1OAUH

Fv structure of the ige spe-7 in complex with dnp-ser (immunising hapten)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
122
structure length
122
Chain Sequence
b'EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN E
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 122
sequence length 122
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oauH00
2BFVL 2F54D 5ALBH 1DEEA 3U82B 5EZOL 3VFSA 3S37X 4ONGH 5ISZA 3P73A 4MDIA 1A2YB 1UGNA 3NABL 2V2XB 3RY6A 1IKFH 5FA3B 5K59E 1ND0B 2YD2A 3S35X 3WSQH 1FORH 2I9TA 5FYKD 5CSBA 2MQ0A 1MHPH 1IKNA 5CHNB 3UJIL 4LBEA 1NMBH 2VN4A 2EE2A 1YEEH 4KHXH 2DOCA 2V2WB 5CJ5A 4LOUD 2CKBB 3WIIH 3NIFE 5K9QI 4I5BA 1ZHLB 4MGXA 2F54A 4JDTL 4HKXA 2Z9TA 4NQTA 1K8IA 3ARFB 3C2AH 5C8JB 3SDAC 1OB1A 4Y5YC 3FCTA 3BT2H 1YEKH 2YZ1A 5CEZH 4Z76B 2OL3L 5EO0B 2CKNA 4WY7H 3TBYB 4GQ9L 2WSKA 1SYSB 2MCPH 5H35B 3EYFB 5E6IC 5GS1A 5E8DL 1ACZA 4WW1A 1YY9C 3MCKB 5J7CC 1TVBA 5D1XA 3I6GB 1TJHL 2QSVA 3CZFB 3JWNC 4G8GA 5HPOA 4ETQA 4Y5VC 1BQHA 1D5IL 5DJAB 5DJYA 4LVOC 1BHGA 1Q9LA 2BC4B 1IAMA 3S36X 1VHPA 3TBSB 1TTUA 2EXYC 4WTXA 1CIDA 1L7TL 1HHGA 4RGND 1J86A 5HDQL 4MSWB 5KSBB 4X9IA 1AXSA 4OF0A 4D8PA 1OF2B 4RQQB 3QDMD 1UZ8A 1S5HB 1DDHA 3VXNA 1HSAB 4PJ7B 1U8PA 3LQAC 2CUIA 4NO0B 4YDLC 3C6SB 2G60H 5GISH 4LLYB 4B53A 4DTGL 4X6EA 1MVUB 4PB0L 5J57B 4ORGB 3ZE1E 1XH3B 1SHMA 3VGDA 3N1QC 4G6FB 2AK1L 3GI9L 4FQHA 3CFCL 4TPRL 4L8SA 3RU8H 5C2BL 4WNQA 3QXTA 1YNTB 1MAKA 3BE1H 4XAWH 3BZFA 3QDMA 1I8KB 5I1HL 2AQ1A 2BSTA 4U1JB 5DRXA 4F9LA 3UPCA 3GSUB 3NACH 4C56A 2IAND 1PKQA 3SJVB 3CVHL 4ZS7H 4HJGA 4I3SL 1H5BC 5IIEA 1CICC 5KVEL 3ARWA 1OW0C 1T4KA 1FG9C 1XF2A 4HFWA 5TE4L 5HPMA 4UTBL 2VXSL 4LKCB 5DJXB 5F1KC 3WFCL 3V5DB 1FNSH 1FG2A 1S8DB 3WDHA 1RK1A 5C7XH 3IVKB 4KK9D 1RSFA 1FLTX 2CGRL 1LE9B 2ICWB 3HUJA 1C08B 2AJUL 5L88H 1ZK9A 4H25A 4TRPH 5AZEL 5KS9E 1HSBB 4MA1B 1XGRA 1G7HB 2IANA 1KTDA 1A6ZB 3PDDA 4FFYL 4DCQB 4OCNC 1WIOA 4WDIB 4PLNC 3MGOB 1FO0L 3EO9H 3TCLA 4J3VA 4BSVB 1K8DA 2IGFH 5FGSA 2EDRA 3V4VL 3IDMA 2PCPB 3UJTL 4P3CL 2I26N 4UIKL 4M5ZL 3S97C 3BDXA 3ZTNH 2P47B 2G2RB 1FFRA 1A21A 4TOYH 1G9MH 1XR8A 2UYLB 2ZOLA 4BSWA 4OJFH 3OXRA 4JO1H 4CN4A 4EN3C 4PB9L 4FG6D 1Z3GH 2HJKA 1L6XA 2MMXA 5JR1L 3HZYB 3ARZA 3MV9D 4OUOA 3VXPA 4BFIA 2F53A 4ELMA 3O81A 3PWUB 3VWKD 4QRSA 1KCRH 2HAZA 5BRZB 5KTEL 5FYKH 1YPZB 1KPVA 1EH9A 4XAKE 1IMHC 1ZVSB 1EHLH 2DIAA 5DUML 1UEMA 5DJCB 1XGQA 3IXAB 5I1LA 5BQ7B 2CQVA 4U1GB 4F7CB 3QRGL 4G9FE 4MNGA 4MJ2A 3MV9A 4PTTA 4OZFG 4XCCL 4GLRI 3VWKA 2Q87A 2EIEA 2EKJA 2YKLL 4QYOA 5SV3A 3RNQB 2ICEB 4MDJB 4I4WA 2QLVB 1KBGH 5MEQB 3RWIB 5D70L 4WTWA 4XBGB 3BD4A 1MCDA 3AXLB 3QUXC 4H5SB 5DJ6A 3GSNH 1CDBA 1I1FB 1TZHA 4JLRB 4HIXL 4N8PA 4WI7A 43CAB 4KTEL 5H94A 2D9QB 1QVOB 1T89C 1HN1A 3QT2A 1BQLH 1VFBA 2DTSA 2QHRL 1SEBB 4FP8H 5BXFB 4ZFOA 3O4LE 1U0QA 2XWJA 3VFGH 2OK0L 5IVXF 4TVPE 4UZGA 1BIIA 5I1GH 2EZ0C 1KTLB 3RX8A 3I02A 5IVOA 4F2MA 2HFFA 4M1GH 4MXVE 2HTLD 4QRUB 3ZT6A 5C70A 2MHAA 4O02H 5EWIH 2R0KH 4U7SA 1BBJB 5GJTH 2HJLA 1CXLA 4CVXB 2DM7A 5FYJL 2DWEB 1J5OL 4UAOB 2FWOB 1E4XL 3NA9L 4TSCL 2OYPA 2CDEB 1LE5A 4KI5D 3WJLC 3QO1A 4QNPE 2X4RB 4GW5A 4I2XB 4RFOH 3TZVB 4HK3J 1X4XA 1NSNL 5BZWB 1OTTC 5J1AB 2X9YA 2WP3T 3HC3L 3L3DB 4Z7NF 1PKOA 5EBMA 2Y23A 4Z76A 4LLWA 5L8KB 3VWJB 4GXVL 3JVGA 4I77H 3MRFB 5GRJL 4K2UL 3MCLL 1S9XA 2ZSVA 4HJJL 1F90L 7CGTA 2XZZA 3IFNH 4BK4A 4RBPH 5J06A 3FT2B 3SGEH 1RK0A 3W5NA 1ZHNA 2EDOA 3MCKA 1BD2D 4BUHA 4EUPG 1KFAH 2ADJA 2GJ6B 3S8WA 1U8JA 1TETL 4C59B 4LIQH 5D6DC 4OB5L 3ROOB 1XR9B 1Z9LA 2IG2H 3ME0A 1K9TA 3P0YH 3BI9X 2E7MA 5EZJA 3RY5A 3SE9H 4Z8FH 1CCZA 3EYVA 4G6FD 3CX5K 4HSQA 1A1OB 4HKZB 3F62A 1P84K 5ENWB 1JL8A 4U1HA 1IGCL 2XQBL 4M1CC 3X3FL 1T20A 4QWWD 4XCEA 4BZ2H 4PJDA 4JDZA 4V1DE 2CMRH 2ILLA 3SJVD 1BD2A 1RJYB 2B0SL 3UROR 1BZ7B 4JY5L 5ILTH 3G6AA 4PY8J 1BP3B 1S78D 2XNAA 2G5RA 1MHHB 1A64A 4ZAKD 3DX6B 1QFOA 1VGEL 4OFPA 4JFPB 4UIMB 1XH3A 2J4WH 4YPGB 3BKMH 4YHZH 5DO2C 1AGBB 1OGAD 2PW1B 4OV6F 5EBWA 3SDDB 4PJEA 4NHCH 3OAUH 3GIZL 1QSEE 4C58B 1T03L 1NCUA 3TNNB 2Z4QB 3MNWB 1U3HB 2XTJB 4LCIL 3GMMB 4PG9A 4UT9L 3GSUA 3U83A 4QRRE 2JK5B 3QQ9C 4PY7B 2W38A 3QPXL 1IGYB 2O93L 2QADB 1JPSH 4XNYH 4D0BB 4KMTL 4ZAKA 5F7EH 4RA0C 1KCSH 2NXYB 1F4WL 1T0PB 2W60B 3MTRA 1EEUA 1S7TB 1F4HA 2YPVH 3ORJA 4N9GB 1IILE 1OGAA 3RTQB 3P4OA 4NCC2 4P46B 4NO2B 4JHAL 5INDB 4FQ1H 3ZKXC 2ICWA 3HA0A 5BVJB 4TNWF 5K9OB 1HSBA 4XVUD 2WUCL 5KJRL 4F7PA 1G7HA 2CLZB 3JWDC 2GCYB 4JRYB 1UXWB 5EBLA 5DT1H 5EUOA 3WKMH 3O6KH 1AE6H 4HPYH 4ENED 1BVKA 1LNUA 4YZFF 3U2SA 1CG9B 4L4JA 2P45B 1U92A 4I2XE 5DD1H 5A1AA 3UPRA 1G0YR 4FZ8H 5IVZA 2IALB 1BQSA 1F13A 3O6MH 5F89B 3FO0H 1BX2A 1MHEB 3CU7A 3DV6A 2DKUA 4NRZA 4P59L 2R8SH 3QHZL 4OF5A 2K7QA 12E8L 2ADFH 3EJYD 4KUCF 5DK2B 5IM7A 2GJ6E 4AH2B 1NDGA 3DURB 1CFQB 1VFOA 4HWUA 3OX8B 3T4AB 4KVCL 3MACH 1ZVSA 2B20A 2DQEH 3WXVH 5JW4Q 1JGEA 2LVEA 2X4QB 1I7RB 2BVEA 2CRIA 4M7JH 2O5XL 2DQUL 4X5XA 1NCBH 1QACA 3TZVC 5T1LB 2A73B 3BPCB 5IMLB 5BS0D 3V0VA 2Y6SD 3BWAB 5C6PB 4OI8A 4Z5RB 1QLRA 3VWJC 2VC2H 5HVWA 5ALBL 5DUBB 1MUJB 3SOBH 4AMKH 2P8MA 1G7JB 4N1CA 4MDJA 5LGJA 4MJ5A 