1OAZH

Ige fv spe7 complexed with a recombinant thioredoxin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
122
structure length
122
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN 1
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 21
structure length 122
sequence length 122
chains with identical sequence J
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oazH00
2FX7H 1KENL 3ULUL 3T2NH 4G7YH 1YZZA 3QIUA 1U8OB 3EO0A 5JQ6L 3CX5K 4WHYG 1W8NA 1IAOA 5IFAH 2BVOB 1ZLWH 1BWWA 1AKJA 3STZB 5ICZA 3FRPA 3FFCB 3DJ9A 2JB6B 4WRLA 3WIHL 1MRCH 4P2CG 1YPZB 5EPMB 4AQ1B 3KHOA 1MFEH 1F4YH 4LCYA 4LSSL 2X4NB 5GGSY 2NX5B 4JO2L 1YY8B 4JFFA 5DT1L 1T2QL 2HT3D 4LRNL 1BD2D 2OYPA 2V2TB 4YWGH 1I8KB 4GAJL 4GUPA 1UH4A 4LLVA 1P1ZB 3ZDZE 4GBXD 4LOUC 1QSEA 1NMAH 4JO1H 4P99A 3RVWD 1CFTB 4HWZA 1UXWB 1QNZL 2XN9B 2YC1A 5D2LA 4C56B 1X5JA 3KPSA 1UACH 5HJ3A 5DF0A 4HWEH 1FNEB 5DZNA 4FQXB 1CDYA 1RIHL 2V5MA 5ETUA 5ICYB 1M7XA 4XVUC 5CP7B 4GT7A 2Y06H 4ZTOL 5D5MA 4OSUL 5CIPH 4HK3J 4MNHA 4JFQA 2XV6B 3TNNA 1EVTC 1A5FH 1QO3A 4PGZA 3ARZA 5HGAA 5I1KL 1CD9B 1DBML 3IGAB 2OL3L 3IFLH 4XC1H 3IKCB 4N9GA 3VMNA 2Y9RT 5IHUH 3FT2A 3KYNA 1A4KA 5J3HC 1MRFL 5B39B 1YEFH 1FV1A 5M95B 1A4JA 3ROOA 1A3LL 1JPGB 4AENB 5DLMH 3DO7A 2WINA 5HHPB 3W9EA 1X5FA 2C7UA 4G3YL 4DAGH 3IU4L 1IEAA 2I27N 2BNQE 1TJHH 1RZ7L 3WHE1 4HWNA 2CGRL 3ZE2F 4HFUH 3QQ4A 4P2OA 4PV9A 5ISZD 4POZD 4F58L 1MNUL 1T1ZB 4N1EA 5JR1H 5IIEB 3TVMD 2C1OA 4PJ5B 3U9UA 4Z7UA 3PV6A 5AZEH 3HG1B 1MY5A 2NXZB 2DAVA 5EU5A 2GSIB 2ITDA 4FZ8L 4U6HA 4IRZH 4IRJA 3MX0A 4M9PA 2OTPA 3LMJH 4EI5D 1ZMYA 3HR5A 1ADQL 1T0NA 2VUYA 3CZFB 1H0DA 3AS2A 2H8PA 4R96A 4HXBL 2XWBA 4I2XE 1JK8A 2X4QB 5HGGS 5I8CB 4F33B 1TENA 1FO0H 5C0CA 4Z0BH 1XCTB 1I1YB 3C6SA 5IOPB 2NCMA 2BNQB 1ZTXH 3DRQA 4EI6A 3QISA 3CLEH 3MXWL 1ITBB 1XGQB 3REWB 1FZOA 1KXTB 4HUVB 1CT8A 1BAFH 4O2EA 5DJ0A 4XPBL 3UXFA 1I4FB 3EJZD 2AKRA 4K9EL 2Z31C 1FAIL 1IAII 2ZNXA 4GAYA 2IPTH 4ZOBA 5HGBB 1FYTD 3NIDE 1U42A 4P23C 5KZCD 3BN9D 2A6JB 2HFFB 5B3JE 3BUTA 4JDZA 4LSQL 1MFCH 4Y4HA 3UAJC 5EU6D 3C87A 2GTWA 1Z3GL 1BREA 2HYMA 1G1CA 2HVKB 1NGPH 4TSBH 2KQMA 4N0UB 3BPNB 5EZLA 5JO5A 4TVSa 2VXUL 3FO9A 1WEJL 4D9QD 2FH8A 1F5WA 2ED9A 2NXYD 5DD5L 2BRRH 1WT5C 2Q20A 3VXTA 3EJJX 4G8GB 5SV4A 5FO8A 4OF7A 4L1DA 3UTZB 1ACZA 1V3MA 1UQSA 4UBDC 3CSBA 4LLAA 1CWVA 1UWEL 3E3QE 5C6WH 7FABL 3TV3H 2NY2B 4KUZH 1EHAA 4HC1L 5C0AD 5GGTL 3ZL4H 2ZCLH 1OAQL 2WM0A 5JUEL 3ZYJA 1A7NH 1X5HA 1NUNB 1WZMA 1U9KA 4JREB 4CVWA 4RDQG 1QFPA 4Z7WB 4Y16B 3UJTH 5IBUG 2D0HA 1FC2D 2VLKD 5F9JB 3QFDB 3GEWB 3EYUL 2VAAA 4RFOL 4XZUB 1CR9L 1M7DB 3I9GL 5MENE 3RJQB 5IVNA 3TIEA 4MJ6A 3ARDB 3KPNA 2OBGA 4OT1L 5JPNA 2R2EB 1D9KC 1TQBC 5INDA 5CUSL 1TFHA 4GW4B 1WLHA 2EO1A 4WUKH 1LHZA 1AC6A 1S7TB 3L3OB 5AZ2L 5HXMA 3CFDA 4YXLH 1MEXH 2EXWC 1EEYB 4P2RB 3T4AB 5L0QB 4OF6A 43C9A 2AQ3A 5F9WB 5C0BE 3O41A 3IFPA 4Y2OA 5D6DA 3JWDC 3ULVL 5BV7H 3GJFA 4MJIE 3WFDL 3BPLB 3OAUL 4H88L 1MWAA 4JZJB 4NKIL 1CS6A 1IQWH 1YEGH 2J8UE 4APQD 1YPZF 3RAJL 4U33A 1G0DA 1FORH 2CRZA 4DN3H 5E2UH 5I8EB 3GMLA 4WFHE 1TQCC 1ETZA 4OLZH 5I2IB 5IB2A 4KKCD 1QSFE 5K9KA 4W6XB 2X89D 4YDLC 5IQ7L 5ID1B 1BFOA 1A14H 2OZ4L 1MJ8L 4BYHA 5FYKU 5TQ2H 1FZJA 1I7RB 4NRXA 3DX9A 2NY4B 2ADJA 1F2XK 4X6CA 4CU6A 5HDBE 1EXUB 4WTZG 4X6DE 4EVNA 4YQXL 3OMZA 4PIRF 2H26B 4HIHB 1QBLH 3GIVB 5F6HI 4XPHL 2I5YH 4AEHH 4HUXB 5ILTL 3GSVB 1ZT4A 2AJZB 4MAYB 3QO1B 1MCHA 4E41D 5KVDL 2ENSA 4FTVE 4ODHL 4FP8L 1KJ2B 3V6ZA 1NCBL 5C0BB 1Q0XL 4P57B 4JZNA 1WWCA 4OTXH 1U8LB 4W70A 4FQ2L 4F37K 3KLHC 5HVGB 4PBVC 3MCLH 4EDXB 1BZ7B 3EFFA 1PKQA 4ZAKC 2BMKB 2XOTA 5F1IB 1OCWH 5GRVK 2EDLA 4R4FL 4F7MB 1MLCA 3BT2L 2ZCKL 4I3SL 1B88A 4GXUN 2YA1A 2H32H 4PG9A 1TITA 1AI1L 4XNZB 4IS6A 4GSDL 1QSFB 2KZ1B 5C2BL 3LEXA 4O58H 3QCTL 2ZUVA 3MRGA 1RFDL 4MDJA 5F7KC 1BGXH 4AYFA 1VGKB 1ZANH 4HSQA 3UC0H 5TDOB 2FWOB 1XGTB 3RIAF 2FLBT 1JHKL 2HT4D 4X6DB 3WJJC 1KELH 2ZUQB 3DBXB 1UH2A 5IM7B 4P5TD 3JTTA 4MNQE 2XWTA 4OD2A 3HMXL 3PE9A 5IBTL 2A83A 1KYOK 4OQTL 2GAZA 2C26A 4P5MA 3IF1A 4AG4L 1I9RL 4CMMB 4GKNA 3QIUC 4G6KH 4ODXB 2BY0A 5DUPL 3EZ8A 2Q87A 3SDXB 2R2BB 3MRRA 3MLUL 4U6YB 2GJZB 5EBGA 3GSQA 3BP5B 1YNKH 5CBEB 1IRAY 4MQTB 4UINH 5JW4N 1QEWA 2XA8L 3EDDA 1J0JA 4XCFH 4PJAA 2I60L 2QQKH 3MRHA 4OZFA 1P5VA 4U7KA 1AHWB 4M6MH 4QXGH 2EIZB 2ITCB 4KY1L 1P4BH 1I1AD 3NCFB 4OB5H 5DD6B 2W0FA 4EUPG 3RL2A 1P9MA 2H9GB 4R4ND 1F4AA 4ZS6C 1GGUA 2NYYD 3TA3A 2OL3A 3NFSH 4NKQB 2WV3A 4H8WL 2VH5H 3QPXH 3CC5B 5EUKA 1CLZH 1DUZA 2EDOA 3O6LH 4M1GL 3OKMA 2I24N 3U30B 1QLFB 5I73C 1QFOA 1RMFL 4PR5B 3ALPA 2DTMH 3Q3GA 1KEGL 1Y6MR 3LS5H 3QUZB 4JKKA 3VWKD 1S7QA 1TZGL 1YEKL 2EE3A 4NT6B 3TGXA 3E1F1 1BEYL 2KBGA 1R5VA 1S78C 4MWFB 1D5BA 4QOKE 5JLZA 1OSPH 4NFDA 1I3UA 1HHGB 1CF8H 3RWIB 1VACA 3B9DA 5E8OB 4LCWA 5DHVA 1YNTB 2CRIA 4ODTH 3CFBB 1FNSL 4NO3A 3QCUH 4FQCL 5CGYC 4OZIA 2COQA 5HDQH 4QHNB 1MHEB 2CLVA 4P0DA 4DW2H 1HSAB 4P2OC 1ADQA 1NGYA 4M62L 4XX1G 4PJFE 1N0LA 4WJ5B 3QHTC 4ZOEA 1S7RA 2KPNA 2ADFL 1F4WH 3PWPA 2IALB 4Z7WF 5LGJB 2LE9A 4HPYH 2A9ML 3EYVB 4G43B 5KJRH 5IB4A 1IGTA 3PQYD 4NO2A 4BQCA 5DTFB 1U8QA 4XPTH 4IRJC 4ZD3L 