1OAUH

Fv structure of the ige spe-7 in complex with dnp-ser (immunising hapten)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
122
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN E
total genus 28
structure length 122
sequence length 122
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oauH00
3B9AA 4JFYA 5IHUH 5INCA 1OGAB 3GBMH 4DQOL 3OAUL 2AK1L 4RMWA 4LARL 3PHSA 2Y36H 3MZGB 2FIKB 2X44D 2VXSH 5H37H 1JWUA 4N5ED 1OAUH 4XGZA 3STZB 1HSAA 2D0HA 4TN9A 3RWIA 2AJXH 2NW3B 1IQWL 3DO3A 5M95B 4NZDA 5F9AC 3RVUC 5IB4B 2VLRB 2ESVD 2R0WH 5ALCH 1NBVH 4PRDB 4ZUSB 5LGJB 3MA7B 3JWDL 4ODVL 3FB8B 3QCTL 3WIHL 3F58L 1IGJA 1U93A 3BJLA 3GRWA 5DD1H 1HSBA 3CFJB 1DQDL 4PJ9D 5GRXG 1JE6A 1HOCA 1SEQH 2F58L 1EEYB 1YECH 1T21B 3OBAA 4L3CA 4RIRB 4NKQB 1CN4A 4LSRL 2HVJA 4KZDL 4P57A 4HIEA 2YPLD 3NMEA 3PE9A 4XPAH 3U46A 4K2UL 3EDEA 3RTQB 4Z7NF 4EN3A 4KJYA 4U0RC 5IB1A 4Y5YB 2X10A 1IGFL 5CS7A 4LLWB 3TFKC 4P23A 4ENEC 3DYOA 4CL7A 3OSKA 2X4PB 1MREH 2H26A 3N85L 1N8ZB 1U91B 1HH6B 3ARUA 5ADOL 1RULL 5FYJD 3SDAA 2VQ1A 5JHLL 1O7VA 2HT3D 3C08H 5KSBE 2BSSA 1JHTB 3FT4A 2ICWA 2OQJA 3OZ9L 4YUEL 3S9DB 1CG9A 3OTTA 3ALXA 2G2RB 3OKKB 5CUSH 4K7PH 1MAJA 4H0GA 2NX5A 3HPJA 4LCWA 4GQPH 1EVUA 4KVNH 4P99A 3SDCD 4DGIH 2VLLA 1MCLA 5CZVL 1QEWB 1GC1C 2APTA 3ZT6A 3QZWB 3HNTH 1D6VH 1RJCA 2AK4D 1T04B 2B20A 3QDHA 3U46B 3CSGA 5C0CA 4XPHL 3QDJD 4YK4C 4APQA 4M8QB 3PDDA 5LGHL 4OZHA 2YD2A 3MTRA 3S5LB 3EO1A 3GJEA 3QFJA 5DUML 3GMQB 1GGIH 1OAZH 1BP3B 4OZIE 4KUCF 4Y2DB 1RD6A 1QLEH 3O3DA 1HH6A 2K9UA 4HW6A 4P5TB 5CKGA 4LVOB 5CD5C 2YUZA 4L4TD 3GBNL 4S0TD 2UWEA 4TUJA 3SDDB 2JJSC 1Q1JH 5GS0D 5DI8A 4ZPVB 4W6WB 4CADA 5D1QD 1RIVH 4P46A 4X0KB 3L7EB 3RX5A 3REWB 1S7WA 3N9GL 5HYJD 4DVBB 4HS6B 1J12A 2A77L 3FN3A 5C0CE 2EDOA 1I3VA 1I75A 4UV7L 3HPJB 1LP9E 1ZOXA 5L88H 5DMKA 4Z78B 1A4JA 2VLLB 4OCRH 4XTRC 1TQCC 4K2UH 2WUCH 2ESVB 3K74B 3B9KA 4LHUD 4OGXH 1FZKB 3DV4A 4PP1C 2IANE 2XTJD 3BIAX 5CJ5A 4QHUB 2QADC 3LD8C 5T1DH 1CDHA 2VXVH 4X5XA 1UB5B 5J3HC 1P5UA 3U36B 1HHKB 1C1EL 1RSFA 3V4PL 1CGXA 2BVEA 1INDH 1VEPA 5E4IA 4R97B 4JPVH 1OT1A 2OZ4L 3QO1B 4LCIH 1UVQB 3O6FC 1H3PH 4KU1A 3O3DB 5CEZD 1MVUB 1FZOA 4U6YA 2R69L 1CD1B 1WTGT 1K6QH 1UM5L 4N8CL 5CBEB 1D5IH 1OD7A 4YC2C 2IAMD 3B8YA 1MCIA 1AJ7H 2M1KA 5FM5M 3L7EA 1FYTD 4HC1L 1HK6A 5H37G 1UJ3B 1NLDL 1S3KH 3GMNB 1C12B 1XIWB 1U8JB 3O9WA 5EO1B 3NABH 5FXCH 4LFHD 4P2QA 1TQCB 1VA9A 2VSCA 3EDKA 1IE5A 1H5BC 1BJ1H 1ZS8A 2BXYA 3HZMB 4LLUA 4U6TA 2AERT 5C6TH 5E08H 2R0ZH 2F9BT 5IHZB 3U1SL 3OAZH 4EOWH 4FQIH 3Q5YA 1BX2B 4RBPK 4OCWL 4UAOC 2C4XA 4MVBD 4WV1B 3D0VB 2DQHL 1IQDB 1JNHA 3OGCB 4QRQA 3D87B 1HHGA 4FQLL 3UMTA 4PRNB 2KKQA 5JW3L 5SWQB 4UDUB 3ZKXC 1MCEA 4K94C 3VRIA 4ALAH 4MB5A 4HWEH 4JVPA 1YPZF 4ZS6C 4Z77B 3T77B 3GI8L 4NN5B 2BOCA 4GKZB 3QI9C 1KN2H 1BD2A 2AGJL 3ZKQD 3KPPA 4YHML 1BHGA 3U6RB 1I7RB 1MCSA 1MIML 1NGWB 5I66B 4JKWA 3VXQB 2JIXB 4LIQL 3VFNB 3QEGH 1QSFE 4AT6B 3LDBC 1XR8B 1A64A 1E4XI 4JDZB 5I1LB 5BV7B 1T4KB 5HYQB 2GT9A 3WNPA 3QHFL 4NN5C 1R3JA 3Q6FB 1WAAA 1F4XH 5K9QI 1FNSH 4QRRB 4F9PC 5E5UB 3QDJA 2HKHL 1TTGA 4HQQH 1VERA 3D9AH 1KTLB 3BPNB 2HTLC 4KY1H 1T0MA 1AGFA 4J3XA 1IQDA 3OGCA 2YD4A 4BSWB 2IPKB 2WIIA 4K23H 4OBRA 4A2MA 3LKSB 4QOKE 4DUVA 5DQDH 4LPXA 3MC0A 4L3EA 1HIMH 2I60L 4Y4FB 2J5LB 5KSUA 1OY3B 4P59L 1BF8A 4EI5B 1YJDH 5F3BB 4YWGL 3KPOB 4R4FL 3MXWL 2QTEA 3CFCH 3SBWA 4P2YA 5GSVA 3V5KB 5I6XB 3MOAH 4RWYL 4N8VA 4NM8H 5TF1H 1P4BH 1W8OA 3ARRA 3U6RA 1I7RA 1PYWB 4OZGB 5E5MA 3QPXL 3VXQA 3QT2A 5GRJH 3DECA 8FABB 3G08A 4ELKA 5CJBA 3VRLE 4NZUL 2AAVA 3V7AG 4J7RA 5F7DB 4NFBA 1J88A 5TE6L 1I9JL 3SDDD 4X6DF 4NSKB 1YUHB 1QBBA 3E1F1 1CLOH 1KYOK 4PTTB 5DHXB 1HZHH 5DJ2A 5D70H 4HULB 2A9NL 5E2UH 5AUMB 1JGVH 4YBQC 5BZWA 4HIXL 3JTSB 1RZKC 1AGFB 2H3NA 4MS8C 1MY5A 4R97C 4K71B 5DXWA 1LNUA 1DN2A 2YD9A 1J05A 5E8DH 3FONB 5KW9L 3V4VL 4OLUH 4RMVA 2NYYD 5B3NA 1D5ZA 3S36L 3JSSA 4LVNB 4A6YH 3EFDL 4QRTA 3STBA 3MRLA 3RJDA 4JPKH 3FQWB 2A6KB 3V5DA 2FHFA 4W6YB 3JWDC 5C08A 3TLRA 5ALBH 4NQDB 4NNYA 3CLEL 3N1MC 4I2XA 5DA4A 1R24B 4YUEH 4M93C 4N9GA 3HI5H 3QJFB 5GJTL 5D7LA 4U1IB 1ZT4B 3GJFB 4OI7A 3S35H 1BFVH 1EXUA 5FOBB 2A1WH 3MODL 1MFNA 3HR5B 1P4IH 1Y18A 2BRQA 3NAAL 4PJ5D 4FFVC 1EAPA 3TBWA 3U79A 2QEJA 4JQVA 4OF3A 4HBQA 1OLLA 4FP8H 3IETA 4LHQB 1PSKL 3NGBB 2BOBA 5DJZA 3IFOA 2DBJA 1RI8A 1TZGH 1LNUB 3VXRE 1DDHA 1M05B 4RQQB 1J05B 3LAFA 4UBDC 1CF8L 3I6LD 1XGRB 2K3TA 3FAWA 3DI3B 3FFDB 4MJ2A 4Q6IA 1RV6X 3HUJF 3QNXB 4BZ2L 4QRTB 2CRYA 4PGDA 3FHAA 3OKMA 4NYLA 1Q0YH 1WUNT 1CFSB 1MAKA 3GMLA 1F4YL 1K8DA 1MH5B 3DX8A 2A0LC 3VFOB 5C0BA 4UI2A 2UWEE 4GAJL 4O9HL 4Q9QL 4PLOB 4G43A 4I2XB 4PJ5E 3P9MA 3E2HB 5KVFL 2ZUXA 4JAMB 2E9JA 3ECBB 2XZQL 5HYJB 2F5BH 4HBCH 4P46C 4WY7H 2OL3B 2QQKH 5IHLB 8CGTA 3F6IA 3LPGA 4HEME 4G80B 1BECA 1Y18B 5DEGA 5J12C 1FL5B 1REIA 5HGBA 1NEZG 3K4DA 3ARWA 1RJZA 3P0YL 5D9SA 2DBLL 1KEMH 1KXTB 2YD1A 4OF0A 1SJEA 3T3MF 3DXAE 4PJBE 4OIIL 5DD6A 4ZTPL 3T8XB 3S36H 2IPUG 3GO1H 2QQKL 4H8WL 4DZBA 1BLNA 3FZUC 3HCVB 5EO0B 4LMQI 5LBSH 4Q0XH 3NH7H 1LWRA 3CFKB 3HI1B 4BQ6A 3QXDB 1NSNH 1ZLWK 1PKOA 5HVWA 1X44A 1G7IA 2HLAA 