 1QBBA 5J1TC 4M6OH 2WQ8A 1UVQB 4Y5YC 5B3NA 1WZLA 3A6CL 1JNNH 1JV5A 1U95A 4JHAL 4KKAD 4WO4C 3QXUA 3FN3A 2B5IC 3IXTA 1J12A 3KYKL 4YDIL 4JPKL 2I60L 4DKEH 5FYJL 4R0LC 3MV9D 1EVTC 3IU4L 1K85A 5F3BA 5T1LB 5FGSA 4ZODA 5T3XD 5J3HD 1ZHLA 3TJEL 3HI5L 1FZKB 4QCIA 3JV0A 3KPQB 5EN2A 3V9FA 2A0LC 4O58L 1G9EA 1NL0H 3MLTB 4HGKC 4PJEE 3LQAL 3WL9B 4Z0XA 4F7PB 1N3NB 4NN6C 5IB2A 3H9YA 4IJ3B 1NFDB 1KN2H 2ENYA 4OTXL 1X7QA 2V7HB 5IMOA 2AEWA 3IDYC 4PJGB 4N9OB 3L9RB 4TQEL 1LEKB 2Q1EA 3MJ7B 5IVXB 2RJMA 1A21A 4F3FA 1JZ4A 3ULSA 3NIGE 1A7OL 3VXTA 2VB5A 3UPCA 1W72B 3HI1A 4OCRL 2CRYA 4PLJD 2UYLA 1F8TL 3U4BH 2NX5D 5KSAA 1PAMA 4YEEA 3VW3L 1K3IA 1VEMA 3QUMA 2DQFA 3PP4H 1MCLA 1JNJA 4ZD3H 1OM3H 1RZJH 5DVOA 5E95B 4JM4H 1CFNA 5IVZA 1AD9B 2D9QB 4WW2A 4XBGA 5EORL 4WJ5A 2EE6A 3O4LE 2BOCA 2VO5A 2EYSB 1L7TH 3MV8A 3MOBL 4MNQD 4IRJD 5GGSY 5C0IA 2JK5B 3BZ4A 2VAAB 3U36B 2O26U 5TDPB 5IMMB 3FFDA 1IM9D 2WBJA 5DR5H 3H7BA 1DEDA 1XR9A 3CLFL 3SDAC 5MEND 1NMBL 5FO9B 1RZFL 2JELL 5ETUA 1FVDA 2E8ZA 2X70A 4KJYA 2MWCA 5EZOH 4Q9CA 5HHMD 2A1WH 2E9JA 1MRCL 3CFIC 4NC1E 2RB8A 4NJAL 3PWLA 5DUBA 3FN0H 3RWGA 1UJ3C 5HGBB 3UC0H 1HKLH 3STLA 4OUOA 4NT6B 2DM2A 2D7OA 3IDGA 1KJMB 3RVVD 1NMAH 3NGBC 2QADB 4HD9A 4OD3L 1KIPB 3BZEB 5KW9H 1ZHKA 1WBZA 2IWGA 3ZKMD 3VH8G 4DZBB 4JFHE 4Q0XH 4PJFA 3OAYK 2ZJSL 1VFAB 2VDPL 1FC1A 4PJBA 4H8WH 3AY4C 4ZYKB 3WFCL 5CJ5A 4HS3A 2Q6WB 1K8IB 4RISL 1TENA 2EEAA 4XPTH 4WFFD 5DSCA 1UYWL 2YPLB 1RUMH 1U8MB 3AMLA 1J8HB 4DKAA 4FS0A 1K6QH 3M8OH 4WV1A 4RMQA 1Q8MA 1J87A 1WBYA 1WIUA 4ODXB 3BD3A 1R5IA 4FFWD 5IW6A 3B5HA 2FYYA 4HSQA 1P5VA 4KJWC 3BKYH 2WWMC 2IPKB 4DVBA 1BVKB 3KPRE 4IIQB 2DQHL 2ZSVA 3NIFE 5TF1H 3S4SG 2DM4A 2F19H 4JFEA 5D7JA 5MHSD 3SOBL 1D5XA 4GT7A 1KB5H 3WIHA 1M6OB 4PJAE 2AJZB 2CDEB 3N1GC 1MNUH 3I6GB 4P59L 1ZE3C 3LEXB 3QAZB 1M05B 2DL9A 1HIML 1U3HB 4OLZL 4YPGA 2JB5L 5CD5C 4ZFOA 1S9XA 2EDLA 2P5WE 4D8PB 1LK3L 3FFCE 1DBKH 5EC2A 4EN3B 