1OAZH

Ige fv spe7 complexed with a recombinant thioredoxin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
122
structure length
122
Chain Sequence
b'EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN 1
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 21
structure length 122
sequence length 122
chains with identical sequence J
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oazH00
1W0VA 4GG8A 5BS0B 2DLHA 2AJYH 3V6OC 4O9HH 5CD5D 2M2DA 3NCFB 4WVRA 4ODVH 5EDXA 3NCCB 3NH7L 5TGBB 4PRPE 1Q9WB 4G6KH 3X3GH 5CZKA 3UTSE 3ILQD 1BOGA 1YEJL 2H2PD 1N5AA 5JIKA 3X17A 3MOAL 3QDAA 3CSYA 1P84K 2HFFA 3BEWA 4N8CL 4HKXB 4LPVA 4PJ5A 3OXSB 2AK4B 4QHMB 3S88H 1EBAA 4L29B 1JGDA 3P4LA 3GO1L 4F7CA 4XNYH 1A6WH 3HAEH 5BW7A 2EC8A 4JG0L 5EO1B 5ICZB 4DVRL 1C8PA 2FZ3B 1XF1A 1CU4H 3QEHB 2ZUTA 5ETUB 4GRMB 4LK4A 4Q6YA 3C6LA 1E6OH 2DF3A 4X0KB 5EORH 1A2YA 2P8MB 2RFXA 5BOZG 1V7NH 3MPCA 4J3WA 4F57L 3QDME 4PV9B 3ARBD 3VXTB 4ORGA 4YUEL 1DLFH 3B4NA 4HUKB 1ZA6B 3JV6A 3DUUB 5I0ZA 3LRSA 5DZNA 1I3RB 1OQXA 2AEWA 4GKZB 3ARYA 4YXKL 5DJ2A 5M7QA 4WUKH 4Y4KA 4PP1C 3WYRA 3G6DH 3KPRB 3S37X 1MFDL 5ESAA 5I9QB 4UT9H 1ZHKB 1ERNA 1C08A 3TBYB 2VWEE 4KKBD 2JCCA 1YYLL 5ILTH 2A2QT 1QLEL 1YC8A 5IBLC 4DW2H 4ZOEA 5GS2H 4BKLB 1ND0A 3ZTNL 2IMMA 5DO2C 2EYTB 4K8RD 2JIXD 4R0LB 2X5PA 3FTGB 2IGFH 5FYKL 1S9XB 2P43B 4G8EB 1E4XI 5DWUL 4J6RL 5HYQB 4P23A 2YOCA 4H5SB 3U1SH 4ZFFA 3PIQB 2NTSP 4K3EL 1N6QL 4DK3A 4N0CC 4YAQA 3QRGL 3KPSB 4DZBA 5I1EH 5IJVA 3QFJD 3A0OA 3OPZL 1S3KH 2F58L 1MHEB 1EVTC 4RGNE 5E94B 3UX9B 3SDAC 3L95B 4HJ0C 2OTUA 4YHML 1U8NB 4JO3H 2P5WB 1FHGA 1NEUA 3QUML 3MACL 3RWJA 1QBLH 2OXGA 3UDWC 2VZOA 3EOBA 2Z4QA 3E3QC 1CXHA 4QRTA 2V5TA 4NRYA 3FMGL 4D2NA 4J3TA 4LSVH 4JO2L 2D31B 2ICWI 5I8KL 4JJ5A 4XMLL 4YNYB 5DDHA 5CD3B 3UTZB 4EI5A 3SGJA 4GRLB 4WTWA 3RZCA 1PZ5B 1QSFB 4MXVE 1IGML 4G8GD 1NC4A 3F12B 4Z0XA 4JFFD 3HUJF 3O11B 5IB5B 5GRUL 1PKQE 4RGOL 4EJ1C 4DGIL 2E3VA 5E2UH 2NXYB 4JFOA 5FM5M 3TZVD 1GGIH 4HUXA 4JHWH 1I9JH 4F8TA 2EDEA 3BT2H 3IFLH 5D1XC 4V1DE 3FONB 3L7FA 4YDVA 2H32A 1UWXK 3CVHB 5FYJL 4PR5B 1A5FL 1D5MB 2X4PA 1NCWH 3ZZ1A 3S34L 4R9HA 1NBQA 5AAMA 2VISA 2AJZA 1GGCL 4MB4A 3BKML 2NLJB 4PY7B 1G6RB 1T0PB 3IF1A 1NGYA 3V5HB 3GZKA 1H8OA 2PO6B 4D0DA 3ARBB 3IDIA 2LTQC 3VFOA 2YXMA 3L3GA 3M07A 4NQXA 4QRQB 4PJAA 3WXWH 4GKSA 4PJ9A 4L4VD 1DUYA 4AIOA 4FQJL 3LN4B 5IV2A 1A1MA 3R1GH 4PGCA 1BECA 1FIEA 4FTVD 1F5WA 2R4RL 1HH9A 5JXED 1GC1H 3EYFA 1CG9B 3S3PA 2VLRD 4RWHA 4HWBH 4PG2C 3OSKA 1CDIA 1N6UA 1RZFL 1WT5C 2R1YB 4Z5RB 3H7BA 2OR7A 2AXHA 4QHKJ 5FO7B 4JO4L 3VG9C 4NWUH 1JTTA 2PR4H 4LKCA 2JIXB 1Q9KA 1TJGL 2VKXA 3LKRA 1NBZA 2DICA 5E2VL 5I75B 4P57B 2Y7QB 4QY8B 5JQHC 2FBJH 4I77H 3ZDZE 5ESQA 3HMXL 2D3VA 4R4FL 5BO1L 3QFJB 2WQRA 1KIPA 4HC1L 1B4RA 3DMMD 4NQVA 3B5GA 4M61B 2GITA 2I9LA 3ZYZA 2AQ2A 5FGCB 1Q0YH 3SDXA 4MDIB 2H1PH 3IXTB 1CYGA 3IAQA 3TIEA 1LD9B 2P5ED 3ZL4H 3B9VA 2AJVH 4PJHA 4Z76A 5F7UA 3H9HA 4WTXA 3U0TB 2ATPB 4HUUB 1X5YA 1J12A 3GHBL 3UJTH 1HHKA 4C83A 2R2HA 4X6CB 1G7HA 4NWTL 2BERA 4I0PA 1D9KD 5D2NB 1WTGT 5E8PB 4PLKC 2FLBT 4RISH 2BVPA 4KJWC 4Z0BL 5EO0A 5TE6H 2F19L 3QEQD 3QO0B 1QFPA 2XN9D 1EDQA 4JFFB 5TE4H 4QHNB 2HVJA 1EHLH 3HNVL 2MFNA 1I8MA 4YDJA 4YHKH 3OKMB 2DYPD 4GXUM 4G42B 4MJID 4X6EA 3TZVB 3OKEA 4MNHA 4K7PL 5B39B 3HAEG 3CVHH 3DSNA 4ERSL 1MWAB 2Q8BL 3QQ9D 2ZUXA 5F7YC 4X80H 3L1OL 2FRGP 4R2GC 2E9IA 5KANI 1BJ8A 3N0PB 5E8EB 4NFBA 4ZUVB 4X4YB 2QV2A 3HNTL 1ZGLB 4G6JL 4GMTL 5DRXA 3MLZL 1KIRA 4QOKA 5K9QG 3L3DB 3VXUE 1KCUH 4M7LT 1RK1A 5FGSA 4NBZB 1X44A 3UPCA 4ZXBA 4UU9B 1OD7A 2GUOA 3MZGB 3KHQA 2EE6A 5I15L 3LDBB 4NC0B 4K71B 1AC0A 4FQIL 2P48B 4BZ1H 3FRPA 3RL1B 2W0FB 2A73B 1OF2B 1GJIA 5IP4A 1JPTH 4LEOA 3GMRB 2GJ6A 1JHLH 2Q1EA 4Q97A 3BX7C 4CKVX 5DHVH 4U1LA 5HVWA 1A9BA 1SBBA 2BHUA 3HI1B 2Q6WA 4APQA 4GKOA 1OTTC 4S10A 3UTTA 4FP8H 2D7MA 5T1MA 3LD8B 4HQQH 2PXYD 2Q76A 4J3OC 1G7LA 3EYQD 1AHWB 4HWNA 1QTYT 5EFIB 4L4VB 1NLBL 3P73B 3WHXB 4PJEE 4P2OC 1QPPA 4FTVB 5CBAB 4TSBH 4U7MA 3BGAA 3N85H 5F9JB 1UG9A 3IJYA 3ROLB 4P9HH 2CO7B 3TN0A 1U2CA 1J1OL 3VFGL 2DWEA 3RQ3A 1QFUL 3P3YA 4M6NL 1I8IB 4I2XE 4IOSD 2Y06H 4MSWB 5B21A 5JW4R 4JZJA 3NFNB 5D7KE 5EU7E 4U6HA 2NZ9D 2W59A 2ZUVA 5AYQA 4A2MA 