1OCWH 1X5FA 1UEYA 3SEPA 4DN3L 4W68A 1JGUL 4XNXL 3RWEA 3RVXD 3EOAA 3MJGX 4EUPG 1F4WL 4IBLT 2E7BA 2AJVH 4PJAF 2RQ8A 3RZWA 2DICA 2YN5A 1U95B 3TBTA 4YHZH 3WJLC 4I0PA 2FZ3A 2J3SA 4U6HA 2Z35A 5DFWH 1LO4L 4JG0L 1P4IL 4ZYKA 2Q1EA 4QXWA 1X5AA 4BQ9A 5LBSL 4X9HA 1YDPB 5MI0B 4QOKB 2Z8RA 1DQML 3ZL4L 2Y23A 3KDMA 2NY4D 1V7MH 4O58L 1IC4L 2P7TA 2R15A 3P11L 4OM0H 3TIEB 2HTKD 1CBVH 1FJ1B 5FYLD 5D5MF 2VQUA 3T8XA 3QRGL 1JNJA 2DI7A 1KJMA 3MV9D 3ZE1F 5IMOB 1T66C 5E00A 3OKNB 4YDJB 3DTXB 3UJIL 2DIJA 1HQRB 4M7ZC 3UP1A 1X4ZA 1IARB 1CE6B 1LO2L 3RWEB 3VI4F 2Z8SA 4NZTL 5F7EH 4EDWH 2W0LA 3AFLA 2NY6B 1O5DT 3FB8A 3T0ED 1IGJB 1U93B 1X5IA 1B6UA 4GSDL 3UTSD 2VAAB 1QSEA 4MD5A 2CDFA 4MNGE 4WTXA 3PGCA 4WFFE 3HG1E 4ZYKB 2YKLH 1HOCB 1NAKL 3VFMA 3X17A 2C5DC 4IRZL 1S7SA 1YEGL 1B9ZA 1WFNA 2VLJE 1P6FA 1S7XA 4IJ3B 4UQ2A 3VXMD 3CC5A 1NGPH 5H35B 3NZ8A 4F7PB 3Q2CA 1NCNA 2H1PH 5BJTB 2Z31C 5I8CB 3CLFL 5GS0C 3S37X 4O4YL 5IB1B 4KY1L 3O41A 3S3PA 1U58A 4HJGA 5I1DB 2O5YH 4JQXA 2DLEA 2Q3AA 5CD5D 3INUH 1KC5L 5SWZD 2C1OB 5GGVH 5CP7B 2EZ0D 2Z93A 4LEXH 1HI6A 1PG7W 3LIZH 4HXBL 4ETQA 3HLAB 4FXGB 5DUMH 2CUMA 3UTSA 3RL1B 4GRWB 4BH7B 2O5XH 4FQQA 4YLQT 5EOQH 3UZEA 4K3EH 4NWUL 4XB7A 5FGRA 3RZCA 1A02N 2V2TA 2EH7L 5EBLB 1GHFL 1T03L 5ILTL 1N0XL 4G5ZL 3GMPA 3MACH 4KRNA 3U83A 1YYLH 4ZFOB 1N5YL 3MRNA 1QSEB 3I6GA 3I75B 2LFGA 2H45A 2DQEL 1MWAA 3MV7A 1A3RH 2AJZB 3SKJL 4Z7WB 3O6FD 3CDFA 2VDLH 3EOYG 5HHMD 3QZWA 5A40E 5EORL 5CP3H 1JL8A 3MFGB 2R4RH 4QGYA 3BO8B 3C09B 3IU3A 2HRPH 1FV1A 3FO9B 2XWBB 3PP3H 1ZKAA 4HHAA 5GGRY 4KMTH 1XGQA 5CP7A 1MY7A 5T1LD 3FT3B 1SVZA 2BNUA 2PUQT 2EDXA 3CK0L 1CR9L 3H9SE 1FNFA 2DYPA 1AIFB 2G9HA 5GRYA 1MLCA 3U7WL 4TUJB 5E2VH 2H9GA 2R4SL 2BNQB 4NQDD 5DI8B 5TQ2H 1V05A 2JJSA 2QQLL 5DR5L 5ANMB 2GFBA 4LLQA 1FG9C 1UYWL 3MRPA 5E1HB 4ZXBA 4JY5L 4MD4B 3ORJA 4MDJA 1NEZB 4GG6F 1V7NL 1IGTB 4NCC2 4OCRL 4P4KB 3DBXA 1MWAB 4KAQH 3MV7B 4YDVA 3OAZK 4M7KL 3MLXH 4HCRH 4ZFGL 2ESVA 4RA0C 1MHHB 2B1HL 4MA8L 1AHWB 4PTUB 2ADGB 5D7SL 1QLFA 3O81A 1AO7D 3SCMA 3O11B 3RVUD 1NMAH 4F37K 1QLRB 4U33A 5CZXD 3DVGA 3HE6A 3QWQB 4J12A 4O2CA 3U36A 3GFUA 4KJWC 2AVGA 2R23A 4H26B 4JY5H 4U1LB 4XVUC 3QG6B 3AREA 1ZTXL 2IWGA 3C60D 4HHAB 2NR6D 4RWHA 5E1AB 4PY7A 2AJUH 3FQNB 4NO0B 1IM9B 3MRJA 1IBGH 2DIAA 2J4WL 5IW1B 3UDWC 5EPMA 4FFZH 4N5UA 1II4E 5D7IF 1IEAB 3ARFA 4FQHB 1I8KB 3NIGE 3GSOA 1KOAA 4HC1H 5EN2A 3IRPX 3QDMD 1FFNB 3PGDA 3O45A 1QA9B 4Y16A 5C0DA 5GZOD 3TIDA 3GMNA 1FRGH 3TO2A 1JHLL 1BIIA 4N5EC 3BT2L 4R4BA 3U2SA 4NM4H 4L4JA 4Q7DA 5I15H 4RISL 1DQDH 2GI7A 2AW2A 5I75B 2PXYD 5JHDE 2I9TA 1BZ9A 5D2NC 5E6IB 3KPSA 4FQJH 3HC3H 3IAQA 4G8EA 4KRPD 4TRPL 1FNEB 3DVGB 4YIQA 35C8L 3D0LB 1CDJA 4JZJC 3THML 1JPTL 1UA6H 3OXSA 5DRWB 4Z95L 1ND0A 3QG6A 4B41A 1SYSA 1F6FB 4YR6A 2EIZB 1HHGB 1WZ1H 4ZSOA 3BGFB 5DMIL 5HDQL 1A3LL 1IM9D 1IZJA 3QQ4A 4U4BA 4U31A 4H8WC 2FX9L 2QSCH 4Q2ZA 1OM3L 1HN1A 4MQ7B 2BVQA 2DS4A 4KMLB 3QUMA 3QIBA 1MREL 1NDGA 1OB1A 2NLJA 3NH7L 1A6VL 3QPQD 5D5MA 1FAKT 2PR4H 5C0CD 3ZYZA 4UT7H 1AH1A 2PTTA 1VKXB 1J8HA 2IJ0C 4XWOC 5F9OH 1Z9MA 3LQZA 3TWCL 4LSRH 4X6CF 4E5XA 3J7HA 3VFNA 5TF1L 2NY6C 4M5ZH 4KK9D 4U1NB 3RI5F 3TNMB 2YK1L 1JJUA 2FD6H 3ALPA 4JLRA 4JO1H 1MJ8L 4OF6A 5T3ZH 4PLJD 3GSVA 3QWOA 1Q94B 1U8QB 3T65A 3W2DL 2ICEB 1G7QA 1I3UA 1P7QB 5DEFA 2EKJA 5IEKB 1CGSL 4K8RD 4U1HB 1LD9B 4POYA 4P5KB 3K81A 4QRPA 1NAMA 1ND0B 4WHCA 4ZOAA 3LKSA 1JGVL 1A6PA 3RVTC 3QXWA 1ULVA 1Z3GL 3NFSL 1T0NA 3IRZA 3KHOA 3NCJL 4Q2ZB 1BBDL 3NIFF 2HFFB 4K3HA 2X09A 2BSED 4XP6H 2FX7H 4UU9B 4ZNEE 3QBTB 1YZZA 3D25A 1UQSB 4IRJD 4ODXB 4M6NH 2Y5EA 3C60B 1EPFA 3TBSB 5F3HB 2BVUA 3WLBA 3OJDA 3L5XH 4HX1A 1CTOA 3DYPA 4Y8DC 3TA3D 5AYQA 4MA1C 3WFHA 2H6PB 3S3SA 3X11B 1QFWI 5HJ3B 1EAJA 4ACPA 3L5WB 5J6GB 4OFVA 4CNIA 3CX5K 1LDPL 4GOSA 1CGUA 2NXYD 3EDDA 3VD9A 3DMMC 4R0LB 2H32A 2VO5A 5FCUH 4ZUTB 3RPIB 3H3PH 1S7TA 4PRIA 3P30H 5DJAB 4JM2C 3JTSA 1JHKH 1QR4A 3DX9B 5EU4A 1OTTD 1EMTH 4JZNA 3KPRB 1YY9C 4PJIA 3MRRA 4POUB 3FONA 4OQ1A 1KXQE 1S7QA 1FNHA 2HFFA 2PW2B 3ALWA 5TE6H 2BNRD 5FIEA 2OR9L 1VFBB 4LFHG 4UU9A 2X4RA 3MRHA 4Y16D 1W72A 4DKFH 2YZ8A 4AY0A 2A6KA 4P46D 2VNCA 3MCLH 1Z0NA 1QFUL 3RWGA 3TBSA 5F3HA 1QHPA 2GUOB 3VI3F 3UPRA 4R3SA 3ARDC 4ODTH 5CILL 5J1AB 5EU6A 1YA5A 3RUGE 3X11A 5HJ3A 4J3TA 3KYKH 1TZHB 4JANB 1RZKL 4XPGL 3IDMB 1OF2B 1OP5H 2J88L 2YRLA 1JF1A 4NQVA 4TSAH 1CS6A 1JRHL 2BY0A 5DVOA 5C0JB 3RWCB 3GMMB 2X1PA 3DSFH 3MR9A 3OR7B 3TZVD 3BN9D 2W9DL 3NCYS 1DDHB 3TJHC 3B2UD 3TBVB 3LKOB 1DTUA 2YMXH 1YPZA 5L2KD 5C0RH 1LK2B 4S1DD 2DQCL 1MEXH 3NIFE 1P7QD 1XF5A 2AI0L 1DLFH 2FEDC 1WZMA 3RUGA 3KYNB 2R4SH 2C1PB 3PHOB 1WVZA 4RDQG 3DX8B 4X7FC 4Y1AD 3GSUA 1TVHB 2Z31A 2PYED 3HR6A 2X4OA 3PQYB 4G9FB 1GZPA 2VXTH 3L7FB 2EE9A 3U30C 1NCCL 2ARJA 2IBZX 4WEMB 1MIMH 1LP9A 3PQYD 2GCYA 1BQHA 2ZPKH 1HHJA 2AQ2A 3ZDXF 5IM7B 4GBXC 2NTSP 3VH8G 5I71B 4WWKB 4P2OC 3W9EB 2VL5B 1WBXA 1ORSB 4JANA 2E9BA 4BZ2H 3MJ7B 1TJIH 4RFNC 5D7SH 4KUZL 3M1BA 5KVGL 1SJXA 1WFTA 1NMAL 4CGTA 1OAKL 2HA1A 2F5AH 4XMLH 4E42B 3EYQC 3GHEH 3GK8L 2PYFB 4OKVB 3MV8A 3QEQE 4TPRL 2HH0H 1MFAL 5DO2D 1G9EA 5DQ9B 4MDIA 3SGJC 4YHMH 3UJTL 2VTFA 