4D94A 4Z0XA 3ARXA 1OP5H 5EBWB 3WLBA 2V2WA 2VTFA 1QOKA 3PGFH 4Z7QE 2P45B 3BPOC 3B3IB 4GW5B 5HI3D 3EYQC 3CVIL 2GITA 2AJ3B 5F71A 1BBJA 1NUGA 1LMKA 2FZ3B 3TWCH 3P77B 3QWOB 3JUZA 4PD4K 5EOCL 5CEYA 2EDHA 4JB9H 4QRPA 2OK0L 4DUXA 2C3VA 2PETA 4WO4D 4ESKA 1AR1C 1G7QB 3E2HB 5FGBA 3W0WA 4G6AD 3P9LA 5GRJL 3GSNA 3SQOL 3MRIA 3MLZL 4PJCE 1D6EB 4MS8D 1CE6A 3JBG7 1HHKB 3MROA 5ERWB 3UROR 3C09C 4OUUB 2I9LA 4O9HL 4FS0A 5CBAB 1N26A 1QFWH 4JO4H 5C9JA 4Y4HC 3VWJA 2ZUTA 4NKDB 1O7VA 4HC1A 3VXRE 1YDPA 3FFCD 3FOLA 1JPST 3G04B 4QHLB 5J6GB 3FB5A 1J8HE 4HZLA 3MBXL 3BXNB 2ZCHL 2JIXD 4WEUD 4RX4A 5CJOH 3MR9B 1JZ5A 1F3RB 4U6XB 2NY1D 1QLRA 1G84A 1X5AA 1OLZA 2VLJE 1U95A 4KTYA 3ARYA 4Z7VB 3H42H 4KGJA 3RFZC 4XNQB 3W2DH 1H3XA 3EHBC 1LE9B 2DQIH 1NLDL 5TFSH 1A6VL 3RKPA 2XN9D 4C56D 1FAKT 4YZFF 5T1MB 3GI9H 4YHLL 5DJCA 1A6PA 4FQXD 4OBRA 1T1XB 4NJ9H 1NMBH 4R8WL 4IMLB 3JWOL 3L3GB 1K4CB 3DV6A 3QQ9C 2FNBA 3VU2A 1YUHB 4JY4B 5JW5A 4HFWA 4NUJB 2BVTA 5E8DH 4EDWH 1E4WL 1JGDB 3DX7A 3H0TA 35C8H 4ZFOA 3HI5H 4JRXA 2BK8A 3THML 3IXTB 2F58L 4OZ4A 5K33A 5CGTA 5C0JA 1PZ5B 1KGCD 1ORSB 2JLLA 1T89A 1AD9A 4QLRA 1OTSC 1S7UB 5F88A 2YD4A 2CIKB 4ERSL 3VFVA 2ED7A 5TE7L 5I18L 5I1EH 5KSAB 5DZLA 4ZMAT 1LEIA 4N8CL 1P7KB 4OCSL 1FNHA 5D6DC 1LDSA 1AP2A 4XPGH 5F1KC 4NZUH 2DI8A 1XCQA 1D5ZB 4IOIA 2H2PC 3F7YA 5DEGB 2R1WA 1G7HA 4KZDH 3MXVH 1XR8A 3FOMA 1T66C 4MJ5B 2B5IC 1N3NB 5IB3A 1D6VH 4GAGH 4PJ5D 5A16A 2NY0C 1E6OH 2HT2C 3S37X 5JIPA 4DJMA 2EKJA 3N50A 3HG1D 4JPWH 2OJEA 4L9LA 2NXZD 3KNBB 5I71B 1GVIA 3TJHC 5KSBA 4OD1H 5T1LA 4F8QA 1UJ3B 4CJ0A 2VQ1A 5IMMB 3FL7A 4U05A 4LLQA 1NC4A 2UZIH 4N9OB 2ATKA 4U2ZA 1BD2A 2JB5H 1AQDB 5FUZL 1DQML 1A7QL 1YMHA 2VDML 2XQBL 2W9DL 5FYJE 3RWCB 8FABB 1HDMB 1L9MA 3OXRA 3F7QA 1R0AL 5DJAB 4CMHC 4HBQA 4J3OC 2DQJL 5GRXG 2BNQD 5EZOH 4PJBB 5KN5A 2DM2A 1NCDL 3TT1L 2EC8A 3T3PE 3HE6B 5A3ID 5EO9A 2VXTL 1FSKC 4FN0A 5CKGA 1IGYB 3PDOB 1RZJC 1XGYH 5TE6L 1JCKA 5E2WL 3NTCL 4OLUL 3LZFL 2NY7H 4LMQE 4P2QB 1RUKL 5GGQH 3IFOA 1Q9LA 1W72H 4OQTA 1UWGH 4RAVA 5IEHB 2DQGH 1YEHH 2YRLA 2IBGA 4K7FA 4BUHA 1CICB 5MEPB 5JHDE 1MQKH 3RPIB 3JXAA 2HTKD 2Q8AL 5D7LE 4KV5E 4Q6IB 4BKLB 2FJHA 4GKZA 1ZGLP 1IGFL 1CCZA 4OFVA 1HKLL 4HS8H 3RL1A 1IEHA 3O2WL 4YGVB 1GAFL 4K7PY 4G8GD 5IR1B 3GMMA 1ND0A 4P4RB 4X8JB 4DGVH 3QDJB 3UZVB 1HILB 3QHZH 1OPGL 1ZHLB 4XMLH 3KXFD 5EC2A 3INUL 1P4LB 4Y1AB 2NY2D 4XHJD 4KKNA 3KPLA 2I9TB 3QO0B 3M8OH 4HK0A 3QFJA 5K9OA 4NKOB 3ZKXB 1J0HA 5DJYB 3I6LD 5C09B 2YZ1A 1UZ8B 1PG7H 1HH6A 1XGPB 1G6RB 1WZKA 5CD5C 2HLFC 4Y16D 3NCMA 5H2BB 3PGCB 1EEZA 4N0YH 4KDVA 1H3VA 2DWDA 3U0WL 4J3WA 4R4BA 5TGBA 4U1KA 1T6WA 5JHDB 4M7LT 2X6MA 4X4XB 1P9MC 3G5VB 4GS7B 3ARDD 3K4AA 4LPUA 5CAYB 5HHQB 4O2FA 3QUMB 3HUJE 3TA3C 5DA4A 2P46B 3GZKA 4RFNB 1FL5B 3GBML 4WGWB 2VJXA 3FCTB 1N64L 1PG7X 4P3WA 3STLB 3FQRA 2BNRA 4P2RD 2H3NA 1INEL 3BPCA 1QFWI 2FX8L 3TBVA 1T03H 4JY6B 5IVZB 3PNWA 4G6MH 3ARGA 3EYOB 4XPFH 2DQCL 3OAZK 1I75A 5FM5O 4U6VH 4HJ0C 3SKNB 3LKOA 1H3PL 1LK3H 1LO3L 5HHOE 1JRHL 5JMOC 4MMZC 5E1HB 3SCMB 5DJXA 4UZGA 4DKDC 3EDEA 5H35A 4CN1A 2JELL 1NLBL 2QSTA 1JV5A 3T1FB 4UV4L 2V7NB 3HC3H 5E99H 2O5YL 4ZYKB 3FQWB 3MGOB 1G7PA 2I07A 4HKBB 1MVFA 1Q8MA 1F45A 2NY4D 4TNVF 3PWLA 1KTRL 3DURA 5T1KD 2QEJA 4UNVA 1LO4H 5HBBA 1IEBB 4Y2DB 1CIDA 5C6TL 5C0AA 4KHTH 3DV4B 2WBWB 4NNXA 5D2NE 4QXUH 4D0CA 2Z9TA 5JZ7D 4DVBB 4I4WA 4MAYD 1S9VB 1I3GH 2WMPA 1JYNA 3KLSA 4KTDL 4PRNA 3SEPA 2J5LB 3U7AA 4YDKL 3D1MC 3WNPA 5E08H 3B5TA 1EBPA 5D72H 4M8VA 2VLKA 2MCPL 3MLRH 5T5FH 2B0SH 5SWSA 3ZE1E 5I76A 2IFFH 1JPFA 2UWEF 3K1DA 4FABL 1XGUB 1Q9KB 4YBLB 4EN3B 1MCSA 3DI2B 2IBZY 2D7MA 4LF3A 1FVDA 3DSFH 4GRWB 5EIIB 1RZKL 3MNVA 1HXMB 1QSFD 1FCCA 4LSTH 1KCSL 3O6KL 4ONGL 4XI5D 4RAUB 3B5HA 5D70H 2N1KA 2E7MA 3QPQD 1ZGLM 5AAWA 5FGBC 4BSVB 1JWMB 5EFIB 1GJIA 1UFUA 5FEBA 1GHFL 4L4VB 4ZUUA 3DX8A 4NQXB 1HH9A 1NCWL 3P4MA 3UYRL 3V6BR 3QH3B 2XQYK 3VWJC 1ZHKA 1I8IB 1VADB 3CDGA 1QR1B 2WLZA 2GHWB 5FOJA 1U93B 4PJGE 5L2JB 1KT2B 2X1WL 4PJXB 3Q6FB 4M7ZB 5JW3L 3VE0A 2V7HA 4DKEL 1I7TA 1B9ZA 1UT9A 5LG1A 1JFQH 1NAMB 4U31A 5AEAA 3SKUD 1NGXA 4F7PB 4JFXA 3MJ9H 4J2XA 4YK4C 2CLZA 5JOFA 1TZHA 1RUML 4R2GB 1D5IH 2D7TH 4OM1L 2C3XA 2HJKA 3SDAC 4HIXH 5CJQH 2HRPL 4HGMA 1MHHA 4UIKL 2HMID 3CLFL 2AGJH 4Z5RA 1U8JB 3MNWA 4M3JA 3MSPA 1QQDA 4XBEL 6FABH 1KV3A 3V5DB 3SJVA 1YMME 4K3JH 2X5PA 2FB4H 2NW2B 2HJLB 2R1XA 1TTFA 4WWKB 2JJWA 3IDXH 3RVUD 1EK3A 3TEUA 3QUZD 5FKPA 3O2DL 5HHXL 1GC1C 2HKFL 4PRIE 2ESVE 1WC7A 4XMPH 5EBLB 1XH3A 4MQXC 1AO7B 1EZVX 5F21B 1MCDA 1T89C 4H20L 1DN2A 5C7XH 4MNGA 3STBA 1OTTC 4CADA 5IP4A 4RGMC 5KVEL 4HT1H 1FNGA 2FL5A 1UKQA 2BZDA 4WFED 1FL3A 3QUXD 4GQ9H 2J88L 4QF1B 1JI2A 5TH2A 2BSTB 1YN7A 2EH8L 3RUGB 2NY6C 3VFWA 3T0EA 4PJHE 3RIAK 3BFOA 1NSNL 3FONB 1XF3B 4JFPB 4OAWB 4L9LC 3VRLE 5I1JH 5ALBH 3UPRB 3VXMD 1PDKA 4NZRH 4YDIL 1A7OL 1AY1L 2J3SA 2HT3C 4QWWD 4UB0H 3BGMA 5BZWA 2O5ZL 5IBLD 1Z0NA 4B0MM 4DQOH 4YHIA 2ARWA 3I6GB 5C07B 4HX1A 3TO4B 3FQUA 4FXKB 2ZSWB 3FJTA 5KS9E 4QTHA 3PABA 4C83B 4PB9L 4TSCL 4WFGD 2VKWA 1CDBA 3AUVA 1OSZA 1OAUL 3SO3B 4FFYL 2VKXA 1U3HA 4QHUB 3QJHA 2GFBA 1BQUA 1T7XA 3MODH 4RMQA 2WBJA 