1A6VL 4BQBA 1IC1A 1E4WL 4Y19A 3IVKA 5ID1B 5E8DL 3MBEC 5T3ZH 4K9EC 3UBXB 1YPZE 3VXSA 1GPOL 3MFGB 4BQ8A 5JIPA 1X5ZA 4LL9A 3AB0C 3MV9D 2JK5A 4AM0A 4H88L 1KPVA 4M7ZB 3QXWA 2GCYB 5IQ9A 1WIOA 3V0VA 1FG2B 3QZWA 5I30L 4LOUD 2ZSVA 3EJJX 3AXLA 4FFVC 1SEBA 2FEEL 3KXFA 1E4KC 5DUBB 1CFQB 2P5EB 1KYOK 4KTDL 4JFED 4Z7NF 1DFBL 1J10A 4LFHD 1N5YL 2W60A 1HXYB 2IAND 4RFOH 1I7RA 1FZMA 4HK0B 3DBXB 4YPJA 5EG6C 5L2JB 3KWWB 3OV6A 1D9KB 3CFBB 5BCAA 3ORJA 1MCOH 4OUOA 5E4EB 3WFHB 3CMOH 3QAZC 4LPYA 2FCBA 5E03A 1F4YL 5C09E 5CP3H 1J5OL 3WFDL 2YR3A 1MWAH 4AG4H 4RX4D 1DN0A 3QFDA 4Y5VA 5CP7B 5AZ2H 4ZMAT 3O3AA 3A67L 2RJMA 1YEKL 3O0RH 3VGDA 2DYPB 3OR6B 3CC5B 4MJIB 5E2TL 3EDFA 3VU2A 4ZFOB 1N59B 2C5DC 5D71H 5TE7L 1QA9B 4LSSH 3MSPA 2Z31C 3RBSA 2ZUUA 4N9OB 1H3PH 3P9MA 4PP1D 4Q9RL 3MLTA 1HILA 3IGAB 3X13B 2NY3C 2OMBA 3H3PH 2C1PB 2J8HA 3NIGE 1AR1C 2XQYG 3SPVB 4B53A 4MX7B 5IBLD 2CDGB 2WLZA 2EXWC 3MV8B 2YZ8A 1I9RL 4YR6B 4P46D 1RQ5A 1CFBA 5IMMB 3PHSA 1HSBB 2XWJA 3OJMB 2E9JA 4XX1G 1U8QB 5B38G 1QFWH 1NL0L 4OI9A 2LFGA 1F3DJ 3KLAA 3T3PF 5CEZD 2AXJA 2HJKB 4OZIE 3FT4A 4LNRB 1B2WL 5D8JL 3T3ME 3FFCD 1IM3B 1KJ2L 5D5MA 1KT2A 2AKRB 2BVOB 2PXYB 3BEVB 1FNGB 5CILH 3RU8H 4MA1B 1G7JA 3QNZA 3SDAD 4N0UB 4HJ0D 1KNOB 3MUZ1 1MRDH 1IARB 4S11A 3ALXA 4EBQH 3MBXL 4HS6B 3DRQA 4ZNEE 1HQRB 3JBG7 4JM4L 2EYRB 2VKWA 3S3SA 4D94A 5FO9B 5I74C 4AIXA 3IDNA 3PWNB 1MAKA 3O3EA 4MA8L 4Z7VF 2IPTL 4QTIH 1HNGA 4NO2B 1X5IA 1YEHH 4QXGH 3HZMB 3BUTA 5DFTA 3WL9B 1OCWH 4UTAL 2X4UB 4IDJH 3BZFB 1KTKE 4JDZA 1LK2B 2VZUA 1QSEE 1VADA 2CR6A 3T0EC 5HPMB 3MV9B 1OP9A 2HFGH 1LK3H 5BVPL 1TVBA 4OFVA 1UZ6F 1BEYH 5HGHA 1P1ZB 2VE6B 3W5NA 1D6EA 2W9LA 4D9RD 1NQBA 5F1IA 4KK5C 3SGKC 3V6ZB 4X5WB 4YHNA 4KXZH 1NAMH 5D1XD 2VDRH 1DQDH 1NFDA 4NHUB 2VXVL 4C55A 2AI0L 1R6VA 4ODHH 3ETBF 5KOMC 1YN7A 4JFEB 5F9OL 1DL7H 4XNQB 3S7GA 3U7YL 3AM8A 3QDGA 2IANB 5AUMB 1L7TH 4KDVA 1R5IA 1NPUA 1TITA 4LLQA 3GBMH 4FZEH 2AEPL 4WHCA 1DQTA 2IADA 5C0BD 1JN6A 1B88A 2ICWB 5C0FA 4WO4C 2MOVA 3PABA 3ZKMD 1XCQA 4EDWL 5J13C 3HG1D 1NCBH 1OB1B 1QRNE 2ZWLT 1NDMB 4Z7OF 5EU5B 1LO4L 4M7LL 4HS8H 1SYVA 3ZE2F 2QBWA 3CDFA 4NDMB 5EIIB 2DIAA 2Y07H 4S0SD 5EA0L 2IFFL 3WFEL 4BSJA 5GJTL 2VTFA 1CFTB 4JQXC 5TF1L 1QFHA 4OCRL 3O9WA 4PJBA 1TJIH 4ZUTB 3UYOD 4M6OL 1VCAA 3VFTA 3TA3C 4M1GL 4H0HB 1BBDL 1RK0B 5J4MA 3NIFE 3ARTA 2EE3A 4ELMA 1DP0A 3P9LA 5HGGS 4KK9C 4P46B 3P0YL 5GRVK 1EFXA 3EOAA 1FVDA 5C0EB 4JCLA 3H9SE 2E7LC 3D0VA 1WAAA 4FQPA 2PKDA 3OKKB 2GJZA 3NN8B 3AY4C 5CJOL 2RIKA 3IU4L 1FGNL 5MHSE 2MKLC 3VMNA 3NTCL 5C08A 1MAMH 3A6OA 3VG0L 2PYFA 4MNGE 3FFCB 1U6AL 1I1YA 4UINH 5T1LB 1ITBB 3S36L 3SDAB 1SJEA 4PIRF 2ATKA 1OGAE 1KCSH 2VR5A 4C56A 5CJXC 4F7MA 2SEBB 2EO9A 1D5XB 3VGBA 4IMLB 3IDYC 3BRDA 1V7ML 1WBZB 5E9DD 4EDXA 1KN4L 3AC0A 4U1HA 4OLEA 1WUNT 5IT2L 3SGEH 2HMIC 1LO2L 1ZXQA 3HR5B 5KVFL 3HZKB 1XT5A 1PEZA 5E70A 4PRDB 4PLKD 1G1CA 4OGXH 2VO5A 1ODAA 3EYVB 4QHKI 1E4XH 1BF2A 3L3HB 4PGDB 1IC7H 4Y2DC 4U1NB 4GXVL 1N8ZB 1EEYB 4U1IB 1TCRA 3TFKC 1VFAB 2UZXB 2P42B 4AEHH 2KH2B 4HULB 3GSVA 5BMFL 2P47B 2GY5A 1T7ZA 3HNSL 4DK6A 5JNYA 4JFYB 4J8RB 1C5CH 2AQ3A 2V2XA 1E6JH 3WSQH 4M62H 3MLYL 5F93C 3HLAB 1JPFA 1T2QH 3D39E 4LPXA 4FQLH 4R2GD 3CXHK 4PB9H 1I8LA 1HHGB 5B39G 2GAZA 4Q9BA 4PRPA 4CL7A 2CD0A 5CJBA 2YEZA 3BPCB 4G6MH 5C0JB 1SBSL 3FT2A 1YEIH 5C0BB 1L0XA 4ZD3L 4QRPB 3GMOB 1AO7D 3QNXB 3X12A 4JFQB 1ZOXA 1IMHC 3TV3H 3JWDL 1W0WB 4KHXL 3FQXB 3T1FA 4OFKA 3CH1B 5DZOA 5MEPB 1T7WA 1JTPA 1UWXH 4BFIB 3DV4A 4RDQG 4WCYH 2LTQB 1QBML 1IZKA 5TQ0H 4CADA 1DBJL 3STLA 3O2WH 1R3JB 4P2QA 2D9CA 3K8KA 2FIKA 4NCDA 4NQTA 4ZAKA 4RZCB 2Q3AA 3NGBB 5I18L 1MCLA 3QG6A 5DK0B 2X10A 3DO7A 1UB5B 4OLVH 4MJ6A 1FO0A 4AL8H 4CU6A 5DHVA 4HXAL 1NSNH 3IU3A 4PG9B 4FNLH 1DLHA 3HHRB 3WNLA 2JJSA 1RUMH 4NCC1 5I73C 4WIQA 1NCAH 2FD6L 3N1QC 3IT8D 2H6PB 3K8MA 4DWHA 4JFZL 2L4OA 4M03A 1FNSH 5I1CH 2IPUK 3AMLA 2J8OA 4OGZA 3EZ8A 3NACH 3RUGF 1U8JB 3BKCH 3MBED 2ADGA 4RAVA 1JF5A 3VWKA 3B3IA 5HJ3B 4PRNA 1HHJA 5T3XL 2FX7H 1QNZH 2NMSA 3DARA 3QIUC 4GBXA 2DBJA 2W9EH 3O3BA 4LLDA 3HRZA 3D2UA 4L3CA 5JHDD 5DJCA 2DJSA 2AEQL 4HV8B 4NC2B 5BXFB 4L8BA 1BVKB 1J0KA 1LEGA 4JRYE 1B6UA 1XR8A 3SOBL 3MLXL 1IGTB 1NFIA 5E9DB 3MA7A 5D7LD 1A1NA 2DQHL 1KJMA 5EZLA 4NQCD 