5JLZA 2VZVA 1M71B 3HRZB 1ZGLM 1J0YA 3D39E 4AEFA 5HHXL 3IAGC 2FEEI 4K3JL 1OAKH 3UTPE 3EOAB 4N0YL 2P5EA 4JREB 3GK8H 4NNXA 1YEEH 5CD3B 2F8XC 4M02A 4D9QE 4O2FB 5HHOE 3VXOB 3MGTB 4NO5B 3S96A 3PQYA 2QQNH 4Z0XA 3JUYA 4E0RA 3BYYA 3HC0A 3O4LD 4QWWD 5MEQA 4PJ8D 1WBXB 1ORSA 3TN0D 4FQXD 3VXTA 1DQLL 2XZCH 3MJ7A 3G9VA 3GI9L 1TVDA 5FO9B 5IG7A 5D6CA 1P2CA 5HPOA 4HUVB 5I1CL 2LVEA 4YPGA 5SV3A 1KJMB 2V7HB 4OCNC 1N2RA 1WSST 2KUTA 5IMOA 4S2SB 4K7PY 1F8TH 3EZ8A 1Q0XH 5KS9F 5JXAH 3HAEG 3B2UC 3O2WL 1RURL 5B8CC 3KYAA 3IXTA 3GI9H 4FTVB 4U0RB 3B2VH 3PP3K 1IGYB 1T2QH 4G8FB 4GSDH 2H2SD 4OCSH 5FDYA 3LEVL 2WMPA 4XPHH 1F3DJ 1MI5E 1J1OH 3GMOB 3T2NL 1MF2H 3QRGH 4N90D 1TITA 4P5MB 3T3PE 1QACA 4R96A 4QRSA 4JFHD 5EU5B 4IHOB 4XPBH 4JFDD 1NGPL 3VXTB 1EHLH 2H1PL 4TPRH 4D94A 4DUXA 3KLHD 4OTXH 2PTVA 2XWTB 3D6GA 1SMAA 3O41B 3RNQA 3VI3E 4TVPH 1JGEA 4V1DB 2EKSA 4H0HB 5MHSE 5T1KB 4OFYD 2DMBA 1C5CL 1P7KB 5C08D 3VGFA 1U8KA 4X4YB 1RZFH 1AGEB 1M7IB 4QTHA 2I27N 12E8H 2Z92B 5SV4A 1T22B 3D48R 4NKIL 4IRSA 5J13C 4WO4A 3JXAA 1G7LB 5IMMA 2JB5H 1B0RB 2V2XA 4J4PD 1YQVL 4PREB 4EBQL 1WISA 2COQA 5EBLA 4J1UA 2QKIB 1K85A 4PRHB 3PXHA 1EGJL 1N64L 2B2XL 3QEGL 4YAQA 1JTPA 2IGFL 1IEBA 2VZTA 1YYMH 4P5MA 2AJZA 1TTUA 4Z7WA 5IVXA 3GZKA 5EU5A 3ISWA 2ZZUT 4JY4B 3MJ9H 1P1ZA 4JEGB 3RY6C 4AG4L 5BOZG 5DHYA 2P8MB 3MRIB 3QNYA 4R7DA 3TYGL 2QR0B 4HUNB 4PGJA 5DHVB 1E27B 4ZO7A 3BO8A 1CE1L 4JRYB 5DJXB 2EDTA 2XA8H 1LE5A 2EKSB 4JR9H 4MYWB 4HLJA 4KVCH 4ZD3H 1AGEA 4HWBA 3TA3C 4EUPB 4S1RL 3KJ6L 2D9CA 5JXAL 3BRFA 4X6FA 4XP5L 5HHPB 2Y06H 5I8EB 3VG0H 3QDAA 4XTRD 5CSZB 3NACL 4KZEL 1QPPA 1CTNA 4Z8FH 2X70B 4FMFA 5DD1L 5MENB 5E08L 3OWEA 4WCYH 4ZUVB 4YNYA 1T80A 4LIQE 5FKPB 3MCLL 4WHYG 2V7NA 3E8UL 5MEND 1JWMA 4ONOA 2O93L 1I1AD 1NFDB 3IDGB 2H41A 3U7YH 3HMXA 2IG2H 4LLAA 5EBMA 4Y4KA 1UWXH 1YEKH 1XZ0A 4OI8A 2DYPD 3EFFA 2GJ6D 1EHLL 3HUJE 1EFQA 1KEML 3EO9L 4ODUA 4GAGL 1J8KA 1MCWW 2P5EE 5HGAB 5I8OL 1QKZH 4GW5A 5CLWA 3L9RB 3C6LD 3LS5H 1AP2B 1MFCH 3WE6A 2QQLH 5EOTB 4XC3H 4R8WH 5J6HB 4U1LA 1NPUA 1TQBB 4XWOD 3U0TA 3QUXD 3U7YL 2MPAL 2EEAA 1NEUA 4S1QL 5D2LF 5IV2B 1DUYB 2WINA 4PUBH 3STLB 3DROA 2ED7A 3D39D 4M61A 3RGVC 5D6DA 3C08L 3CZFA 4FABH 5ESQA 5FUOH 5DMIH 5BXFB 2ENYA 3PV6B 3UZVB 1H3UA 5C2BL 2FX9H 2QSCL 2C7UA 2CIKA 2CKNA 1U3HA 2O61B 3H42L 2R0KH 4KDVA 4FQHA 4G6JL 2EXWD 5I18H 5MENA 4NO2B 3ZYOA 2V9RA 3HZVA 5FKPA 3PWUA 4GRMB 2V7NB 4GXVH 1QA9A 3ZDYF 2CO6B 5E9DD 4PJXB 2B39A 4AEHH 4MA7L 1A6ZA 2GAZB 3SDXA 1AXTL 1NGZA 2BVOA 3O2DH 3DXAD 5DFVC 1JZ5A 3RY5A 1J9CT 3ES6B 3MQIA 1K8IB 1EERB 3MV8E 3KPSB 4JPWL 5E6IA 4WJ5A 1NCBL 1TDQA 2CR6A 2VAJA 4N0RA 4PJHF 1AP2A 4GUPB 1FFRA 2YC1A 2YZ1A 3FO1B 4YQXH 5DRWA 3F7VB 4MQXC 5GGSA 5HGDA 3MJ6A 1M6OA 3S98A 1UH3A 1FZJB 2EIZA 4ZSOB 3MBXH 1FN4A 4KKAC 5GHWL 4EQ2A 3JV6A 4DK6A 1EGJA 4JPIA 4Z7QF 1DUYA 1BEYL 2WINB 3QEQA 4L29B 5DMGD 4MJIA 3CZFB 4M43L 1CLCA 2DKSA 4M48L 5C9JB 5HVHB 1FVCA 1R3IH 3FQRA 4MNHA 3PJSA 4RMUA 3W0WE 4HC1A 9CGTA 4PJBF 3A67H 3QH3B 3RQ3A 5IW3A 4JDVA 1G7PA 5GS2D 3CAFA 2IFGA 2VLME 1H8OA 3CVIH 3WN5B 1T20A 1CLYH 5K9JH 3R06B 2Z4QB 3WXWH 3F7PC 5HHQB 3FHQA 2ILLA 3LKPA 3KXFB 2YPLB 4PJCE 3TA3A 1QKZL 4IDJH 4N0FA 5I74C 3CFBA 1I4FA 3KPSD 3MLYH 1SEQL 1R3IL 2R2EA 3EOBB 5I1HL 5TH2B 3QUYA 5CFHA 5D7JA 3QIWC 3FOLA 4W6XB 3GSWB 4NC1E 4GAYA 2ZUYA 1I8IA 5FF6A 3ILPA 5BCAA 3FO1A 5KVEH 1JZ8A 4JFZH 3T09A 2W38A 2IADA 1RIHL 3P30L 5EZIL 4YE4H 5B38G 1A1OA 3HE6D 2WV3A 2X1XR 1VDGA 2VE6B 5HVHC 4QO1A 4WVRA 1WQVT 4IMKA 3QEQB 4X7TA 5JOPE 2IQAB 1FL3B 4U1MB 1ODAA 2C4FU 3DRQB 1SQ2N 1T7VA 4OQTA 1BWWA 3VFTA 5K59F 4Z76B 4K71C 1NBZA 4LHJB 4XNQB 2FGWH 3QH3A 3QAZC 3V8CA 1G7PB 2VXUL 2EC9T 1S78C 2KBGA 2GJ6A 1F6LL 5E8EB 1A7NH 4HZLB 4A2LA 1J86A 5CHNB 5IR1B 5E2TL 1A7PL 5ITFB 4HKJB 4ZDHB 1CDYA 1S7UA 4UNUA 2H6PA 4HMEA 1MIEL 1FVDB 1KCVH 5GRWA 1JRHI 3ULVC 3D9AL 3RWHB 3IFPA 1NCAL 1Z2KA 4R0LA 4DKEH 2YEZA 4WI5A 4PGCB 4HT1H 4NUJA 4NZJA 1D6VL 3ZE2F 2DB8A 5FF6B 2VUYA 1YQ2A 4YXKL 5JW4R 5HXMA 5CEZL 3RU8H 3RBSA 4HKZB 4KK6D 3CFDB 5LWYL 4OAWB 3WDHA 3MRRB 1P5VA 3ZKMD 3EIFA 2IQ9H 1FL3A 4BSVA 3P2TA 4NPYA 4WI8A 1OT2A 1VFBA 1QNZL 1XGUA 4DAGH 5GS1C 1W72B 2DM3A 1MFDL 4AH2A 1EEZB 3OJMB 5IP4A 1D6EB 1HYSC 5L2KB 4WW2A 3HG1A 1CWVA 4JO3H 3R8BB 3WFDH 4JM4L 1MJJA 3G6DL 2WBJB 4LCUB 1B3JA 1X5HA 2I24N 2UZIH 1U3ZA 3MGOB 1KGCD 4S1SL 1PX3A 3Q0HA 1N59A 2BCKB 4CW1A 2Q6WB 1A6UH 1QBMH 3QPQC 1A6WL 5EUKA 3CGTA 2HT2D 3CX2A 5EUOB 2AJUL 4U2YA 2PO6A 1NC4A 4Y4HA 2YEZB 2EDKA 4M6MH 2C26A 3QR2A 4QKXB 2W0PA 3K2UH 1IEHA 4KK8C 1S78D 5C09B 4WU5B 2XNAA 4DTGL 4XZUA 2Y6SC 1U8OA 3H9SD 3LKOA 3HZYA 1I7UB 5I73B 4M5YH 3PWVA 4GT7A 4C56D 4RWYH 3PDGA 4NNPH 1J0IA 4M6AA 4NHCH 4WDIA 1F6AA 3IFLL 4XP4H 2W60B 4NWTH 3BT2H 3WO4B 4YX2H 1OSPH 5EU3B 4M6ML 4P23C 4TSBH 4HH9B 5L88L 3ULUH 3MNVA 4TUKL 3QDGD 4E9LA 2HFGH 5IB3B 2AXFB 4XP9L 4QTIL 4R6UA 2V5MA 4LPWA 3BN3B 1YEJL 5IVZA 1RUMH 1I9JH 5T3ZD 4DTGH 2W9DH 4AENB 3L7FA 3T0XA 4JRXD 3TBYB 4OCXL 2BNQD 1DBKL 2ZOLB 3MLVH 4JJHA 4GW4A 5LVEA 3PWNB 3MXVH 2N7AA 5DK3A 1GCFA 1UACL 5I16A 5B39A 1H9VA 1A3LH 2JJVA 4M62L 1ZHNA 3IU4L 4TUKH 3M1BB 2ITDB 4NC1C 1JPFA 3RGHA 1F02I 