1YEEH 2YKLH 4QYOA 3WNOA 2RFXA 1Z9LA 1U93B 4YZFE 3V5DA 1JZ6A 5F8RC 1D3CA 3K4DA 3D87B 4XGZB 2AK4D 5DRZA 2DQDH 4H20H 2V6HA 1OGAB 4BQBA 2Z8WC 2Z92B 4FN0A 5C0BA 1TTFA 3D39A 3DX8B 4YC2B 1QEWA 3HZVB 1P1ZA 1T7ZA 3C5ZB 2Q20A 3IFOA 3N0PB 4FTVA 2ARJA 1LE9B 4N9GA 5KSUA 2P7TA 2CMRH 3AM8C 1MCFA 3OXSB 1I1FA 5LWYH 4FHBD 5TDNA 1BZ9A 4KXZI 2VXTL 5DLML 1T5WB 2R1YB 1CCZA 4X5LA 2MPAH 5IF0A 3S37H 1UB6B 4CBPA 5I74B 2Z31A 4OKDA 2ZSWB 1MAML 4JG0H 4ZUSB 2GW5A 4OLEA 1KEGH 5ISZA 5ERWA 1AY1L 1OAZH 3O6KH 1BAFL 1D5MA 5JMOC 3L6FB 5EOTB 4PJ7F 5L88L 5IROC 1V7ML 4P5TD 4BZYA 1QNZL 1A6UH 2J8UA 1OW0A 2OLDA 4S1SL 1AJ7H 1HNGA 2NY3B 3MZTA 3O0RL 1ZAGA 3V6OA 4UTBL 5ESVB 1LO4L 4HWNA 1T1XB 3QUYD 2GTZA 5DF0A 2ESVE 2DWEA 1UKSA 5BZWB 1EH9A 4FQLL 4HXAH 2X9XA 4K3EH 4WUUD 3IDJA 3V4PH 3RDTA 1I3GH 5EA0H 5L6YL 1U92A 2X09A 3TT1H 1J0HA 2R23B 4LCIH 3OX8A 3UTSB 3QZWA 2QTEA 4QOKD 3F58H 5CS7A 4P9MH 5C7XH 4DW2H 5DYOB 4PJHE 4HWEL 4V1DB 1BBJB 3K2MC 1MRDH 2PETA 3TCLB 1KB9K 5ICZA 4L5FL 3OKLB 1CLOH 4AK1A 1H3GA 2KBGA 2F53E 1A6ZA 1CN4A 5DHVA 1ADQA 3DNKA 2VL4A 1ED3A 1FJ1B 1QSZA 1PW3A 3JV5A 4XP9H 4DN4H 3V95A 1NSNL 1C5DA 2BY1A 2Z91B 4M1DH 5HHQB 3LKSA 5D5MB 5B3JF 2BCKA 1MCWW 3EOTL 1WC7A 5HHOA 1DSFL 1JGVL 2HH0L 4N8VG 4QRQB 1CR9H 2IANA 2YA1A 1JNHA 5JR1L 3RU8H 3MCKB 3GIZL 1X6NA 2XT1B 1ZLVK 4LHUG 2V5MA 4PRIE 3ISWA 2A6JB 3KWWB 4I4WA 1ZT7A 4M3JA 3KYMA 4OLUL 2GSGB 4H5SA 4LEOA 3U0WH 4YHKH 3LKPA 3EYVA 2R0KL 2DI8A 2FJHB 5C0EA 4BH7B 4LCUA 2K7PA 4XCFH 2YPVH 3VFTB 3I50H 2IAMB 5F7YC 2OZ4A 4XHJC 3MRCB 3IT8D 5INCB 3RIAF 5IFJB 4LPWA 3J8F7 5I8KH 1IC1A 3ZT6A 1NLBH 5SV4A 5D6DC 3N9GL 3EO1B 3T4YA 4HGWB 3DROB 1EMTH 3E1F1 2Z8SA 2WUBH 4LCCB 4LRIA 1WGOA 4NJ9H 3S5LG 4W68A 1T0NB 4X6CB 1KCSH 4J4PC 3RWFA 4XCYB 5KN5B 2ATPB 2CLRB 5B38G 5T1LA 4HJJL 3QPXH 3LPFA 3GSNB 5TFSL 2IGFL 3LVEA 1FYTD 3KPQA 1G7HB 4LNVA 3BP6B 4G6KL 4MAUH 4RWHA 3VWKB 3MLTA 2H32A 4NM8H 4F7PA 3KPSE 1N3NA 3QHZL 3BMWA 4XP1H 