3FB6B 3MFGB 4M6OL 3RBGA 2OSLA 3HAEH 4QRSA 2XWJB 5FO7A 3WN5B 3BZFB 4M5YL 4IIQA 4YHZH 1CIUA 1ZS8B 5JORB 1NCCH 4FQHA 4XCEA 5E6YA 1JN6B 2YPKA 1OY3B 4LVHB 5I15L 1PLGL 3T2OA 3SKMA 2FHCA 3OSKA 4G8IA 3R0NA 2FR4B 1DBKH 4G5ZL 1RIUL 2NNAA 5C8JB 3F6LA 4P48A 1D5MB 2JCCA 2A73A 2DLGA 4NJAL 5IBUB 5IFHH 3GMOA 1BECA 1IT9H 1U8MB 3H3PL 4M6NL 2X7LA 1RJLA 2DMCA 1YNLL 3V4VL 2W65A 4ELME 5CEXA 4XBPB 1CBVH 1MCKA 3DGCR 3GSWA 1CQKA 3TVMC 3O3BB 1MCBA 5T5NF 4PY7A 4M7JL 2ZUYA 2R2HB 3KS0H 4LQ1A 3PQYA 3MGTA 3O8XA 3V79C 4Q9QH 5D7IA 2C5DC 3G5ZA 3BZ4B 4QRUA 1V3JA 4XAKD 3HPJA 3LKQA 5TE4H 2XTJE 4PB0H 3HZYB 5DYOB 4PGCA 1C5DB 1TVBA 4H26A 4X80L 5FV2A 2PW2A 3SY0A 5C0RH 4NQDE 2L4OA 3MCKB 3LRHA 1TZIA 1H3UA 2VDKL 3QXTA 4G9DA 4PRPE 2ICWI 3QULA 5KANI 3EFDH 1BMGA 3DUUA 3RKDC 1KFAH 5C0FA 2Y36L 3RX8A 3X11A 3PHOB 3QDMB 4LQFH 1KJ2L 1GOGA 1CDIA 1OP3H 1NFDA 4C58B 4XWGL 1IQDA 1UWXK 1MCOH 4J3SA 1K6QH 4Z77B 4RMSA 1MREH 4XTRC 2VLLA 4KVCH 3TNMB 2EDTA 3FRUA 4W4NA 2X40A 1L6ZA 4QHKJ 5KSAD 3NCYS 4M1CD 3ZHDA 1FL6A 4XNMB 1F42A 2NY5C 3AM8A 5DI8B 1UVQA 4AMKL 4M48L 3HN3A 3P2TA 3IU3A 2EICA 4I77H 3BN9C 1U6AH 5C0GB 4P2YA 1YC7A 1KNOA 3ARGC 5IB5B 2HH0H 3FQTB 1GRWA 1NEUA 3LD8B 1JMZA 4PJXF 2P5WE 5D71H 2AI0H 4NHCH 1INDL 2FCBA 4M1DH 2QADB 4XNUL 4M02A 3STZA 1F90L 2Y5EA 1KBGH 5J1TC 3FFDA 3LKNA 3ZTNH 1MCJA 5FCSH 1I1CA 4G7VH 2PO6A 3WE6A 1JP5A 1A7PL 2ICCA 2X4NA 1EJ6A 1LO2L 2NX5A 4M9OA 1MPAL 1DLHB 1U8NB 1CG9A 3PWVB 1P1ZA 3G6JB 5GIRA 3BH8B 5SWZE 4HG4J 4JKPH 5J6HB 3VW3L 1BLNB 1CFTA 4JFDE 1SY6L 1DN0A 1KCUH 1QRNE 1KB9K 1ZA6B 3TBWB 3NFNB 4J23A 3NIFF 4HPOL 32C2B 3QRGH 1KJVB 3MA7A 3C9NA 5DK3A 2IH1A 3WD5H 2XT1B 3HE6D 4J4PA 1RULH 1S7WB 4XP9L 2EYSB 4C55A 1WQVT 5GHWL 1NC2B 4M93B 4LVNC 1U8HA 4P2QD 1BOGB 3IGAA 3IKCA 4YFLF 4MD0A 3OF6D 5E56A 3HLAA 1TXKA 1TVHB 3JWDH 5B39A 4LRIA 2GSGB 1CICD 3ARRA 3KPMB 4K3EH 1JPGA 4AENA 2Y23A 1CD1B 3QNZA 3V0WH 3WUWG 3HTLX 4JVWA 3RUGF 1REIA 1KC5H 1VERA 4LPYA 3WKNA 1DDHB 2B4CC 2GQHA 4LVOB 4JR9H 4A6YH 1HYSC 1OB1A 4JFDB 1DR9A 2C3GA 1AQKH 1T1ZA 2AVGA 1QKZL 1CFQA 1A6UH 1R5WB 5IIEA 1BWMA 4JAMB 2MJWA 4EUPB 4HKJB 3QDJD 4R0LB 2VXQL 2XG5A 2F5BL 3OAZH 1HHIB 4K3DL 5L88L 3MRNA 1N0XL 1P2CA 4Y1AD 4KKCC 3VGAC 2HLAA 3U48A 2ZOKA 3GSOB 2GSIA 3U46B 1CXHA 3GNML 4GW1B 1A7RL 3MOAH 5C09D 1YECL 3BUYB 4NZJA 4L8SA 5DS8B 2KUTA 5HD8D 3CZFA 5DJ6B 1GSMA 4NP4L 2X4QA 4ODWA 4HUKB 1CDJA 3VCLA 4MXQD 2DDQL 4WUUB 1B4JH 1IAKB 4NUGH 3ZDYE 5DA0B 3LQMA 5JHDD 4X4ME 2Z4QB 3RJDA 3OHXB 3O2DA 5ITFB 1NL0L 3D9AH 4UOW1 1XCTA 1I1YA 4P3CL 4ODSL 2BNQA 2JCCF 1BJ1H 1LQSR 4LCUB 4WY7H 3TH4T 4AY0A 4NRZA 3T65B 4RWYL 3GB7A 3LH2H 4X4YA 4HUVA 4FQLL 4I9WE 4PRHB 3ROLB 4V1DE 2IADB 2CH8A 1LK2B 4NN5C 4V2CB 3OXSB 3UTSE 3VFPA 1MQ8A 1U92B 5IG7B 1IGJB 3CFEB 3PJSB 4PJIB 3ZO0A 2AXGB 4UOW0 3MLVH 3NIGE 4NQCE 5CEZH 4XP4H 5D93C 1I9IH 1J5OH 2BY2A 3D69B 1CTOA 1ZGLB 2MKLC 5IV2B 1WTLA 3MUGB 1RUAH 1TJIL 5E94A 3DGGB 1NGQH 3SCMD 4I2XA 5EC1B 4IM8A 5FDWA 4YDJB 3D39E 1T80A 1T83A 3OKEB 3BD3A 4NNYA 3D2UA 4OCRH 4DWHA 1AD0B 3OR6B 4K94H 4MCYB 5J89A 2CUHA 3RX7A 4NO0B 5L8JB 3GM0A 1IFHL 4Y2DD 1FPTH 2VITB 4U1HB 4R3SB 5ICXA 3T0EC 4XCNB 2F74A 2YXMA 5KTEL 5EU7E 3HI6H 5I66B 1QLEL 2E7HA 2AS5M 4MSWA 3VXUE 5F3HB 4V2BA 5BVJA 3PIQB 4IOSD 1EV2E 4Y16A 1MRDH 1CLOL 4NQCB 2JJVA 3U7YH 4RZCB 3T8XB 3G6DH 2EYRB 3HNVH 4OCYL 3QAZC 3WFHA 2X4SA 5KSVA 2DIBA 4EN3D 2XTLA 5I16B 1LP9E 3LIZL 5ID0B 2R56L 3MOBH 2R1YB 3KPQB 3H9HA 4XXCA 4PGDB 3HNTH 3D48R 3L3OA 3GSXB 4RMWA 5E8NB 1U3HC 4WHTA 4JO3L 1N6QH 5HGHA 4E0RA 1EEYA 5KVMC 1JNHA 1OF2A 1WVZA 2WBJC 5C2UB 4Y7MA 5F7FA 3HRZA 3OQ3B 3QIBD 5EO0B 2Y5TB 1JYVA 3OKNA 3ARPA 2PF6A 4IIQC 4JZJA 4AIOA 1IM3B 4JCLA 5DO2D 4WDIA 2E9BA 5A1AA 4L4VD 2Q6WB 5J0BA 3JV4B 4JY5H 4KI5E 4KMTL 5IMOA 2NMSA 5DQJB 2XXMB 4ONOA 1MCEA 5E4EB 3BHBB 2J8OA 1T6VN 4YHNB 4CAGA 3MRLB 3WO4C 4CL7A 4DCQB 2FEDD 2DB8A 2VLRB 1JPSH 4F15B 3K2UH 1SM3L 4FQQB 1AC0A 4ZDHB 1DQDH 5LXGH 2H26A 3MMEB 5HPMB 3CCHB 3GIVA 3UBXA 2LU4A 4LCCB 5DFTA 4R2GD 2C1PB 1A3RL 1NBYA 3B6SB 1VESA 3O8XC 1ITCA 5ACZB 3SDYL 3QO1A 3ZDZF 3WFCH 1SVZA 5C0BA 1QFUL 3OAYK 4IRSA 2WUCH 2ZSVB 4MJIA 1EO5A 5ENWA 2AJVL 4TNVK 3F8UB 1LEGA 1XF2A 2VXVL 4BK4A 2BMKA 1ZK9A 3MO1B 2J8UA 2ZWLT 2BXZA 2G2RA 4MD4B 1WWWX 4IDJL 2ZG1A 5IJKA 4R97C 4IHOB 5GSVB 5HI3C 5DFWH 1L0XA 4WWKD 1C5BH 4Y4KA 3UJIL 3QNXA 1KIUA 3LN5A 4LDLB 5F6IB 1QSFA 4XCCL 5DK0B 5E8PB 2F9BT 2FHBA 2IANE 1P7QB 3BDBA 1AO7D 4MXVF 4HEPG 5KANG 2FWOA 4K8RD 4X6DA 4G6AC 4QRTB 3DBXA 1F3DJ 3LPGA 5E95B 4OM0L 1OGTA 3AM8C 4NZTL 1Q9WB 4ACPA 5I1AB 1FNAA 4FQJH 4LSRL 2E6PA 4JM4H 5CLWA 5J1SC 3SDXA 4NQVA 2R2BA 1MOEA 2FJFB 4XP1L 4XMKH 1NPUA 4TUOA 1UXSB 2GJZA 3BP7A 1W0VB 3RA7L 5CBEA 1EHLL 3O3DB 1MCWM 3QA3B 2PO6C 1RZFL 4F2MA 3EYSL 4OCXH 4L8CA 1AHWA 4HJJL 2YXFA 4LAJH 1C5CH 1T1WA 4L29B 5E5UB 1CGVA 5EOTB 3QIWB 3P30L 1IC4H 5HPOA 2ENYA 1GZPB 1V7NH 5C07D 2H9GA 4ZOAA 3TO4D 4CVXB 4Z18A 5CIPB 1EJOH 4OLVH 3O45A 4NN6C 5HYSG 4AT6B 4AK1A 1RZKC 1G6RL 4PV8A 3WNKA 1BVZA 3CC5A 4LPCA 4MNQA 2OR9L 1WBXB 2BHYA 1QLFA 3AAZB 1WIUA 3K8KA 5LJYH 2VOTA 1EGJA 3DUSB 1YYMH 4J4PC 3D25B 4JGUA 4NT6A 1I9JL 4LBEA 3ARFB 3WFEL 5L6YL 5LQBL 4Y88A 4QCIA 1BQLL 