5GGVY 5C9KA 3BGFC 2AQ1A 3VDCA 3T0EA 1DVFA 3BEWA 2VR5A 3D3VA 4PJAE 2VLRD 1KIPA 5DQ9A 1RJYB 4MDIB 1I1YA 1PY4A 4ENED 1YPZE 1AQDB 1OP3K 4AIZB 5EBWA 1M71A 3HRZA 5DC9B 1ZVYA 5SX4H 4WDIB 3SQOH 4PP2A 4X98A 5EZLB 1I1FB 5E5RB 1EEYA 3BUYA 5IROA 4HWEL 1IGML 2FO4B 2OJZL 4JHWH 5CKAA 1DQTA 1ERNA 2HVJB 5ENWA 2F5AL 1OTUC 3T3ME 3FQUB 4LSSH 3L1OH 1AE6H 3L3OB 1G6RB 3WUWB 3CLFH 3IJSB 3SO3C 2P1YA 3L3HB 4HWZA 4PJBA 3ZTJG 1XMWA 4CVWA 2XN9B 1S8DA 2NW2B 1AFVL 3BP6A 2J8OA 3DUSB 1U36A 4LVOC 5HHXH 1I8MA 2B5IB 2WP3O 2DF3A 1WF5A 2X89D 3MLTA 5J11B 1PKQA 4PYHA 1KNOB 2VH5L 4DN4L 2VDQH 2X7LA 2VDKL 3BISA 3X14A 4OFDA 4EI5D 4HFWB 4PJEE 1AGDB 3VXRA 1RPQA 5T33H 5A16B 1ZHKB 1FE8L 2V7HA 4U6XA 3FO0L 3GSXB 3DRTA 1HQ4B 1NJ9B 1AR1D 1FGNL 3KYOA 2Q8AL 2G5RA 1EFXA 1KCSL 3P4NA 2NX5B 3OB0K 3ILQC 1I3RB 4GG8A 4LDOB 5JZ7D 4AIXA 3LKQB 3C5JB 2AJVL 5GGQH 3HTLX 3FAXA 4G8FA 1L6ZA 1SJVA 5KTEL 3PWLA 5ENWB 3T4AA 2GJ6E 1FO0B 3BMWA 1MVFA 5D1ZC 4BQCA 3WUWA 5C0CB 4OGAC 3PABA 1P69B 4XI5C 2YD3A 5DGQA 3GSQB 4MHHG 1CXLA 2IPTH 5CP3A 4H5SB 4ELME 4MX7A 1Q9WB 2AKRB 4Z18A 4YHNA 4OLYL 1T89C 3NTCL 4IHOA 1T2JA 1LP9F 4XNZB 1Q9KB 3NA9L 5TPWL 4LSQH 3RVTD 4Y2DD 3RX7A 5JOEA 2X40A 4FQCL 5T3XD 4KPHL 4MMZC 2CRIA 3SGKC 1GH7A 1F11B 4V1DA 2AXHA 4ZPVA 1CT8A 5B8CA 4G8IA 5JUEL 2BZDA 4RFEB 5E56A 4XX1E 3WV0A 4XMKL 1EVTC 5F8RC 3D5OF 2F8OA 3I9GL 3ZE2E 1R3KB 4QTHB 4YHOH 1YEFH 4OZIF 3JVGC 1CVRA 1I3RA 1A4JB 1RZJH 3L1OL 2KQMA 1A2YA 1MCHA 5JA8B 3O4LE 1ORQB 2NY5H 4H20H 4LSDA 3QRFM 1EGJH 4QY8B 2QKIA 2LU3A 1NMCB 1KB9J 4PB0L 4RFNB 2BY1A 4IMLB 3S8WA 3S7GA 5CEXA 3ARQA 4Y5VB 4QXUL 1MHPH 2G5BB 3PHQB 4MNQE 1F3JA 2WW8A 3KPLA 3EYOA 3FRUA 5DTFB 5B4MD 3HPLA 4RNRB 3RY4A 5IESL 4MVBC 2YMXL 2AEPH 5JO5B 1ROWA 2B5IC 1HDMB 3VRLF 3OR6A 3SKMB 1UXWB 5IFJA 4P4RB 4XMLL 4G8IB 4NJAH 2V17L 3BAEL 1AY1L 5KSAD 4WHTA 1N64H 4YXLL 5GS1B 4C56E 1W0VA 1OGAD 3MNWA 2X4SB 4UUJB 3ROLA 3FO2A 1BBDH 3QUZD 4LSPL 2OR7A 2VN7A 2AV7A 4Z8FL 3ZKXB 4PR5A 3V8OA 4UTBL 2FWOA 4G7VH 2DTML 3BMVA 1NGYB 1FC2D 1ZS8B 3C8HA 5C2BH 4DW2H 3MRQB 4HUWB 3MMEB 1FHGA 5IGXL 5INDA 4XHQA 1NUDA 5AD0B 3NAAH 1F4YH 1NFDA 1QSEE 3E0GA 3O2VH 2F19H 4Y5VA 2X4QA 1JNHB 5IT2H 5HVGB 5FHAH 4MA7H 2RAMA 4ODUB 4PJEB 2GY7B 2VLRE 1ZANL 3G6JB 2DJSA 1YEIL 5D8JH 3VFUB 1P6AB 5DTFA 4GMTH 5INCB 2BVYA 1OGAA 2EH8L 1N26A 3O0RL 2APVA 5J6HA 1J8HE 3MRDB 2VSDA 5DVLA 4JFOA 4NFDA 5BS0B 2HRLA 4X5LA 3WO4C 4X4MA 1U3YA 1RK1B 3IDJA 4PRDA 4NRYB 4L9DA 5LKNA 4QRPD 1KLGB 2JIXA 5HD8D 5BXFA 5CEYA 1U8MA 1G6RH 3D3VE 3QCTH 1QSZA 3BQUD 4JDTH 4PG2C 4H8WH 5B38B 2FR4A 1A3QA 2X1OA 1HSBB 1TLKA 3CFJA 3ET9F 4HF5L 3SGEI 4DKFL 4LHUB 4GXVL 1OAXH 3IKCB 2HFGL 3PWUB 4GRMA 3MROA 4RMRA 2G75B 1DN0A 4KXZH 2YSSB 4JO2H 2VZ3A 3X13B 3V0VA 4IRJA 1RUQL 3J8F7 3X3FH 2CH8A 4GS7C 3P9LB 3MLPA 1AC6A 3I6KB 4YHLL 3RRQA 2WIIB 4JRXB 4XVTL 2VLKE 3HMWL 4S11A 5CCKH 4F37F 2ITCB 1R3LA 5IKCA 5H2BA 1YNLL 4LU5L 2MCPH 2E7MA 3BESR 3C5SA 1LO5A 1A6TA 1HWHB 1JZ4A 3EYQD 2AP2A 1G1CA 3H9HB 4OIIH 4QHMB 1NGXB 3HE6C 2A74B 1U6AL 3D2UA 5F3BA 3RGVB 1PZ5A 1TCRA 2N1KA 1WIPA 4MJ6B 4Y5XB 5D2LE 1A7BA 3OAYK 1FN4B 4JKLA 4WI3A 2E27H 3LS4H 3M8OH 1A0QL 5KS9A 3FT4B 1P9MA 4F7MA 3SKOA 3GNMH 4F7EA 5JPMA 4F58L 5K59E 4LPUA 1EBAA 1P84J 5LGKA 1UZ8A 4XBGA 4P9HH 3H7BB 1W72H 4PV8A 2CK2A 5FGBC 4LHUA 1KGCE 1CL7L 3JV4B 3BPCA 3ARGD 2ICWJ 3QFDB 3BKYH 2VXQL 1YUHA 3MROB 5I1EH 3WN5A 5D1QB 1IT9H 1QFHA 2IF7A 1D5BA 4XPBL 4KTEL 4GKNA 2XG4A 2D4FA 5EC1A 3U48A 1TPXC 2VITB 3SJVD 1OW0A 1IC4H 4MA8H 1ZANH 3P9LA 3MGAA 1YEIH 3V4UL 1BEYH 2B0SL 4Y4FD 1RZJC 1I4FB 4KMQA 2NY0C 4HWBH 5GS0H 4CRPA 3U0PB 1EO7A 4I18A 3KHQA 3UTPD 2R2EB 4P59H 1S9KC 5K9OA 4N8VG 5TE7L 3QXAA 1Q38A 1QBAA 3GMQA 2A74A 3VMNA 3MJ9L 1RQ5A 4QOKD 2HJKA 1PZ5B 1INEH 1TCRB 3QAZB 3L95B 3SE9H 1H3VA 3L6FB 3VDAA 1CDGA 5FYKH 5DVKA 4NM8L 4GQ9L 1FYTA 1HZHL 1SM3H 2P8LB 3GBNH 3QUZA 2VE6A 4UT6H 1JZ7A 3GGWB 4X99A 4JR9L 4P46B 4X0KA 4BYHA 3V7AE 4MXVF 3HE7B 3MJ8B 4KXZI 4JCMA 2Y7QA 5E8DL 1OGAE 5F9OL 4YHIB 1NBZB 2PKDA 4I48B 4JRYD 1BJ8A 1EXUB 5FOBA 4HJ0D 4M03A 4FOMA 4Z7VB 3BPCB 3ZZ1A 1IKFH 1MFDH 1D5BB 1SHMA 2B1AH 1EBPA 1XCTA 5E2UL 4JKMA 1NL0L 1XGPB 3DGGA 4QYOA 5EC1B 2EXWC 4Z7WF 5CHNA 4XCFL 1DFBH 3QHZL 3MACL 1XF4A 4OSUH 5KANG 2AJYL 1NFIB 3GM8A 5KW9H 2DQEH 5BRZE 3CPLB 1OSZB 2Q76A 1ES0B 1XGRA 2XZCL 3H0TA 1IAIM 4UDTB 4FZ8H 4WRLA 3OF6A 5DDHB 5D7IA 1KTRL 4NYLB 1U8PA 3CFDA 2O5XL 1Q9LB 1UH2A 3EAKA 3V5HA 5I1CH 2R0LH 2IAMA 2R1WB 5E2TH 4LNRA 2DMCA 5A2KH 4XAKE 5EIIB 1XGUB 3BIBX 2OK0L 5ESAB 4ZPTB 5LQBL 1ZT7A 1RURH 4YXHH 3ULUC 1KJVB 4GBXB 4G6ML 5TGBB 5HGBB 3QHTC 3L5XL 5I8OH 3PIQB 1XCTB 2FSEB 2XKUA 3SOBH 3BPLC 4Q9CA 4HLZH 3K7UA 3QIUD 3H8NA 4QTIH 2ICWI 4PBXA 1N59B 4KK9C 3T2NH 1SMOA 2RR3A 2YD7A 2XQBL 4OLVH 1X5KA 1PVHA 4WV1A 3D0VA 1NFIA 1IC5L 1F58H 2AABL 2EDRA 3P73B 1CGSH 1E4KA 5EUKB 3G5XB 4HBCL 1CIDA 4EKXA 4M1GL 4Y4FC 1Z3GH 1S5HB 3KPRE 3DPBA 1F3DH 1I9RL 4HUUA 5HPMB 4OV5B 3L3DA 2WBKA 4WU5A 6FABH 3RAJH 1SJHB 5F88A 2EDEA 5IFHL 3RVWD 3TBTB 3V5HB 3KPPB 1R5IA 1IGIH 1R5WB 3BZFA 4LNRB 4PJEF 4I0KA 2PO6C 1UKQA 3G9AB 1CXEA 4HGWB 4OD3L 1X5LA 3KLSA 1X7QB 1MJUH 2GT9B 4FZEH 3VE0B 5TGBA 4NQED 3RPKA 