5ABDE 3WUWG 2HWZL 1C08A 2VR5A 5C0CE 2V7HA 2J4WL 1D5BB 3EDJA 4PJGA 3L9RA 3BXNB 1ZTXL 1LEKA 5D1QC 1UCBL 4PUBH 4BYHA 1BREA 1W72A 4HIJB 5IHZB 2XTJE 3JWOH 4UT7L 4XWOD 5CKAA 3T0XA 3GNMH 1Z6JT 4P2CG 4JZJB 4HAFA 1S7UB 3PWUA 3BE1L 4FG6C 2J1KA 3MLPA 4ODUB 5JOPD 3OGOE 3WYRA 5EBMB 1Q94A 1OTSD 1FZOB 5L2KE 3T3MF 3S97C 2GFBA 2ENSA 5JXEC 4R7DB 3N1MC 3W0WE 2EYSA 4PJEB 2JK5A 4QRPD 4QT5B 1OLZA 5TDPA 4CN1A 1EO5A 1JTOA 1ZVSB 3ULVE 1J1XL 5BRZB 5FO9A 5I1GH 5KSBB 5I75C 4GMTH 3OF6D 4RGNB 3GZKA 3SDAD 4Y2DC 2FH6A 4AQ1B 1HSAA 1MQKH 2AEPL 3OKDB 3HZKB 2VKWA 5J0BA 2X4OB 1X4XA 3S3PA 2WLYA 4NT6A 1GJIA 1BECA 1QYGH 2YPKB 1R3JB 3L7EA 3S96B 5BMFL 2FD6H 3CFBB 4GRLB 1B3JA 4HJ0C 5D72H 2VJXA 3K80A 4LLYA 1WBXB 3VXMD 5I73C 2HG5B 4DZBA 3O4LB 15C8H 4MB3A 5JHLH 1WWWX 3TH2T 1VFAA 5TE4H 4OF6A 4OZFG 4LRNH 2DWDA 4YHPB 4BFGA 4ZYKA 1KPVA 3INUL 4P4KC 1K8IA 2Q6WA 1ZSDB 3WLWC 3NTCL 5EOCJ 2YPLA 4LLWA 4D0BA 1U8MA 2APFA 4BQ9A 3FQXB 1LO2L 1XCTB 4YUEH 4YHNB 5A2JH 4I3SH 3W81A 3MBXL 2BNUB 4NNXB 3CLEL 4ODXA 1ZWIA 1OAKH 5GGTH 4YHML 3TESA 2J5LB 5D2LF 1OL0A 1GGIL 3QO1B 4OFVA 2IPKA 1BVKA 4IIQA 3UJIL 1JNLH 4P2QE 1N5AB 2AEQL 2WWMD 3TVMC 2QLVB 1M6OA 1I1RA 2AJZA 2CDEA 4RBPK 2VLJA 3QQNA 3I6GA 3LEXA 4LMQI 3L1OH 1M05A 5KTEH 4R97B 1G1YA 1T21A 1U3HA 3MLSL 1DLHB 1JGUH 3C08H 3DARA 3L3KA 1DJSA 3PF2A 3T3PE 3QEHB 2PXYC 4D8PA 1MI5D 4FQJH 3PDGA 4X9BA 1HINH 1HHKB 1MWAA 4C59B 5BS0E 3DV4B 4JY5L 2BVEA 5IBUG 1INDH 4LGSB 2OTPA 3OR6B 4FQIL 2HRPH 3RNKB 1T20B 1UWGH 25C8L 1A6AB 2QQKL 1IJ9A 4UTAH 1GOHA 3VFNB 5JW3H 1OGAA 3KPRB 3T04D 3MO1B 1FNFA 1NLDH 3DX8A 2NY5C 1PKQE 1KENH 4PJAB 3C5ZA 5J12C 4ZO8A 1MJUH 1T03L 4PYHA 4PP1C 2VABB 2O5ZH 3OXSA 4F33B 1AKJD 4V2BA 3U7WL 4N8CL 2FJFA 3FJTA 5ENWB 2G9HA 3OKOB 3UBXA 2R1YA 4WCYH 1WWAX 1UKQA 2D03H 2DDQL 3FFCB 1I9IH 2VUOA 4N5EC 3HPLB 4N0UE 3MLVH 1UB6A 3UTTE 4WHTB 1F4WH 3NABL 4MD5A 3NAAL 5JIPA 1F3DJ 2ZSWA 2F74A 4ZUSA 2DLEA 5E9DD 4GKOA 1AD0B 3SY0A 