2Q86B 3QUML 4U1SB 3QZWB 2WWKT 1RHFA 3NVQA 4NN7B 1HHGA 4LRIC 3GJFH 3NFPB 3RWIA 1MWAH 4X5LA 4BZ2H 3HC0B 1Q94A 3MRKA 1UWXH 2W9EH 3CFBA 1GGBL 4A2MA 1WBZA 3IDMB 5FYKE 4HIJB 3K4DA 1MHEA 1EUTA 3CZJA 3RHWF 3CMOL 5F6HJ 2V9QA 2Y07L 4NM8L 1JMXA 2O26U 1WZ1L 4JM2B 1KIPB 5HHVL 5J56B 3BKJL 2E3VA 1KN2L 1X5GA 1ZHNA 1YQ2A 2NXZC 3F58H 1FO0B 5DTFA 5I1IL 3W81A 1J1OH 3MRBB 4ZNCD 3MACL 1N7ML 4L8SC 5EBWA 5DMIH 3GSRB 4M5ZH 4JG1L 1HIMH 5TDNA 2HA1A 5FKAA 3B2UD 2D9QB 1P4IL 4QOKA 4AIZB 5E2VH 3C5JA 3V6FB 3B3IA 4GW5A 1F6LL 2F5AL 4GH7B 4HCRL 2AJ3A 2APXA 3QSKB 3LPFA 3FO0H 3S36L 1JNLH 2DQDH 2FZ3A 4X98A 3WV0A 4XXDA 5DRNA 1M4KA 3QWOA 3C5SA 1WIPA 4KQ3L 1RZJH 3QDMD 3RGVB 3QCVH 4M7LH 4HMEA 2VDPH 2DN7A 5J11C 3CFKB 4PJDE 5DR5H 5J1AA 4N5UA 4PJFA 3LQZA 5DMKB 4K23L 5E6ZA 2WWKO 4BFBD 4H5SB 5JA9A 2HTLD 1MELA 4DN4L 1N4XL 2JJSA 1ONQA 1M05A 5BJTB 4JRYB 3HAEG 1PSKH 3H7BB 5D2LE 4NQUA 5IHLB 5IGXH 3GSUB 1VDGA 4NKDA 4F57H 5DDHA 2QADD 4P3DB 5LGHL 4QHLA 5J6GA 4GOSA 1OGAE 3BXNA 3B83A 3S5LA 1T83C 5IMKB 4F8TA 2H2SC 1FE8H 1HHHA 1CDGA 2VDOH 1YYLH 2XFXB 2AJYH 4LARL 1AFVH 1QR4A 5JXAL 1L7TH 3SGDH 4OKVA 1BFSA 3UTOA 5C0NC 3BGFB 1I8MB 1BIIA 4OQ1A 4OZFH 4YIQB 2ICES 3LKPB 5HDBF 5CCKH 3VMPA 2DM4A 3JVGA 5T1MA 2R0WH 1IM9A 3QG7H 1HZHL 3H2WA 4JREC 5FGCB 3IXAB 1YEIH 2DQUL 2DD8H 1NGZB 2A9NH 2LTQB 4PJCA 4X6FB 4Y16C 1NAML 5GGUA 3C8HA 4B5EA 2HKHH 1AXTL 5CP3A 1S7XB 2OL3H 1K4CA 3QXUA 4PJ7B 1VSCA 1YUHA 5A2IH 3BJ91 1T2XA 3PGDA 1NC2D 1JGDA 3KPOB 1FFPA 1YY9C 1YA5A 3VXRA 4U1MB 2I26N 1QA9B 1VEMA 2OTWB 4OJFL 1JHTB 4YPJA 1L0YA 2NZ9D 1J8HA 4G3YH 3IU4H 1UADC 3O2VH 4RGNB 2DYPA 4UQ3B 2VSDA 4XXCC 4JGMA 3IRZA 4M00A 2JK5A 4PLKD 3BRFA 1S7UA 2VLJA 4M8QA 1NBQA 2CIKA 1YQVL 2R23B 4N90D 4PRDB 5JIHA 5F9WC 5I19H 1J12A 1P7KA 3WLWD 3E3QC 1BQHA 1J10A 1D5ZA 1MUJA 4FFWD 4GXVL 5FK9A 3PL6A 4JFDD 4JZJC 5DEGA 4F3FB 2AEIT 1NCUA 5DZOA 1UA6L 3DECA 3UMTA 2PW1B 2ZP0T 3CJJA 4EBQH 1ADQH 5DD0H 1IC5H 5F96L 3TBTA 4LSUH 1NFKA 4RA0C 1GOHA 1U8IB 5IVXE 3KNBA 4JFHD 4MD5A 4CU7A 2MQCA 3TZVB 3PDGA 4NSKB 4ELKA 2DQEH 4ETYA 5LBSL 3V4UH 2AQ2A 1T3FB 1R3JB 4OD3L 4AJ0A 1NCTA 1CFBA 3K0WA 1AQDA 1DUYB 4GRLA 4K2UL 5J12B 5EZJB 4N0FB 8FABA 3GGWB 4WUUD 3SE3A 5I30H 4OZGE 4IOFC 5DUMH 2V2XB 1F02I 3TCLB 1UYWL 5DJAA 4JFEE 2H32B 3LY6A 4S1RL 1BFVL 1HHJB 3DROB 2IH3A 4P4KB 4PJBA 2NPLX 2IBBA 4IRSC 3REVA 1JGEB 5JOPE 5C0EB 4PRAB 4TVPD 4YE4L 1S5IL 4ZG1A 4PRHD 1IGYA 5EZIL 5LGKA 4LU5L 1CU4L 5IJKC 3RNQB 3ZHKA 5A2KH 2XPGA 4P2QA 3NCJL 4Y4KC 1PG7W 2X4PB 1C1EL 5GJTH 5GZOC 5IVXB 1KCRL 4Q2ZB 2CK2A 3GSNH 5ANME 2VXUH 3V4PL 3C2AH 1JGVH 4XI5C 2BDNH 5F9AC 5DK2B 4HEME 1EAPB 3FO2A 3BWUC 2WWMD 4Q6IA 4BKLA 3OKLB 3UTQA 2E5EA 3SQBA 4WTWA 5AG9A 1VPOH 4F7TB 4TULL 1OAQH 3Q6GL 4NO0D 4P4RA 3QDJA 2EH7H 1X5KA 1RV6X 1UEYA 3BYYA 5F9DC 1RQ5A 3KYKL 3VFNB 5FF6B 4PJFF 2GJJA 1MIML 3QO0A 2PTVA 5F3BB 1KLUB 1FRGH 4LAQL 1Z9SA 5DJYA 1IKFL 3RNKB 1QBML 4RA3A 5DEFB 1UZ8A 4HGWB 5IUSA 4NWTH 3JSSA 1QPPA 1MSPA 2DLFH 1WCBB 5ALCL 5H2BA 1AHWC 1SJHB 3OZ9L 4XH2A 1TETH 3GBLA 2O93L 4ZPTA 5AD0B 5ANMB 4NHUB 3VGFA 5IJVA 1CFNA 5JHDA 2JTDA 2FSEB 4X4XA 3L7EB 3NN8B 5F7EL 4WCYL 4G9FB 3RVVC 2X1XR 4HGKC 2HMIC 2Q76B 2FIKA 1LEKB 4HXAH 1A9EA 3M07A 3U30C 3HC4H 1GC1H 2CLRA 3OAYH 1OAYL 3STLA 3N85H 2ZG3A 4ODUB 3G5XA 2Z91A 4JY6A 4MYWB 3LN4B 3ES6A 5F89A 5IVZA 1FG2A 3TN0B 3VFUB 3P9MB 4J1UA 1WAAF 3L9RB 1P6AB 1U3ZA 3ISWA 5AYUL 3MLWH 4LIQH 2G75A 4K7PH 1MJ8H 4OLXH 3QEQB 2VNCA 4JEGB 2F19L 2D7NA 1OLLA 3QEGH 3AGVA 3CK0L 1T0MB 3MV7E 3SGDI 3T1FA 3MV9B 2J6EL 2VLRD 3DXAB 1DEEB 1AJ7H 3IDIB 1T7VA 3MV8B 3SDDA 4KPHH 3TPUB 1N5AB 4G8EA 3HUJA 2R0LH 2BVQB 1HNFA 3E8UL 3GI8L 4FFVD 1NCBH 5DJDB 3ULUE 1CGWA 2FJGB 3L3DB 2YUVA 4L3EB 5D1XA 3LEVH 2HFEB 4DVBA 1FFQA 2PN5A 3FQXB 1S9VA 4L4TE 2IG2H 3T08A 2P43B 1AXSB 3RTQB 2XNAA 1F58H 4HV8B 3T1WA 1QSZA 2R9HD 5IBLC 1CK0L 3IAQA 1XGUA 2C3WA 4NRYB 1ZLSL 4EN3A 5HHOA 3I50H 5D1ZB 4ZUWB 4IDLA 1N5YL 4Z8FH 1HXMA 5FHAH 1GPOH 2ARJB 1FVEB 4X7EC 3MV7B 3WFZA 4NKMA 2P7TB 1P7QD 3VXPB 2VAJA 5L7XL 3QJFB 1Y6NR 3V0VA 3W9DA 4BQ8A 2CDEB 5BXFA 2D31A 4OQTH 2E9JA 3E2HC 4YDVA 3T77B 4OZHE 3ZE0E 1B90A 3MOQA 3ARBB 5GJSL 1JWMA 1LDPH 4WU5B 5EFIA 2JJSC 4JQVA 5FA4B 4L4VA 2NTSP 1HSBB 4NQXA 4ZFGH 4I13B 4X7DC 1F8TL 3CPLB 3P0VL 4OFYD 4XBGB 2RGSA 2I60H 2PYFA 1I8IA 1QR1A 1FFRA 4P9ML 3ALXA 3GO1H 1YEDB 1U93A 5L2JA 1LWRA 1RZ8A 4ONHA 3C60B 2WW8A 3GKZA 4S11A 1DBAH 4EXKA 3ZYZA 4D3CH 5HHNB 5CJ8A 2V5RA 5GSRA 4HUNB 5IKCA 2YPVL 1QSVA 3QIWD 4PS4H 5KOVC 2NLJA 4HK3N 2IQAB 3QI9B 5L2KB 5H8DA 1ZKAA 1NEZG 1OWRM 1XMWA 1H8NA 2CXKA 2DI9A 4D9LL 4TUKL 1H3GA 4DGYL 1V7ML 3T0DA 1JF1B 4UTBL 3TF7C 5FUOH 4P5KA 1BEYH 4ZNEA 3V5DA 1Q72L 2BSED 3DTXB 3OGOE 2NW2A 3ZLQC 3MA9L 4HJGB 3KJ4B 4KRPB 3VFGH 1F4XL 2JJUA 3T3PF 5TDPA 4P46A 3ARFD 3MUY1 5T1DL 4YNYB 1LVEA 3MLTB 2FHFA 1MJ7H 1UM4H 4PJGA 1QRKA 4P9HL 4M61B 2NY5H 1RK1A 5E2TL 2MFNA 3UCRA 4JPIA 3VFRA 4N8PA 5E2JA 5B38B 1AO7A 4TVPL 3QXDB 3MLPA 1MHPH 4CU8A 1BZ9B 4M62H 4AZ8A 1NQBA 4ZUTB 3RPKA 4M1CC 5HGDB 2P24B 4ZUVB 3FB8A 5DMGC 1NKRA 3C5ZB 3X13B 3HFMH 1QACA 5SWQA 3BZEA 2VB5A 3PL6C 4RIRB 3QG6B 5CINH 3UTTE 3L3JB 2GI7A 4OFPA 4JM2D 1XIWA 5I17B 5MEOA 