2X4PA 4XBGA 4ODXB 5CGYD 1IKFL 1FZOA 5ANME 4JFEE 5E5UB 3WSQL 3ZLQC 1FORL 2W91A 1T1WB 1UWXH 4JHBA 3TJEH 4E42B 4NN5C 3BUTA 1ZMYA 2XA8H 1MHPL 4YXKH 3TBVB 4KKNA 1NMBL 5BS0A 4KHXL 3WIFA 2GJZA 5CJ8A 1QHOA 2VJXA 1YYML 5E9DA 2KQMA 1M4KA 3AY4A 3CIQA 4PRPA 5BXFA 3DXAD 1BZ9A 4ZYKB 5ITFA 5DGRA 1ZVHA 3C2AL 2C3XA 1SJHB 1KTLA 3BT2L 4UI2A 3UO1L 1YEKL 1ADQA 1S7SA 4W70A 5CEZL 1CGSH 3OPZH 4APQD 3BW9B 4JY6B 4K3EH 4WY7L 4LPVA 4XP4H 3S34H 2GK2A 4OGAD 2MCPL 4J4PD 1FVEA 2FYYA 2KDGA 3ULVD 2IPUK 5I1DA 1CR9L 6FABL 4R4FH 2OSLB 5FGBA 3S3PA 3OMZA 3DXAA 4PV9B 2VE6A 3Q3GA 3MMEB 3LN5B 1DVFC 2Y5TA 4JG1H 4XVTH 1BFSA 3ET9F 1ED3A 4APQA 1YNKL 2R0WH 2EDYA 4RAHA 4J4PA 3IGAB 2DQJL 2NXYC 2GY7B 5HI5C 4HG4J 2B8OT 3KPQA 4WI3A 1OP3H 2I07A 3VFNA 3AS1A 2G60L 5GISL 1MRFL 1UA6L 2HN7B 4HFUH 4MJ6B 3CFJA 4GAJL 2ARJB 3M8OL 1C5DB 1LD9B 4ZUUA 2VQTA 5HYSB 3BH8B 3RU8L 1CWVA 1EMTL 1P4IH 1S7RA 2F58H 3BE1L 4XAWL 2NY5C 3PXJA 3SDDD 3KYAA 2N4IA 1J7VR 4N90D 4J1UB 5L8LB 2EH8L 2GK0B 2BY0A 4JO3H 3NACL 2H2PC 5T3XH 2V6HA 3MNZB 3SPVB 4ESKA 1U3HD 4ZS7L 4LGRB 3RWDA 4B50A 3FAXA 2Z91A 3LKQB 3ILQC 4GMSH 1BZ7A 3QIWC 2QADD 4UUJA 5A16B 4IIQB 3DX6A 1A1NB 2WWMD 1A0QH 4PJCB 1FNSL 5C0JB 5C7XL 4WO4C 4HIIB 3UZVB 3ALXA 4ZUWB 4G6JH 4NFBA 1AGBA 3AB0B 4P46D 1U8OA 3SDDA 5L88L 4KDTA 3O6FC 5GRUL 4CU8A 1TPXB 2LU7A 2XN9B 4HMDA 4JRYD 3LEVL 3EO9L 1CLZH 3QQ4B 4GMTH 5E4EC 4CL7A 5B4MD 5CZVH 4WTZG 4XNMA 4NQCE 4BQ9A 2PR4L 2W60A 3MGTA 1XGTB 3ZTNL 1HYSC 3G6JF 4K71B 1JNHA 2F5BH 3KPMB 1C16B 4PJFB 2W9EH 4OJFL 5E1AB 5FECA 4ODHL 4P46A 5CEYB 4JO1L 4YHMH 4XXDB 4YDIL 3QDJE 4EIZC 1MFDH 5FKAB 2GHWB 2HRPH 2CO6B 4JRYA 1T1XA 4LDOB 1ADQH 3T09A 2E7CA 3L7FB 4P2RE 4CRPA 3OV6A 1KCRL 2J8UF 4K7FA 4ZFZB 5FYKL 3BKCH 3VFMA 3D69B 2ATPB 1FPTL 1EHLL 3KXFE 1LEIB 3B2UC 4WHCA 4Y2DD 3IYLW 2NW3B 4X6DA 3EGSB 2CUMA 5FF6A 1UB6A 1HINH 4FOMA 4QHNA 3ARED 3DSNA 1J8KA 1ZHKB 5D7KD 1Q94A 3W82A 3EOAB 5T1LD 3MJ8A 2UZXB 3HE7A 4G9DB 1S7VB 3WJJA 4UINL 3MYJA 4AH2A 3RVUC 1WBXB 3DURA 5HYEA 1DQLH 1KBGL 4JFHE 1A4KB 1KG0B 4NNXB 3ULVH 1HDMB 4NQDD 1B0GA 3T0XA 2AJ3B 4XNXL 1E0OB 2ADIA 4IOSD 4Y2DA 4PV8B 4GBXD 2VR4A 2YC1B 4FXLA 4IOFD 1V3LA 3AREA 4QO1A 4WRLA 1N59B 3GI8H 5E0QA 3RUGB 3HNTH 1MH5B 2A73A 3BPCA 4X9FA 2X4OB 4I0PD 3WD5L 4NT6B 1F00I 1UADC 2BDNH 3EAKA 4NKQB 4FP8L 5DS8B 3QXUA 5MEND 2FBOJ 1IBGL 3VFGL 1EGJH 5KAQF 1AKJB 5HHMB 4WUUB 1XCTB 5I1GL 1PEZA 4NQDA 2FZ3B 4M1GL 4X7TB 3K0WA 5C07E 3G5VA 4GBXA 1N64L 4O02L 5EWIL 4F33B 2R0KL 3EZ8A 5GJTL 3ZDYE 4X6BB 2HFGL 1T1WA 5IMOA 1KELL 4V2BA 3WV0A 4R8WH 3U1SH 2IMNA 1YYLL 5C0DB 4I0PA 1FVCA 2VDNH 5F70A 1QFPA 3RL2B 4NGHH 3QH3B 4LQFL 5MENA 5DFWH 3C5SB 4JB9H 1MLCA 3QJFB 2WBJB 4UB0L 4O9HH 5E00A 5IWLC 1I3VA 3W0WD 1SJHA 5JPNB 1Y18A 5KVFH 1S7QA 1G7IA 2Z93A 1PX3A 1OTSC 2HFEB 5AD0B 3O3DA 4I77L 4GG8B 4GKSA 3IFNL 1AGCB 3PGCA 4XBPA 5ABDE 1NJ9B 1Q38A 3RKPA 5CUSL 3MRLA 1EDQA 2OSLA 5AUMA 3VRIB 4DQOH 5DHVB 3AB0C 1X6LA 1MFBH 5E99L 1EBAA 2CRMA 3E1F1 4EI5C 4X7EC 2IG2L 1A9BA 3W0WA 3P0YL 4U1IB 3SE9L 4GG6F 4PGCA 4NQXA 1WWCA 4J8RB 2HT3C 5F88A 4KJYB 4LCUA 4IDLA 5E5MB 5B3NA 2ATKA 1CFNA 1FNGB 2EICA 1DBAL 1FC2D 1R3JB 4LVHC 3TA3D 3D87B 5GGRY 2JCCA 4G43A 1CFTA 4OCRH 3RJQB 1RUAL 3WNOA 3ARDD 1T5XA 5ILTL 4YBQD 1VFUA 3D2UD 2PXYB 3PJSB 4LLVB 4JZOA 3MPCA 4G6AD 2J4WL 9CGTA 1YZZA 3H3PH 4HAGA 4HG4K 3BKML 4NOBA 4YHZL 5JMRA 3TBTA 1CT8B 4KRPD 4NHCL 3OAUL 3TA3A 3HZVB 1HKFA 4P49A 2XZAH 5DFVD 3RUGE 1SM3L 1CXEA 5LAXA 2MKLC 1MREH 3MNZA 5C6WH 3ARDA 2XN9D 3RA7H 1JPSL 4XNYL 4WFEE 1MELA 3QA3A 3CFEB 3D2UA 3IFOB 5C0CA 5CD3B 1CFVH 4KJWC 2C3GA 2YPVL 4LLDA 4P3WA 4I18B 2SEBA 3MRNB 3UX9B 3ZT7A 1IGIH 4FQ1L 4M02A 1H0DA 2ZCKH 1GGCL 1RU9H 4ZFOL 1ZLWH 4G80A 3I9GH 4D9RE 4LCYA 4Y4KB 4RBPK 4RGMB 2JJUA 5HGBA 3WKML 4P2YA 2R2HA 4LHJB 1JZ5A 3O6KL 4HPYL 4BM7A 3DOSA 3QQ4A 5CSZB 1MFCH 3RNKA 5T1MA 1B88A 1IEAB 3QUYD 2YPLB 5GGRB 1ZA6A 4NRYB 4L1HA 1MCRA 2GIYA 2JKXA 4FZ8L 4LCCA 3LKNB 3VW3H 3C5ZB 3O6ML 4PJFA 1K6QL 3HAEG 1M7IA 4NDMA 5HVFB 3KYNB 3QG7H 1E4XI 2G9HA 4Z7OE 4HWZB 2R8SL 4K3GA 4WEBH 3TM6A 2FNBA 1K2DA 2ADFL 1KJVA 3JV6B 1H15B 2KPNA 3LPWA 5IB4B 1YN6A 5TGBA 2DQHH 5DYOB 1HI6B 3QUYA 5I1KL 1VB9A 5F9DC 4L3EB 2X40A 1DE4B 5TE7H 4K94C 3MACL 1S7UA 1K85A 1YJDH 2DQEL 1G6RA 4PJXA 4YHOH 3RWEB 3DVNA 2Q6WB 3WXVL 4FTVB 1PBYA 4OF3A 3L5HA 3I50L 4RCAA 3FHAA 3EGSA 5DEGB 2Y36H 2BHYA 3IJYA 2I5YL 4N0UE 1VENA 2NX5D 3KHOA 4RAUA 4YGAB 2R0ZH 4WVRA 5GIRB 3DX9B 1D5ZB 2IPTH 3G04B 2VC2L 4BQBA 3SO3B 1EZVY 3SOBL 4AMKL 3CSPA 5IF0A 3HRZA 4Q0XH 1LK2A 1ZAGA 1AKJD 4WUUD 3GJFB 3N0PB 3NBNA 2I27N 3PGFH 5I1JL 1A4KA 1IGMH 1KG0A 2VLLB 1DQTA 4I3GA 1OLLA 4F9PA 3S5LB 5KZCB 4PV8A 1SVCP 3KPLB 1AQDB 3ESUF 3QFDB 4PYHA 3TJEL 1W72A 4LNRB 2XA8L 4ZUSB 4WI2A 4YXKL 2NX5A 3HB3C 1MH5A 3H3BC 3BGAA 4MLIA 2X4OA 4K8RD 5BOZG 3KWWA 5DK3A 2DJ4A 2V9TA 2WBJD 1RZKC 2DAVA 5I75B 3O2DA 4MAYD 5BV7B 5D71L 1AP2B 3OPZL 2AJXH 1NANH 5F3BB 4NZTL 3DYPA 3DUHA 5D6CA 1TCRB 4XP4L 4X6BA 3S34L 5L0QB 3I6LD 2NW2A 3SE3C 4O58L 3C09C 4KKAC 3I6KB 1TJGL 1ZT4B 3QJHA 1LQSR 4JPKL 3QEGH 3WN5A 1UG9A 1BEYL 1NCTA 4OLZH 2KQNA 1I1YA 2WBJA 4JG1L 1NEUA 5B39B 4XVTL 4MAYA 2B39A 2QEJA 1JPGB 3GMPB 2R0WL 