2E7LA 5EOTA 3SE9H 3MJ9L 4CN4A 4U2ZA 2FEEI 5DRWA 4QF1B 3AXLB 3ZDYE 1EBAA 4Z7WE 3O9WC 5ESVA 4XPFL 4KZEH 1S9WB 1MHPH 1T1XA 4BM7A 3GKZA 3EFFB 3HE7D 4ODTH 2X1OA 4G8EA 4A6YH 4X7CC 5ACMA 4AENB 2NY0B 1LO0H 1NGYA 4TUKH 5SWQB 1S5IH 4OLVH 3UTSA 4KQ3H 1TVHA 3HE6A 3MJ8B 1QTYT 3TN0C 5DYOA 1LE5A 3QXAA 4I18C 2A9MH 1EFXD 3HN3A 1XGUA 3ESUF 1J1PL 2CK0H 1EGJL 3GMOB 5I1HH 2PTVA 5DFWH 1DQDH 5FIEA 2H26A 3L5IA 3LS4H 4CVXB 4YFDB 2OR9H 3OKLA 4NQSB 4TVPE 3TH4T 1XZ0B 4HGMA 5F6IB 5AAWA 5TE7H 5IFHL 3CMOL 3P11L 4P2RD 2QJDA 2NTSP 5EFIB 1IAKB 4HULB 1FJ1A 4Y1AD 2X7LA 4Y16B 4IHOB 1QKZH 1I75A 2ESVB 2MCPH 5AZEH 1P69B 2Q86B 5K9QI 3AB0C 1FO0B 1FPTL 4PRHA 1BBDL 5HHQA 1B90A 1UH2A 1CFQB 4DCQB 2E3VA 5D5MA 5E2VL 1AC6A 1TPXC 1DBMH 4WEUD 3VDCA 3I9GL 5JW4Q 3KHQA 4EI5C 2BOBB 2K1MA 3MCKA 3V4VL 4PJHB 4OM0H 5B8CC 4U1MA 5JW4M 2A6JA 3KWWA 3MRJB 3HMXA 1I8LA 2GSGA 4TNVK 1L0XA 2H9GA 4AEHL 1BGXL 1F2QA 1FVEA 4TPRL 1IGFH 1D9KC 3QIUA 4X6EB 1J7VR 2F53B 3WIIH 3Q2CA 5BW7C 3VFTA 5E08L 4MJ2A 3MRCA 4MX7A 5INCA 3L7FB 4XPHH 1F4YH 5E2WH 5D1XC 4NBXB 4XHJD 4G9FE 4R6UA 3ARRA 4JHZA 4U6XB 4AEIH 4EEEA 3EO1A 5HY9B 4NZTL 4HGWA 1YEGL 4E41D 3HI6L 1T1YB 4LCCA 3AREC 4POUB 1KB5B 1T0NA 4X6CA 4PRIB 1T6WA 4XCYA 1I7RA 5KN5A 4GJTB 2ATPA 4XC3H 4NHUB 1PD6A 4X8JB 3UZVB 5IMKB 4NQEE 4J4PD 4HF5H 2EDFA 4UBDC 1NGXB 3B9DA 3F8UB 5EO1B 3OB0K 1OGTB 3MUY1 2AV7B 4OF7A 5LJYH 4HPYH 1G7HA 1I85A 3BP6A 4HH9B 4MD4B 1YMHB 1UWEL 1WEJH 1B0GA 3R8QA 5DT1H 1ZLSH 3ABZA 3KGRA 2HVKA 1JZ3A 1D5BA 1FDLL 4PGCB 3U2SB 5DRXB 1IILE 4KGJA 1I1AB 3IJYB 4NWTL 5IB4A 4FQPA 3WFDL 4WWKC 3QP3A 4X4ZA 4HIJA 3KPLB 5IHZA 5AEAA 4CJ0A 4NGHH 2F5BH 1CZ8L 1DBJH 4NN5B 1VADA 4ODSH 5DZLA 2CJUH 1AHWA 1VFUA 2ITDB 3UEZA 5BO1H 4ODUA 4WNQA 3FT2A 3HNTH 3UZEA 4OFKA 1TZGL 4FG6D 3PWPE 3C5JB 1IC5H 5EBMA 1FZOA 3NBNA 4YE4H 3W9EA 4R7DA 3T4AB 1CDGA 4PJEA 4XWGH 1CFTB 4HKXB 3KPSB 5E70A 5JXED 4D9LL 5IJVB 3BEWA 1UM6H 3CFJB 4JAMA 1ZVSA 3SDDD 