5EBMB 1SMOA 5HI4C 2PR4H 5FUCC 4J3XA 3WDIA 1F11A 2LU3A 4MVBD 1XF3A 2YK1H 1YMMA 2GTZB 2YD7A 3UPRA 5I71C 3FZUD 4XC3H 3BDXA 1BBDH 2DJUA 4FG6D 1FQ9C 1M6OA 3JV5A 5IHZB 2E8YA 4XP5L 3B9KA 5DGRA 4PRIA 4UUJA 4WW2B 2ESVA 3AB0B 1XR9B 4GRLC 4S1DC 1A6AB 4D0BB 2QHLA 2ILLA 3EGSB 1H15B 3K4ZA 4FXKA 3SE3C 4JG0L 3RI5F 1OAKH 4ODBD 4N0CC 1A9BB 5T3ZH 1DE4B 1YN6B 4DVRL 1WBYA 2HFGH 3QDGE 2DIJA 1TCMA 3RGVD 4D8PB 1C12B 2R0ZH 4QHUA 3ULSA 4HUWB 3NCBB 3FB6A 1HOCA 5GGVY 2UUDK 4MA1C 3UTTB 4UTAH 1J1XH 1SYSB 4H0GA 4BZ1L 4PJEE 3WN5A 2XWJA 5ESVB 1MF2H 2D03L 4PJHA 2ERJB 1FGVL 1G7JA 4E5XB 2NY3C 3NZ8B 1ZS8A 4PREA 2B39A 1ZHBB 4JRYD 2B4CH 4ETQB 1JN6A 2P8LB 5DD1H 1IAIL 1XGRB 1IARB 4GG6B 5H37G 3BWAB 3AXLB 4L1HA 4JKMA 5C1MB 3U83A 2FR4A 4IJ3B 4ZOCA 4RGOH 1UM5H 4Q6IC 3B8YA 5CJBA 1ZVHA 2GK0B 3IJYA 5C8JA 1D5MA 3KLAB 1I85A 3UYPA 5KS9A 1G7LB 1CLYH 5C70A 1M1SA 2IGFL 2WIMA 4XBPA 1UCTA 5D7JB 3ULVE 2AP2A 5GISL 5BRZD 3QQNA 2RCSH 1UKSA 3RY4A 4WHDA 1JUFB 3DYPA 4XVJL 4Q0XL 2PYEB 3ZYIA 3U36B 4CNIB 3U0PA 2DQFA 2NW3A 5CWSB 3BZ4A 4KROB 1IILE 3RHWK 4JVUA 2CD0A 5KG9B 3BE1L 4ZFZB 1V5JA 1SQ2N 1M7IB 2E7BA 2WAHA 3K46A 1B2WH 4XAWL 5DFVD 4HLJA 3NABH 4KH2A 2A6IB 4LVEA 1V8HA 5EORL 4OIIL 4DKAA 1LGVA 4MXQC 3BJLA 3D0LB 4ZPVA 3WS3B 2AABH 1T04B 5JIIA 3ECBB 4BH7A 3VFTB 5D8JL 25C8L 1CFVL 3PHOA 5D7SL 3ZE1F 1FLTX 4Q6YA 5FYLH 4ZSOE 4RGND 4HIEA 3QXAB 4RFNC 2WIIB 1SBBA 2BFVL 1RU9H 1TIUA 3DMMD 2I25N 4ELMA 3C8DA 1MFDL 4KK5D 4OV6F 1BD2E 1C8PA 3G9VA 1MVUB 5DI8A 5JTWA 3NMEA 1G9MH 4S0TD 4KHXL 4AEIL 2YOCA 2YZ8A 3P73A 5C0GA 4WTZA 4X7SH 5F7DB 2FX7L 1P6FA 4HH9B 3OL2A 3JV6B 3T2NL 3S4SB 3O6FA 5DQ9B 3DO3A 4G7YL 1A3QA 5IW1A 5IW6B 2DLEA 5IFAL 3L3KB 3U4BH 2N56A 3NZHH 3SPVA 4DUWA 4I18A 5I1GH 4PRPA 3UX9B 1A7QH 2XQBH 3TZVD 5E5MA 4BFGA 3MFFA 1JF6A 1MFEL 3P40A 3VRIA 1F4YL 1IE5A 1EIBA 1NBVH 5JA8B 3SDDC 3BDYH 3RX5A 4LKCA 2FLRT 3BH8A 4Y4FB 3HB3D 4YWGL 3OB0K 1ORQA 3OG6B 5D1XC 1NMAL 4JO1L 1S5HB 3OKDA 5F7MC 1WSST 5JPMA 3TBWA 1NGWB 1UACL 4HWEL 5DJ2A 2J5LC 3S96A 4P49A 2ICWB 5E2WH 4P4KD 1N6UA 4YHYB 3T3MF 4F7CB 2AK4B 4PGBB 1J05B 2ADIB 5ISZE 1S7WA 3FT3B 1FJ1A 2Y06L 2EYSA 3I2CH 2P5WA 4N8VA 4EN3C 1R3IH 1NMCB 1A5FL 1BOGA 3VFSB 5K59E 4LLWB 1KIQA 1LD9B 3EO1B 3O6MH 2W0KA 3ZMRA 3IFLL 4NNPH 3WIFB 1TVHA 5MP6H 4XC1L 4OV5B 1BPVA 2GSGA 5IHUL 3CUPA 1ZOXA 3TH3T 4Y5VA 3EAKA 5EU4B 1KYOJ 4OGAD 4R7DA 2LAAA 4BQBA 5SV3A 5DLML 5HI5D 2OLDA 5DMJB 2FIRT 3DNKA 4DAGL 4TUJB 4U1NB 3ZT6A 1TJHL 2R15A 4MX7B 3INUH 4JFDA 1FP5A 1VHPA 4JQVC 4HFUL 1QRNA 4QRRB 4JCMA 4EUPA 4HH8A 2X10A 1XF4B 5B8CA 1EHNA 4Y5XA 3M1BB 5HYSB 5AZEL 3U46A 5JNYB 4LP5A 4WW2F 1RJYA 3VXOA 4IRZL 3BUYA 4U7MA 5DS8A 4M7ZC 3QXWA 2ATPA 3LMJL 1HQRA 3UEZA 1FYTE 2HG5B 3I75A 4HKXB 1K4DB 1GGYA 2Z4QA 1UJTA 2QTEA 1CXLA 5ITFA 1JL8A 2Y72A 5EU6E 1IL1B 1FO0L 1FFOA 3HPLB 4Z0BL 2QKIB 4G9FD 1IBGH 4KRLB 3Q2CA 1T22B 4MJ2A 1T20A 4D9QE 1ZTXL 4HHAA 3T65A 1MHCA 2X4UB 3CLEL 4RCAA 1CYGA 2YD6A 4KTEH 1DVFA 3IDNB 3ROLA 1LNUA 2Z35B 4FXGB 2LVEA 5HHMB 1BAFL 3GK8H 2IC2A 1CE1H 3PJSA 4P46C 4PJIA 5JXED 2AXGA 5C0AE 2OXGA 3AVEA 3TN0D 1KCLA 3H8NA 1MJJA 1ZGLA 1MFCL 1BX2A 2BSSA 4JE4B 3MUGA 1W0WB 1ZE3C 3QEQD 3DGGA 1EAJA 1O0VA 3DVNA 4DKFH 4R90H 4YDJA 1NGPL 4TSBL 5IK3B 1AD0A 1AIFA 1KN4H 1RVFL 3GFUA 1T2JA 3OR6A 3CVHA 4X4MA 2A0LD 3MV9D 2BRRL 3DXAD 4DZBB 4NO0A 4WGVB 1X7QB 1A2YA 1RK0A 3MV8D 1FVCB 1H9VA 4DTGH 3C2SA 2IAMA 2VITA 1XIWC 4LGSB 1OP9A 2EDEA 1MIEH 5IFJB 3G5YB 3KVQA 4L3ED 3SN6N 4KUZL 1JWSB 2P48B 5I66A 5K93A 2YSSB 4V1DA 3ZL4L 2ZCLL 5F3HA 4UT9H 1A7NL 3HCVA 3C8KA 4J3VA 3HRPA 3RTQD 3L1OH 4NQCA 3UJTL 3EDJA 3B9KC 4PD4J 4RZCA 1I3RB 3VDBA 1XF1A 1NBZB 5JIKA 3MYZA 3HAEB 2IPKA 4MQSB 4JPVL 5ID0A 3D39A 2R1YA 3KPQA 4UT7H 4PGDA 3VGDA 3SO3C 3MV7D 4UDUA 3GSXA 5E8NA 4WUKL 2VISA 2AXHA 5J9PB 2GYSA 1EZVY 4MZ2A 3V9FA 1GHFH 4YXLL 1ZVSB 4AEEA 2Y5TA 3MTRA 3WN5C 4JVPA 2DOCA 3ARBD 3SKJH 5BV7L 1RHHB 2VABB 1E6JH 3ILPB 3TYFB 2P8PB 1R3KA 1IQWL 3VXUA 1YEGL 3JV4A 2V9RA 1A6ZA 4PJ8B 4E41E 2NZIA 2WNGA 5EU3A 5MERA 2HAZA 1FORL 4DN3L 5E2UL 5DQJA 3UZEA 1PQZB 3LS4H 5DD3H 4DKEH 3BHBA 4OLZL 5FB8B 4DCQA 1MCRA 2GT9B 1A14L 1I85C 2GY5A 1IZJA 5TQ2L 4FHBD 4FZEH 1LP9A 1TVDA 4UIKH 2X4RB 3MMEA 3CLFH 3KR3H 2BVPB 2C1PA 4HIIB 1QBLL 1J0YA 1NJ9B 4QY8A 3QI9D 4GLRH 4E42A 5L2KD 5ACZA 2I5YL 1UB6B 4AEHL 5I1DB 4GMSH 5D1QA 1M71A 3EIFA 4XP6H 4MNGE 1QFHA 5TQ0H 2ZSVA 4BH8A 3ILQC 3O2DH 4OTXL 3TO2A 2YBRA 3MO1A 3MCLL 4S2SA 3UPCA 4P23B 1XT5A 1CZ8H 1OCWL 1ZXQA 3Q5TA 2V17H 3SOBH 5GSVA 4LLYA 4KRPD 4E41B 1RZGA 1AGFB 3BP4B 15C8L 2AV1B 3TLRA 4S10A 3ZE2E 3X12B 2B2XH 5E8PA 3HNSH 4LEXH 1JNNH 5ACMA 4UU9A 1JZ6A 5BZDA 1ZANL 2P47B 3AREA 3UC0L 1U8KB 3KS0J 3VXQB 4QRTA 3ZYOA 3MNZA 3VFOB 5JMRA 2Y7QB 2UUDH 1I9EA 2BJMH 1KELL 1WFTA 1VGEH 3K2MC 3JTSB 1Q9WA 4GKSA 2QV2A 2K3TA 3VFMA 5E8EB 3MRCA 1G0YR 3IAPA 4W6WB 3O6FC 3ZKSD 4JDTH 1FYHB 2XTJC 4G6KL 5SX4H 2EDXA 3HMWH 4RNRA 4FQPA 2CDFA 1UXSA 1DCLA 1INQB 4UILH 3O3EA 4PY8J 4YEFA 3W5NA 4NWUH 3QA3A 4I18C 4Y19B 1KB5A 1YNKL 4NZDA 4UINL 2VERN 3RVXC 5JHLH 2YPLB 4XCFL 3K80A 3NGBB 2QQKL 5FA3B 4TSCH 5EUOB 4M6ML 4OF8A 4QXGL 4YPGB 1P4BL 1TQBB 4QXTB 4NQEB 5M94B 1TCRB 2IANA 4CVXA 2IMNA 5CIPA 