4X7TB 4LGSB 4PJCA 2R1WB 4ZDHA 1CBVL 4IJ3B 3TT1H 3HC4L 5T33L 1PEWA 3KGRA 1H0DB 3W82A 4JVPA 1CFVH 1Z9MA 2IQ9H 5HYJA 1NC2D 4OZHB 3UO1L 1T3FB 3T77B 2D7OA 3I50H 4ZYKB 1CDGA 4MXQD 1ZEAH 3SDDC 3W0WA 1QLRB 1OAZL 4KPHL 5D70L 1EHNA 4F8QA 3VW3L 5DD5H 2YBRB 1BD2B 4HIEA 1J9CT 5FFLA 5HYEA 3K2UH 1J0JA 1NEZA 4WHTA 4LLWB 1G7IB 2DQDH 3D25A 4WI8A 5BS0E 1U8LA 2HLFC 2UZIL 4HGKC 4U1MB 15C8H 2QQKL 4DCQB 5C6PB 2Z31D 1JBJA 3U46B 3VRLE 4N5UA 4R2GB 2NY3D 4XVUD 4XP5H 1KN2H 3DOSA 4U1GC 3VXRA 3ARDA 1AR1D 4IRZL 4OZ4B 4YHPA 4I0KA 3V95A 3BP6A 1CI5A 3TNMA 1WCQA 5IESL 2EDWA 4GAGL 4XBGB 2EXWD 2M8XA 3HE6C 4JPKH 3VFSB 2DBLH 3DYOA 1KCRL 2AK4E 3T4YA 4JM2B 1H3WM 5KVMC 1AO7B 3VH8B 3LQZB 4O2CA 3G5VA 5DJAB 3SO5A 4JN2A 4M4RA 5JUEL 4HWUA 4QRSB 4X99A 4XVJH 3TC9A 1GCFA 4I4WB 1PYWA 1F6AB 2FB4L 3OJVC 2AK1H 1BZ9B 1OT2A 3P77B 3RWGA 1S7QB 3LKNB 2EIZA 4JDVA 1UH3A 4LEXL 5GGSB 1JPSH 4M5ZL 5C86A 1YZZA 4FFYL 4G5ZH 1DE4A 2CR3A 2X42A 1M71A 4JZNB 3LN9A 5DA4A 4NQSA 3KPRE 3OB0H 2ZUQC 5ADPL 1C1EL 2YSSB 3O41B 1AD9A 2QQLH 3F62A 4D0BA 4IRJC 2OP4L 1JHKL 1RZJC 2Y72A 4OF8A 4R7NA 1F8TL 1BQHB 1F58H 3HC0A 3MJ9H 3L3JA 4XX1E 4G7YH 3U36A 4JG1L 1MQKH 1NLDH 3KYOA 2J4WH 3QYCA 1FFPB 3SE3A 1ZT4B 4WY7L 4NZJA 5FK9A 2A1WH 3DRTB 2E6JA 4X5LA 4IBLT 3FN3A 1UXWB 5I17B 4JN1L 5IFHL 2F8XC 1FN4A 1URLA 25C8H 1MHCB 2EICA 3UPRA 3T0ED 1B4JL 4RMQA 5CSBA 3H9ZA 1V8HA 2R29L 4W4OA 4WFFD 5CKAA 1UEYA 3KPSE 1JZ2A 5CSZB 2VR4A 4WU7B 5JO5B 4OKVB 5JHDB 3AREC 4KK5D 3RY6A 4U33A 5F88A 1OOAA 1OAUL 4RA3A 3K2MC 3MV11 5KSBA 4N90D 4LHJB 1HXMA 5HHOA 3OJDA 4NN6C 2P5WE 3O6FA 4KH2A 1XCTA 4Z77A 2EKSA 5TDOA 4K3JH 1ZT1A 4HXBL 1SY6H 4J3UA 1JVKA 3CAFA 3DHMA 2RQ8A 1FGVL 3HPJB 2VAJA 3DWTA 4HPOL 1MCJA 1NC2B 1FO0L 3C60D 1WIUA 2LU7A 3IETB 2H41A 1BGXH 3MC0A 4LFHG 2GKIA 2X89A 1CF8H 1NAMA 5EZJA 1S9YA 1RZIB 1UJ3C 4WO4D 3TO4A 1Z3GL 3FAXA 4QT5A 2J6EL 1QSFE 1GGYA 1QKZH 4AMKH 4LGRB 2H8PA 5JPNB 2X9YA 2X70B 3VRJA 4F58L 5KSAB 4G6FD 2X4NA 4ZPTB 2BY2A 2R0KH 4OCSH 3RIFK 2Z91A 1RIVL 3GSXA 4IIQA 2NY3B 3F7RA 3QIBC 3RJDA 1P7QA 2KKQA 4JRXB 5J3HC 2B20A 1UH4A 3TA3D 3BH9A 3JWNC 4MVBC 4Z95H 5E1HB 2B0SL 5DD1H 5JR1L 3VXQB 5KS9A 5IHLB 3ISWA 3VI4F 4KK9D 4OM1H 2QQNH 4YPGA 3GM8A 4M6ML 1J0HA 4BQ6A 3TVMA 1DDHB 5SWQB 1OSZA 3W9DA 3HZYB 4ACPA 2I9TA 4JKMA 4TNWF 4ODWB 5DEZA 5LKNA 4OF6A 1TZGH 2XICA 5ITFA 1KEMH 1LVEA 3SKMA 1ACYH 1M05B 3PDDA 1RIUL 4FA8A 1PQZB 2E6PA 3SJVA 5D7JA 4MWFB 4NYLB 3CK0H 3MJ7B 4FXKB 1NCCH 5KSUA 1EZVX 3BZ4A 5IB1B 1ORSA 4P3WA 1SJVA 3BWUC 3GSNB 1DEEB 1AXIB 1YNLH 4LF3A 5EBGA 2P44B 1VGKB 4X6DF 5E1AB 1L0YA 4UDTB 5EU6A 3FO0H 4H25B 4XVSH 1WCBB 1WEJL 4XP6L 4EN3D 1VKXB 2NTFA 3MO1B 2HMID 1A7PH 1CIUA 5FYLD 4TUJA 2G9HA 3U82B 1Q9OB 1DANU 1OAXH 3EZJB 2H3NB 5INCA 5DD6A 5E6ID 4Y2DD 4YFLI 4PJIB 5DTFA 5J57B 5EBMB 12E8L 3G6JF 4UIMB 3BPNC 3T0EB 3MUY1 1Q72L 4KVNH 4G9FD 3TFKD 2BHZA 2VDQL 2F8VA 3IDGA 3MV7D 3QFJE 3EO9L 3L7EB 5T3ZE 5DJ6A 3IDXH 1M7IA 1YQVH 1IGJA 4JFPA 3CUPA 3W9EA 5FGCE 4L4TA 1U58A 3PWLA 3GK8L 1LE9B 1UKQA 1GH7A 4YHOL 1AH1A 3KPLA 5I19L 3OF6D 4LCCB 5DS8A 2BNRD 1RZKL 1MCCA 2W92A 1A7OH 1O0VA 1LO3H 3EGSB 3VRIA 3C8HA 2BOBB 3QI9C 4JHAH 3ZKNC 5CMAA 3ULUL 1XR9B 2WZPD 3C60B 4X6CE 3CFEA 2AJ3B 4OD2B 3KYMB 3WUWB 4KDWA 2IAMD 1A7NL 1RUKH 1JV5A 5D2NE 1YYMH 4DZ8B 1H8SA 2OK0L 4NKOB 5JW4M 3ULVH 2A0LC 2ITCA 1FLTX 2A6IA 2D03H 2J1KA 4HEME 4PGEB 4RFNB 3RUGB 1R3HA 2VDLL 4JFFE 5FEBA 3MLVH 4XPFL 1FVCA 5I8OL 1CWVA 2CIKB 4JPVL 3VI3E 4G6FB 4OLWH 1R3LB 1KGCD 4MMZC 1QYGL 3DVGA 4WI5A 1MELA 2C4XA 3I75B 4E5XB 1KELH 2UWEF 3AFLA 3TO2B 5HHPA 4OSUL 3T2OA 1NCDL 1OGTA 2R23A 3LS4L 2GT9B 4J1UA 1EJOL 3UYRL 3DX6A 2RCSL 2GI7A 2YK1H 3ZHLA 1EK3A 5CJQH 2KZWA 3TYGH 1T2JA 6FABL 1V3LA 5EUOA 1KTDA 3P0GB 3W5MA 4CBPA 3O6MH 3U0PB 2LAAA 3CFJB 4XC1L 3O3DA 3PP3H 3QPXL 2VN4A 3KLSA 4LVNC 1I3VA 3FHAA 3H6JA 4TVPL 1D7FA 3ECBB 5ADOL 2A83B 5BVJB 3H0TB 3BHBB 3CMGA 4YO0B 5C0CA 3FO1A 1A4KA 1ZK9A 1HEZB 4PTUB 4XAWL 4GW1B 1HZHH 4L4VE 4L8SA 5F1SA 3BESR 2LABA 3NCYP 2VWEC 4GLRI 4FTVE 4X4MA 4NQED 3NFPB 5K59E 3Q1SH 3UROR 1U8PB 2A9NH 3RHWK 4EN3B 2F53A 2W65A 3ZO0A 2MCG1 1NAKL 4KVCH 3EHBC 2WM0A 3SQOH 4ZNEA 2EYSB 2X09A 1XGRA 2EIDA 2OBGA 4I48A 1BVLB 5IGXH 1FAIH 5IF0B 3O3UN 3BDBA 1MCKA 2O5YL 5CHNA 2BNQA 5E6IB 3O45B 4Y2DB 