4PJ8D 4PP1D 4RFEA 1R3KB 3SCMC 1KNOB 2HFEA 4KU1A 5AD0A 1BF8A 1T6WA 3RL1B 4XCFL 1WAAA 4IMLA 1CF8H 2RHEA 4ZPTA 5ACLA 4I18C 5D7LE 2BY3A 5CJXA 5LXGH 5FEBA 1HILA 2GI7A 1KTKE 1YECH 1DBJH 1R24B 3AU1A 1MAML 2AV1B 5DFTA 3WUWB 5D7JD 3VMNA 1QSFB 4Y4KC 1GOHA 3A67H 4PJ8A 3HLAA 1GGBH 4LPCA 2DM4A 3BP7B 1P4IL 1K5NB 2QL1A 3HR5B 2OLDA 3OAYK 1PZUB 1UWXK 5F9JA 4ONOA 4L8BA 2EIBA 5H37G 1A8JH 1E6JH 4FABH 3SE8H 3D9AH 4JO3L 4WFFE 1GAFL 4Z7UA 3C5ZC 4Z6AT 1LWRA 1OGTB 3IS1X 3V6OA 4GMSL 3WXWH 5CCKH 1G6RH 4S1RH 5IQ9B 4S0TD 1B4RA 3CFDA 5D7JA 2EDEA 1CDUA 4I9WE 1A0QL 4P99A 2RFXA 2IH3B 4YDKH 4G6JL 4OLUH 4UOW1 4PJGF 1I8MA 5DURB 2BCKA 3VI4F 5F6IB 3OKOA 3ZE2F 2YUZA 3STZA 5DVMA 1JUFB 3RIFK 4GMTL 5CZVL 3HNSH 5D2LA 3CFEA 1OAZH 4HUXB 3IFOA 2FJHA 3IJHB 5DMKA 4UU9B 1W72H 5CD3A 5I15L 4TNVK 5F9WB 1NBZA 2YPLD 5IR1A 4PLKD 1S3KH 3CU1A 4QOKE 2DIJA 1JWMA 4PP2B 1OSZB 1JHLH 4YHML 4HV8A 1ZLUH 4B5EA 3IDNB 1MFDL 4L9LB 4IS6A 2H32H 2HRPL 5EO9B 1OP3K 3CDCA 3O2DH 1ADQL 3REVA 3EBAA 3U4EB 3LEXA 5E94B 4KGLA 4KQ3L 5ID1A 15C8H 3WFZA 4GO6B 4KKCC 1A3QA 2OI9C 5DQDH 1T7WA 1IEAA 5DC4B 5DHYA 5MEOB 4XC1H 1D5XB 4NNPH 2D31B 3T2OA 3VFWA 4PRIB 4MXWH 3V7AE 3MV11 4NRYA 2OR7A 4XI5C 1U8MB 4UT7H 4BKLB 2WNGA 5C0IA 3QRFM 3TYFB 3HPLB 4S0SD 1VFAB 4MCYA 1MF2H 4FTVD 4TSAH 4K8RH 4GS7C 5DJZB 1EXUB 5EU5B 5B22A 3JV0A 2X4UA 4CN1A 4IRSC 3SDAD 4JM2F 2VTFA 2GEEA 4QGTA 2NZIA 5IB4A 3S98A 2VLKB 5IVXE 2JJTC 2R1YA 1DQLL 3QULB 4KVNH 1W0WB 5DRWB 2JLLA 1JF1B 4H26A 5C0FB 3ULVL 5T33H 4IOIB 3OXSB 4FTVA 1YY9D 4LEOB 5E4IA 4F7EB 1F6LL 5IB1B 4KDVA 3ARVA 3GI8L 3HNTL 2BOCB 3AM8A 3LRHA 2UWEF 4XZUB 3SDAA 1JV5B 1YY8B 4Y5YA 5CBAA 5I1AA 4Z7WF 2BDNL 3LD8B 3VA6A 5DEFA 2EXYD 4P2OB 1GL4B 1BLNA 5DJDB 4YIQB 1IEBB 1X7QA 4U0RB 4Y88A 4HK0B 3PDGA 1O7SA 4JQXC 4Z7NE 5E6IA 1HEZB 2WIMA 5TQ2H 1SQ2N 5EC2B 4HS6A 5FM8A 2NY1B 1F3DH 1WZKA 1WSST 1CXFA 2ZCLH 4TQEH 4K3DH 4R8WL 4ZUSA 2X4TB 3U1SL 2FR4B 1TQCB 4Q97A 1FN4A 1JIBA 2XWTA 1DANT 2VDNL 3ES6A 3MV7E 5FK9A 4DVBB 5C0BE 4LSRL 4NGHL 3DJ9A 1K4DB 2EDLA 3T0WA 1MFAL 3IAQA 4D2NA 5EZLB 4JB9L 1TQBB 4HLZG 1M71B 4QRPB 3QEUA 3W11D 3V2AR 5IFJA 2DI7A 2X6MA 5J3HC 5KVFL 1M7DA 1G84A 1AY1L 1U8HA 5F72S 3UCRA 2AABH 5HHVH 5F7LB 5IBTH 4AIXA 3WUZA 1I9JH 3OGCB 1W0VA 4G42A 4IRJB 2HMIC 4KHTH 1AH1A 2FATH 3W9EB 1AXTH 1FZJA 4DQOL 3MRCB 1NFIA 1P69B 5CLTA 3VXOA 3ZYOA 4D9QE 1AO7E 4LRIA 4OCMC 4K9EC 3V4PL 5DWUH 3D3VE 2L7UA 4HLZH 3VH8B 3L1OH 1MFEH 5B39A 3UEZA 3P9LA 1QSFD 2MKWA 1QRNB 3DX8B 2O26U 3GMPA 5DQJA 1A6PA 2B4CC 4PRAB 2JTDA 1CICA 3O8XD 4M8QA 2ZG3A 1AFVL 4X8XA 5FYJU 2QQLH 2V5RA 3G08B 2VAAB 4OCRL 3RBSA 1WEJH 5ICXA 2PW2A 1CTNA 2J6EA 3DRTB 3PWNA 1QUNA 1JZ3A 1X5KA 4LSUH 4NWTL 4PRNA 3TEUA 2P1YA 1R3LA 1PJ9A 2OJEB 4UQ3A 1FLRL 2YWYA 3MRPB 4KFZC 4EN3D 4LVNB 5JQHC 2GAZB 4ZOEA 2LABA 3H3PL 4Q9BA 4KUZH 2XY2A 4OGYH 3O8XA 3QQNA 3VXSB 1I1CA 3FOMA 1K5NA 1C1EH 3L3OB 4YAQB 4UNVA 1J1XH 5DURD 5SX4H 4PGEA 5JHLH 2XZAL 5GGUB 4XH2B 1MREL 3T0EB 4JZJB 4P48A 5K9KB 2BNQB 4MA8H 4Q9QL 2WANA 1HIMH 2FJFA 4YZFE 3GBLA 1CFVL 1AGDA 4TTDD 2R1WA 5HVHC 4HWEH 4EN3A 5DRZA 5DZNA 2HVKB 4HUWB 5IV2B 4P5TD 1U3JA 3OHXA 1KIPB 2AK4B 1A6VL 4IEFB 4PG2A 3QUKA 4ODWB 2ZCKL 3U9PH 1RU9L 1U91A 4Y1AE 1HYRC 4UDTA 2P4AB 5IGXL 5J6HA 2P48B 3O3EB 3I9GL 2XTLA 5KS9A 3EUUA 5DJ0A 3NTCH 4LLMB 1LP9F 1NPUA 5C0AB 5FHBH 3BPNB 3BGMB 3EDDA 1F11B 3FB6A 1PZ5B 4PJ9C 3AMKA 4XWGH 1MIMH 1E28B 1L0XA 3QUXD 1MFCL 5I16B 4XNZB 3WE6B 3FB7A 3GM8A 5IOPB 5IB3B 1T0MA 4N8VB 1UFUA 3W39B 4PJAF 3C8KB 4P5TA 4PRID 3VW3L 5F44A 4XAKD 5GHWH 2ZP0T 3LQZB 2FL5B 4KAQH 3O2VH 1OSZA 3X14B 2VQUA 2C4FT 3KPSE 4PJBB 3GKZA 4BZ1H 1DBBH 4J12A 3QG7L 4ONFL 1IGTB 3WS6C 4WEBL 3IB4A 2FRGP 4P5MA 2EZ0D 3QPQC 3TC9A 3S4SA 3BQUD 3QUXA 4LFHD 3TO2B 3IFLH 3STLA 5CIPA 1W8OA 2DQHL 3T04D 1IM3B 3S96A 1NGZB 7FABL 5TE7L 2NY2C 3FRPA 4PJHB 5MEPB 1EA9C 4PRIA 5IW1B 1YJDL 1U8MA 3TPUB 2X5PA 4XHQA 4YHOL 3TH3T 2D0FA 1T89A 2IQAB 3VXQB 3SGEI 4X6CE 4PRHE 2O5ZH 2IJ0C 2X4NB 3MXWH 4CMMB 4G9FA 3DGGB 1JNLH 1A6AB 4HZLB 4RAVA 3BQUA 3K4DA 1J05B 1CDGA 2IPTL 5FFLA 1NBYA 1S9WB 3F65A 2Q3ZA 4MQ7A 3RPKA 2VDPH 4Q0XL 3T4YA 4TVPD 3PGFL 5DRWA 1IGML 4XTRD 1N2RB 5D1ZC 3L3GB 5SWZE 4CW1B 4F7EA 5IB1A 1IAOB 2R4SH 1UB5B 4FQQB 2ITDB 1TVHB 3BKJL 5GPRA 2NY1D 4H1LB 4L3AA 4MJIE 3DBXA 5JNYA 2GFBA 3PWJB 4FQIH 2BOCA 3T0EE 1A1MB 2J8UB 3VD4A 4KK5C 4Y19B 3O4LA 4WW2B 4JFZH 1JZ7A 4JFXB 3FTGB 2I9LA 2JJWA 5JOPD 1T7XA 1IEBA 2G75A 4Z7VF 4LSQH 4M1CD 3ZYJA 2P44B 3PHQB 3HG1B 5DLMH 2AJYH 2AJXL 2EYSA 4JFOA 4DW2H 3M17A 4G8EA 5J6GA 3MUHL 1OM3H 1MRCH 4Y4HD 1AR1C 1YEJL 5D6DA 1U58A 4X7DC 5FB8A 4GRMB 1SVZA 4Z9KB 1JTPA 3LKOA 3QEGL 43C9A 5IHZA 3H9HB 5E7FA 4GKZB 3SE4C 3DGCR 4ERSH 3RWJB 1A7BA 1PAMA 2C3WA 4P5KB 4R4NC 4M93C 1KV3A 2X4SB 4YUEH 3T0EC 3VFOA 4HDIA 4JZJC 4PGDB 1T04A 1G7LB 2X9WA 4DUXA 3FOLA 3NFPB 5SWSB 1FE8L 3QQ9D 2V5SA 4Y4HA 1TTFA 4JFFE 3VDBA 4R7DA 1CF8L 4RMTA 4IBLT 3T8XB 1INQB 4P3DA 3KLAA 2CK0H 4X0KB 4CMHB 5LXGL 1JMZA 4RA3A 4V1DD 1YECL 5L9DH 2L7JA 1WT5A 4JPVL 5KSVB 1U42A 1CE1H 1JZ2A 4P2QE 3BPNC 1RPQA 4TULH 1GGBL 1IC4L 3FQWA 3OBAA 3U6RA 1BJ1H 4HULB 5C0GB 2QJDA 1BPVA 4S10A 1FZKB 4UNUA 4UBDC 1E6JL 4FA8A 3H7LA 