5E6IB 1TMCB 4OB5L 2DRUA 3RWDB 4LFHG 5L9DH 5HSFA 4M6OH 4BSJA 4JZOB 3BX7C 3NFSL 1A47A 5D7KD 3QPXL 4AM0A 4PLJD 3AAZA 1A1OB 1CLZL 3O6LL 3LHPH 3X3FH 3EJYC 4LEOA 1BVLA 3DETC 1YJDL 4HLZH 3UTTD 4NO5B 1I1FA 1V05A 2DTML 3NH7H 5KSUB 4HQQL 5GGRA 1U8PA 3FHQA 1PEZA 2A6KB 4A6YB 5CGMA 2WUBH 2FEEI 1OQXA 2RHEA 1MI5B 2KL6A 4CDHA 1OSPL 3NFPA 4Y5VC 4U3XA 1CF8L 2VRAA 4M6NH 5GGSB 2C4FT 1II4E 4QGYA 1U91A 5HYJB 4ODTL 2PCPB 5IB1B 3DX6B 3QCUL 1GH7A 3RVTD 5HDQL 3BKMH 3EDKA 4FFWC 2H6PB 3ABZA 5KVFH 1LILA 4DW2L 4X7TB 4LHUG 3GHBH 4JM2A 4F7EB 1S8DB 1KIPA 2EIBA 5D7JD 1KTDB 1MLBB 1F4WL 2D3VA 4WU7B 3VA6A 5B8CC 1NFDE 4HPYL 2Q8BH 3BYTA 2PYED 4HKZB 1ZWIB 2MHAB 4MXWH 4ZAKB 5E9DB 1CL7H 4KROD 3I84A 2C4XA 4XPTL 4KDWA 4LCIH 2OTUB 5EWIH 4MA8H 1FN4B 3BSZH 1LE5A 3RWEB 4Z7NE 3OB0H 1PJ9A 2SEBB 4YO0A 3TWCL 3FFCE 5A40E 5GXBB 1TPXB 4FFZH 4CW1A 3PHQB 4KFZC 1YPZE 4CVUA 3H9YA 3WEXB 4JB9L 4MA3B 3KAAA 1DVFC 5KBNC 4NQSB 3EOYG 3BP6B 1GZQA 3RI5K 3ARTA 3QIUB 3LEYH 2GJ6E 1IAOB 4KJPC 5GGRY 1AKJB 5ICZB 2VDLH 4U4BA 2XN9E 4C56E 2GW5A 4Z6AT 3BIKA 3JZ7A 3GSUA 3F5WA 2ZJSH 1QFWL 4JO4L 4HS6A 1UEMA 5BO1H 1A7PH 5C92A 3WYRA 4XVSH 4LCYB 5DRWA 1ZSDA 3E6HB 3PP4H 5DC0A 4OCWH 3MLYH 4KI5F 2FBJL 5IMKA 4S1QH 4KVNH 2YD2A 4GUPB 5CJOL 4LLVB 1QSEB 3A6BH 2VZ1A 2X9WA 4R26H 1ROWA 3SE4A 4HWZB 3H42L 1SYVB 5FCUH 5HJ3B 2Z8VC 2IAMC 4Y4FD 3W2DL 1OP5K 4DGIH 5GS1A 3KYOA 2JIXB 4PJDA 4RWHA 4ALAH 1KGCE 2QR0B 3O4OB 2DQIL 2IFGA 4YIQA 2AK1H 5ETUB 3WBDA 2NY1B 3LKPA 4KKAC 3ZKND 5TFSL 3U0TB 4N5EC 2R29H 4LPWA 3NCCB 4WV1B 2DLIA 2EXYD 3BEWA 3OR7B 5GHWH 3GI9L 5D5MB 4DUVA 1S9YA 4X6FA 3B2VH 4JFQB 3W82A 2ARJQ 2A1WH 2AK4D 2GJ6B 1NMBL 1WWBX 3TNNB 1QO3B 3FN0H 2VDNH 4PJ7A 3V7AE 1VCAA 2LFGA 3KPOA 5JQHC 3KYNB 5I75B 4U1JB 4EDWL 4LKXB 5E8DL 2CDGA 35C8L 3HI5L 1FV1B 1DSFH 4KKBC 4PJ5E 4U1MA 1A4JB 1EGJH 2OTWA 3ROOB 1JHTA 3GMPA 4KK8D 2RR3A 1OGAA 1L7IH 3HG1E 3MUHL 4FNLH 4M7KH 5LAXA 4WI5A 2C7UB 3CSYA 5HY9A 2OP4H 2A77H 2QBWA 2X09A 2R23A 1DZBA 1T5WA 3QQ4B 4P2OB 1WGOA 2F8OA 4KQ4H 1J1PH 5I1EL 2UYLB 4ZO9A 1VFBB 2KKQA 3TBSA 3IS0X 4XPGL 5EU7C 4NZUL 2M8XA 4Z7UB 3PV6B 5SX4I 3U9UB 4OKDA 4QRRD 1A21A 4B53A 1DLFH 1EUUA 3MXVL 1K8IB 2E9IA 5EU5B 2ITDB 3IDGB 4U6HB 4IRJB 4POYA 2AXFA 1NEZB 1D6VL 4GAGL 4WW1B 3HR5B 1E6OL 4PTUB 5E4EC 5EUOF 4FQIH 1H0DB 4R96B 4JPWL 4CRPA 2XWBB 2DDQH 1JK8B 4BSWA 2X70A 4OD1L 3BPOB 1CGUA 3TESA 2A6DB 2MPAH 2UZIL 3RWGB 3S88H 1IC7H 5C0CB 1TTUA 2JB5L 4FFVC 5EZJA 2EO9A 4N0FA 3V2AR 3C6SB 2DIAA 1ZEAH 3ZKMD 3D3VB 3DRQB 2PUQT 1Q1JH 4M4PA 3TCLA 5TF1H 4KK9C 5D1QC 4HWBA 1HHJA 1CT8B 4O2EB 4N0UE 1JGEA 4L3AA 2AKRB 5EZOL 4OLYH 4GAFB 5I9QC 4G8GE 3Q5YA 3RNQA 5HHMD 3C09B 4KI5C 2KZWA 4JDZB 1XGYL 4G80A 4YR6B 4X99B 2X4PA 3AC0A 3KXFE 2NY7L 4Y4HB 2PTTB 5GGQL 5IVXA 5J4MA 4H0IA 3R06A 3HZMA 1JGUH 3IT8D 3VDCA 5HVWA 1TLKA 1W72L 1UWGL 1GCFA 5EZLB 3I6LE 2DQGL 3WS6A 1YEHL 3FO9B 1ODAA 1S9KC 1MQKL 1EAPA 2DLHA 2Z0BA 4Z7WE 2VDQH 3VXTB 3AREC 4XB8A 3OKLA 4JLRB 5FO8B 2F8XC 3RY6A 2XZCH 2EC9U 1UQSB 2R4SH 4OZGA 3QWRD 2FX9L 1H3WM 4LOUD 4HS8L 4F7TA 3RWJB 1NUFA 4PP2A 1KPUA 4JFEA 5ADPL 4YHKH 4DGVL 1JWUB 1CL7I 3QHZL 4XMLL 1ES0B 3VFNA 3UBXI 5DJ8A 2VIRA 1EO8H 3RNKA 2Q7YA 4XVUD 3F6IA 5L8LB 4HGWA 3CH8A 4LPXA 4P2RE 5GS0C 2VAAB 2YMXL 1PG7L 1OAXH 1WCBA 3KXFB 1OD7A 1SJHA 3OX8A 4J12A 3IDUA 3KPNB 1AGDB 4N0YL 5JPNB 5ANMA 4DZ8B 4NHUA 5INDB 4TPRL 1F4HA 1KJ3H 5J3HD 5F70A 3KPRE 1QD0A 5CP3H 4JO3H 3TFKC 1CTNA 4LLMB 1RAMA 2EE2A 3CFDB 5FECA 4I3RH 1HEZA 3K8MA 2Q76A 3NACH 1LEKA 3LDBB 3O41B 1BOYA 1KPRA 3GJFB 2R69H 1MWAB 4YX2H 4PFEA 4PUBH 5C0DB 5CSGA 2K1MA 2UZXB 5GRVL 1C7TA 2B5IB 2HJFB 1G9NC 3LN4A 1T03L 3P9MA 1DQQA 1OAZH 3GUTA 4N0RA 4G6ML 4HUUB 5IB2B 2NR6D 4XPFL 5J7CC 5K9KB 2W0PA 4PJ8D 4LSPH 4U6VL 1KULA 1BFOB 1LK3L 1O7SA 2VQUA 4J3UA 3CD4A 1I7ZA 3V8CA 1FZJB 5D2LF 1SBSH 3DX9B 1JTTA 1HXYB 4PP1D 1T0MA 2ADJB 4OLWH 4X6CB 4YH6A 4EVNB 4ZTPH 4QXWA 2QQNH 3DXAA 3EOAA 2HWZH 3HC3L 3KPRB 3JWNC 5E99L 3CGTA 4NPYA 1N5AA 3KYMB 5I1LA 5F93C 1WFNA 4JM2C 2BVQA 1ZT4B 2AQ1A 5D5MF 3LB6C 5DJDA 4CMHB 1KG0B 1LO4L 3VD4A 3L3DA 4HF5H 4MVBC 3V6ZB 5JW4Q 1FLRH 4KHTL 1J0IA 1D5XA 4U0QB 4QXUL 1PKQB 5EA0H 4X83A 2JE8A 1I3GL 2AW2A 2CR6A 5T1KB 3UJIH 1MLCB 3NA9H 3GBNH 2CKBA 5E08L 5D72L 3VI3E 3IFNH 4QGTA 3MLRL 5DRXA 3TYGL 4P23D 2B0SL 4IS6B 3OKYA 2IFFL 4JJ5A 3LEXB 3CMGA 3MRGB 1EA9C 4WVRA 5D1ZA 3VXNA 3UAJD 2DL9A 3DSFL 3SDXE 4CVZA 5E00B 3MV7A 2AV7A 4LSTL 2P7TA 2VXSH 1BP3B 5C86A 1IVLA 2VWEE 3L5WA 4Z7UF 3WFBH 4LLDB 3JTTB 2XWTB 1F6AB 4XGZA 2EE9A 2LQRA 3T77A 4OD2B 3ZKQD 3IF1B 2DMKA 3ARBA 4UBDD 4GKNB 1ZT1A 4QEGA 1DL7H 1JZ4A 5FA4A 3IS1X 1HSBA 3U1SH 1DJSA 2CRYA 1BM3H 3S3SA 4L4TA 5FYJH 1EHLH 3CPLA 3MV11 3GSQB 3L5JA 1Q38A 1HINL 1QEWB 2EEDA 3WIHA 3RDTA 3L95B 4MAUL 4PJAB 3MRHB 4OZFB 4ONFL 3OGCA 3P30H 4Y19D 3C60A 4S1SH 2YPLD 1KB9J 12E8H 3RL2B 4HULB 5GZNC 3SE4C 1KCVH 4UNTA 1JFQL 3BGFC 4GRMA 3MJ9L 4NQED 5GS1C 4D9RD 4UT6H 1D5IL 5A2JH 5E6ID 2D7TL 5DXWA 1DUZB 3VG0H 3PWJA 3MGAA 1VKXB 2PXYA 5CJQL 2EXWD 1OARH 4OZHA 4WFEE 3WUWA 4H25A 3GMNB 1S3KH 2AGJL 2LTQC 5DUBA 5DFVC 5DQDH 3V7MA 6FABL 4HJGA 1B6UA 1R5VB 2FB4L 1D5BB 3MRJA 4C4KT 4YHOH 3IDXL 4Q9RL 3JV0A 4LL9A 