5IHZA 2VDMH 3V52L 1S7VB 2AVGA 3V6FB 1BQUA 3L5WA 1HDMA 4KRPD 4PJXB 4QRUB 4OLXH 4OBSA 4HKZB 1R24A 1X3DA 1T0MA 4G9FB 3QUZC 1TTUA 3MOQA 1HWHB 1QEWA 4S0TD 3V0WH 4RGNC 1RFDH 2EDYA 4H1LA 3MV7B 1SVZA 4KZDL 2C3XA 4NNYB 5I1GL 5A16A 3L3KA 4PJGF 3CCHB 4JDTH 1UZ8B 2Y36L 2DTMH 4OF3A 1SYSB 2IQAB 2Z93A 4ZO8A 3OKDB 2PUQT 4LLYA 4UILL 5IB2A 2VXSH 4QO1A 3BDXA 2P5EE 3T0DA 2W9DH 1UWGL 3GRWA 4XCFH 1I7TB 4XC3H 4RNRB 3TNNA 3NABL 5FKPA 2IALA 2F74B 3QUXC 5DJXA 2WUCH 1U93A 4BH8B 3EOTH 5BZWA 5JW5A 4HJJL 4F2MB 4GXUN 1G9NC 2IAMB 3RL2A 4IRSA 4WI9A 1T5XB 1XGTA 3RJQB 4X9HA 3TBVB 4FQCL 5F8QC 4S1QH 1I8KB 1PG7X 4G8FA 4HPYL 4P5KB 1FJ1B 3STZA 2CLZB 1CR9L 4PJ8A 1FFRA 2V6HA 4GG6A 3KJ6H 5KVGH 1I9IL 2UUDH 5DQDL 5CEYB 3VH8G 4Z7UF 2ZOKB 4LPUA 4WV1B 5GZOC 4S1SL 4MJIE 5EC1A 4OJFL 5E8OB 4QRRB 4YHZL 1E28A 1MLBA 4PJ7B 4K23L 4R6UA 1RULL 4TYUA 3DX7B 5GGVY 5DFWH 3MRLB 1BPVA 3RTQA 1JCKA 2VLLA 3MQIA 4IRJD 2P24B 4Y16C 1Q1JL 4FQXC 4ZOAA 5I1HL 3QUYA 2X9WA 4JJHA 4XZUA 1G7PA 4TRPH 3KLHC 4N5ED 2AXFA 3MV8E 3BP5B 3HFMH 4HIHA 5BJTA 4I8DA 3PV6B 1BQHG 3QJFA 1RUQH 5GRZA 3FOLA 3E2HB 1DBKL 4NO3B 2DQJL 4M48L 4LHUA 2X4OA 1T20B 5ABDE 4KROD 2NY5H 1ZLWK 2O5XH 3NMEA 5DQ9A 1QD0A 2GY7B 3ARED 1KV3A 3WO4C 5D2LA 3KNBA 4UV7L 1JF6A 4N0UE 5J1AB 1T83A 3P4OA 1C5BH 4HDIB 1I85A 5EBLA 1D5ZA 1KLFA 4MNQD 4NQEB 1SEQL 3DVNB 5FYLH 2ZSWA 1CQYA 4BZYA 1UM5H 3DI3B 5B8CA 3BGFB 3IS0X 1UKSA 5GGUB 4HFWB 1IAOA 3MR9B 1S9KC 4QTHA 2LAGB 1JZ6A 3PQYA 1HH6B 4UT6H 4MXWL 3WS6C 4NM8L 4B7LA 1A0QH 3ARFC 5HHXL 4U1KB 1U8IA 2DLFL 2Z0BA 3QCVL 2C3VA 4L5FL 4F7PB 2GSGB 2QKIA 5EULV 5DGQA 2IH1B 1FG9C 5ALCH 4RAUB 1U36A 1H3XA 4KRPB 4DJMA 5FA4A 3ABZA 1H3VA 3MV9E 3SDCA 3TEUA 3KPQB 2I5YL 2OTPA 3LN5B 4OD3L 3PL6A 4PJDB 5D1ZA 4ZFZB 4U0RC 1MRCL 2R1XB 1R5VB 1XH3A 3L3OB 4AZ8A 4HIXL 3NZ8A 1EV2E 1QLFA 2HTKC 4G3YL 1U91A 4U6VH 2HRPH 3QIBD 2ORBH 5E5MA 5FUOL 3CFDA 5J3HD 4LCWD 4X6DB 5I1LB 4WI4A 1X4YA 2GW5A 4JFEE 4UOJA 4LRNH 4LASH 1INDL 1S9VB 3LQAL 2IANE 3RDTA 5MEND 4G80B 2ENSA 4G9DB 1EUTA 3HC3H 2ARJA 4X5XB 3W39B 1UADC 4R96A 2GK0A 1KJVB 3NA4A 2ENYA 2UYLA 2B1HL 4U6YA 4YBLC 5AYUL 4TSAH 1AI1L 1T1YA 3CLEH 4O02L 4OIIL 1WJ3A 3BW9B 2OSLB 2HG5B 4X7SL 3WN5A 2DQEL 1UXSB 1MVFA 2ZZUT 4EVNB 3QDHA 4OCXL 3GM0A 4H20L 4NN5B 3AS2A 3CFKB 1TETH 3RNKA 2OM5A 2ESVA 3MREA 4MMXC 4J3SA 2VERN 3I02B 4YHYB 4KWUA 1CIDA 1J7VR 1T21A 1OAKL 1DQLH 1EBPA 2XWBA 2EIEA 2BY3A 5JOEA 5IW1A 4DN3L 3C6LC 4HG4K 4MXVF 2J3SA 5HD8C 3GRWL 2ICCA 3VFRA 3VFMB 5BV7C 1CVSC 1J05A 4TQEL 5TFSL 1G9ML 1N4XL 3MROA 5J6GB 5JHLH 3CPLA 4GUPB 3HE7A 1JGEB 4WDIB 4Y4KC 3N06B 1KACB 2NPLX 2F9BT 1SJHA 4KROB 2C26A 1A6UL 2ZCLH 1FVEA 2X4TA 2A6JA 3IJSB 5K9KB 3NPSB 3FFCE 2B1AH 5EIVA 2OI9C 3OAUH 1MFEH 1XF5A 4Z7QE 4E0RB 2VIRA 4WW2A 2V7HB 2YMXL 1ZS8A 5EBWA 1W8NA 3T65A 4R26L 5F9WC 2Q8AL 3DGGA 3U4EB 4KAQH 1M6OB 3OX8B 3QI9D 4P2CG 3ZKND 3AAZA 4P23C 2X1WL 2G2RA 4HUVB 4Y4FB 1AJ7H 1AKJA 3V4PH 1GAFL 1UJ3B 1AGFB 2APTA 3REWB 1TZIA 3LIZL 2A0LD 2AEIT 4KJQC 3WUWG 4JANA 3TBWA 1CN4A 3HPLA 1U8MA 5D72H 3EO1A 3MGTB 1QVOB 1CFSB 3JVGA 4P5TC 5KSVB 1BLNA 3G5YB 3FO2A 3UTSD 5F70A 5JIHA 1XGPA 5C07A 5GGVL 1F3RB 4ZQKB 4JFDA 1VPOL 1A9EA 3VGAC 3BN3B 4D9RE 3IFOA 4TPRL 2R4SH 4X6FB 5D1QD 4UV4L 1CD1B 3QIBB 4W6XB 5BS0A 2HFEB 5JW3H 4EI5C 4LCWB 3QUKB 4KK8C 1UT9A 4Q6IC 1LDSA 1IAKA 3OAYK 3DROB 2XZAH 1XZ0B 3GSOB 5E99L 4XPGH 3WHE0 1MUJB 1YEFH 2V5MA 5KW9H 5MENB 3BQUB 4KGLA 4KUZH 2JJUA 1NBYB 2N4IA 3BRGC 1FFNA 4PRBA 2DQUL 5E0QA 5ITBL 1IL1A 3VXNA 5C0RL 2DLEA 5C0BE 4DAGL 4QRPE 3OXSA 1MQ8A 1JWMA 1T22A 2VDPL 5B3JF 2IG2L 4GAJH 4OLUH 1JNHA 5CZVL 1MOEA 4Q0XL 1ETZB 4KGJA 5F6HJ 4FQQA 3UTQB 4GRMA 3WDHA 3M17B 5F9DC 2P8MA 3BIKA 3B9KA 2O5ZL 4JO1H 3X11A 3NVQA 1CXIA 1SHMA 4LSQH 1RJLB 1ZWIA 3CX5J 5F6IC 1L6XA 2ADJB 1HYSC 3I9GL 3E6HA 4KHTL 1KLUB 2CRZA 5EPMA 3BKYL 3I6GA 4X6BA 4Z7NE 4LIQL 4OI7A 3O8XA 3RVUC 2HWZL 5TPWH 2P46B 3RA7L 4PS4H 5J6HA 1B0RA 1P4BH 3BN9D 5GPRA 1U92B 4ODTH 1JFQH 3EAKA 2BFVH 3VFUB 3KYKH 2IPUG 5DI8A 5HDQL 4PJ9C 4ODXB 5C0AD 1WITA 2ZP0T 2XXCB 3MRJA 1BM3L 4KQ4H 2EYTA 3QUZD 1I75A 2DM3A 4RGND 3EJYD 4R0LA 3WBDA 3MCLL 4OB5L 3V79C 2APVA 7CGTA 3PWVB 5C0NC 1U3HC 4ZS7H 3QULB 1I7UA 1DBBH 1CS6A 4G8IB 2OR9L 4H5SA 1F90L 1FL3A 3PIQA 5E4IA 5GRYA 2ICEA 4NUGH 