5J1TC 2CGRH 2FL5A 4AK1A 2VERN 3ARDB 1JMXA 3F7YB 4HV8B 4J4PC 3C8DA 4JFPA 3U7AA 1D9KB 5DURB 3O4OB 3GHBH 1ONQA 1DQQB 3LRHA 3AU1A 1M7DA 4UTAH 1F2QA 4P3CL 1FJ1A 3BQUA 2R1XB 4KQ4L 4TVPE 4UV4L 1ZLUH 1EUUA 1WITA 5BW7C 3EFDH 2J6EA 3OQ3B 1LO3L 2L4OA 4PB9H 3WEXA 1NSNL 4PJFF 4UQ3B 3UTQB 3BPNC 2X9WA 4TUOA 3ZDZF 1R0AL 5I73C 1N6QL 5EO9B 1JTTA 4OQTH 4LAQH 3QWRA 1BJ1J 4J8RA 3ROOB 5DYOB 3C6LB 1IC7H 4YK4B 4NZRL 3WJJA 5I1IL 3VH8A 4IS6B 3LQAH 3WFCH 5HYIA 4N0UA 4H0IA 1UEMA 2VJXA 1K4DA 3BGAA 4Z7UA 1CK0H 2ERJC 3U4EB 4LSTL 4NHUB 4QHNA 5DK0A 2M2DA 3ARZA 3G08B 3ESVF 4MNQA 1DQMH 3WFEL 5DS8B 4D0CA 2HAZA 1TJIL 3FB5A 3DHJA 3MREB 5KSVB 5FDWB 2F74A 2MKLC 1DBML 2WIMA 3CXHK 3NZ8B 3E6HB 2NXYB 2IALB 3ZKNC 1WTLA 1LEGB 2HT3C 2XN9A 4G6KL 3FOMA 2Q8BH 3RVWC 2AEQH 3C60C 2NW2A 1KENH 1L0QA 2R1XA 4G3YH 1UH4A 4F33A 3HI6L 3QNZA 1DUZA 1UKSA 4KUZH 4MQXD 3RGVD 1YY8B 2XZZA 1KNOA 1FO0H 3VD5A 3QCVL 3TNNB 4UQ3A 2B4CC 4N0YH 4YGVB 4P4KD 3TFKD 3E3QE 4B0MM 1NAML 4OZ4B 4NQCD 5JXEA 1QSFD 3JWDH 1UADC 5CSGA 3S37H 2V2TB 2FGWL 2DOCA 4U1SB 3MA9H 2YUXA 2EDNA 3K4ZA 3T0DA 1Z0MA 3VH8B 2F8VA 1XIWC 3I75A 1B88A 2UZXB 4KJQC 4FXLA 1ZHBB 3QCVH 4JFFB 4N9OB 4EUPH 3MREA 4NO0D 4XVJH 3VGBA 2P43B 4KTYA 4WFFD 2FNBA 4P57B 1BFVL 2GKIA 3AS2A 5D1XD 4GLRI 1EAPB 4WUKL 4NO3A 2NY5L 3BKCH 5EC2B 3WFDL 4KKLD 3VWJC 4OUOA 3DVFA 1YC8A 3MBEB 4PRPB 1DVFC 1KLUB 4PJAA 3MLWL 3VD7A 3VXUA 3FT3A 3QP3A 1JZ3A 5JOPD 3DV6B 3KPMB 5D93B 2IH3B 2O5ZL 3NFPA 3KPNA 2VQ1B 5JQ6L 3QNXA 1ZWIA 4G9DB 2DI9A 3Q1SH 5MERA 3ARDD 1KJ3H 3VFWA 1D5MA 1JPGB 1DQJB 1X5YA 1LE9A 1TCMA 4MD4A 4TOYH 2VDOH 5GGRA 3SGEH 1A6AB 4JM2D 4NRXB 2P5WB 3P9MB 4LDEB 7FABL 1T1WB 5E6IC 3MV01 4GXUN 4LSPH 1A2YB 4WW2F 5LAXB 4PD4J 1NGQH 3PWPA 5EIQA 2OI9B 5C0BD 2F53E 5D70L 4XHJD 1V3JA 4XC3L 1E6OH 4JO4H 4QHKI 5IF0B 4M8QA 3ULUF 1AD9B 5T5FL 1DFBL 3QHZH 2IANA 2VDOL 3EYUH 3VWKA 1JHKL 2VZOA 3AAZB 1OLZA 4S1DC 3CDGB 5HTSA 5FM4A 4AYFA 4Y1AA 2XTJB 3GJEB 3QFJB 4NQXA 3WUZA 2DBLH 1BMGA 3S88L 4K8RL 4R4ND 4AEIL 2BVPA 5ICYB 4I0PC 5GGTL 4NQSB 5FAAA 4ZTPH 4ONHB 4OZFH 1NGQL 3OR6B 4IOFC 2Z9TA 5DWUH 1EZVX 4Q9BA 4NJAL 3UPAA 4KHTH 1F90L 1ZWIB 3UXFA 5CINL 5EN2B 1G7IB 5I6XC 4Y5YC 1FFNA 2BSTA 4LHUG 1H15B 4YHPA 5CBAA 4LKXA 1P7HL 4UUJA 2CMRL 3BEVB 3EYSH 1ZTXH 3VFVA 4I0PB 4U6HB 2WUBL 2P5WA 2ZUTA 5CMAB 3T2OA 5I0ZA 5F7YC 1HEZA 1VFAA 4XPFH 5DQJA 4QF1B 4CMMA 3NVQA 4G6MH 4KRLB 1FZKA 5F89A 3KYKL 3N06B 4XT1C 4Y4KC 4X7EC 5HYEA 4EI5C 1MI5A 2DQUL 3VXPB 1C1EH 4U1GB 4WUUE 1UWEH 2EXYD 2V17H 1Z9SA 3BH8B 3VFRB 4JO2L 4C4KO 3S6CA 2KPNA 3F5WB 1TZGL 2OCFD 4P3WA 4PJ7B 3TT1L 3QO1A 4KGJA 1UVQA 4Z7OF 3AMKA 5GQBA 1PJ9A 4WW1B 4GG6B 1BF2A 1PZUB 4BELD 1UZ6E 3Q3GA 1UC6A 2HKFL 5JNYB 3RA7L 1LEIB 2QBWA 2X4NB 5C0AB 3SKNB 4O02H 5FM8A 2YPVH 4FQJL 2OXHA 5DK2A 2FB4H 1VGEH 4OZHF 1WWCA 4Y4HD 5F21B 3SE8L 1E4JA 1EV2E 2CKBA 4OLXL 1KULA 1FIEA 2R2BA 1INQB 2B4CL 1XIWA 1GAFL 1U8JA 3HNVH 3VG0L 1QD0A 1U8MB 4NOBA 2JELL 5D7KE 3TO4A 3MOBL 4HF5H 5IFAL 3FFCE 5BRZB 2QSVA 2H2PD 3UYPA 4LLUB 1KT2A 4FQ1L 3QDMA 1F2XK 1ZA3B 4F9LA 3HB3C 5AG8A 3NBNA 1BX2A 4UT7L 1RVFH 5E6ID 1WZKA 1BM3H 5HYSG 2DQTH 4IMKC 3CC5B 5E24E 3EW3B 1MFBH 5BJTA 2FLRT 4HMDA 1YN7A 4GAGH 2AEIT 1R3LB 2D03H 2RHEA 3BXNB 3BP4B 4YZFE 1FGVL 4M00A 1UB6B 3MV11 4WW1A 4GG6A 4UOJA 2DWEA 4OLYH 3NTCH 4UAOB 5TQ2L 4ETQB 4DGVH 5BVPH 3HLAA 2J6EH 1JGDA 1UJ3C 5SWSE 4L3AA 4GRLD 2ICCA 4U49A 2BP3A 4NBZB 1IAKB 5DK2B 3KLHC 1YNTB 1QVOB 5IMLB 2MTPA 4MWFB 2V5RA 5HD8C 1V7NH 5J7CC 5DA0B 5LGJA 2CLVB 1A1NA 3NCFB 3UYOD 3SKOB 1NCTA 2YK1H 4F7EB 4H1LA 1CICA 5BRZA 1F8TL 1E4WL 2MHAB 1MIEH 2OMBA 3H7BA 3W11D 5I1EL 1K4CB 1FDLH 1PBYA 1UWEL 1KPVB 4ZFFA 5C0GB 5ID0A 2YD8A 3SKJH 1GZQB 2EICA 1VCAA 3V0WL 4OZFA 2B0SH 4OLEA 4PB0H 2CKBH 4KPHH 4L8SB 3N1QC 1A14L 4K9EC 4QHLA 4LLVA 3X12B 3F62A 3NCJH 4G3YL 4TSCL 4JQIL 3EDFA 2C3XA 3X3GH 4JB9L 5B21A 2CD0A 3C9NA 1G9NH 5GISL 3KS0H 4OGYH 5I1KH 1HNGA 1F42A 1N8ZA 1U91A 4J4PA 3DXAB 1MHCA 2BNRB 1BAFL 1J1XL 3L6FA 4I13B 1IC1A 2CRMA 4I3SL 3V5KA 1N3NA 1QUNA 1P4LA 1FYTB 5DRNA 3WFZA 3P0GB 2H9GB 3C5ZA 4MWFA 4X6CE 1E28B 3G6DH 3QUMH 4K3DL 2ATPB 1KB5L 2R39A 2ICWB 3B9EA 3QIUC 4H20L 5JZ7C 3OV6A 4KI5E 4LLWA 3QISA 1UCTA 5HY9B 2Y7QB 2DQJH 2G2RA 1A9EB 3I02B 1U8LA 4HIJB 4UV7H 2XWJA 5IMKB 1TZHA 5D96B 3SDAC 3DO7A 1XGPA 4QYOB 3RI5K 4WGVB 1QLRA 1ZGLB 3K2UL 3QEUA 2AS5M 5D2LA 4O2CB 5ACZA 3B3IA 1LO0L 1Q1JL 3GUTB 1FLTX 4K55A 3MUGA 2XQBH 4E41D 3QA3B 3H7LA 3D85B 2D7OA 2FGZA 4P3DB 2I25N 2Y36L 3P4OB 4FZ8L 4TNVF 1LHZA 3DVNA 3SGJA 5C6PB 3BJ91 4YE4L 1IKFL 1DL7H 1QFOA 1DBJL 2IBGA 3TV3L 4FQXB 5KN5A 2BNRE 1I1CA 3GSUB 1E28A 3DARA 2Z31B 2VL4A 1WGOA 3SDXF 5ILTH 2X4OB 1R24A 3O45B 2VZSA 3SQBA 3RZCD 3NIGF 4UINL 5GRUL 4HS6A 3K8KA 1ZT4A 2QHLA 2EO1A 1HXMB 4WWKA 5ID1A 1BZQK 4ZO6A 2XWJB 5IMKA 4FTVD 4P2RA 3EO0A 3HB3D 2OJEB 1RFDL 3BVNA 4PJHA 1Y6NR 4WUUA 2PYFA 1ZGLA 3MV8B 3B6SB 4HFUH 4YIQB 3D0LA 4U6VL 4NGHH 3BD5A 1H5BA 1VFOA 1GVIA 3HMXL 1KG0B 5FA4A 1H8NA 2YPLE 1VEOA 2CSPA 1PG7H 4L8DA 4P3DA 1XH3B 3WIFA 1GSMA 1MNUH 2WSKA 3B9KB 3CVHA 3MRBA 3MNZA 4IOIA 3GMLB 1F90H 3DV4B 1J8HB 3B8SA 5LJYH 3C8KA 1EA9C 5E7BA 3VMPA 3BP7B 3VFSA 3S96B 3MV9B 2I9LB 