5L8KB 4YNYA 3MLTA 1VACB 3TBYB 1GGBH 4LCWB 2VR5A 4M61A 4LASH 1NUDA 4O4YH 1MI5D 3AY4A 3BH9A 1RUPH 4ZXBA 4XMPL 3VXME 1S7SA 2EEBA 3QXDA 4NM8H 5FDYA 2Q7NA 4U1GC 3ZDXF 3N9GH 5C7XL 4PBXA 4ZUTA 5HYJD 1NGYB 2QLVB 5HGDA 3WSQH 4HT1L 2IPUK 3W11C 2X4OA 1S7RB 1A1MA 3C5ZA 4Z7OE 4GQ9L 1U58A 3PWPB 1IKNA 4UQ2B 3L3JA 5BMFL 4WFGE 1Y18A 3VD9A 4LDEB 4NO2B 1NANH 2N7AA 1N7MH 3QUXB 4Z0XB 4X8XA 3CNKA 3KLHD 3WLBB 2V2WB 1FIGH 1VEPA 1S9WA 3O0RH 4ZAKD 5I1JL 5ALBL 5E9DD 4QYOA 1MCFA 1XZ0A 3EKCA 5IHZA 5SX5K 3NA4A 1NFIB 2AEQH 1BBJB 1FH5H 3FQNB 3IDJB 4UB0L 2E27H 5J12C 1A6AA 2GCYA 4D0BA 4AIXA 3EGSA 1CFSB 2Y6SC 3FTGA 3O3AA 1FZMB 3D18B 3VXMB 4DQOL 1HE7A 4U6TA 4X5XB 3GKWH 2BVYA 5CEYB 3VXSB 2BOBA 1D7FA 1YN6A 2C3VB 2FO4A 4ZFFB 4D8PA 1ED3A 1C12A 5IVOA 4C4KO 5CEZD 3P9LB 3GSNB 1Z5LA 2G60H 3MRIB 1IGMH 3QHFH 3UTTA 3IJSB 3MODL 3LSOB 4TSAH 4Z7VE 1CE6B 1SYSA 5I8KH 3IAGC 4GG8A 3MROB 3S36X 3QIUD 3U2SA 4E5XA 5EOQH 3VWJB 4YHZL 4HLZG 4OFKA 4ETQA 1AKJD 3LRGA 1NCCL 3FOLB 4X6CF 2MWCA 4GG6A 4XAKE 3KYAA 3WS6C 2J7LA 3QNYA 1UB5A 4XWOD 4Q9CA 3KPPB 3LQAC 5HI5C 1QLRB 5JXAH 5DJZA 3PG2A 5CD3B 2GK0A 3RY6C 1DBKL 3KLAA 2EE6A 2X42A 5LWYH 1G7LA 4YK4B 3ORJA 5IFHL 1IT9L 5A2FA 1QSED 4PTTB 3E0GA 2UV3A 5BQ7A 5D7JA 3QDGA 4BZYA 1CBVL 2EKSA 4ZS6D 5GGTA 2VYRE 5C08B 2AEWA 4HMDA 2DBLH 3MJ7A 4KJQC 2PYEA 3MQIA 3U36A 4CNIA 1XF5B 2IF7A 1AXTH 1P69B 4ZO8A 3DI3B 4Q9QL 3QBTB 1GL4B 4PJEA 3DV6B 2LU7A 4ZFZA 3D85B 5TE4L 1KACB 2ORBH 1K8DB 5DHYA 1T1YA 4HFWB 4YBHA 4ZFOB 3DX7B 1L4IA 3H0TB 2GJ6D 5C0RL 2H45A 4JRXB 1S78D 2IQ9H 3D0LA 3SDAA 4H1LH 1BVKB 3HI1A 2DQHH 2KQNA 1YJDC 2FDBP 5GGVH 5C0JB 3EFDL 5CILH 1HI6A 1Q9OA 1KFAL 4ZO7A 5FUCE 4HDIA 3PXHA 5KVGH 4LQFL 4RGMB 4JFYB 1Z2KA 5EULV 3G6AB 4PYHA 1KEMH 1N59A 5CGYD 4I48A 1MCOL 1ZA3B 3VA2C 1AP2B 1K6QL 2BHUA 2Z93A 1MREL 1XCQB 4KVCL 2BX5A 4P2OD 3F7YB 2R1WB 1G7HB 2MQ3A 2AJSH 3FOMB 3S37H 5JXEC 2UWEB 3J7HA 2R0KH 4PJAF 4HH9A 5A16B 3GRWH 4ODVH 1U6AL 3OKKA 5DQ9A 4NC0B 3MRFB 2HH0L 3MREB 5D71L 5LBSH 5T1LB 2AI0L 4IRJD 1IGIH 4NHCL 2VQ1B 4M1DL 2EDBA 4PJBE 1KBGL 3A67H 2OZ4A 4LLQB 4UOJA 3ZTNL 2ATKB 1C7SA 4G7VL 3VJ6A 5C0IA 4B7LA 4LMQI 3I3DA 3EYQD 1MAMH 3PDDA 4P2QE 1E0OB 2X9XA 3DYOA 5CZXC 5BV7B 5C0CD 4Y4FA 3OXRB 4ZSOA 2M26A 4G6FB 1R5IA 1YEEH 2AAVA 1KTKE 1G7MB 3D3VD 3ARQA 1N8ZB 4Q9BA 4LNVA 4LHQB 2DQTH 3L3HB 1DQTA 1DQJA 1KCUL 1MY7A 4C54A 5FM8A 4RISH 4YE4H 1OM3H 5EO9B 3WMSA 1AR1D 3OV6A 4F7CA 4GBXA 3P9WB 3QRGL 5B4MC 5DURB 1X6NA 3TIDA 3WD5L 2RFXA 1Q9LB 2V5SA 1EPFA 1OP3K 1RULL 3H7LA 3QDJE 4OZIF 4I0KA 3UJJH 4K7FB 5D1ZC 1RJZA 2A2QT 4Y4HD 3EO1A 4MHHI 4Y1AE 4YEEA 3FAWA 3SKOA 3F7VB 3WIFA 4GMTH 1JNJA 3JWDL 2FJHB 5C09E 2HRLA 3JUYA 2HN7B 3QEHB 2V5TA 2UY6A 4K3EL 3AS0A 3I6KA 3V0WL 1SJEB 3MLSH 3IJHA 1Y0LA 1KC5L 3GMMB 3HMXA 3QWQB 5F1OB 4U3HA 4A6YL 4JR9L 3ARBC 3ULUC 1JF5A 2APVA 1NANI 2BC4B 4JFZH 3EHBD 3D87B 5EC2B 4AH2B 2XZQH 3IDYC 1AQKL 3KPLB 2VZOA 4HK0B 5FO9A 3QFJB 5K9OB 3N1GC 4ZS7H 3KWWA 2FATH 3M1BA 3MJ9A 2CMRH 3RDTC 5ALCH 3MBEB 5ISZA 5F7LB 4WI4A 3EOTH 2DWDB 3I3BA 3QQ9D 4MA7H 3R8BB 4R4BB 3MOAL 3C60C 3TVMA 3LRSA 3QZWG 2G5BB 4U1KB 4CBPA 2Z8RA 4NQTA 1RZIA 1C16B 3EO9H 5GPRA 5E1AB 3PP3K 1K4DA 5EH1A 1RIVH 3ARVA 2FBOJ 1B4JL 4NUGL 3WIIH 2ZKHH 5F1NA 3T0VA 4EI5A 3HPLA 5IMLB 1DFBH 2QKIA 2W07A 1OTSD 3D9AL 4HS3B 2MKWA 2PXYC 4WEBL 2BNRB 2OI9C 4WY7L 3IDNA 2R8SL 5FV1L 4ISVB 3TBVB 4FXGA 2H2PD 3ARGB 1S9XB 1T66D 4LHUB 3LKOB 2VR4A 4LNRA 1VB9A 4X0KA 2P8MA 1N2RA 2HT2D 3MLVL 4PJEF 5CEZL 4XP4L 1GGCH 5DJXB 2ZUSA 4XVTH 1I9IL 1J5OL 3QDAA 4Q58C 5H35B 3AY4C 4ZXBC 1AR2A 3H3BC 1JV5B 4C57C 3HZKA 1FYTA 2FYYB 4CJ1A 4WNQA 1NGQL 4K71C 1BFTA 3QWRA 1G1YA 3E8UH 3DURB 4OCRL 5HVHB 3C5ZC 4BFIB 3CFJB 3GMQA 4K94L 5EU6A 5AWNH 1X7QA 3KPRD 2IWGA 1U41A 1SEBA 1IKNC 4GRWE 2YKLH 4HUMB 5DRZB 5GRWA 5IFJA 3OJDA 3R0MA 3FB7B 1FPTL 4DEPB 2O61A 1CGSH 2YD1A 3MRPA 4PRBB 3ULVF 1CXFA 3G08A 4YAQB 4YBQC 3HI6L 4J8RA 3W5MA 2M2DA 1JPFB 5IESH 1MRDL 4LF3B 1FVDB 5IW3A 3WHXB 1RI8A 3U9PL 1K2DB 3U7YL 1P84K 1MCCA 4L4VE 2VL5A 3G6DL 2VC2H 3HNVL 4J6RH 5F7NC 1NDGA 4I5BB 3VG9C 3ESVF 3V6OE 4L5FH 4TN9A 5F9OH 2OQJA 1QBBA 3MOBL 1HK6A 4KZEH 1OQOA 5IEKA 3ME0A 3HNTL 4PLJC 4QT5A 4PJXE 5D9SA 4CDGC 5CSZB 1N6QL 1X3DA 1QG3A 4K9EC 3TPKA 4KMQA 4TYUA 5ADOH 1KXQE 4ZUUB 5KSBF 1SEQL 3B43A 1HH9B 2GY7B 3ZSSA 5FYLE 1FZKA 1E27B 1RHHA 3ILPA 3TYFA 1ZHKB 2FRGP 4U0RC 1JE6A 4BELD 4PJ8A 2ZPKL 4JY5L 3VDAA 3QIBB 4JQIL 3HZVA 3VE0B 2V7HB 4YFDB 2HP4A 2ZG2A 3V52H 2HFTA 1I7TB 2D7QA 4EUPH 4ZNEE 1BQHG 4CKVX 1BF2A 4APQA 5EN2A 2EDQA 2VSCA 1NGXB 4JFXB 2EDRA 3NIFE 2CLZB 1MAJA 4EZMA 1JPSL 3AFLA 3K2UL 5D7JC 5DVNA 2HJKB 2ZZUT 2X89A 1DQDL 2D4DA 2DWEA 5GS2H 5LXGL 3TA3D 3TJEH 4HIIA 3MNWB 1UB6A 5I1DA 3DARA 1AO7E 4L8DA 4KROC 2NTFB 3WFCL 5JW4R 1J8KA 1AGCB 2GUOA 2WUCL 1QYGH 5FKPB 5DVMA 1B3JA 5SX5H 5D93B 4E41A 5I74B 3RUGE 1T5XB 4HJ0D 1C5BL 1PX4A 4JHBA 3V0AC 3X12A 3Q1SL 1A6WH 4LCWD 3F12A 2QHRH 4CADB 2V6HA 4PG2A 2R4RH 2MQ0A 5K59F 1IAIM 2W91A 1FL3B 4K3GA 4U2YA 1PZUB 4O02H 2J8HA 4KMLB 3DHJA 3VXQA 3ULVC 1YN7B 5E70A 1KF9B 1FBIH 3JTSA 2W60A 3PWPD 4HWUA 5C07E 2BHZA 1HQ4B 2VDRH 4FQJL 5ESQA 3CVHH 4JM4L 2APWA 4M43H 4P5TA 2VL4A 5IF0B 