5DHYB 3KPSA 4XVTH 1RV6X 5IM7A 5E9DE 3U7WL 1IJ9A 5DJYB 5HHQA 4XHJD 3IDJB 5IHUL 5E08H 1YEGH 2AJXH 3ARRA 3P11H 4XCCL 5CGYC 3M1BA 3QUXD 4XWOC 3I6KA 2BRRH 1FSKC 2R0ZH 1S7XB 1AR2A 3LKOA 4OZHE 2FSEB 4KFZC 1ORQB 3QWOA 4NFCA 2AS5M 35C8L 4QHLB 1NFKA 3R4DA 4I3RL 1NMAH 1K8DA 1N2RB 1BD2E 4LSDA 4PJEF 5GGRY 1LP9A 5GIRB 3R0MA 1EMTL 3LKQB 4HUWB 4DKEH 1DVFA 5GZOD 4RQQB 5I0DA 2BOCB 3SE9L 3F12A 3C2SA 1UVQB 4DVBA 5IUSA 3OGCB 4QCIB 1G9MC 2W0LA 1A4JB 2YD7A 5DJDA 5DVNA 3A6BL 5DJZB 3L5IA 5D1QB 3FB6B 4F9LC 1Y6KR 5FYKD 4CMMB 5LGHL 3DIFB 1TCMA 2EEDA 4NT6A 1CLOH 4K94L 5D6CB 4LRIC 2V17L 4FQXD 1IAIM 3BSZL 1I4FB 5LAXB 1FIGL 4KRLB 1YN6A 1TMCB 2HT2C 3ILPB 4OM0L 5GGRA 4MA7H 2FEEI 1YPZF 4TULL 2HVKB 3IDMA 1QQDA 5L9DL 1BAFH 4CN1A 1AO7E 2X1QA 3SCMA 1RZGA 4OQ1A 1S5IL 3FB5B 5DMKB 4OTXH 4LVNB 3Q6GH 3PHOB 2R2EB 4ZTPL 4JHBA 2HH0H 1JUFB 3KYNB 1UKTA 5DGRA 1T80A 1RUAH 5ICXA 3WJLC 1G6RA 5F7DB 1K4DB 3DX9A 1H5BB 1IC4H 3PGDB 3V5HA 3VFVA 3TBSA 2NY2B 1J1PL 4MA3A 3SY0B 4CVZA 1MHHB 2CO6B 3PP4H 3P30L 1LGVA 1U3ZA 1W72A 4F37K 4LNVA 3WNMA 2BDNL 2PCPA 3JTSB 3KJ4C 1C12B 4LVHC 1IAIL 4XB8A 4ZUWB 3U9PL 3BWAB 4YDIH 5FOBA 2ZG1A 4CRPA 5JQ6L 3PWJB 4NZRL 4XCYB 4MD0A 3GB7B 1FZJA 3V4UL 3ARFD 2VQ1B 2WWMC 2HT4D 3MYZA 3SKOA 3MMEB 4RFEA 3QG7H 1R0AL 3OHXA 3MJ8B 2WBWB 1FNEB 1F4WH 3KPMA 1EHAA 5FYJD 3UXFA 5C0AB 5L7XL 2FATH 1Q0XL 4ZSOA 5CEXA 3QUZB 2A74B 5EN2A 5C9JA 4TUKL 2XG4A 5BZDA 4DGYL 4JKPL 1OLLA 3W2DL 3MODH 5ANMA 4P57A 4S1RH 2AJUH 3VD5A 4Z78A 3NIGF 1B0WA 3TJHC 1AXSB 3TYFB 5DXWA 5JHDE 3ULSB 5IR1A 4GLRH 2AV7B 4LCYA 3PE9A 4F33A 5FUZL 1MREL 3DX8B 3L9RA 1M4KA 3KS0J 5IVXB 5SWZA 4ZOBA 3X3FH 4E42A 43C9B 3NPZB 4WJ5B 1OTSC 1U8HA 5HHNB 3UMTA 2R2BA 3OKOB 1FYTA 3QUXB 5ISZB 1OP5K 5IVZB 1KPUA 5DR5L 1R3KB 2IBBA 4YK4C 4G6AC 1MJUH 2F5AL 1YA5A 3TGXA 4OZIF 5J11C 2GQHA 5A1AA 2NNAB 2FGWH 1GHFH 3T3MF 2NY1D 1IM9A 5CUSH 1U42A 2ZCHL 2ZNXA 3DO3A 4QYOB 1CFNA 3FRUA 4LLUA 4PP2A 2BMKA 2FJGA 2ZCKH 3H3BC 4BJLA 2FDBP 5SWSA 1U95A 3MRFA 4MGXA 4I5BB 4PUBL 2CSPA 3FKUS 4G8GA 4PJ5D 2A9NL 1EGJH 4NM4H 5FHAL 5KTEH 1UB6A 4JFFA 4ONHB 4GRWH 1IEAA 3FT3A 4UTBH 4NO0D 4ZTOL 3VXUD 5ACZB 3NAAL 2CJUL 3WEXB 1QZ1A 3MNVA 1M7DB 4JRXE 5GS0D 4JY4B 3JTTB 4FQXB 4M5YH 4L8DA 1FZKA 4F3FA 3S4SA 1UCBH 1IGCL 3C6LD 1J0ZA 5HHVH 5EH1A 4NZUL 3SDYL 2F5BL 1OVZA 4HUNB 5HD8D 5IWLA 2N7AA 3D0LA 3I85A 1EAPB 4UQ3B 4YDKL 5T1KB 2PW1B 3HB3D 3M8OL 4KDTC 2QADD 3QUMB 4U2ZA 1DQQA 5MI0C 5EUKB 2MHAA 3SDXF 4OD1H 1WWBX 3JV4B 2IF7A 1F2XK 2HKHH 4NQUA 4FQHA 4Y4KD 1CGTA 3GSUB 3HZVA 1MVUB 3G08B 3EDKA 3LPGA 3KPPA 3ZDXE 4U1JB 3TH2T 5DUPH 5B3NA 4F15C 1CDHA 4Y5XC 1I1FB 4KMQA 5LGKA 3VWJA 3HI1A 1GZQA 2ED9A 1GSMA 1EA9C 3NH7H 3NOIA 1W2KT 1Z5LB 1XIWC 4MCZB 5C0IB 2EDQA 1NJ9A 1YEJH 1HHHB 1KIUA 1OM3L 5JDJA 4P23D 3MOAH 5CCKL 5AD0A 5C8JB 5CBAA 4N8CH 4NRZA 4D0CA 4UAOB 3ARFB 2VLRA 2YC1A 4HW6A 5DMYA 4U3CA 4R4BA 3WLBB 1L4IA 1A02N 2QEJA 1BZ7A 1VFMA 4R3SA 1I8IA 3U4BL 3GO1H 4PJIE 4JG0H 2Y6SC 4JGUA 4OFDA 4P5TD 4DVRH 3K80A 2JKXA 3T0EE 2G60L 5FGBA 1MPAL 4FXGA 4WFFE 2LVEA 5IIEB 3GMQB 5E2WL 3C9NA 1MFNA 2NW2A 1WBYB 2VDNL 4QLRA 5SV3A 4EKXA 5GSRB 4F57H 5JMRA 3UP1A 1S8DB 3AROA 5IBUB 4L9LC 4YUEH 3LB6D 3BGMA 3QNYB 4NGHL 3WNNA 4N90E 3JUYA 3MRCA 1P7KB 2XV6B 1G6RL 4EI5D 4YXKH 4HS3A 1I1AA 4EUPA 3DMMA 3DURA 3OGOE 2CMRL 1NC4D 3T0XA 2X4QB 4YX2L 4RRPG 1MFDH 1YEDA 2QL1A 1W72L 1Y6MR 1WTLA 1NCUA 4PGBA 4NSKA 1CE6B 3ELAT 1CFQA 2V2WA 1W0VB 2WIMA 4GG8B 4BZ2L 1YYLH 1Z0MA 1QLEH 2V9RA 3BP4A 5IEHB 2DB8A 5FDWA 2NY1B 4UT7L 4CDHA 2NY4D 4WI6A 4YIQA 3RVWD 3ZTNH 3KYAA 1J1XL 1Q9LA 4IOFC 1W0YT 4XPTL 3RUGE 1BFVL 3CFBA 4RMRA 1N5AB 3WXVL 4PB0L 3CSYB 3BEWB 3QEQA 3MXVL 5FYKH 5HDBF 2RAMA 3BH8A 5DWUH 4J6RH 2XN9A 4PJ5B 1VEMA 3VDAA 1KB5A 2YD5A 4K3EH 1N6QH 4K8RL 3VD9A 3QRGH 1JGDB 1ZLSL 5JORA 5DFVC 4NO0B 3OPZH 1ONQA 4F7CB 2F58H 2B2XL 4N9GA 4MJIA 1T89A 4MD5A 4DQOL 1HYSD 3IJHA 3O6LL 3IFNL 4YHMH 3R06A 4OKDA 3C6LB 4PBXA 3QUMH 3MACH 1A2YB 2RFXB 3RVUD 4YH6A 2RR3A 2VSDA 3FB7A 4H26A 3WKML 4ORGB 4MAYA 4V2BA 4F7EA 1ZHBA 2XPGB 2Z92A 4DUWA 3JV6B 5BV7B 3OMZA 2AXGA 3FMGH 2QADB 3SPVA 4X9GA 3LY6A 4PJ9D 1ZGLM 4JO2H 2R69L 5DJ2B 1X5HA 5IEKA 5FHBL 1LO0L 5I8KH 4XMLH 4Y4KB 4YR6A 4UUJB 2VL5A 3BUYA 3RNQA 5HVHB 5H2BB 1IGMH 1MAJA 1DQML 5C0ND 1U3HD 