3KG5A 3OKLB 3V2AR 4DAGL 5J06A 1ZEAL 3CFEA 4WWKD 1HYSD 3TVMD 3TJHD 4HGWA 1BFSA 3A6BH 4LVHB 4KVNL 2OL3A 5ICZA 4M5ZL 1E4XL 5MEOB 3O6KH 5SX5H 3BD4A 4P2RB 3Q5TA 1Q94A 5IHZA 1H8SA 1IJ9A 1MELA 3T0AA 5D9SB 3P9WB 3PP4H 4LLYA 4QXUH 4HH8A 2BSRA 4KQ3L 4P5KA 4IIQB 3EDJA 4MCZB 4HKBA 3HCVA 3FQXA 4HS3B 5MP6H 1WAAE 1AHWC 2VDRL 5DC0A 1ZA6B 4YFLI 4L9LB 4OFIA 1JGUH 1B90A 3TPKA 1FL6A 4ODHH 2FCBA 2QHRL 4G8GE 5IQ7L 4P9HL 2CIIB 1E6JH 4HJJL 3C6LA 3C8KB 3WYRA 2MWCA 3IGAB 2I9LA 1FNGA 3REVB 2P48B 1HKLH 3UTSE 3L3KA 1NGWA 2XIDA 3WLBB 4QWWC 3MV7D 1OSPL 3H3KA 3OJDB 4NHUA 4KI5C 5DK0B 4PRNA 4PJ7E 4F3FA 5H94A 3EYVA 4M62H 3FB5B 2VKXA 3A6CL 1BPVA 1RUKL 1RZIA 1T7YA 2P49B 5I8KH 5CZXC 4K07A 5ADOH 2I60H 3QDJB 3DMMD 2PXYA 2IALA 1B0GB 4HJJH 1JYVA 5EBGA 4LLYB 2OS7A 5AZ2H 2J8UF 5DJAA 3RKPA 1PG7L 1N5AB 1PD6A 1NBYB 3DIFB 3TO4C 1KACB 3ARVA 1U8KB 4X4YA 4MCZA 1A7OL 4GQ9H 3IU4H 4UT9H 1FGVH 3VXSB 3A6CH 1NCUA 4W4NA 4JDZA 5I1LA 1S5IL 3OKNA 5HYQA 2MCG1 4IRSB 1S7VA 5MEPB 32C2A 4O5LH 3GSRA 2BY2A 2Y5TA 3K46A 1RHFA 4ZTOH 2V9TA 3SE3A 5GS2H 4WEUD 4ONFL 5DJCA 2GTZB 1CFBA 4JGJA 3MRFA 4PRHA 3V0AC 3LV3A 3B43A 4ISVA 2YKLL 2C3HA 5GZOC 3R1GL 1X3DA 3VFPA 3BUTA 5C0FA 2GTWA 4IDJL 3NPSC 3FRPA 4WUUD 1AO7A 1WFUA 4EI5A 2P8MA 3SO3B 5BV7C 5ERWB 2J1KA 1N6VA 3MXVL 5H35A 1FIGL 3EJJX 4F57H 5JA9A 2JB5L 4N8VB 4I0PD 4HJGB 1S9WB 2CK0L 3F8UB 4GRLA 5KVEL 4PRPA 3BAEH 5I9QC 2VDRH 4CVXB 5T5FH 2DQFB 4NKDB 4CVZB 3DV6A 4JB9H 3TBVA 4ELKB 1XAUA 2AJ3B 4G7YL 3VMOA 5DZNA 3AM8C 2M26A 2R0LL 2XY2A 3UC0L 1YPZB 2BVTA 3O4LA 3RJQB 4DK3A 3OPZL 2Y5TB 3LN9A 2RFXB 5L7XH 4UMGA 3TC9A 3MRLB 4PTTA 3LZFH 2ZCLH 3OKOA 3MODH 4GRLC 3VFWB 3BP5A 1WEJL 2XYCA 5F1IB 4JZJA 2X42A 1SYVA 3DVIA 4OT1L 3LV3B 2HTLD 5E6ZA 2KZWA 4AM0A 1E0OB 2J7LA 2UUDK 1BQSA 1XZ0B 5JHDB 1RHHA 4LSSL 5BQ7B 1IM3B 2BJML 3WL9A 3KWWB 5D7IE 5TPWH 4RFOL 43CAB 3ARBA 2AQ3A 1YJDC 4ZO9A 3MFFA 1UCBH 2VL5A 5ERWA 4YEEA 3AXLB 3RBGA 3WNLA 4HK0B 4DZ8B 2X4TB 4KJPD 4MHHI 4XMKH 5BVJA 5C08B 3BKML 4HUMB 5BRZD 1DR9A 1MUJB 4TOYL 3BX7C 1KSRA 4CVXA 5IV2A 4HKXA 4RQQA 3LN5B 1ZLSH 5D7LB 4FFWD 3HRPA 2D2OA 25C8H 1I85C 4XVUD 1LEKA 4V2CB 2ARWA 3O4LB 1NBQA 3FFDA 4RRPG 3HKFA 4XCEB 5GRZA 3TF7C 3SDDC 2AV1A 2A6DB 1TZIB 4I8DA 1N6UA 3MRPB 4NBXB 4CMHB 2W91A 2VN4A 2NY0D 3HG1D 4MDJB 2QADB 3LD8B 1IGCH 3QIWB 3L3JB 4G6AD 5CWSB 4PRAB 3MO1B 5C0IB 4CN1A 4I18C 2QJDA 3CK0H 3DUUB 4MA1B 2BFVL 1OP3H 3O4OC 2EYSA 3HC4H 4LLDB 5A3IC 3OKMB 4HK0A 4DZ8A 2N4IA 4UBDD 1QPXA 4BFIB 1K8DB 1MH5A 3F5WA 4OSUL 1VB9A 1VGKB 3GIZL 2CMRH 4NKIH 1CQKA 1CQYA 2NNAB 5HYJA 3LN5A 4J2XA 3Q3GB 4RDQF 1WC7B 1BGXH 2CDEB 4Q6YA 3G5ZB 5JNYA 2NXZC 1LEIA 3CFKA 5JXEC 3FKUS 3IFLH 3LRGA 4PRBB 5FKAB 3QIBD 4G9FD 4JDVB 1TZIA 4MNGA 1NUNB 4RGNE 1G0YR 1TJHL 2GSIB 2Y9RT 1QR1A 3AY4C 4KTDH 1MAML 3TO4B 1EEUA 1C7TA 3L3JA 3HI5L 1SY6H 2NY7L 1T0PB 1RZ8A 4AMKL 3GMOA 3IJHA 3ULVF 1CD0A 2E7CA 2ZPKL 1NKOA 1FORH 1MSPA 2XXMB 1KT2B 3CXDL 2FJHA 3UEZA 4QOKA 3TP4A 1NCBH 1FQ9C 1ZA3A 4ZFOL 3ZO0A 1KIQA 1IGMH 2OJZH 3FOLB 4KJWD 3GSWA 5DRXA 5I2IA 1GGIL 3ILPB 3WD5H 1Z9LA 3S4SG 1P53A 4O2EA 5KSBA 3BE1L 3QPXH 2HFEA 1P7KA 4KGLA 4OIBA 4G9FE 3UJTH 2Y1VA 3LH2H 3LDBB 2FJGB 3QUMB 1G7MA 1AKJB 4JFDB 1D5IL 1CXIA 2JCCA 2VC2H 3L3IA 4ZNCD 4OGYL 5CLTA 3I3EA 2VH5H 5FGCB 4YDJA 5HDBF 3WIIL 4PRBA 5FO8A 4XNQA 1MFEL 1HQRA 2HJFA 2IH1A 1ZLUK 1WCBB 2P44B 1CE6A 5E9DB 4XVJL 3THMH 1G9ML 3WDJA 1A1NB 4PJ5B 4XNYH 4UB0L 1DBBH 4RGNB 3TIEA 2PETA 5ISZE 3R8QA 3GB7B 4KKAD 1G0XA 1JNNH 2VXVL 1LVEA 3FQTB 1FSKB 4WWKC 5EU7C 3NFNA 3WO3B 5JOFA 4ERSH 3FB7A 4LKCB 5DEFB 1MCKA 2OSLA 4HGMA 3V0WH 4A6YL 1CXFA 1A5FH 5FK9A 2NY3D 4XC1H 1LD9A 1H3PL 4PBVC 5DD5L 3WUWG 4DKDC 4Y7MA 1J1PH 4NIKB 3RWDA 3U4AA 5JDJA 2VIRB 1A7NL 3V9FA 1OAQL 1KCUL 1GL4B 2FD6L 3QDGE 1CLZL 1LK3H 4KHXL 3ZE0F 2OTUA 5GS3A 5HI5C 1G7HA 3U30B 3ARGA 4X6FB 4MAYD 3VFMB 1MCNA 3GI8H 3BHBB 3RDTB 1S7SB 1KN4L 2FO1A 5A2JH 3NPZB 2E8ZA 3D25B 4HXAH 3G5YB 4OQTL 4C4KT 3WNNA 4LVEA 2JJTA 1HH9B 3QUML 1MAMH 4K3GA 5E9DA 1OGTB 2ADJA 3GNML 5I0DA 1F4AA 1DBJH 2Y6SD 4LF3A 4WCYL 1SEBA 1E4KC 2VDPH 1HXYB 1T1XA 1AGCB 5IEHA 4X4XA 4Y16C 5CGMA 1RK0A 2GITB 3VWKD 3VD4A 4JFYB 5TE4H 1JPST 3GEWB 4LMQE 3QSKB 5EBMB 4MQSB 2D7TL 5I1KL 3EFFB 1FNLA 5I19H 1UWGH 2EDFA 3DO7B 1S7TB 4PRIB 1G7JB 1T5WB 4ZOCA 4Y4HC 5FK9B 4OIAA 1CVSC 3PL6A 4Z7VE 2VDPL 3EJZC 5DWUL 3FTGA 4G8GA 4JZNB 4ZOEA 1AQKL 4OCYH 3MUGB 2DQIH 4WEBH 5J13B 3HZYB 3N50A 2MPAH 4PGZA 2OTUB 5C07E 2F5BL 2GSGB 2H2PC 4Y19B 3DVNB 5FYKL 3T2QA 2EC9U 2FECI 3RVXC 1N4XL 2G9HB 5FUOL 5K33A 1P4BL 4HH9A 4LP4A 1BIHA 1KJ2H 4NZTH 1CU4H 3K1DA 4FFYL 4Y1AE 5F7EL 5EDXA 3BRGC 4PJIF 3QHFH 3L3GB 3P0YH 4LLQB 3GJFK 4HAGA 1V3MA 1YMHA 1OOAA 1FV1B 2BK8A 3QCUL 1XGQB 3C6LC 5EU6B 1D7FA 1TVBA 4WFGD 3DX7B 3IDNA 1HHIA 4KJQD 1T1ZB 3OXRB 5KSAC 4K23L 4MD0A 3AS0A 1OF2A 2HMIC 4NWTL 2WUCL 1KPUB 1YMME 4D3CH 4JM2B 2ZSWB 2UYLA 1ACYH 1AHWA 2ADGA 4PTUA 4OKDA 4YEFA 3BKCL 4CN6A 2ZCKL 4ZUUA 5L2JA 2A6JA 1D5XA 2HKFH 4KKCC 2OQJB 2VR9A 3TPUA 1YJDL 2YBRB 3W0WA 4PD4K 1H5BB 2YPVL 2WQ8A 2E6PA 1OTSC 1SBSL 2BHYA 3V4PH 3VXMA 3VI4E 1ED3A 3KS0J 4L8DB 2PO6D 1SM3L 4PLJC 5E8PA 4Y19A 4MSWB 2JELH 4ZMAT 4WU7B 3TYFB 