3P4OA 1FDLH 4XMKL 2DTSA 3GIZH 3I85A 5JDSA 3SBWA 4JHAL 4Z76B 5BZWB 1MJUH 3DPBA 1L0QA 4HX1B 4KJYB 4OCXL 1IJ9A 1T7WA 1KJMA 1W0YT 3PABB 4QTHB 1C5CL 2ICEA 1J18A 3WXWH 4QXTA 4Y4FC 3PWNA 1G0XA 4YHMH 1IC4L 5E6IA 1V7NL 1DBBH 3ZKNC 4JFOB 3SE8H 1EJOL 1U3HB 4OLVL 3VXSD 1KXVC 2WBJB 4JZOA 3H9SB 4YHYC 2OSLB 1I1AA 4GBXC 4QRSB 5FO7B 5J13C 2QQLH 1A1NA 2KDGA 3RVWC 2CK0H 4IIQB 3BAEH 4MLSA 2P5EB 1AE6H 2P4AB 1YYML 5KSUA 5TF0A 3BMWA 1JTOA 1NMCC 2YPKB 1QVOA 1SHMA 2A6KA 1L9NA 5B3NA 4M03A 2YR3A 3VWJD 3DIFA 2V9TA 4KU1A 3SKMB 4G8IB 1OVZA 3TT3H 2NNAB 3MLXL 1UKTA 3VWKA 5GGSA 2JCCB 3CIQA 1MWAL 5ELIA 2X7LB 1RJLB 4MDIA 5IB1A 3O9WB 4MHHG 3BOVA 3DYMA 1PFCA 3EYFA 4PY7B 4DK3A 1YC8A 5KW9H 4LSDA 3FO1A 3MGTB 4Z95H 3O8XB 4RRPG 5D7IB 3QDME 4RFEB 1MLBA 3G5ZB 3MRQA 2K7QA 4QRUB 2AJUH 4UIMA 5C08D 3LKQB 1K5NB 3N1PC 4TOYH 4PGCB 1TVBB 4HKZA 4XRCA 2L7JA 4QHMA 3SY0B 4POZC 4O00A 3F58L 5DSCB 4U3CA 1TZIB 1T21B 4U7SA 1J1OL 4G9DB 4R97B 2OTUA 3D85D 3QULB 3DUUB 5D8JH 1FN4A 5DMIL 4M5ZL 1HIML 1U0QA 5C0FB 4JRXD 3X11B 4WI7A 4XCYB 4YXHH 2OJZH 5E2VL 3BQUB 1A6TB 2OR8A 5I8OH 2CSPA 1IQDB 4RQQA 4EI5C 4MQXD 5GQBA 3FO0L 3SE9H 5H94A 4HMCA 1JNLL 2DQDL 4H8WC 3L5XH 3BZDA 4ZO6A 2B20A 1U2HA 1MFDH 1RZJL 3PHQA 2XZZA 3QCVL 4YXKH 4M7LL 1B0RB 3WEXA 3RZCB 1FL6B 2VDPL 3QQ3A 1C08A 5DR5L 3GM8A 1EX0A 4L9DA 4NQSA 3IU3B 5BVPH 3BP6A 2F53E 1KNOB 2XZAH 2NY6D 1CDHA 3GJFK 4DOHB 2ID5A 3G6JE 1F3JA 4EJ1C 1T4KA 3R8QA 4ZUSB 1KLGA 1WJ3A 3FFDB 4WO4A 3LKNB 4UAOB 1PSKL 3CDCA 2PO6B 3EJZC 5IGXL 5EO1B 1IGCH 5ECJE 3WE6B 5T1LD 4F57L 2E6QA 3E6HA 1NC4D 5K9JH 4QO1A 1CDUA 2X9YA 1CG9B 1U8OA 1FE8L 5GIRB 2VDOL 1YYLL 2BVOA 1J0ZA 3S35H 2AJYL 1AFVL 1DN0B 1SYVA 3FFCA 1L7TL 2JB6A 4W68A 5GS0H 1KB5H 2D4FA 4NN6B 4J7RA 1YPZA 2JIXA 5EPMA 4G6FD 2QR0A 2YN5A 3NCEB 2NXYC 3GJEB 3C9NB 3MA7B 3U0TA 1KPVB 2IH1B 4WV1A 5CCKL 4X9BA 4N90E 1YY8A 3OR7A 2F53B 5FHBH 2R0WL 3QG7L 2V2TA 1I8KA 4QTIL 1YEIL 2DD8L 2A9NL 2GJ6A 1U8HB 5DURD 4MB4A 1UXWA 1EERB 2XN9A 2HKHL 4C56A 4MXVE 4BJLA 1NAKH 1FNEA 3S35X 4P59H 4MD0B 4U1JA 3HLAB 4FQXA 3PP3H 4LKXA 5ICYA 1MFAH 4H1LG 3QNZB 5JOEA 5CP7A 4JFHE 2VZTA 4JHZA 3O2VL 1G9NH 1NKOA 4RMRA 3HE7B 2B1AH 1OB1B 4PPTA 1XAUA 4HAGA 1CFQB 2UYLA 4NGHH 4XNYH 2CR3A 5I19L 1VFBA 4Q97A 5E24E 3LKSB 3BD4A 4WUUE 3RWFB 4O5LH 3KJ6H 3MRNB 1P2CB 2NR6C 1BHGA 4I1NB 2HLAB 1K8IA 2ZOKB 5HHPA 4PJ8C 3IDGA 3QFJD 1K3IA 4LFHD 1NEZA 2WZPD 3WHE0 4NBXB 4WW1A 4EBQL 3A6CL 4L8SB 4PTUA 5DD0L 1IC5L 5K9QI 4LSUL 3MBED 4PP1C 1EMTH 1MCPH 3N0PB 3R1GH 3FMGH 4TVPE 4ODWB 4APQC 4PRHE 2YN3A 3VCLB 1DQLH 2A6DA 2DQEL 4QNPF 4PJ5A 3V4UL 3QRFM 4XX1E 3RKDD 3RWGA 2YRZA 3HG1A 1IMHC 4PJIE 5B38G 1RURH 4H0HB 5E4IA 4YHPB 3D3VA 2AJXH 5I30L 5J11B 3CFCH 2HVJB 4NRZB 5DUML 3BKCH 4XTRD 1VFMA 3GB7B 4X4YB 1CDCA 5I8CA 5LVEA 4F33A 2BNRD 3JWOC 3WKMH 4HBCH 3VFPB 3CDFA 4OCLC 5FYKH 4LSVH 2DF3A 3ARGD 3NAAH 4YR6A 5CZVL 5IOPA 4X99A 1UM6H 2L0DA 4LHUD 2PTTA 1X6LA 4NOFA 2VZ3A 1EFQA 1XGQA 3REWA 5E94B 5GJTL 4I2XB 5FDWB 4PG2C 1RVFH 3GSNL 1I4FA 3C2AL 3D2UB 4NNYB 1CD8A 4JN1H 1JGVL 1U3JA 2BDNL 2C3HA 5HGBA 4JLRA 4XPAH 5GRUL 2XYCA 2D7OA 5D7IF 2A6JA 2HFFA 5F8RC 3FT4B 1KOAA 5ICXB 3RWJA 1WF5A 2F74B 1VPOL 4W81A 2HVKA 3QUKB 1JWUA 4YC2C 4N0UA 4WTXA 2EH7L 2HT4C 4MSWB 1ES0A 1X5XA 3P0YH 5BVJB 3WJLA 1R3LB 4P5TC 3AU1B 3OPZH 4G8GA 1FRGL 3UTZA 3SBWC 5SWSD 3RIFF 5T3ZD 5KAQF 1NDMB 4C59B 1NFDF 3WFHB 3KXFA 4NWTL 2X4SB 4LPTA 5MI0B 1MH5B 3SGJA 5KSVB 3NGBC 2DLFL 4OI8A 4JPVH 1AGDA 1RUQH 1TETL 5GS3A 4DZ8A 3H9HB 5E6IC 1R6VA 1T0PB 4U1LB 4LLMA 4Z7WA 4MCZB 4WHTB 5HGHB 3U82B 4E0RB 1JNHB 1OF2B 5F9JA 3QFDA 4Z7NF 4RMUA 3HRZB 1OT2A 4ZFOL 4XZUA 2FECI 1HYSD 1I1AC 1M7DA 3BRDA 3LV3B 4HXAL 2XKNB 3OKNB 2VLRE 2V5YA 3HC4L 1GC1L 3ARDA 1QPXA 3NPZB 3TH2T 1CQYA 4R4NC 5C0DA 1Z9MA 2R2EA 2NYYC 1OL0A 4WDIB 3H9ZA 3N85L 4GW4A 2HJFA 3BKYH 8CGTA 2DKUA 5IMOB 1S7TA 4HUUA 2VO5A 2FGWH 4P2RA 3T4AA 1JPTH 3MLWL 4LIQL 1LO5B 4K7PL 5MENB 3UDWA 4OLXL 3VWKC 1E28B 1VFAB 2UVEA 1HXYA 3QEGL 3NPSB 4M3KB 3U7WH 1BQSA 4AL8H 4RSVA 4JHWH 3KPRA 5I8EA 5I0DA 3UBXB 1NBYB 3KYMA 1Z0MA 1AJ7L 3DVIA 4KPHL 5I2IA 1KG0A 2R0LL 5ID1A 2X05A 1TJGH 3LEVL 4IRSB 3CXDH 3LOWA 4MJIB 5I1CH 4O51B 5ENWB 1XF2B 1I7RA 1LEGB 5E7FA 2YD5A 5LCVH 3SJVD 2J8UB 4Z78B 5T1KA 2G2RB 2VE6B 1EXUA 1HN1A 2IG2L 3I02B 5B22A 2J1KA 15C8H 1DBJH 4Y4KB 5FYLD 4HIHA 1F58L 3S4SG 3QNXB 2D9CA 3LN5B 3O4LE 4HWBH 2FD6H 4HUXA 3VH8G 2CJUL 3GSVA 2AJZA 3RU8H 4MAYA 2RAMA 2VZVA 1HKFA 1KJ2A 1VENA 3RZWA 4P57A 1U8LA 3I50L 5E00A 1PYWB 4EDXA 1BZ7A 4Z8FL 1TPXC 5F1IA 5FHAL 1GPOL 2WANA 2K7PA 1Q0YH 4F7MA 5C6PB 4X5WB 4E9LA 5C71A 4LLDA 1OGTB 1F6AA 3ZTJH 4N8VG 3MCG1 2E7CA 3UTPD 2AEPH 1VFOA 4FTVB 1WCQA 3LQAH 1FGNH 1LDPL 3T0ED 4NQVB 4W4OA 1LO0H 1VGKA 4K94C 1NCAL 4WO4C 4NCC2 4TUOB 1ACYH 5F7WC 3BP7B 5TDOA 4ZFGL 1XGTA 5F8QC 2D7PA 3EOBB 2LVCA 3SO5A 3L95A 1AH1A 4XWOC 5IM7A 3C08H 4F2MB 1UCBH 3NCYP 4L8CB 3O4LB 2CIIB 4MS8C 3GO1L 3HR6A 1T1WB 4CMMA 4ODXA 5T3XH 2DL2A 4N68A 1DBAL 4D3CL 2Z8SA 1SY6A 4U6YA 3WCYA 3O45B 2IPUG 3BP5A 4PS4L 4JANB 4ORGB 4PV8B 3O4OC 2EZ0D 5IT2L 2NY1C 4MNQB 1U3HD 1VKXA 5GRYA 5MHSD 1YJDH 4WV1C 4QRQB 2EIZA 2ITCA 4Y5YB 3S34H 1JHLH 2WBJD 4OGYL 1GGIH 3GMNA