1U8QA 3F7VA 5LCVL 2YKLL 5GRUH 3CFCL 1EPFA 4RGOH 3C5JA 4DGIH 1A21A 1M1SA 5F6HI 1T1ZA 1ND0B 1IT9L 4LNRA 5MEQA 1DUZA 3HUJA 2V2TA 3T09A 2VRAA 1UQSA 4DKFL 4PJFA 3B5HA 1RD6A 2YUXA 3FQWB 4AT6A 3FQNA 4JY6A 4POUB 2OJEA 2X05A 5CGYD 1WC7A 1GC1C 4P23B 4K3GA 4GKNA 3C5SA 5FYJH 1A5FH 5SV4A 5FYLE 4YAQB 1NGWA 1EAJA 4DZBB 5IJVB 3S34H 5INDA 1WFUA 5EC2B 1KFAL 2DD8L 1MFCL 2JELL 4L1HA 4PRHD 2V5RA 3LRGA 1GGCH 4LBEA 1ACZA 1HNFA 2CDEA 2OTUB 2XFXA 3DSFL 3BKMH 2VZTA 3PGCA 4LAQL 2VJXA 4P5TB 4PJXE 4YEEA 4P5MA 1RUPL 4G9FE 3RWJB 3WL9A 3EOBB 2Z4QB 3MV7E 2AP2A 1X5FA 3PF2A 1NUFA 4QRTB 4BFGA 1F4HA 4NRYB 5A2LH 4M1DL 1A3LL 3V6OA 5HVFB 2FHBA 4EI5B 5E24E 1P1ZA 3RZCB 5JW4N 4FQJH 1MJ7L 2BHYA 4HH9A 1NC4B 4Z0XB 2R4RH 1K6QL 4OGYL 3PNWB 4Y88A 3F7YB 4B41A 4JFOB 1RZFH 4GRLC 5F96L 5D96B 1IGFL 3ARPA 2B7DT 4HUXB 2NY4B 4XP1L 5AUMA 4JO4H 3L7FB 4YDVB 2NXYC 2H32B 1TJGH 4GQPH 4X7EC 5E2VH 1I8LC 5DK2B 2X4PB 2AGJL 1P5VA 3OAYH 4J4PA 3ILQC 1KGCE 3HMXH 4ZXBD 4QRRE 2VISB 4QXWA 2AJZB 2MSPA 4PJ7E 4R4FH 5BO1H 1PLGL 2DN7A 4HC1H 3TT3L 5FCUL 1IRAY 2NCMA 4KUCD 1VEOA 3VA2C 4LQFL 3IF1B 1NGYB 4RMSA 3S6CA 4X9BA 3SHSA 2IH3A 1I3UA 2WWMD 3IDIB 1IQDA 4JRWA 3VFOB 3GHBH 3L3GB 4WWKC 3O2VL 4NQXB 4PJAB 5C7XL 5MHSD 3ARGC 4GKSB 4PJ9B 3BD3A 4NWTH 5MP6L 1DUYB 1NGZA 3P0VL 2CKBA 1S7TA 2FLRT 2PO6C 3CDGA 2EH7L 3RWCA 5IV2B 1A1MB 4O5LL 4U05A 4Z18A 5ESVA 4A6YA 4Z0BH 2F19H 2FJHA 1HH9B 3HN3A 3EYFB 3VRLF 4Y0GA 3TN0D 3IRPX 3H7BB 3T8XA 4OF7A 5JXAL 3OL2A 3HNVH 3RPIA 5TH2A 4LPTA 4ZG1A 3DI2B 3VD4A 1RY7B 1CL7L 3DYMA 4K7PH 4LKCB 1KB5L 4ERSH 3RX7A 1Q9KB 4OFYD 1PJ9A 3LKRB 1NBZB 1OTSD 3MRRA 4LCUB 4Y19D 2Q8BH 1ZLVK 3L1OH 4EOWL 2MCPL 3VXSD 4P9HC 1FSKB 3HNTH 3MNZB 4G6JH 5ESQB 4G6AD 4GMTH 4K8RC 3MLZH 4L9DA 4DTGL 3UDWA 4UDUA 4FG6D 3HI6L 4ZNCD 5I75C 5F7EL 4M02A 2FNBA 1TVHA 3NZHL 4NQVB 4PRHB 5GZNC 2X4RA 2I9LB 3GJFH 4N68A 3IFPA 5I15H 3SDXB 4FQIH 1MJJA 1G1YA 3TIEB 1OSPL 1JNLL 1FZOB 3EFDL 4Z76B 3QQNA 3O4OB 4GSDL 4HF5L 3D39D 4LMQE 3P4MA 2GTZA 4PJDE 4ELMF 1CVRA 2D0GA 1HHKB 4MLIA 4C83B 3JWOL 1G7HB 1CLYL 4I0PB 1QHPA 4FXLA 1MLCA 4PTTB 1VFAA 3MRIA 4UIKL 3FQRA 2HKFL 2BVPB 5EO0B 1NLBH 5IMOA 1JPST 5DRZA 4NOBA 3U48A 3PWPA 1AGDA 1P9MC 4X6DE 5K9JL 2DQIL 3KPNA 5D1XA 2HJLA 2JF1A 4B0MM 1CK0L 2HVJB 5D2NC 3NFSL 1BFSA 1EGJA 3MLWL 4RMTA 1I8MB 4YDJB 2ZG2A 1J1OH 5IK3A 1S7UA 3VFGH 3PXJA 4ONFL 4D9QD 1QFUH 5GSVA 4X6EB 3OKEB 4M6NH 4MNHB 3RAJL 4XXDA 3C09B 5FIEA 4POYA 2DRUA 4BM7A 3PDOA 2ZUSA 3AMKA 5HBBA 1A6VH 2BY1A 2NZIA 2YPLA 3GSRA 4LSUL 1E4WH 1IEBA 2DS4A 5C0BA 1NBVL 1JNNL 1NMCC 5E8DH 4HK3J 5DRXB 1B0GA 1KIRB 1OLZA 4G43A 1JGVL 1ED3A 1GPOH 3HG1A 8CGTA 5HTSA 2WWKO 4LAJH 4F7TA 1RK1B 1KC5L 1PSKL 2ERJC 5D7SL 4ZXBB 1YNTA 4P4RA 4OUUA 4H88H 4BFIA 3ZYJA 3QSKB 5F97E 2GUOB 4H8WL 5I30H 1XIWD 3U83A 3UTPE 3Q48A 2WIIA 4LEOB 2GJ6B 5HVGB 4Y89A 1WWWX 1ZLUH 2GK2A 4U1LB 3OB8A 1A9BB 3LDBC 4K2UL 4KTDH 1DFBH 2Q6WB 1WFOA 3QIWA 4NN7B 4APQB 1N5YH 3LAFA 5IMLA 2Q76B 1VFBA 1WT5A 2VABA 1G7LB 2XWTA 3SE8L 5H94A 3BI9X 3MCKA 1MY7A 1MCBA 3Q5TA 3GI9L 4KK6C 3LD8C 4TSCL 2FR4A 1AHWC 3IJYB 1AC6A 3TN0B 1F4YH 2NX5A 3MRGA 1J5OH 3WFDH 5TQ2L 3FCTA 2DWEB 4HAGA 1KPRA 1MRFL 2AAVA 2ITDB 3A67H 1YEKH 1MEXL 2YRLA 5E2TH 4JZJB 5JXEC 4U6HB 4PV8A 3QPQC 3OWEA 3MGOA 5TE7H 1K5NA 4Y19B 2CH8A 3R8BB 4GQ9L 3IVKB 4Q9RH 1GGBL 2A9ML 3PJSA 1BVKA 3VXSB 1K9TA 4YK4B 1IGTA 2JK5B 1Y0LA 3A6CL 1YY8A 5KVDL 1KPVB 4AM0B 2ADFL 3IKKA 1CE1L 5IQ9B 1WVZA 2ZOLA 5DC9B 5H35A 3QZWB 3RY6C 1I9RH 1K8IA 2ZSVB 1EEQA 1T7YA 3AXLB 4A2LA 4BFBD 3GMPA 1SEBB 1LEKA 3KXFB 2VAAA 4M7ZC 3H2WA 1NL0H 5L6YL 2CKBL 4RMVA 1LMKA 3WV0A 3GSWA 1TTFA 3MUGA 4LDEB 1EEUA 4A6YL 4I18C 2W60B 3QDGD 1B2WH 4IEFB 1I7RB 1FZMB 5D8JH 5C70A 3VJ6A 4JQVC 1A1OA 1KJ2H 5DFVD 5E8NA 1INEL 3CH8A 5CEZL 4M6AA 5T3XD 4DCQA 2J2ZA 4LCWE 4MDJA 3D18A 2AK4D 1D6VL 3MBXH 4LSRL 2FHFA 1DN0B 3GJEA 3QFDB 4JM4H 2BSRB 4Y5VB 5HYFA 5E4EC 5MENE 3ZSSA 4X98B 1MH5A 4UNVA 3CD4A 4M7JL 4HBCL 3J7HA 4Q9QL 3AS1A 5GGSY 2XACC 4MA8H 2IPTH 3FN9A 4MJ5B 4HIIA 2DIJA 3P9MB 4ODUA 3MLTB 1HILB 1I1CA 2GFBA 2BXYA 3O9WD 4Z7VA 2MMXA 3SO3B 2XKNA 4UTAH 4QXTA 4U6XA 4E41A 3QQ9C 2D4DA 2ZUYA 3U9UA 3RP1A 5KBNC 3KPRD 3EYSL 1ZT7A 5BVPH 2DKMA 2AERT 1BZ9A 1CGUA 4NKMA 4X6CF 2XWJB 1X5GA 4ELKB 1RJYA 2VXVH 2AI0H 4P2OA 