3V52L 4LCYB 4OFPA 3KYNA 2BY3A 3CVHB 3MRBB 4IOIB 4UTBH 1C5BH 3ZE1E 3SY0B 4BSJA 2BDNH 5CGYD 2OBGA 4QXTB 4K8RC 1FFOB 2AJSL 2EDQA 2JB6A 3L3OA 1G6RA 4G9FA 1ZVSB 2VISB 5C0DB 5EWIH 3WMSA 3CFEB 3RX8A 5LQBH 5E1AA 4LRIA 3U2SB 5IT2L 5ICZB 3DX7A 4JRXE 4N0FB 2N56A 3NIDF 5ITBH 1I8MB 4P49A 4P5TA 4Y89A 4C59B 1C5BL 1OAXL 5KSAA 2ZSWA 2XG5A 4TULH 5D1ZB 4OKVA 1RIUL 4CADB 3KXFD 4OF7A 2BSRB 4JQXC 4HAFA 2ADFL 4M9PA 4NKOA 1AXSA 1QQDA 2VDMH 4X4ZA 5IROC 1ZHKA 1KBGH 1P9MC 3BZ4A 4R4BB 3FQXB 1NDMB 5JW3H 3RDTC 1NJ9A 4OJFH 5C3LD 1BOYA 5DMKB 1MRCL 3P4NB 1CU4L 1KCRH 4FFYH 4U1MA 4L4TB 1BBJA 5J9PA 2FBJH 3O2DA 4M9OA 5C7XH 4Z76A 3W81A 5CD3A 1HHHB 2D31B 2EDLA 2JB6B 3TVMB 1TJHH 4D0DB 4AEHL 4ONFH 1DEEA 2ZWLT 1SYSB 1QFWL 5L6YL 4OD3H 4U1NA 3TNMA 4PJ9C 5MEQB 1A9BB 4P2OB 5DVNA 4RRPA 1RZ7L 4JLRB 4YHLH 5F97E 1CI5A 1ZV5A 1PFCA 3W82A 1XR9A 1HILB 1CD1A 1PKQE 1U8QA 4YH6A 5EFIA 4JHZA 1NMCC 1ADQA 4GJTB 2ICEA 2PTTB 2VXQH 1FSKC 1VKXA 4CJ0A 2OR8A 1MJ7H 3ARPA 1NCAH 5I9QB 2DQGH 4J6RL 1U92B 3B83A 4Z7WE 5I17A 3Q1SL 1BD2E 5B8CB 1JYWA 3IS1X 4I3SH 1NAMB 4E5XB 5HBBA 3B9DA 4YPGB 1LO3H 2I26N 2HWZH 1FGNH 1A0QH 4OM1L 4BFGA 4LBEA 3ARBC 3QDJE 4HZAA 4LP5A 4XNMB 4RX4A 2AJSH 3IXTB 5JIKA 4EEEA 4XWGL 2VZUA 4XAWL 5TDNB 4LL9A 1EEZA 5DJCB 2GTZA 3VWKC 2D31A 5EORH 3T0EE 2VRAA 3H9SB 3CDCA 4IMLA 4J3WA 4HG4J 3WXWL 4QRQB 4FZEL 1JZ2A 1MJJB 4WI9A 3VXME 2ZSVB 1VFUA 4HX1B 3UBXI 5ICXA 1Z5LB 5C0FB 4UDUA 2GTWB 1IFHL 4FQXC 5E95B 4ELMA 1FO0L 2CQVA 3ZHDA 4CW1B 3VRIB 4P2QE 1XR9B 3AM8A 3CSYB 4P3CH 5EFIB 3O2WH 5GJSL 3T77A 2Q20A 5EH1A 5EUOA 1S7RB 1A22B 4QRUA 4OFYA 1UXSB 4ZUTA 3RNQB 3SKMA 2FJFB 1XT5A 1INEL 4WW2C 1KELL 2APBA 5T1KA 5C0AD 1NANI 1ZLVH 3IJYA 4PS4H 5GS1A 1I1AC 5DMGC 1BWMA 2DQFA 4G8GD 5C09A 3SQOL 4WIQA 3FN0H 3FN9A 1A4KB 3U0WH 1TPXB 5E99L 1WWAX 5E6YA 3MBED 5GRJL 4OLUL 2AV7B 1A6VH 5FHBH 5L7XL 1U8IB 1QRKA 3DOSA 4JFED 1J0JA 4XNMA 2DQCH 5KZCB 2FX8H 1AGBB 3RFZC 4TQEL 2NY3C 3OKOB 2Q7YA 1KELH 4N1HB 2YUWA 3H9SA 4FN0A 3RWGB 3SGDI 3EKCA 4N0CC 2IGFH 4R0LC 1MHPL 1RHHB 5DQDL 5LG1A 4C54A 1ZHLB 2XV6B 4L4VB 4R3SB 4QEGA 1DZBA 3CFIC 4ELMB 5J1AA 4OCXH 4TYUA 4PJFA 1MRFH 4L8BA 4HPOH 5I16B 3T4YA 1E27A 2BFVH 3MRHB 4JRYA 1KEGL 1JF1B 4NQVB 4LLMA 5GGVL 1O7SA 4M1CC 2A73B 1LE5B 1KFAH 3MR9B 4ODSL 5FB8A 1NMBL 3UJIH 1A14H 5SWSA 1RK1A 3IDJB 2ZP0T 3OHXB 4NZUH 4WEBL 3Q6GH 4PRHE 5HHPA 2WWMD 3RHWF 2F54A 1CFTB 1Q9OA 5E9DE 4Z7UF 1LK2A 1GGCH 5I15L 2FX7L 1U8IA 1NCDH 1GPOH 1JCKA 4E41A 3IDMA 4IEFB 1NKRA 2EH8H 4D0BA 3F7RA 1RAMA 4HIXH 1K3ZA 2HMID 3ILQD 1YEKL 1T5XB 4JJ5B 3FQUA 3SOBL 2ARJB 3GHEL 4S1RH 4DKAA 4P9ML 1LP9B 3GKWL 2DIBA 5DSCB 4JPVL 1F58L 1D5ZB 2EYSB 5IWLA 4D9RE 2NY2B 3DUSA 3D2UB 1K3IA 1X6LA 2J8UA 5F7MC 4BK4A 4D3CL 5DD3L 2HRPL 1GGTA 3HA0A 1MCBA 3PHOA 3RVVC 3EOTH 4Z7QE 2EEDA 5ABDE 1OAUL 2CLZB 5I1JL 4HFWA 1AGDA 3T0WA 1Y0LA 3OX8B 5FHBL 5A2LH 1YEEL 2IMMA 3NABL 2ZCHL 4F7MB 2W9EH 1S3KL 4OB5H 3HMWH 1WC7A 2CDEA 3DRTB 1U3HB 2O61A 3F58H 3KYOB 4PV8B 1EJ6A 3TBWB 4JZOA 5DJDB 3HC4L 1B0WA 4MNGB 4XBPA 1L7IL 4NT6A 5HGHB 3IFNL 2EECA 5DJZB 4PJXA 5D1XB 1SY6L 1RMFH 5IB2B 5FUCC 4KROD 5BO1H 3BSZH 4KJYB 2VLKA 2B1HH 4L4VE 4P23B 1MCDA 2V9QA 4N0CD 3TN0C 2HT4C 1GGBL 1S9YB 5FFLA 5FECA 4XP6L 3KNBB 4PGDB 1IQWH 4Y2DC 3CUPA 2YC1B 4OLXH 3F7VA 4NNXB 5CZKA 5KSBB 3NA9H 4XNUH 1FZJA 3MGTA 4YO0B 5JTWA 3KR3H 1DP0A 4TVPL 3AVEA 4G43B 1OP5K 3OX8A 1JHTA 4ETYA 1GGCL 3ECBA 1IAOB 2NY7H 1J1PL 1YN6B 4DGYH 1WLHA 4JFDA 5FYJU 4LPYA 4NUGH 4NKMB 2NMSA 5KOVC 2EIDA 3OKKA 4MJIE 3ARFD 1JTOA 5FO8B 2CDGB 5K9KB 1JN6A 2MOVA 5FA3B 4L5FL 1WBZB 3O2VL 3DURA 4WV1C 2GK0A 2Z4QA 3GM0A 5DD0H 3UJJH 3MRGB 2D0GA 3LSOB 2RBLA 5F6HJ 5DD6B 5IQ9B 2VWEC 4GMTL 3ZKND 5FGCE 3UTZB 1QYGH 4KKNA 1GIGH 5BVPL 1D9KC 4QRSB 5LGHH 5FYLH 3EO1B 4IRZH 1A5FL 3L5IA 3S5LG 4B53A 3CUPB 2WWKO 2DKUA 2UV3A 2DLTA 2XPGB 5D7IB 4XPAL 2GW5A 5BMFH 3CFCL 4Y8AA 1A1OB 2B1AL 4PJDB 5HI4D 4YHKH 5IFJB 2FZ3B 3HAEB 3QZWG 4G6AC 4HIIB 1G7HB 2B7DT 1M7IA 4NQDE 5CJXC 2PW1B 2APWA 3BHBA 2DLHA 3RDTA 2YOCA 4D9LL 3GRWH 1G1YA 3QXVA 1I3GL 2CDGA 5K9KA 1RZKH 5GIRB 1KUMA 2EIEA 5KTEH 1X9QA 3SJVE 4LF3B 5JW4N 3O9WC 4DEPC 5IGXH 1JGEB 4LSVH 1RZGB 1UM6H 4NGHL 1KTDB 4X5XB 2JJUA 2FHBA 2X4QB 1U6AH 2DM4A 3GMRA 4BQBA 7FABH 4KKCD 2PXYC 3SCMD 4AQ1B 2Z92A 5CUSL 3KXFE 1A1MA 1BVLB 5DHYB 4PJGA 4H88L 2G60L 3HS0B 1X5ZA 3O6FA 3P0VH 1MVUA 4PREA 2X2YA 1K2DA 4HKZA 3BZEA 3G6AA 5KOMC 4J1UB 1FFQA 2IQ9L 3EYUL 1A7OH 4M6OH 4M7LT 3UBXA 3BDYH 5KSBF 3RDTD 3PGCB 3MLSL 1QBLH 5IW6B 5IK3B 4F80A 4NPYB 2CUIA 4XH2A 3U0WL 4XXDB 1BAFH 1J1XH 3ZSTA 1GOGA 4LPCA 5DEZA 1K9TA 3BPOB 1BQLL 4BKLB 3D69A 1FAIL 2LTQC 1T2XA 2HFTA 4OCMC 2EDDA 5GIRA 3HZMA 2FL5B 4I0CC 4ZUVA 5I8CA 5FUZL 2RB8A 3V4UH 1KC5H 3VXSE 5AZEH 4YFLF 1RZGA 1A6UL 2R4RL 3KPSE 1HI6B 4YBLC 2XRAL 5CJQL 3BQUB 3IDNB 3I6KA 3IVKB 4PJCB 2DMKA 4POZD 5KS9E 1FCCA 1FG2A 1T3FA 1KPUA 4JM2A 3HE7C 4JHAL 2J5LC 1UKTA 1TETH 4PJGB 5EZOL 5ACMA 1NGXA 5C0EA 5EO9A 1ADQL 3O6FB 2I5YH 3SDYH 1X5GA 4PYGA 2E7LA 2VQTA 4PG9A 4JFEA 2YBRA 3W0WB 5ADPH 1YYLL 1UWXK 5KG9B 4G6JH 1VADA 2YS4A 3VXMB 2JCCF 3I6GB 3PWVB 5TQ0H 4IS6A 1AR1C 4G42B 5IK3A 1BFOB 5KS9B 1K4DB 2FIRT 4XXDA 4HWUA 