5JW4N 5C0CB 1QUNA 5F8QC 5KJRH 4ZMAT 5GS0H 3REWB 4G8FB 1G7PB 2X2YA 2V2WB 4EZMA 4XPGL 2Z8RA 4YHYB 3GMMB 5DS8B 3BMVA 2XTJB 4DZ8B 1YJDC 3KPPB 3BKJL 1FFOB 4YDKH 1F4HA 2K9UA 3KPNB 2YPKA 4O51B 1R3JA 3S96A 3D85D 3OPZL 3CFBA 4GRLA 4EI6A 3ULUC 4HUXA 3QUXC 4NRZB 4L8CB 4ZO6A 5F7DB 1WBXA 4Q74A 4O2EB 2HG5A 4HJ0D 4LVOC 3O4LA 3W0WB 2XKSA 5J89A 5IT2L 2XNAB 3D18B 2Q76A 4I0PC 2RIKA 1JGDA 1YMMD 4YHPA 4R3SB 2DQEL 3TNNA 4KMLB 2HJKA 4UIMA 1UQSB 1G6VK 2E5EA 4P4KD 3THML 1ZOXA 3WLWD 2A6KB 1XCTA 1PY4A 3BKCL 4E0RB 2HN7A 3NCEB 1JUFB 2FEDC 1F4AA 3QO1A 2EXWC 3OMZA 2LAAA 4XXCC 1N5AA 2P45B 5DFVD 4MNGE 1NGWA 5DD1H 2GT9B 4AL8H 4K2UH 1RIUL 1H3PH 3LHPL 5HI3D 2PYED 4JZNB 1C7SA 5GS3A 1DLHA 2APBA 5H2BB 4HKZA 1GCFA 4RZCB 3ZTNL 3QEHA 1MVUB 3TYFB 3ZLQC 1EO7A 4GS7B 1HHKA 2PXYD 3AMKA 3DV4A 2PYFB 2VXVH 1CGSL 4Z6AT 3OR6A 5IWLC 1U6AL 3VFOA 1T20A 5KVDH 4PJXA 2L4OA 5F72S 4AJ0A 5JPMB 1A6AA 3JSSA 1P53A 3VFNA 5HHVL 5EO0A 1MRFH 1TQCC 3KPRA 1MEXH 3MO1A 5EU6B 4P2QB 3ARFB 2WBWB 3PJSB 4K9EC 4IRZL 4P3DB 1RFDL 3O6FC 4PJAA 3WNKA 2CD0A 1YYML 4M61B 3ZE0F 2VABA 3NPZB 4GQPH 4F33A 2WUCH 5ENWA 3NCYS 3QPQC 3OKOA 3RGVB 1W0YT 4AMKH 4DN3L 2CUHA 2P5WA 2BSSB 3ECBB 3FFCA 4XBEH 2XQYK 3HPLA 2YD4A 3GRWH 5BS0B 5IW1A 3FB5B 1YN6B 4WHTA 1MVFA 4N5ED 4WI6A 2VXQH 1QFUL 4XCCH 5IESH 3VD9A 1NBZA 2OM5A 3SPVA 1E27B 1LDPL 4KVNL 1AD0A 1CE1H 2XWJA 3C60A 3DMMD 3GI8H 3EYFB 5HDLA 3TV3L 1J5OL 4NIKB 1OAUH 4QF1A 4GXVL 4OFDA 4L29B 3HRZB 5T3XH 2PF6A 1FGVH 4M7ZB 5J11B 3UCRA 1PKQB 4K7FB 3EFFA 2EDJA 2AEIT 2F54E 3MLUH 4X0KB 3ARVA 3G5YB 5J57B 4AENA 2F15A 5FYKE 2EIZB 5SWQA 2C3HA 3N85H 2F5AH 2Z8VC 4N0UB 3MJ8A 1A3LL 4AIZA 2E6JA 4P2YA 1DN2A 5L9DL 4F57L 5JTWA 4LF3B 3TN0D 2XRAL 4MJIE 4F80A 3GMOA 1GZQB 3T1FB 4OZIF 3MODH 3EW3B 4CVXA 4JVUA 4NQSA 1RMFH 5TQ0L 1XZ0A 5ICYB 5CEZH 3WFEL 4MJ4A 1FC2D 2EH8H 1N4XL 4ZFGH 4Y16A 4MQ7B 1OY3B 1S7RB 4IHOA 2ESVA 5JPNB 3QI9B 1FO0A 2Q8AL 4D9QD 4DCQA 4CL7A 1CLYH 4HZLB