3KLAB 3FT4B 5C08D 5F9OH 3T1WA 1LDPL 1O7SA 3KHOA 3O4LA 3U7YH 4YGVA 3I2CL 1KT2B 5D5MB 1QBAA 5LBSL 1G7JB 3QNZB 3PHQA 1QO3A 2AEPH 4XNUL 2HP4A 2XNAA 2DM4A 1WZ1L 5ICYA 1G0YR 2ZPKL 1X7QB 2PXYC 5MEOA 4EDWH 3EYQC 5DJ8A 3R0NA 2CGRL 5I17A 1J8HA 3MBEA 4UMGA 4Q7DA 1LO4H 2NY7L 3TJEL 3GUTA 3TIDA 4M7LH 2P5WD 3IDNB 3O3EB 3D48R 5H37G 3DUSA 1X5AA 5EA0H 3JZ7A 2IFFH 3WFEH 5A43C 4HMCA 5GJTH 5JHDA 1KLGA 1K3ZA 4X4ZA 5TF1H 4NPYA 1OAYL 2VQTA 4OCRH 5AWNL 4JDZB 4RDQF 2NZ9C 1VADB 3OXRA 4EQ2A 1E4KA 4YFEA 4M6OH 3BKJL 5D7LA 2L0DA 1TVBB 5GGTL 4M1GH 1BBDH 4NQCA 4P9ML 1D6EB 1F4AA 5F1IB 3UC0L 3IB4A 4YHNB 3P0YH 1NFDB 3GDBA 2BCKA 1ZVHA 2NXYD 1LO5A 1CTNA 2WAHA 3GIZL 3RWHA 1YN7B 4KC3B 5CJOH 3IU4H 1FGNH 1K3IA 4LOUC 4MCYA 5K59F 3NTCH 3QDGB 3CXDL 1T4KA 3JUZA 1R5IB 3VG0H 4XNXL 4LLQB 1U6AH 4XCEA 3TCLA 3H9YA 3S36H 2IADB 3MRNA 1JN6B 5C3LD 4ZPTA 5C0FB 1RU9L 3PABB 1XCQB 2Z31A 2LV4A 1Z9LA 4O00A 4NHCL 1V7MH 5J1TC 1KN4H 3DVIA 3GHEL 1T04A 1A7QL 4HIJA 5IT2H 1EO8L 3LKSA 3HMXA 2HRLA 1LO2H 4WWKD 5KVFH 1YNKL 3ARGD 2CRYA 4P59L 4P2QD 5HGAA 4HC1A 2YXFA 4JREC 2UZYB 2JB6A 2PO6D 5AEAA 2ZJSL 2QSCL 3EYUL 3G5ZA 2WP3T 4DN4L 3HS0A 3EYOB 4I0CC 3O9WB 3BE1L 4PJBB 5TJWK 3WDJA 3K4ZA 4M43L 4NNXB 4GXVH 3VFTB 2CUHA 4K7PY 5JTWA 4ELMB 5M94B 3LS5L 3P9LB 5BMFH 4UQ2A 3HNSH 1EFXB 1V3JA 3EOAB 1FVDB 1G7QA 2R0WL 5JPMA 1M05A 4CVXA 3D0VB 3MLYH 2Q7YB 1PX4A 4WI7A 2K9UA 3HI5L 1HYRC 3SGEI 2GJZB 5B38B 2G5BA 5GXBB 3RWFA 2J8UA 4FMFA 4P46C 4N8VA 5C08B 3FN0L 4GBXD 2PYFB 1BP3B 2VZ3A 1X9QA 1HIML 5GZND 1SJEB 5DRNA 1WBXA 1YY9C 2ATKB 1SBSH 4C56B 2Q87A 2QLVB 4HZLA 4L8SC 4F7MB 5C0AE 4ZD3H 3AU1A 1Q9OA 1ZV5A 5CWSA 5T3ZD 4EZMA 3K3QA 4EDXB 4C57C 1RJZA 1BHGA 1MCNA 1ZE3C 4U1HB 2WSKA 3JWDH 2HN7A 4KHXH 5CLWA 1SM3L 5KS9F 3QA3A 5EBMA 1YEEL 5HDLA 2E27L 3T0EA 5HYJD 1QBMH 1DBJH 2F8OA 3GJFA 5IVXE 5KJRL 1GIGL 2EDRA 4ODBD 4R8WL 3SGKA 4HT1L 2Y25A 2VZSA 5I18H 2WINA 3QEGL 5I1IL 5ISZE 3LSOB 3GIVA 4HXAH 4XMKL 3MFFA 1H9VA 3GSVB 4WGVB 5JNYB 2V2XB 5LJYH 3RY4A 2FD6H 2AABL 1P4LB 4JFZH 2VXTL 1RZ7L 5GRJL 2YD8A 3VFWA 4WTZA 2A38A 3Q6FA 3VXRD 4XXCC 4WO4A 2DL9A 2CLVA 1FL6A 3RIAK 5T3XH 3ZTJH 1UM4L 3WJJC 3RUGA 5ENWA 2B5IB 3MNWA 2YEZB 1RAMA 3AS3A 1CZ8L 1UYWL 2CRMA 4IHOA 3FT2B 4IRSC 4UB0L 5FYKE 5C0DA 4K9EL 1H8NA 2AEQH 5DD0L 3X12B 1PD6A 4JQXA 3LEYL 3SOBH 3MLXH 4M7KL 4JPWL 1I7ZA 2YD6A 3DV4B 3FL7A 2DQHH 2XA8L 3TO2A 4D9LL 5HSFA 3FRPG 3E6FA 2D7TL 5KVEL 2XT1B 2I07A 3RWEA 4P3CL 4CADB 1CBVH 4KZEL 3HC4H 4WWKB 5T33H 5T5FL 3ZKMC 2NR6C 1ADQA 3TA3A 3ARGB 1T2XA 1NMBL 4P2QB 1T03L 2FIKB 1WGOA 4ZAKB 3UO1H 4GO6B 4L3EA 5K93A 4JVWA 5LG1A 4KK6D 2YD1A 2FO4A 5IW3A 3QG6B 2E7LA 1OAZH 32C2A 4KPHH 4PFEA 3DO7B 1FO0B 1T6VN 5D70H 5DHVB 3VW3H 5IBTL 3IU3B 1PW3A 1FDLL 3AY4A 1QPXA 3S35L 3QUYC 1DLHB 3NGBC 4TN9A 4N0FB 1BBJA 1S7WA 3KPOB 3QPQD 4HKJA 2UZIH 2QQKH 5BVJA 3H0TA 2C1OB 1A7RL 5CJXA 2ADGB 4RAVB 5I8CA 3Q0HA 3VWKB 2WUBL 3B3IB 4PRNB 3UEZA 1HHJB 4P0DA 1JI2A 3RI5K 4IRZH 4GBXB 2XTJD 2VLJE 2Z8WC 2JB5L 3O3BB 4LLDB 5IESH 3HRZB 2JTDA 4GAGH 1CLZL 1AGBA 4L3CB 1UACL 3QO1A 1FLRL 5DJCB 5IW6A 1WICA 2HLAA 3BDYL 4YXHL 1KCRH 4L8BB 1E27A 5FYJE 1LEGB 4HWZB 1KEGL 1XR8B 3QWRD 1X4ZA 4N1EA 1I85C 2A6DA 4XP9L 5HHOD 1NFIB 5B3JE 1MFAL 1A1NB 3QZWG 1ZLVH 1KJMB 5EZLB 3U6RA 5JUEH 4UZGA 2FL5B 4PJCB 4ZDHB 2FB4H 2FO1A 4UNTA 4YC2B 4QRUA 4KQ3L 4P2RA 5HYJB 5EUOF 3UAJC 4EI6B 4LEXH 2X89D 4M5ZH 4RMUA 4FFYH 2R8SL 3TO4D 4IJ3C 4TVPD 3W0WB 1H3TA 2DDQL 1FYHB 3WNOA 3G9VA 3S37L 4DKAA 5ADPH 1FPTL 3BZDA 3OAZH 1C1EH 3OF6A 3MRKA 5HXMA 2BNRA 2CRIA 1OAQL 3AS0A 1NEZB 2OP4H 1JHKH 3GSNL 3D25B 1KJ2A 2Y5EA 1U8LB 1F8TH 5DMGD 2VB5A 2DQGL 4JG1H 4KY1L 1DBML 4F80A 3BXNA 3Q5YA 1FFQA 4N0YL 2CLRB 5EB9A 1MCFA 4JGJA 4Z7QF 43CAB 4WY7H 5HI5C 5F7NC 4K7FA 1P7QD 5GRVL 4D8PB 3VXRB 3WFZA 1NMCB 3ARDB 4R97C 1KSRA 4JN1H 1MCPL 5IFHH 1UA6L 3BP6B 5F7KC 3OR7A 2CLZA 4UI2A 3TNMB 1M7XA 2E5EA 1B4JH 4PJ5E 2ERJB 2R29H 4XPBL 1MCWW 3V6BR 4KI1A 2OL3A 4KJYA 4PRID 3T4YB 2D7QA 1B9ZA 4JPIA 3KS0H 5KAQG 5J12B 1OAUH 4O2CB 3TVMD 5C6TL 3G5VB 5DLML 4JN2B 4NUJA 3MV8D 3F7QA 1U8KA 3MLUL 1PYWB 1LQSR 1QFOA 3T2PA 4JM2C 4YXLL 3OB0K 5DJ0A 4HXBH 3RWGB 5GJSL 3WN5C 1YMMA 2EIZB 4OI8A 4JDVB 1FGVH 1NCNA 3SJVD 5DUML 3H3KA 2C3HA 4HPOH 1FO0H 2MWCA 4L4JA 3GBLA 1M71B 