4N9OB 5F9OH 2VLRB 4FABL 4KZDH 3IKCB 3SE8L 3D9AL 1QSED 2VAAA 1E4JA 2H2SD 2GJJA 3VRJA 2A77L 4DJMA 1IFHH 3AC0A 4V1DA 1G6RL 2ESVB 4S1RL 4K55A 5CCKL 4QRRD 4AT6A 5F7DA 1DQJB 5CLWA 1MLBA 1VEPA 3G6JE 3LKRA 1H8OA 2CSPA 5FOBB 2OQJA 4OLUL 1X3DA 1DLFL 1FVDA 3PE9A 4L8CB 2X05A 3QDGB 5HHQB 1QSEA 3WEXA 1QLEH 3MUJA 3CAFA 2AXFA 2QSQA 4CVZA 2GSGA 3H42H 4P4RA 3IDIB 4ZSOB 4QRRA 2J8UE 1X5YA 3HNSL 3MRIA 4FQCH 1EAPB 4MA3B 4J3UA 1OAZL 5E8EA 1W72L 2YD7A 5GXBB 4E41B 1S3KL 4F37F 1XIWB 4JRXB 4HUWA 5IJKC 2APFA 2X1OA 3T0VA 4LNVA 5E95B 2EDXA 5J11B 4ODWA 5KVDH 3WFHB 1P53A 3LKPB 3QFJE 5FKPB 2VL4A 3O3EA 2MNUA 3KDMB 4TVPH 3T77A 2PKDA 4QXUH 3O2DL 1XCQA 4NJAH 1Z5LB 4OGZA 1IRAY 15C8L 1RJCA 2D7PA 1WC7B 4BQ8A 3K8LA 5T1KA 4OF8A 4G8IB 1IAKA 1BJMA 4NNPL 4MXWL 1UJ3C 4KY1L 3UTPE 3CPLB 4UT7L 2CDGA 3PABB 4YHPA 1FFPB 2P5WB 3LQZA 5CFHA 1MF2L 3QZWA 4TSAL 4K8RL 2FIKB 1DL7H 3PNWB 3KYMA 1UWEH 4WW2C 5FHAH 4BH7B 4JKWA 1WQVT 3IJSA 1N8ZB 4F58H 3AAZA 5DMGD 4KXZI 2ICWI 4FZEH 4GRWF 2BERA 4M6NH 2DM2A 3TLRA 3QG6B 1QEWA 5KSAC 5ERWB 5IK3B 3CXDH 4PS4H 4LKXA 1VEOA 3EYOB 5FA4A 4ACPA 5T33L 3E2HB 4PBWD 4UMGA 4PJHA 2ZUYA 4OT1H 3SDCB 5EU6B 3JUZA 1I9EA 5D2NE 3MLXH 4JFED 3VE0B 5IP4A 1OP9A 3QIBD 3IU4L 5FV2A 1DVFD 3PV6B 1GGUA 4RX4D 3QEQB 8FABB 5FYKU 2ARJQ 2Q86A 1ZHBB 1WJ3A 3TO4B 4QTIL 1DQMH 1U93A 4WHDA 1KJMA 4LAQH 1NKRA 4EVNB 4GSDH 4X80H 4J3WA 5TQ2L 1UM6L 3HG1D 4YNYA 5ANMA 1AQKH 2BNUB 3ARGB 4JFEA 4E9LA 1PYWB 4TQEL 3GZKA 4K3DL 3OB8A 3QIBA 1DVFA 4EXPX 3B5HA 4RX4A 1RZ8B 4R2GB 4L4TB 1WGOA 3MUGA 1N7MH 4OM1H 2EE3A 5D2NC 2VN7A 3D0VA 3MFFA 4JFXA 1MSPA 5K9JL 3V6ZB 4GG6E 2A74A 2JJSC 5MI0C 1NFDE 1G7PB 4JRXE 3QUMA 3HG1A 1LO5B 2AABL 5HHVL 1NC4B 2H2PD 3BHBA 1XGUA 2R2EB 1C5BH 4Q2ZB 5CEXB 1I9JL 3B6SB 4S1SL 3ILQD 4KHTL 3QIWD 2FATL 4Y8AA 2RCSH 4XXCC 2M1KA 4CGTA 3E6FA 3JV4A 4EI6B 3L9RA 4JPIB 3SKNB 1YC7A 1FH5H 3U7YH 4FQPA 1JWSA 5DWUL 1J11A 4OM0H 3RAJH 3GMLB 1MFEL 1IGFH 1HNGA 4PGDA 1AGEB 2ZPKH 2FH6A 4XP9L 1RVFH 4ZFFB 5GS0C 2QQLL 3QIWA 4X8JA 2P8PA 5EPMB 3TIEB 3O45A 1WEJL 3EFFB 3QNYB 2XZCH 2E9BA 3T8XA 4XPHH 3BIKA 4X0KA 1HYSD 1WIPA 3NA4A 1T83C 4LF3A 2ESVD 3EO0B 4OLVL 1SBSH 3NAAH 1M05A 3EDJA 4U1SB 4X5LA 2DDQH 2YSSB 4KUZL 5BZDB 1T0NA 2LV4A 1CD1B 4JDVA 4U7MA 5SWQB 1HE7A 2AEQH 1C1EL 5C0GA 1J1XL 1EFXB 4WGVB 1EEYB 1FZKA 4N8CL 3X13A 3BEVA 5JHLL 3RVTC 3OKNB 3MV8B 4YBLC 1WBYA 3BVNA 4Y5XB 3QIUB 2BHUA 4RZCB 1F3JA 4ODUA 3SBWC 4MA8L 4OCWL 2NNAA 1HIML 4HIEB 4A6YH 5J1SC 2VXUH 4HWEL 5HD8D 4NQCD 1T2XA 4JHWL 4U1MA 3FFDB 1XIWD 4LMQE 1Y6KR 5IG7B 3U9PL 1ONQA 3W9DA 5I30L 1MJJB 2UVEA 3MLUH 3CH1B 1C7SA 3L5WB 2Z31C 3LN4A 3QDJD 3X3GH 1LEGA 1ACYH 2Q3AA 1YMMB 1R5VA 3E2HC 3NTCL 3RVUD 5BW7C 1KGCE 3OAZK 3ULSA 1KCVH 1KLUB 4ZSOA 1MIML 4LGPB 3HUJF 3FT3B 5E56A 1EAPA 2ZUQB 4YR6B 2APWA 1DZBA 4NQCA 3K1DA 3FB5B 1L0YA 4MCZA 1XIWA 5GHWL 5HGHA 5HJ3B 1HHHA 4HBQA 2EYRB 3O2VL 3KXFD 4OAWA 3B9KC 3RGVC 4BZ1L 1YEFH 1DBBL 1I1AB 5I71C 3ZT5A 5FM5M 4OZ4B 3TO4C 3QDJA 4HBCH 5B8CB 4XVJH 1EV2E 5FDYA 3DMMB 3CC5B 5DC9B 3ILPB 3PP4H 3PQYB 3QUMH 4PIRF 3T65A 2CLVA 3WNPA 4LPXA 2D7MA 4P2RA 3K81A 4HUKB 3X12A 3RFZC 3PGDB 1YDPB 5TPWH 2VQ1A 3VGBA 5EULV 4KQ4L 3CPLA 4ZOBA 4JFHD 4R2GC 3ZKNC 3KXFA 3PABA 3T0BA 3V52L 2VDQH 3F7VA 1F6AB 2H8PB 1XF5A 2O5ZL 3DUSA 3MXWL 4LRNH 2YWZA 4NKDA 3TF7C 5CBEB 2FD6H 1JNLL 2NY5H 1WBZB 3BRGC 4ZO6A 1NDMA 3GNMH 1QYGH 4K7PY 2MPAH 4NYLB 2BSRB 5AAMA 1FFNA 3U36A 2VDPL 1FNHA 2A9ML 3RDTC 1OTSD 4M6OL 1KSRA 3TT3L 5GZNC 4H0IA 2OL3B 1NAMA 3BUYA 3HKFA 5EOCJ 4HUVA 3CSYA 3G5YA 2J6EL 5C07D 3REWB 1FL3A 4YPJA 5CP7B 5TFSH 2KL6A 5FYLE 2B2XL 3VG9B 3P4MA 4FQIL 5IWLA 1OQOA 5CKGA 2VLMD 4X4ME 3PV6A 1R5IB 2IF7A 4Y7MA 5JDJA 1GZPB 4GAYA 2R0LH 4R0LA 1TLKA 5F1NA 3QXAB 3RWFA 2H6PA 4X99B 2R4RH 2HT3D 3LDBC 4JFZL 1X44A 4P57B 2ZNXA 1TNNA 1G0XA 2YEZA 4WUKH 4M4RA 1DUZA 4LSQL 3OJDB 4S11A 2A83B 5DLML 4N5UA 1NCDH 1W2KT 2AJYL 4O2FB 2AERT 4DW2L 5C07A 4X5WB 4LSPH 1SJVA 1NC4D 1OM3L 2BNUA 3R0MA 1MRCL 3QO0A 1QFWH 4MZ2A 1ZA3B 2C9AA 3BPLB 2ARWA 3H9SB 1CS6A 5ICYA 1HH9B 3IRZA 1RZ8A 3DIFA 1A9EA 2CIIB 2PTTB 2X09A 4DZ8A 3VFUB 1BGXH 3P77A 3U0PB 3VXUE 2XQYG 5EH1A 2E7HA 4OZHB 3CVIH 1T2JA 1JBJA 2BK8A 4J6RL 1T7ZA 3MLPA 3K4AA 2P5EB 4YUEL 3SO5A 5C9JB 2R1XB 3TH2T 1G7PA 4M5YH 4BFGA 5D7IB 1NC4A 5FM4A 4Q2ZA 1TZGH 4L8DA 4MHHI 3R8BB 3V5HB 4NQEE 5TDOB 3TCXA 5GZOD 2NYYD 2R2BB 4GQPH 1YEHH 1F2QA 3P9MA 5LWYL 5EIIB 3CVHB 5AYQA 2AGJH 3PIQB 2GUOB 2CK0L 3L95B 3BJLA 3DI2B 3ZE0F 3KAAA 1R5WB 2IMMA 4ZUVB 4JPIA 3SKNA 2NQCA 2BSED 1NGWA 4WV1B 1CE1L 2P43B 2QSTA 3F5WB 2Z92A 4TULL 2VXTH 1LDPL 3B3IB 4PJGE 1UKQA 3IXTA 3VI4E 3FKUS 3B2VL 4KI5F 4NUJA 3ZE2E 4ZFFA 5F9OL 2F8XC 2ZUQC 5ESQA 5JHDB 1EFXD 4KZDL 5HVGB 1FSKC 3BP4A 4OLYL 4PTUB 4QHMB 3EFFA 3L5JA 3MV8D 4OCYH 3H0TB 4DOHB 1FO0B 1IFHL 2PO6B 1L4IA 3QIUD 5HYSG 1I1AC 3WL9B 4MD0A 2HLFC 2ZUUA 2VOTA 4U1NA 4NNYA 4R90H 5B8CC 1Q1JH 2IAMB 5FO9B 2YPKB 1IM9B 5DDHB 5DZLA 3BXNB 3DMMC 1RURH 4PJ7F 5DEZA 2XG5A 3K2UL 4PJDF 5HYJB 5ESAB 2PN5A 1CD1A 5SWQA 5I74C 2AKRA 4XMPH 4HS3B 3EDKA 3NCYP 4DVRH 4IDJH 3VXTA 2GT9B 4OQTA 2A6KA 2I24N 1YMMD 3GSXB 4NRXA 3O3AB 3H42L 2FEDD 3QIUA 5A2KH 1NAMH 4MNQE 1XF4B 1U8NA 