4MSWA 2OZ4H 2DDQH 4HGKC 3BGMB 4ZNEA 3VA2C 2CIKB 3VW3H 4HLZG 4F8TA 4XBGB 2AXFA 4LSVL 4I4WB 3SGDH 3WKMH 3LKNB 1ZVSA 1FZMB 4CVUA 2KH2B 1FNSL 4ODWA 4OZGE 2VXSL 4ZAKD 4G6FB 3VCLB 4KTEH 1A6ZB 1NQBA 2VITA 1IC7L 1EHXA 2HT4D 5CJXA 4WI4A 4H88H 5ESQB 5B4MC 4ZOBA 4MLSA 3R0NA 2C7UB 3WFBL 4WNQA 3ES6A 2ITDA 4W4OC 4R90L 4WJ5B 1C8PA 1DE4B 2P8PB 4GKOA 5DFTA 1R6VA 5GRVL 2X41A 2IMNA 4BFBD 3AROA 2UUDH 2HJLA 5GGSB 3VGAB 4HS8L 4OCWH 1RJYA 4Z95H 3B5HA 5EBWB 2X4UA 2DWDA 3F7QA 4OZGA 1BFOA 5E5MB 5FUCE 2YPKB 4DOHE 4FQLH 3QUXB 1G6RL 1FLRL 5EZLA 5F1NA 1TQBC 1QTYT 3DGCR 4RISH 4PGBA 1FCGA 4I48A 3CH1B 4I4WA 1AE6L 1UGNA 5ACLA 3MCKB 4KV5F 1FZMA 1M6OB 1NUGA 1WV7T 3LMJL 3A6BL 1U8NA 3KVQA 4LK4A 3JTTB 4WHYH 1NL0H 4PJ9B 1MFBL 1A9BA 3NOIA 4P2OA 4PJAB 4LQFL 5A2IH 3W5MA 1XF4B 3CMGA 4JHAH 3T0VA 5IW1A 1B4JH 2D7TH 1HILA 3CD4A 5D93C 5I76B 3KPQA 2IH3A 1R3HA 1Y6KR 3PP4L 1CLZH 3LS5L 1RIVL 4TTGA 2ESVE 1DSFL 4XBEL 3H0TB 4PY8J 2NZIA 4Y16B 2P5ED 3B5TA 4WUKH 3NA4A 2YA2A 4NM4L 2K1MA 2HN7B 1K5NA 4MJ5A 4JPKL 3QI9D 2WWKT 4KDTA 2R1WA 5TJWK 4NRXA 3QUXA 4PBWD 3D1MC 3I3DA 3C5JA 1QSFA 3RNKB 5T3ZL 3VFTB 5T1DL 1VHPA 5TDNA 1JYXA 4J3OC 3TYGH 4IRSD 3ZSSA 4OZIB 4DFIA 1OD9A 3HZKA 1WFOA 4H1LG 2GJ6B 2YA1A 5E8EA 3MRKA 2D7MA 3GSQA 5HHOB 2R8SL 4X9FA 5E03A 3QQ4B 1Z5LA 4MX7B 4PJ9A 1Q9WA 2AKRA 5L0QB 3O3EA 4MQ7A 2BVQB 4HKJA 4ZDHA 5AEAA 2E5EA 4FMKA 4ZUWA 3TJEL 1M05A 1SVCP 5FYLL 5KVMC 1C16A 3JVGA 4YFEA 4F7TB 3ZT7A 1MRFL 1H3TA 4NUJB 1FPTL 4UIKH 4YQXL 3MLUH 5JUEH 4PJCF 1S5HA 5ALBL 3VWJA 1TJGH 1MCOH 3EZJB 3IS0X 4MMXC 3B5GA 1N0XH 3AS3A 2BSTB 4Q74A 2EH7H 4OAWA 4ZO8A 1LO0H 1R3KA 3TH4T 2F15A 1G9MC 3LB6D 4G6FD 4JFHE 2Y07L 5ITFA 3FRPG 3GIVA 2R0ZL 3OKEB 5CMAA 4JAMA 3WN5C 2P47B 4FXKA 3V4VH 4QT5B 2VDLL 3PWJA 4WFED 3IFPB 2XACC 2PYEE 5TDOB 1MWAH 2Q7YB 4PGCA 1IAIL 4OCLC 3UAJC 4HDIA 4ZS7H 2QL1A 1U8HB 3BIKB 2NCMA 3PQYE 4U1GC 4QRPB 2R56H 3DMMA 2IC2A 1RUML 1EUTA 1ZHLA 3NFSH 3MGOA 4GO6B 43C9B 4KMTL 1CD9B 5I1AB 4FS0A 3RVVD 4ALAL 3SDCC 4ZUWB 1OAYH 5FV1L 3GKWH 3FZUD 3D39A 3GSNB 4A6YA 2NY4B 1IAIH 4XCCL 1CDBA 1YEHH 1D6EA 5F71A 4ODSH 3C60A 4OLWL 5JHLH 1KJ2B 2KDGA 2W65A 1Q0XL 1RIUH 3K3QA 1W0YT 3ULUL 2VOTA 3UTTE 3ZDYE 4O5LL 3OF6D 2NR6C 3QULB 3ZLQC 5F9JB 1KIRA 3ZHKA 2CO7B 1LK3L 2BJMH 3ZYIA 1QP1A 2WAHA 2WNGA 2YN3A 4U1KA 3WFHB 3N0PB 4FHBD 3BWAB 1ZLVK 2V6HA 1WT5C 4N0UB 4PJDE 4X8JA 1AI1H 1CXHA 4FXKB 3RZCC 1JUFA 1HE7A 5FYKE 3NCCB 4M7KH 4YXHL 2LQRA 1DLFL 3QWRD 4HCRL 1A7RL 4OLWH 2QSQA 3C09C 5FDWA 4YDIL 1G0DA 3LHPL 3BRDA 3OKYA 3DMMB 1IL1A 4MCYB 5E8NB 5F1OB 4YXLH 3IT8D 4MAYC 5DUBA 2B4CH 2ZOLA 3G6JA 1KCVL 4OM0L 4ZFZA 4F33B 4JFQA 2ORBH 2DWEB 1TENA 3CNKA 3ZMRA 4LASH 1NCDL 1CDCA 1T66D 2VLJB 2IPUK 1ZHNB 4C83B 2QADD 1JPFB 5IB3A 3AGVA 3DTXA 4X5WB 1XF2A 1PQZA 1QZ1A 1DLHB 3BPLB 4CDGC 4NRYA 5T33L 4L8CB 2YD6A 3JWOH 2EXYC 3T1FB 5ELIA 1I1YB 1FRGL 3MOBH 5IJKC 4X6CA 3BWAA 2JTDA 3BN9C 1JK8B 5IJVB 3VJ6B 2VDNL 2X9YA 4X8JB 5DFVD 2D4DA 5JDSB 5B39B 5L6YH 4RZCB 5AWNL 1I1FA 5HVFB 4LCCC 4PLKC 3V6ZB 4NQCB 4RAUA 3MBEC 4LSUH 3GDBA 2FO4A 5DZOA 4PLKD 3O6MH 4NN6C 1HKFA 3FB6B 4H25B 4FA8A 4OZFB 1C08A 4NO3B 4HWZB 1MJ7L 3L3HA 4PJBB 5DD0L 5EU7E 4L8SA 2Y4SA 1L6XA 2LE9A 1DVFD 2HH0L 5HHVH 3GSNL 4IM8A 3MOAL 3VRJA 3C9NB 1XF5B 2ZKHH 4D9QD 5FECB 1NFDF 3LOWA 3PNWA 2DLIA 2FIKA 5IBTH 2X7LB 4XGZB 3STZA 2WQRA 1L0XA 1P4LB 2YWYA 5DRNB 1A8JH 5FYJL 1VACA 3TGXA 1NC4D 1GZPB 1L7TL 1GOFA 2OM5A 1CGWA 2AXJA 1I7ZA 5BMFL 2FBOJ 3AB0B 3U9UB 3UDWA 2R0KL 4RGOL 1EH9A 2A9NH 5IM7A 3HN3A 3QB7C 3MRNB 3W9EA 1S5IH 5GGRB 5JDSA 2YWZA 2IG2L 3V79C 1NC2B 1J0HA 2EYRA 2OX5A 1T1WA 3RWIB 1QRNE 1DQLH 4HIEB 3T4AB 3QG7H 1RU9L 4YXKH 4H25A 1XGYL 2X9XA 3LPWA 3PABB 3UTOA 3EYFA 5C1MB 2MQ3A 4ONGL 4EJ1C 4H5SA 4B5EA 3IDUA 4L4TE 2AK1H 4QCIB 5EUOF 2XWBA 4MQTB 5DJ6A 4PLNC 2FH8A 3ABZA 1HCFX 3TO4D 1F5WA 2R1YB 4S1QH 2C3WA 2FB4L 5EG6C 3QDME 1FVEB 5E70A 4KK8D 3WBDA 3LPFA 15C8H 1T89A 2BNQA 1VACB 1I7TA 4Z0XB 5DRZB 2GFBB 2C3VA 4P5TC 4M48H 4FP8L 3MJ8A 4M6OL 5IHUL 1PSKH 4YHNB 4DCQB 1UM4L 5KVDL 5BV7L 1NC2A 2EYRB 1RVFL 3FFCB 5MENE 3SPVA 4G7VL 3EGSB 4XPFL 4Q6IC 2A83B 1WEJH 2AXGA 1JVKA 3RP1A 3VXPA 4OGZA 4BQ8A 4HUVA 5C0AE 1MCFA 2G5BA 2DQDL 1KYOJ 2JK5B 4PRPD 2R9HC 3S5LA 1RZFL 5DJ6B 1CICD 1BZ7B 1JF5A 2YRZA 3WHXA 2BHZA 5GHWH 1XH3A 4NHCL 1IM9A 2Y25A 2DAVA 2OYPA 1JGLH 4FG6D 4UILH 4X7DC 4LAJH 3DETD 3G04A 3NZHH 3ZDXE 3LKRB 4L1DA 3BZEB 3SN6N 3MLUL 3OKDA 1T04A 2I07B 3VU2A 4BJLA 1E4WH 3A67L 3MV9A 2DQDH 3BOVA 1CDUA 2NY2D 4HD9A 2X4SA 4HXAL 1BFTA 4BKLA 1GAFH 2RIKA 3MLRL 5IVXE 2DDQL 2I9TB 1TXKA 4U0QB 2NZ9D 2FLBT 3IYLW 2CJUH 4M7LL 3OAYH 2AXGB 4QHUA 1KCKA 1NANH 3PWPD 4F2MB 3BW9A 3QQNA 2ID5A 3LEYL 4IIQA 3VWJD 1EFXD 2HG5A 4GXUM 4W81A 3T0EC 3OGOE 4Y19E 3U4BL 1FG2B 1T3FB 3PDOB 1BZ7A 4M3KB 4FFVD 1UB6A 15C8L 4WO4B 4CBPA 3QFJE 4LCCB 4XRCB 1D9KD 3QIBB 5DURD 1NDGB 3T04D 5INDB 1I8LA 3L3DB 5CBEA 4O51B 1NUFA 4NN6B 4LEOA 5AZEL 3LQZB 2OTPA 4LVNC 1YMMB 2BC4B 1M4KA 4XCYB 1PEZA 1I9EA 4F7CA 1C12A 3IKKA 4DVRH 2QQQA 3OJ2C 5FGSA 3VFUA 5I75C 2CGRL 3EO9H 4OBSA 1K4CA 1ADQH 4LQ1A 4MNQD 1WK0A 2G75A 3MRDA 3I2CL 4PRHD 1DQQA 4J6RH 3P3YA 3D18A 5IEKA 1WCQA 3QFJD 3VXNA