3VRLE 4FQCL 1WZ1H 3SDXE 4CVWA 5JORB 2PF6A 1UQSA 2FO4B 3FO2A 5KVDL 1A47A 4PGBA 3VXRB 2A9NH 3SQOH 5JUEH 4TVPL 3MC0A 2VR5A 4KROB 1YMMA 4QXUL 1I7TA 1UJTA 3IDGA 4DK3A 3O6LL 3MRMA 4MD4A 4P9HC 3MRRB 4NSKB 1VFMA 1RJZB 2APXA 2QKIB 3T1WA 2Q7YB 3FT3A 4JVUA 4M03A 1NANI 1BVZA 2VDRH 3FB5A 4HKBA 1KPRA 3HB3D 5HJ3A 4FXKB 1D7FA 4CUCA 2GTZA 1QR1B 1DL7L 4P4KB 3B8YA 1UWEL 5FHAL 4Y16C 1B0WA 3U48A 3GSVA 4OZ4A 1I8IB 4XC3H 1P2CA 1N4XH 3ABZA 2UWEE 4FZEL 3CC5A 4M6NL 3MFGB 4Z7WE 3MCG1 1IT9L 1DN0B 5CAYB 2RJMA 1A7QH 3WHXB 4LLQA 3CXDL 4PS4L 4JZNA 3AS0A 4HIHA 2EXWC 3KGRA 5AWNH 4ZTOH 5C0RL 2BOBA 2X9XA 2DLGA 3HMXA 1EUUA 4OT1L 3GEWB 2G5BA 1LO0H 2YUVA 4JM2C 4RNRB 5JZ7C 4OZGB 4Z78B 4UT6H 2D7TH 1KUMA 1VKXB 2H8PA 3L3JA 3MLXL 1GCFA 1C5CH 3VJ6A 1G0DA 3GSWB 2YS4A 1YPZF 4N0UA 2YMXL 4POUB 3ZDXF 2MSPA 5CD5D 2HTKD 2VZ1A 3TVMB 1D6EB 1JHTA 4MQXD 1MJUL 4NYLA 3IDJB 3MLVH 1DQML 3SCMD 3V6FA 4D3CL 2DQDH 4LAQL 3NH7H 4ETYA 4MAUL 5HYJE 2HP4A 3K1KC 1KXTB 1AQKL 4KWUA 4JO4L 4WV1C 4NZDA 3ZTJG 3NPSB 3UYPA 3L5XH 4LHUD 3LKSB 1RULH 2UY6A 3H9SD 3UTOA 3CCHA 4RFNC 1RIUH 2O5YH 3CUPA 1N7ML 3C6LD 3RZCC 3ARBB 3SCMA 2NXZB 2A1WH 3DVGB 4P57A 3KPRE 1KPUA 1P7KB 1T1YA 3BGFB 4OQTH 4OV5B 1S9YB 2FB4H 2P5ED 1T22A 3MA9H 5FM5O 1JGDB 4HQQH 1MPAL 3PUCA 5FO7B 3LHPH 4PREA 4LHUA 4FN0A 1TMCB 1Z0NA 5F8QC 3CDYA 2P8LB 3GMOA 5D7LD 1FH5L 3U0TB 3C6LA 3TJHD 3U7YL 1NMCC 5EUKA 3LSOA 2DQTH 5FO8B 5HYQB 3EDEA 3EFDH 4OM0L 3RAJL 5T5NG 3MRGB 5CINH 2P5EA 5C9JA 4U6VH 5F3HB 2ZPKL 4N5EC 4K94H 2HJFB 5D7IA 5C86A 1RVFL 5EIVA 4LSVH 4ZXBC 3MODH 3F6LA 4K07A 4Q6IC 4HC1A 4ZNEE 4Q9RH 2DQFA 4ZPVA 5JHDD 2ZCHH 2VLJB 1MCOH 1VCAA 4JY4B 1SY6A 2XZCL 4XPHL 5I6XB 2WUBH 4WFFD 5D7LA 4XPTH 2PO6D 4B41A 2C1PB 2FGWH 3MUZ1 3MJ7B 4YHIA 1UC6A 3NAAL 3ULVF 1NBQA 3F5WA 4I9WD 4F7TA 2Q7NA 1I3RB 2AEQL 5ESVA 2VZOA 5JOFB 3QI9D 4MVBC 2D4FA 1OAUH 4F80A 4NPYA 4W4OC 4OZIE 4FS0A 3P40A 4UDUB 2EYTB 3EYQD 5EN2A 3FN0L 3OZ9H 3SDYH 1LP9E 4QXGL 2DN7A 4CADB 4KKLC 4QHMA 1QBLH 1P4BL 2IC2A 3HMXH 1IQDA 5ETUB 5B38B 1JRHH 1FV1A 5JIHA 4H20H 4HIJA 4XB8A 2VXUL 4P4KC 2YXMA 3RWCB 4BELD 4NO5A 4X7SH 2E9JA 4AENB 4AJ0A 4PJAE 5FO9A 4HAFA 5MERA 1RZKH 4QOKD 3VI3F 2ED7A 3QI9A 35C8H 3ECBA 4J3SA 3U30B 1YEGH 2XT1B 3IETA 4NZRH 4DAGH 1D5BA 3MLUL 1ORQA 3MRDB 4NN7B 4OLXH 3VD3A 3X3GL 2YN5A 2JJVA 1JPTH 2ERJC 4DGVH 3ZL4H 3D48R 3V6BR 2R56H 1MHCB 3KR3H 3VG0H 2OP4H 1PD6A 3D39B 4P2CG 2R23B 2BNRE 4QOKA 2W0FA 2Q76A 4IRSA 3GSRA 3OR6A 2OJZH 2XA3A 5HGGS 1YN7B 3QCUH 1OSPH 4U6HB 3WHE1 2YD4A 5IHUL 1EX0A 1N6VA 1CGVA 4QHKJ 4LU5H 2JJTA 4XVJL 4JO2H 1FNFA 1JN6B 4R3SA 4NHUA 3KG5A 2NY4D 3PP4L 3QUML 1G6VK 3O2WL 5IKCB 1QQDB 5ICZA 5TPWL 3NPSC 2C1OB 2R39A 4NQSB 5ACZA 3NVQA 4AIZB 4Q7DA 4CNIB 3JWOL 2VDQL 3UTSB 4ONHB 1PVHA 3BEWB 2D0GA 4LRNL 4JPWH 3IAGC 3P0VL 2V5YA 2NY5L 4YE4H 2AEWA 5IT2H 5D5MA 3GNML 4JQXA 2MPAL 3TT1L 4A2MA 3TVMD 1GH7A 1LEKA 2GITB 4DEPB 4K7PH 1JHKL 4K3HA 5IVXA 3FQUA 1CYGA 4Z7VE 5I1EL 4OQ1A 3FN3A 1SY6H 2ZUTA 5C08B 4RNRA 5A2FA 4YFLF 3WFDH 3J7HA 4DZBA 5I8EA 5TFSL 4S1DC 1UACH 3JXAA 2N1KA 1MCNA 3TFKD 5FGCE 2FSEA 1FRGH 3MA7A 3S5LG 3TVMA 2EDKA 5C0BD 1MCLA 2DBLH 5L2JB 1ZSDB 2OTUB 4MLSA 5I76B 1SEQH 4L4VE 3ARBD 4TTGA 1DSFH 5SX4I 1KT2A 3O11B 3D0LB 1OAQH 2A0LC 4WENB 4BK5A 1BIHA 4X7FC 4LSPL 5HHOE 5I2IA 3Q6FA 3THMH 3UTQA 2GY5A 3IS0X 4PLJC 1SYVB 3C08L 2EIZB 3QWOB 1BJ8A 4RGOH 3STBA 3DX7A 3I3DA 3EO1B 1QTYT 4HHAB 1HQRA 2VKWA 4HXAH 5JIKA 2HKHL 1YNLH 5C0BA 4NOFA 1M1SA 4XNQB 3WO4C 2XICA 4D9QD 1AO7D 3CVIL 2V2TB 3D39E 3D6GA 5JPMA 1KLGB 4BFBD 5BJTB 4M4PA 2R29L 3BH9B 3RWHB 1FL6B 4JFYB 2FLRT 3KPNA 5DD5H 2ZUXA 4MB5A 1NEZA 1RZGB 1UH4A 1XMWA 1YEHL 2HG5A 4J23A 3V7AG 1UENA 3ZHLA 5BVPH 2ZOKA 3HE6D 2JB6A 3LAFA 1KIRB 3DV4B 2PYFB 3U30C 1AO7A 4HH8A 4X98B 4Z0XA 3RX5A 3TPKA 2H41A 3CLEH 4NN7C 3VGEA 3X11A 2A6JB 4GUPB 2UZIH 3QUZC 3CGTA 2EDDA 1EPFA 3NCJH 5L2KE 3Q0HA 1RIVL 3QQ3B 4R4BB 3BRFA 1TZIA 3FRUA 2X7LA 4LL9A 1DEEB 1QZ1A 3DHJA 3VFSB 2EIDA 3HE6A 5ISZB 3P73B 4MDIB 4OCYL 5IROA 3WUWG 5E8PA 4U3XA 5DR5L 5IFHH 2I9TB 4CN6A 2W0LA 1JE6A 4AM0A 3OG4B 5CJOL 1Q1JL 2NY3B 4LBEB 4EDXA 3ZKMD 4Q9CA 1RURL 5E8OA 1INDH 1OVZA 4I13B 2OS7A 4XMPL 2WK2A 4I5BB 2F54B 4NKIL 2DLFL 1UH2A 3OKMA 2QQNL 4HKXB 3MJ6A 4MQTB 3CZJA 4EDWH 3B43A 4IDJL 1K8IB 2XRAH 4Y1AD 1T7YA 4U2ZA 5DK0A 1OB1B 3FCTB 2CLRA 5CJBA 1MI5E 4PR5A 2NY2D 1FL5A 4XPFH 1G9EA 1NAML 1EERB 1H8NA 1E4KC 1MCEA 5HXMA 1WZ1L 3SHSA 4KUCD 1R3HB 2HRLA 4PGJA 4XMLH 1DQQA 1PLGH 3CMOH 3WS6A 5GS1B 4WW1B 2WQ8A 1TVBB 5D1XB 4Y2OA 4G8GB 4ETQB 1OTUD 1BQHB 5DJYB 1MQ8A 5GGTA 5IUSA 1Q9LB 3ELAT 2A9NL 4Y1AA 5T3ZE 3QDAA 2W59A 5JUEL 3SQOL 1X6NA 3P2TA 5HI4C 4JJHA 4PJCF 4GRWE 4TVSa 1HHGB 1CIUA 2MTPA 4W6XB 1AXSB 4D8PB 2YA1A 1UZ8B 2DBJA 1CGUA 4XP1H 5EC1A 1DDHB 4K9EH 3VXNB 3RKDD 1OOAA 1AI1H 1U8PB 32C2A 1U41A 3HI1A 4LCWD 3L3KA 4AQOA 1IZKA 3B9VA 4X6EB 3KPSA 4JHZA 3UTSD 2B4CH 5HHPA 1IZJA 4XC3L 1C7TA 4PRHD 3HTLX 4RMWA 3M07A 5LQBL 3UBXA 4RGNB 3I84A 1D9KC 2Y1VA 4FQHB 4L8SB 4PJFF 1A7QL 1ZTXL 4NC2B 4WNQB 5LGHH 3BZFB 3QDMB 1EUTA 4ELKA 5AWNL 2BSTB 4ZTOL 4XPGH 4UILH 5DRXB 4AQ1B 4Z95H 4C56B 1PKQB 2YBRA 3JZ7A 1N3NA 4KRNA 4HJGB 1QBBA 4LCWA 3EJZD 4W81A 4UT6L 2D7TL 1T4KB 3UTSA 5HPMB 4U6TA 1A7PH 3MRJA 1C5CL 3RI5F 4BQCA 4X6CA 4PRHA 3ZYZA 1J9CT 5F1OB 1IL1A 1FG2B 1RK1B 4QY8A 2J5LC 4R4ND 3MLVL 4FQXD 4H25B 4YWGL 4MWFA 1XGRB 2DQDL 3FONB 3NH7L 2IANB 1KTDB 2EECA 2WINA 2NR6D 4ISVA 5SWZA 2JF1A 5KN5A 3UAJC 4KJPD 3IDMB 2YHGA 3QXDA 1RZJC 4MJIA 1RULL 1XR8B 1RIUL 2ZOLB 4BSWB 1CXHA 3WLWC 4OF7A 3WLBA 1JNNL 4FQXA 5CGMA 2ADGA 3MLSL 5JIIA 1S9VA 5I76A 1F5WA 3GMRA 4M61A 4UBDD 4OQTL 3O11A 4O5LL 3VXPB 3KJ4B 2FB4L 4BFIB 2F53B 5FUZH 4ELMB 3QXWA 3MA9L 3LH2H 3PHSA 5KANG 1DP0A 4QRSB 4ZOAA 4HQQL 5I9QB 2Y9RT 2EE9A 4CJ0A 4JFDE 5JLZA 1MIEH 3LHPL 1KPVB 2Y72A 1IKNC 2DJUA 4JFFD 3UTTE 3O4OC 1XGQB 2UZYB 3Q5YA 5I1LB 5L8JB 5C71A 2F9BT 3HN3A 4MNGB 4IHOA 4UOJA 3EFDL 1D3CA 5DGQA 3VFTA 5EORL 3V5KA 4ZUTA 2IFGA 4PTTB 3BYTA 1CBVH 3PHOA 4U6VL 1FJ1A 2VMFA 1NC2D 4MA7H 2DLIA 5JDSA 1VPOH 3VWKB 3FFCB 3F6IA 4LSVL 4CJ1A 3MODL 5J13C 5JQ6H 4QYOB 4LEXH 2FX8H 1T66D 1CL7H 5DQ9A 4I4WB 2ZCHL 5K9QG 4JFFA 3RI5K 3VH8G 1XFPA 1Q9OA 3TIDA 4CAGA 4NZJA 4FNLH 4LOUC 2EDNA 1GSMA 4RGNE 5DJ6B 4XPTL 2M8XA 2FGWL 4RWHA 1NBVL 1TZHB 2RAMA 5T5NF 1L7IH 5H94B 4M48H 2NY3D 3S3SA 1NC2A 4P2QA 1VFBB 4W6WB 4ZFOB 1OAUL 2XWJB 4TYUA 5CZKA 2DL9A 3S7GA 1BIIB 2CDFA 3SDYL 1T1ZA 3OZ9L 3I02B 4HJ0D 4F2MB 2HFFB 1ETZA 4WJ5A 1ZWIA 1U8LB 4JN1L 3HMXL 1UM4L 2MHAB 5ACMA 5IJKA 3NGBB 1JRHL 3NIGF 4H20L 3HUJE 2HJLB 3J8F7 3V79C 4ODSL 3CDGB 1Y0LA 2ZKHH 4X7SL 1NKOA 3MROA 4AYFA 5F6HI 3G6JA 1I85C 1RZKL 2ICCA 4RGNC 5GGSY 4XHJC 3ULUF 35C8L 5D1XD 4G8GD 4L8SC 1YEGL 1PG7W 3PL6D 1LE5B 2C3VB 4OLXL 3QO1B 1BFTA 4GW5B 5KSAD 5A2IH 5I18L 4POZC 3ZL4L 3QFJD 1L6ZA 1UJ3A 1H3UA 2AJVL 3GBMH 3MBEC 4LVEA 5EA0L 3NFNA 5EBMB 4LLWB 2R56L 3KR3L 3Q1SL 5FXCH 2UY7A 2X1WL 4RMUA 1F4YH 2OP4L 1R3HA 4G5ZH 1S9XB 2ZSVB 2Y5EA 1S9KC 1FZMA 2BRRH 3GUTA 2AS5M 1RK0B 1ZHNB 3UTPD 2NTFA 2OJZL 3QCUL 3IDXH 1OSPL 3BPOC 3PL6A 2ADJB 1P1ZA 2Y07H 1NL0H 4QF1A 1U8JB 2FJGA 3LZFH 5KSAA 4LU5L 5EZJB 3QFJA 4N8VG 1IVLA 4PJ5E 3UYRL 3EYVB 5F7WC 2EC9T 3B5GA 1P7QD 4U1HB 1QOKA 2VWEE 2EDTA 1T20B 4XCEB 3MV9E 4PJDB 4JDZB 4C56D 4KK9C 3GSNA 1BD2B 1VGKA 4M7ZC 1A5FH 2ZSWA 3G6AB 2XNAB 2XZQH 4WI9A 4JPWL 1UZ6F 2DI9A 2HT4D 5ADOL 3NOIA 4OGXL 5DD3H 2WBWB 3GGWB 4OZFA 1P7QA 5EBWB 4WFGE 1FNAA 2W0PA 4PJEB 1GJIA 4X6FA 5I9QC 4K7PL 5K33A 1WICA 4HC1L 3R8QA 5I17A 3D85B 3A6OA 3DYOA 4PG9B 3W5MA 3RP1A 5I1IL 1SY6L 3SGKA 2XI9A 5GRXG 1AC6A 2ITCA 3WFDL 4FG6C 4ZAKB 2VWEC 1DFBH 5D2NA 3JTSA 4P9MH 1OGAB 4NJ9H 1FRGL 2JJSA 3P4OB 3VWKC 1ZS8A 2OM5A 5CILH 2EDFA 1A6UH 1SEQL 1PQZA 1DSFL 3FONA 4F7PB 4H1LG 4YDJA 5EBLB 1OAQL 2YZ8A 5EUOB 3EOBA 1N5AA 2NY6C 2F53D 2QQQA 4XXCA 1BVKB 3THML 3JV5A 1H3TA 1LNUB 2EC9U 3U2SB 3BP6B 1AIFA 1U92B 3UPRB 1T21A 5IVZB 2HT2D 2D4DA 5C3TA 4OD3H 4HXAL 3ZE0E 3AS3A 1BX2B 4F7MA 4JQVC 1FQ9C 3DV6B 3LEYH 2I25N 1U8QB 4X83A 1C12A 4NRZB 4UOW0 4MD5A 1HQ4A 4GG6A 3BZDA 1G7QA 2BVPA 1NFDA 3FO1A 1RZ7H 4NN6B 3FFCD 5IM7B 4KI5E 1NDGB 1YEDA 1U8IA 5BVPL 3KJ6H 5IBLD 4KRMB 1FFOA 2KKQA 3B5TA 5KSBE 2OTWA 4EUPA 1JGEB 3DETC 1WCBA 1CDCA 4X5XB 5I73B 2UZIL 3ARFC 3U4BH 3P30L 3NZHH 1GGYA 2DMKA 4RRPG 3NCJL 3V0VB 4OLWH 4PJ7E 4PJDE 1R6VA 3HRPA 1QLRB 2RR3A 3FFCA 3KLDA 4CVUA 1ZGLA 5KAQG 3D25A 2P8MB 3BO8A 3ESVF 4GKNA 1HCFX 5DXWA 4B0MM 5LGJB 4MJ5B 2X4PB 1CGTA 1F6FB 2B5IB 3IKKA 2V7HA 3QHTC 1FZOB 1OWRM 1X5ZA 4KI5C 2A2QT 3PG2A 2DKMA 3RGVD 1LMKA 3EOYG 4RDQF 1YQVH 1HHJA 5BS0B 4N0CC 2CH8A 3GO1H 2Z31A 2A6DA 3WIFB 2GJZB 1A6WL 1FC1A 2YUWA 4GW1A 3SJVE 5E9DB 5DTFA 3OF6D 2C4XA 4OZFH 4PRPB 1H8SA 4J3OC 1BZ9B 5ITFB 4EDWL 1DBMH 2XRAL 2BRQA 4FQLH 4G7VH 4YEEA 5EBGA 4URTB 1GIGH 1U8LA 1S7SB 3VXMB 3GJFK 3ZHDA 2DYPD 4TN9A 3ZKND 1P4LB 3B9KA 3RGVA 1FVEB 1RHHA 4E5XA 5F7HA 4XMLL 2FYYB 3CDGA 1AD9A 3CMOL 4L29B 3VFRA 5I1DB 2VITA 1JVKA 3OF6A 1D6VL 4XNUH 2VDLH 3DXAB 2VE6B 3Q3GB 2A6IA 4R96A 2C3VA 5IFAH 2Y5TB 3LY6A 1FGVH 4QWWC 4XMKH 1B0RB 1G1YA 1ED3B 4APQB 2QHLA 2DYPA 4DWHA 4WU7A 3C9NA 1S78C 5CJQH 4J3XA 3PWPD 1Z9MA 5JW4R 3BN9D 4HT1H 4XP1L 1G7MA 2VRAA 2Z8VC 3KPQB 1AI1L 2I07B 2CRZA 5F1IB 3VFNB 3K80A 3L3IB 3MRBA 3R1GH 3WNMA 2Q1EA 3MBXH 2B4CL 5BRZE 3CFJB 5MHSE 1KB5A 1YPZE 3MLZH 4MA1C 3RDTA 5GS0H 1HHIB 2XPGA 3F12A 4EJ1C 3ZDXE 4ZUUB 5BMFH 2IEPA 3SGJA 1IQWL 2EC8A 1S7RB 3PWPA 1MNUH 1CFSA 3BZEA 3QCTH 3V0WH 5IW6A 4XPGL 3S3JA 4Z95L 5E2JA 2IADA 5FIEA 3D85D 1MQKH 3RWDB 3MO1A 4KGJA 5DJ8A 2Z91B 1FCCA 2JE8A 5KW9H 1A7PL 4UUJB 4EUPH 3GB7A 5D96B 4D9LH 1S7XA 2DICA 4XVUC 4EOWL 5J9PA 5FYLD 2X10A 2XWBA 4FMKA 4YXHL 5LCVH 4NQUA 3GGWA 4U4BA 4ENEC 4HGMA 5GGSA 4Y0GA 4NN6C 1U8OB 1HOCA 3T1FA 2YR3A 5L7XH 2YD3A 3D85A 5EB9A 1D5MA 3C5JA 1OHQA 2HA1A 4XNMB 3MNVA 3BZ4A 4U1GC 1KIQA 5I73C 3MGTB 2VH5L 4HZAA 1JNHB 3WIHA 5GRZA 5TQ0H 5A2LH 4X4MA 2WAHA 1KCLA 5FECB 1CU4H 3FQXB 2Y7QB 2V9RA 1U95A 3EYSH 4MB3A 4NQVA 1F2XK 3BX7C 1JP5A 1NMAH 3KHQA 2B5IC 1T1XB 2XACC 1QLFA 2J12B 2HH0H 3LH2L 1F8TH 1CD9B 1EAJA 2F74A 4K7FB 5CMAA 3I3BA 3BP6A 1I4FB 4PFEA 4RIRA 1MIEL 3MR9A 3N1GC 3VFMB 4XP5H 3VMOA 2HLFD 2Y6SC 5T3XD 1BVLA 1XZ0A 2FX7H 4U1LA 5EZIH 5E1HB 1UXSA 1VSCA 2CPCA 3AY4C 1JZ6A 4X6DB 3GJEB 5FF6B 1UB6B 4QHNB 1KEMH 2ZG2A 1F02I 3OJMB 5GGTL 3LV3A 1U8QA 4QRQA 4YFDB 3VXUA 2W65A 3PF2A 3GHBL 1CBVL 1Q94B 3IT8D 3L3HA 2Z35A 3MJ8B 5C09D 4MA7L 4D0CA 3SKOA 1NH6A 1U9KA 3HE7B 5L6YH 4ZO9A 4WFHD 4AZ8A 3MYJB 4LAJH 5JQ6L 2VABB 4LEXL 2VO5A 2FX8L 4JKPH 1CL7L 4U1KA 5A43C 4LSDA 4UAOC 1B0GB 4FNLL 2ADIB 4Y2DB 3WNKA 2Q20A 3MV01 3H2WA 1Q0YL 3U9UB 2FLBT 2BMKA 3AREB 4LQ1A 3VDCA 4Z18A 3E6HA 1RV6X 1L7IL 1KB5H 4HGWA 4JR9H 5C0EA 4M48L 5C09A 3VI3E 1MCBA 4PJGA 5E9DD 1NUDA 4OGAC 3QAZB 3RVXD 4PRPD 3LCYA 1CE6A 1SBBA 3P11H 3ULVC 4NQDB 4ONGL 3G5VB 4GBXB 3UZQA 1KOAA 3HC4H 3VXMD 5SX5K 5I8KH 3OAYH 4MNQD 5IMOB 4KRLB 5D9SA 3CDFA 5DA4A 1YEEL 2P24B 2XTJE 4I0PB 4TNWK 1FVCB 3OKYA 3WIIL 5MENB 5TF0A 1MLCB 5DF0A 5E00B 3ARPA 1UT9A 1Y18B 1S7QB 3GBML 2ZUWA 4HUNB 1G7IB 3VXMA 1IC5H 2Z93B 1ERNA 2RB8A 3ARUA 3O3DB 4MNQA 5J12B 1F4YL 4WTZA 3ARRA 1P4LA 4G5ZL 3GMNA 5DVNA 4GKSB 3SDXA 2BVTA 3PGCB 4XBPB 5FYLH 2BRRL 2UUDH 1CD8A 3MLTA 4L29A 4JRYE 1KACB 1ODAA 3MRLB 3WIHH 1M6OB 5AUMB 1BZQK 2Y07L 1NL0L 2L4OA 3SDDC 3DI3B 2XIDA 3LZFL 4JQIH 1JWUA 4QT5A 1A9BB 3SQBA 3W0WB 3A6CH 1FCGA 5A3ID 2NLJA 2VDOH 1QFUH 1U3HC 2XTJC 4PGCB 4NQXB 4NKMA 1B0RA 5F88B 4JM2A 4LCUB 2ATKB 2QADC 1CFNB 3VGFA 4Q6YA 3IRPX 5KG9A 2JCCB 4G43B 5IB5A 3E0GA 1CFTB 1ORSA 5E7BA 1UEYA 4U6XA 5D1QD 1I3GH 3K8MA 5F1IA 2PYEB 3L3IA 3RTQC 4EIGB 2VUYA 4P46C 1A5FL 1KTRL 1T5XB 3T2QA 5MP6H 2XZQL 4X4YA 4QHLA 4TSBH 5IVNA 4GT7A 4JZOB 1HXYA 1MCKA 1HHIA 1XGPA 5DD3L 2UWEA 3B9EA 1JI1A 1KF9B 3HS0A 3TBTB 4Z7WA 5IQ7H 5B4MC 3O0RH 1EGJA 5JW5A 3TA3B 4PJBF 2AI0H 3DRQA 2D3VA 2J7LA 3O3UN 2VSDA 2XKSA 5D1QA 4POYA 5LAXB 4R7NB 4DUWA 3OKLB 5TH2A 1MCCA 3ARDB 4GW4A 1RZIA 2LVCA 1YUHA 3DECA 3DROA 3BKYH 3QA3B 1DFBL 3D2UB 5C0CB 5TDNA 1WF5A 5EZOH 5JW4N 3MOBH 4WI6A 1DCLA 4LLDB 3OB0H 4PJHF 1HXMA 3VD5A 4U31A 2SEBB 4P9ML 4NJ9L 3T3MF 4Z7QF 2LFGA 4KRPB 1H0DB 2VZSA 4D0DA 4YC2B 5CILL 1RAMA 1VADA 2XYCA 4TRPL 4G80B 4LCYB 4HS8H 5HGBB 4NO3A 4Y2DC 3UJIH 2R2HB 3Q2CA 1WWAX 2GYSA 1FP5A 4PRBA 3RNKB 2IGFL 1WVZA 1BWWA 5T1MB 4HKJA 1QPPA 1JRHI 1ZA6B 1CTOA 4LCCB 5CKAA 1LO2H 4OD3L 4RMVA 4PLOB 4TOYL 1B6DA 1G9ML 3PWLA 4C83A 3FQXA 1I3UA 1M7IB 2Y7QA 4NDMB 3LEYL 1WTLA 3H3KA 2G9HB 4P9HH 4Z77A 3NZ8A 3QB7C 1Z3GL 4HXBH 1A4JA 2FO1A 1K2DB 3KPRA 1ZGLP 2CXKA 3GSOA 1KJVB 2HLAA 3I2CH 4GBXC 4QHUA 5E8DH 1RZ7L 4H8WC 1V7NH 2J3SA 4P23B 3HE7D 1TJHH 1YN6B 5TGBB 3QUYB 2R15A 1I4FA 4WW2F 1TNMA 4S2SA 1S7UB 3KJ6L 5DJ2A 4JGMA 1FYHB 1G6RB 2D7QA 1NGYA 4PJXB 3DVNB 4ZDHA 3IU3A 4FXGA 3GJEA 2E8ZA 5HDQH 4AY0A 3IJYB 4E0RA 1MRDH 3U4BL 5CSGA 4W4OA 4GRLD 4RAUB 3I75A 3O9WD 5HY9A 4CKVX 3C60D 4O2CA 2VABA 5IF0B 3HRZB 4KZEH 1LK2B 4ZFGH 2NY0D 4ZNEA 3BMVA 4PB0H 3SKMB 1AHWA 3DSFH 1T80A 3GSNL 1PG7H 4R97B 2Q8BH 5J56B 3U9UA 5C2BH 1W72B 3RRQA 1HH6A 2MQCA 3TNMA 3HZKA 1YQVL 2B1HH 2NX5B 4GRLA 3FZUD 2V5TA 4JM4H 5I1HH 3FT4A 3O9WA 4UV4H 3JTTA 2DB8A 1BQLL 1CGWA 3C60A 4XCYA 3KWWB 4FFVD 3QDHA 4G7VL 5E8NA 4UTBH 5TE4H 4AEHH 2VXSH 4OZIA 2VXVH 4ZTPH 1GIGL 4PJCE 3WFCH 1LP9A 5GSRB 5DD0H 3U46A 4MNHA 4WHTA 3N1PC 2X1XR 4OKVA 5D6CB 1ZGLM 2H3NA 2MFNA 1HHKA 2NW2B 2AJUH 4J7RA 5IMKA 3QJHB 2P24A 3RVWD 2XN9E 2K3TA 4X4ZA 5EG6C 2VDLL 2BNRD 1R3IH 3WN5B 2LU4A 3DNKA 1X5XA 4G6MH 3QNZA 1I1YB 3V7MA 3V4VH 4MAYB 4RFOL 3UJTH 4XMKL 1J0ZA 4M5ZH 5EOTA 3ARDC 4KTDH 4PUBH 4RFEB 1XGYH 4PJFE 1GC1C 2DIBA 5CJQL 3OKKA 3BIBX 4HT1L 4IIQC 3HMWH 4IMLB 1I1RA 3TN0D 3UDWC 4ZPTB 4OD1H 5C3LD 2BNRA 2PYED 4WWKB 1M6OA 1HILB 3R1GL 4JJ5B 1KFAL 4KRPC 5E2TH 3HAEA 4M7LT 1WK0A 4LIQL 3S6CA 3AU1B 3VGAB 4N0RA 1PW3A 4Z8FL 1TPXC 4PJ8B 3HLAB 1RHFA 1KC5H 5DUMH 1MNUL 2RQ8A 1ZANH 5F9JB 4L8BB 3V0WL 3PXHA 1TFHA 3TN0A 4Z7UB 4LCCC 4BZ2L 2E7BA 2VISA 4K71C 2IQ9H 2CMRL 2PYEA 5KW9L 4XCCH 1J1PH 5CGTA 3CSGA 4I48A 2PUQT 3B9AA 4D9LL 1KJ3H 3CFDB 5D7JB 2YKLH 5C0CD 5EU4A 2OZ4A 2RFXB 2FIRT 5D70H 5LCVL 3SGDH 1I8MB 2BCKB 2Q8AH 2E6PA 5H2BA 3OKOB 5A2JH 3QUYC 3STZB 2E8YA 4HIXH 2BSSA 3BAEH 4L4VD 2BY2A 3V0AC 4R7NA 4JN2A 5H8DA 3OKLA 2GTWA 3UMTA 1HZHH 3CMGA 2QHRH 5HHOD 5D2LB 5F7EL 2FJHB 1KCSL 5HHME 5DMKB 4WUUE 4GOSA 2OK0H 1NBZB 1EZVX 3BIAX 5IR1B 3G5XA 5TQ0L 1JWMB 4IM8A 1OAYH 3DO3A 1CU4L 4HV8B 5HYFA 4QTHA 4YDVB 4WI8A 2AV7A 3EYSL 3NCYS 4IS6B 2B7DT 4NM8H 1NMAL 4JVPA 2KZWA 4L4VA 1UVQA 4KH2A 1J5OH 5DT1L 4PJIA 5C92A 3REVB 5HGAA 4WU5A 1G1CA 3LEXB 4EXKA 2HH0L 1F8TL 5ID1B 1NGQH 2NY7H 1AE6L 1I7UA 5HHOA 4P23D 1QD0A 3VMPA 1RUPH 3HNVH 5DHYB 4DKAA 4FRWA 3MLYH 3D18A 3VFWB 5DD1L 2QR0A 3TESA 3SY0A 3RIAF 2FX7L 1A02N 5EZIL 2XFXA 5C0IB 3ROLA 3FO0L 4MCYB 3JBG7 3QR2A 1VDGA 4OUUA 1KEML 1SMAA 1EEZA 2AXGA 3GSQA 3WS3A 4IMKC 4O2EA 5C0NC 2X4UB 3MREA 4K2UH 4TUJA 1F90H 5L6YL 1NLDH 4XVSH 3TBWA 3CNKA 1HCVA 4P23A 3I3EA 4JKPL 2R1YB 4UNTA 3RGHA 3DARA 2P42B 3UTZA 2O61A 2K9UA 1MAJA 4H26B 4OB5H 4KK6C 3NIGE 4K8RC 3WN5C 3WFBH 1II4E 1XF3A 4YFEA 3HAEH 2WBJC 4M7JL 1J8HB 2FHCA 4FFWD 4FHBD 1KB5L 1NCBL 3IF1A 4MAYC 4RMSA 3GKWH 3SDAB 3HZMA 4U0QB 4Y5YB 3X3FH 5CBAB 3VGGA 5I1AB 5L2KA 5DEFB 4LPUA 3ULUE 3FMGH 1UYWH 1CDJA 2NZ9D 1G9NC 4NBXB 1BLNB 2YN3A 3ARQA 1E4KA 4JY5H 5SV4A 1LHZA 3ZKQD 3P11L 1BWMA 1OPGH 3A0OA 1X7QB 1UKTA 1VGEH 3SKMA 5FOJA 5LG1A 1QPXA 4HF5H 4R9HA 3GDBA 5E6IB 2VUOA 1BOGA 3HC4L 3OJVC 5I8KL 1T5WA 4HS6B 3DUUA 5HDLA 2LE9A 4LVOB 3VGAC 1FYTD 2BHZA 5HTSA 1FN4B 1SMOA 5GGVY 2XWTB 4PJ8C 2OZ4H 3ES6B 3DVFA 5FK9B 3MGAA 4UT9H 1DJSA 4XCNA 3FO9A 5B38G 3QEUB 2H32A 2K7PA 5IFJB 1VEMA 2DQCH 5T3ZD 1M7DB 1F4WH 1U8HB 1NCNA 1U8KA 5F7NC 2E7LC 1MI5A 5GSRA 1O0VA 3ULUC 2XXCB 1CGSL 1IC5L 3V6OC 4YDLB 5DSCB 4K3EL 4DFHA 4NC1E 1LO4H 2YRPA 1W0VB 4G42B 2H26A 1FYTA 1J0IA 1QBMH 2PXYC 4HWNA 3AROA 5FYLL 3NCMA 5AYUH 4R4FL 5KJRH 3WIHL 5IBUB 1FZJB 3RVVC 1NFIB 3VXOB 3ALWA 4WWKD 2D2OA 4JQIL 4GAGH 1UZ6E 4GXUN 3A6CL 2YPLE 2VDOL 3P9LB 4XGZA 5DQJB 4ZO8A 3WYRA 3UZEA 4EZMA 1CICB 4M8QB 1ES0A 2NPLX 2BVQA 3E3QE 2UV3A 2LAAA 4KJQD 5M7QA 5ICXB 2PW2B 4P59H 4OCXH 4I0KA 5GSVA 4U6YA 2COQA 3PWNB 2WIIA 4LK4A 5FCSH 4NC1C 4WWKA 4H88H 4HFUL 4JJ5A 4PRNB 4ZS6D 2EO9A 4QXTA 1FIGH 1R3LB 3T0DA 4JREB 4UQ3B 3M1BA 1I7ZB 4TSBL 4YGVA 4L3EE 4U7KA 1MEXH 2IBGA 1JJUA 4RGMC 4XRCB 1J0KA 2OR9H 4Q58C 4BFEA 4KK8D 2AJZA 3CJJA 5IQ7L 2BXYA 3O8XB 2NCMA 3FOMB 2F58L 4FTVE 1JPFA 4WCYH 1MCQA 4N0FA 3GMQA 2AI0L 2IH1A 5I66A 3KLHD 4PGEB 4JFQA 1KJ2A 25C8H 3GRWA 4NFCA 3HPJA 3WFEH 5T3XL 1CL7I 3MJGX 3VFPA 2FJFB 4EQ2A 1AGDB 1RD6A 3E3QC 5E24E 2R1WB 4EN3B 3KYOA 5DRZB 3MOBL 3Q5TA 5GRYA 5DRNA 5TF1H 2AEIT 3OHXB 1BFOA 4R6UA 2CIKA 3FN9A 3QUKB 5EO1A 1U91B 3T2PA 4UDTB 2XXMB 3NFSH 5J6HB 3UBXI 2JIXD 5H37H 2CUHA 5DJ0B 5KS9B 1CDYA 3RWGA 2UUDK 4HS8L 1NCAH 3FB6B 4QRTA 1VERA 1CLZL 4NP4H 4OD2A 1YYMH 3FB7B 2MWCA 1A6TA 1T0MB 4JFDD 3AM8C 5HGDA 4P5TB 1LO2L 2F5BL 4HUMB 3DO7A 1B2WH 3UO1H 3HC0B 2W9EL 3T08A 4OBRA 4Y4FD 3UTTD 1GXEA 4Y89A 3WDJA 4P9HL 1MVFA 3SO3C 4YDVA 5IEHA 1NGPH 1BFVH 3MRHA 2JIXA 4HXBL 4BA8A 3QHFH 4RSVA 4P5MB 4NKOA 3I2CL 3O41A 3CX5J 3S4SB 1CR9H 1V7NL 6FABH 3QUXB 1P84J 3STLB 5CIPB 3BKCL 3S96B 4JFDA 2DL2A 5E70A 4XWOC 1ZV5A 1V3JA 4Y4FA 4PY8I 3UTTA 3KVQA 4JAMB 1YNKH 3K3QA 4XHJD 1A7NH 1HINL 3WDIA 5DZOA 4JKLA 1MRDL 4G9FB 1DUYA 1J8HD 2DQJH 5I75C 5T3ZH 5BV7C 3IDUA 4RAVB 2F19H 2VR9A 3BQUB 4POZD 5EU3A 4GRWH 1NBYB 3QBTB 2DS4A 1MRFH 1UA6H 3MBED 4MQ7B 4NFDA 5L0QC 3BMWA 4KZEL 4ZFGL 3T4YB 4GAJH 4OZHF 3M8OH 3DSFL 2M26A 1QSFE 2Z8WC 3OB0K 1WTGT 3FJTA 1J10A 1PG7L 4O51A 5E6ID 1I85A 5ID0A 2Q8BL 4LRIC 5D7IF 3W11C 2WBKA 1EMTH 2B1HL 3P4NA 1J8HA 1KIUA 3DBXB 4JM4L 2GFBB 8CGTA 5JNYB 3WO3B 3KPTA 4UV4L 1CD0A 2EH8H 4JKKA 2R9HC 3MBEA 1CXIA 3NCCB 4NZUH 1EGJL 3O4LB 3OR7A 4IRZH 4OKDA 1JYXA 1E4WH 4AEHL 2I9LB 2VXVL 2P7TB 2G75B 2LU3A 3L6FA 1KJ2H 4ZTPL 3U4AA 5JW4M 5KVGH 5DD0L 3GRWH 3IFPA 2EYSB 4JFOB 4LHQB 5JXAH 3M17B 4G8EB 1RZJH 3R06B 5J6GB 3SKJH 4JREC 4Y5VA 5GRUH 1U58B 5DI8A 5FB8B 3MQIA 5E2UH 3LKOB 43C9B 1R3IL 3O8XC 5IHZB 3LEVH 3IDYB 1ULVA 4G6ML 4ZQKB 4O9HL 5KOVC 2PR4H 4PRDA 3VFOB 4HDIB 1T04B 4KTDL 4PUBL 1XGYL 2W92A 5ELIA 3OJ2C 3FOLB 1WFUA 3DTXA 3N85H 4PJ5D 5DSCA 3C87A 1BQHG 4Y4HB 1CICD 4ODHH 4L3CA 3HMWL 4YDIH 5GS2D 4R7DB 5LKNA 4P3DB 3KLAB 5GJSH 3ISWA 4OD1L 3OAZH 5A40E 5INCA 4PG2C 5E2TL 5F6IC 3KYKH 1EEQA 1MFBL 2HWZH 2YA0A 4TUOA 1OAXH 4LSSH 4PRIE 1W8NA 2E5EA 5FGRA 1FPTH 3W2DH 1KC5L 4PJ5A 3FQWB 3U6RB 1H5BA 1ZANL 1I75A 5ITBH 2NY6D 4TTDC 3FB8A 4WFGD 3VCLA 1OW0A 1U3YA 5F9WC 2VERN 4P5TC 3VRJB 2IQ9L 3RJDA 5BCAA 1RMFH 4V1DB 2DRUA 1J1PL 4AT6B 2KZ1B 3K74B 1ROWA 1KJ3L 4UINH 5F7DB 3ZKXB 2BVOA 3KS0J 2VLKE 1I7ZA 4L9LC 1IC7H 1N5YH 1MLBB 1MWAA 3LKRB 4GH7B 2OQJB 4XRCA 3HCVB 1FVDB 2X70A 4MX7A 1DANU 4XNXH 2BX5A 2Q8AL 1WWWX 5JIPA 1NLBH 4YH6A 5HHNA 3FQNA 1QSEB 3WEXB 4JANA 4LLUA 3BAEL 2AXFB 4CVZB 1X9QA 1Y6NR 3BN3B 2GSGB 4P4RB 1CQYA 4LP5A 5D5MF 3RA7L 4QRRB 1HZHL 3WD5H 3MRIB 4JQVA 5E8EB 1IBGH 3DETD 2N7AA 4AEFA 3ARFD 1OAYL 4OLEA 3BQUC 4ODTH 1IGIL 1A2YA 2V2XA 1N64H 4OZGF 5FA3A 2IFFH 1ND0A 2D0HA 5BO1H 2HFGH 4NM8L 3EOTH 3VU2A 3T77B 1KELH 2VDMH 1XCQB 5CHNA 1NGQL 1YYLH 2NY7L 2CR6A 2V2WA 4EKXA 2CKBA 1RUPL 5T1KB 4LQFH 1ZHLA 3HNVL 4QRPE 1IAKB 3MLYL 5JOPE 1CGYA 5DMYA 4UB0H 4XBEH 3ARFA 2PETA 5C8JA 2CDGB 4ORZC 4YHPB 4YJZL 3MUY1 4N0CD 3LD8C 3HC0A 2DLTA 3QZWB 1EBPA 5EO0A 4P2OC 3KYMB 3TBYA 3IJSB 3WBDA 1SYSA 3AAZB 4G9FD 5H35A 4XTRC 4U0RC 3RZWA 1JYNA 3EYFA 1ZE3C 5CS7A 1NLDL 4XVSL 5F8RC 1QEWB 5CUSH 5IEKB 4NO0D 3I6GA 3CZFA 3LQAH 5JW3H 2NY1C 4HEPG 4LKXB 5DJAA 5FA4B 4NN5B 2BC4A 5E99H 4NUGH 1TQCC 1JYVA 3TBSA 1QRNE 1EVUA 4A6YB 1WZLA 3WFBL 2EEAA 3IDYC 4JAMA 1QSZA 1TQBC 4MSWA 5KSBA 2Y36L 1DBAH 1OF2A 3WHE0 4C4KO 3BD5A 5FUOH 3GKWL 3FAWA 4RQQA 1S5HA 2R0ZL 1HSAA 4PJ7A 3FMGL 1RUAH 3B4NA 1OTTD 4NO0A 3C6SA 1UYWL 2IWGA 4LLYA 1ZT7B 4Y4HC 2AEPH 2Q86B 5DUPH 4IRJC 1OPGL 1X5HA 1MVUA 4EQ3A 3O4LD 1U93B 5GS2H 2DLHA 1EJOH 1KJMB 4ORGA 2BY1A 4HF5L 2K1MA 4YNYB 5ANMB 3VXSE 2QSCH 1WT5C 2FBJH 2X41A 4JFEB 4XP6H 1HK6A 1YNTA 2WLYA 3QIBB 3WJLA 1DVFB 4YHKH 1MWAH 1I8KA 2OZ4L 4LASH 1SM3H 4U1JA 2JELH 3SJVA 2BNQE 5GGVH 3MUGB 3D0VB 2C4FU 3MFFB 4PBVC 2DQCL 3DVIA 4HH9B 4LKCA 2P7TA 2A74B 5DJXA 1V05A 3QUMB 1E6OH 3V5DA 3BHBB 1XGUB 1F58H 1S8DA 3IVKA 2AK4E 1LO4L 3R06A 1NFKA 1LE9A 1GGCH 1QBML 1C08A 3N9GH 5F9AC 4LVNC 5AYUL 5C0AE 3LMJH 1Z2KA 1N6QH 3E6FB 1A6ZA 2J8OA 3JV4B 4DCQA 3HFMH 3L9RB 4WDIA 3B83A 3MGOA 5D72H 1JWSB 4OLZL 5DO2D 4GAGL 1TXKA 1KXVC 4ZQKA 4BSVA 4Q74A 5BRZD 2H2SC 5MHSD 2PCPA 3MZTA 3QWRD 2G2RA 2ORBH 2UYLA 1K6QH 4PJBE 3G5ZB 2CKBH 3QIWB 4X8JB 3NCBB 2P8PB 3O45B