4TTDD 4NQSB 1Z3GH 5EU6D 1EEZA 4Z7WA 5F1NB 1AD9B 2J6EH 4D0BB 1DZBA 4FS0A 1E0OB 2VDKL 4FABL 1UM6L 1IKNA 4LLMA 4R7NB 4F58H 3HC0B 3L3JB 3UJIL 4HZAA 3QIUA 3U36B 3L3IA 5CFHA 3KYOB 4WUUA 1S7RA 5IROC 3QT2A 1RIVH 4FFZL 3QP3A 2K7PA 4D3CL 1FN4B 1WWCA 2D9QB 1MCWM 4NNPL 3UPRB 3QH3A 4NQEA 2XTJB 5EIQA 4OGAC 2B0SH 4X7FC 1MI5D 5JR1H 2OZ4L 3OZ9L 2F54A 5GGUA 3S3JA 4AIZA 3MR9A 3MLSL 5F88B 1WZLA 5J56B 3SKNA 1KOAA 5KSBB 4OCWL 3VXMA 4L4TD 4M6MH 1HXMB 4TTGA 1ADQL 5HHOB 1KF9B 3OJDB 1XCTB 4Z77B 1T1WA 2EKSB 5TDOB 3SDDA 4JZOA 4I18B 3VGEA 4LLAA 1FNLA 5ID0A 5DYOA 2PTTA 3QRFM 3C08L 4XTRD 1KCVL 3MV01 1RIUH 5GHWL 4NQDA 1T1XA 1XFPA 5EZJB 1NAMB 1U8OA 4WW1A 3T4AA 4HX1A 3ZT7A 1AQKL 3TO4B 1Q94A 1F00I 5GQBA 4QT5B 3BAEL 3GMMA 2EH8L 2H8PB 4XCNB 1VACA 4Q58C 1TPXC 3ZTJG 1TTGA 2BK8A 4YBQD 3JXAA 4AEIL 4MXQC 3VRJB 1WEJH 4XP6H 3LKPA 3ALPA 1H3UA 4OZFH 2X4NB 4I3SL 2P49B 1Q38A 1JI1A 5DK3A 3WIHA 3HE6A 5IMKB 2JJVA 2Z91B 4E9LA 3VXPA 3GSXB 4IIQB 5KSAC 3UJJL 1P7QB 5J0BA 3ULVC 1HOCA 5ALBL 3QQ4A 3WFCL 2O61A 2V5YA 12E8H 1PBYA 3VE0A 3BH9B 5I66B 1Q72H 4OLYL 2P7TA 3QEUA 4QKXB 4TUOA 2FIRT 3LCYA 4XVUC 5KS9B 2VDQH 2CK2A 3G6JA 2C4FU 4PRIB 3LZFL 3EO9H 3ZE1E 3MUHL 5CINL 3TVMB 4OZHF 2PYEA 1ZA3A 1OSZB 1YDPA 3GK8H 3W9DB 5EOQL 4YHOH 3WD5L 1QR4A 5I19H 5GRXG 1RZKH 3QBTB 1ZVYA 3D9AL 2I9TB 4HWEL 5C71A 2CUMA 2EC9U 4ZFGL 3I02A 5ITFB 4XRCA 3SKMB 1ULVA 2K1MA 1YMHA 4P2YA 5A2FA 4IRJA 3SJVB 4NJ9L 1F6FB 5C0CD 1F3JA 3B8SA 3ET9F 5L88L 2YD2A 3ULUH 3DECA 5KSUB 1IFHL 1YY9D 3BZ4B 4PJAE 2IBZX 1A7NH 3B9KC 3QCTL 4LF3B 5F3BA 3TPUA 3T0BA 3N1GC 5IG7A 5EU6B 4O2EB 5T1LD 2OK0H 2F53D 2VDLH 3RGVA 4KKNA 4XPFH 5I8OH 5IQ7L 2R39A 1U2HA 4JPVH 5DQJB 2G9HB 4OCMC 5J06A 1L6ZA 1R5WA 1QYGH 2GHWB 2OYPA 5INCB 4RWYL 4UOW1 3AREA 2BNQD 5DD6B 4JM2F 2OL3L 5DTFB 3RVXC 1J11A 2DKUA 4OSUH 4JR9L 3SBWC 3T2NL 4MNQA 1NCDH 2UWEA 3LS4H 1O5DT 3IDGB 1EJOH 1MI5B 2X6MA 3UYRH 2YPVL 4IOIA 3CZFA 1TENA 2RCSH 2I25N 4LHQB 5DJ6B 1LEIA 1A6TA 1MCSA 4LDOB 1IAII 1CTOA 1TQCC 4PRHE 1M7IB 4JFPB 1IGJB 5I71B 4GW5A 3CUPB 1BFOA 5HYIA 6FABH 5KZCD 3W9EB 5L2KA 4L4TB 1U58B 3PWLB 3SDXE 3KPLB 4HH8A 4FZ8L 2MQ0A 5IB4A 3MRMA 3REWA 5GGQL 4XC1H 1IC5L 5FO8A 5CZXD 3QPXH 5EOTA 3VRIB 2MQ3A 4JFHD 4TVPH 1MCDA 5CMAB 3P4NA 4QNPE 5ADOH 4LCCC 1MF2L 2FWOA 3CFEB 4IRSD 1D5IL 1JV5B 1Q8MA 4XAWH 3C87A 4XPHL 1RVFL 3HR6A 1VGEL 2XQBL 4YHIA 4PJ8D 2ITCB 2A6IB 2WV3A 2ARWA 3C60C 4X6FA 5BRZA 3QIBA 1FVCB 1NGXB 4QRPD 3UZVB 1CD9B 1KULA 4OFPA 4LCWA 1XGQA 4C54A 1NAKH 2NR6D 4JREB 4RFNC 4P48A 5JZ7D 2ED7A 1J0YA 1JWSA 2XOTA 3EO0A 2OMNA 2O5YH 1FBIL 3RTQD 5HHPB 2DI9A 3V52H 1OGTB 4LU5L 4OZGF 5DZLA 1JHTA 4J1UB 3QUYD 1ES0A 1F42A 3PP3K 4MD4A 4NJAL 3DX6B 5HGDA 5L8KB 2V7NA 3NA9L 4KZDH 5I1GH 3KAAA 5EUOB 4PGJA 1KTDB 4GT7A 4JFXA 2Y36H 5J9PA 3M17A 3ALWA 4ETQA 3SCMC 3SQBA 8FABA 3O3DB 5J8OA 4PJGA 4UILH 2GJ6E 4S2SB 4OV5B 4HHAA 4LHUD 3DXAA 2Y5TA 4I13B 2C9AA 1UWGH 3GI8L 2AV1A 3NABH 5HDOA 5C0CB 3VFNA 1JMZA 3K46A 1UWEL 1SVCP 3FO1B 1Y6NR 4JLRA 1KCLA 5CIPA 4HJJH 5FB8A 4L8SB 2DMBA 3ULVF 2WK2A 4NZTL 2HJFA 3BOVA 4IMKC 3GSQA 3F58L 4FQCH 4HPYH 1F4XL 3WIHL 1U92A 1CR9H 1FCGA 2D2OA 3U2SA 2F53B 1I9IH 2W65B 4QXUL 3EFFA 5DQDH 3QDJA 4OV6F 5HDBE 2FJFA 2NY5C 3WFBL 3REVA 3UAJD 3PQYD 2FECL 1XGRB 4I48B 4S1SH 5DURD 4OJFH 4EN3C 5MERA 4RA0C 4Z7UA 4YHZH 4PLNC 5CHNB 2BNQB 3D3VA 4K23H 1RURL 1RULH 4Y19E 2CK0L 5I6XB 2E7CA 1HDMB 4Q2ZA 4HD9A 3OJ2C 4ZPVA 1R24B 3VXSE 1T0MB 4OLZL 5SX4I 3SDCD 1AXTL 1Q1JH 4H1LB 5I1HH 5E6IC 3IDJA 3PL6D 4V2CB 4YLQT 3L3KB 1BD2D 3ZDXF 3QI9A 5JDSA 1JGLL 3S5LA 3SN6N 5B22A 5KZCB 2Z93B 4BUGA 1NEZG 5HI5D 2XIDA 2EDDA 4ALAL 1BJMA 1RZJL 4LLYB 3KXFE 4Y2OA 5IB2B 4P3DA 5IFJB 3F8UB 2VYRE 4QHLA 3WCYA 2J88L 3TNNB 5FKPB 1DBKH 2DQJH 4M48H 2H9GA 2A77L 2IALB 5C2UB 2VITA 5DJXB 1N2RA 2UUDK 3RDTD 5BZWB 5JW5B 3RL2B 1RMFL 4IRSB 1XGTB 4YDLB 3UTSA 2P8LA 1V5JA 2VDOL 4UV7H 5I8EA 4AH2B 2B8OT 2BOCA 4G8FB 4U1SA 3STZB 3T08A 2Z35A 4PJ8B 5GS3A 2DI8A 4GG6B 3V2AR 5JA8B 1SEQH 3VCLA 1GL4B 2IAMC 4JM2D 1NGPL 4PJIF 2J5LB 2AQ1A 2KQNA 4BFEA 5EC1B 4D9QE 1FFOA 3O2DA 4ZOCA 1E28B 5JOPD 1MLBB 4MXWH 4NM8H 2BNUA 2YZ1A 5HHXH 3TWCL 2ESVD 2DLFH 3QCVH 2BVQA 4L5FH 4XH2A 5DVKA 2R0LL 4JEGB 4AYFA 3GNML 4WV1C 3RTQB 1HI6A 3K4DA 2VLLB 1JYNA 3EDDA 4PYHA 3F5WA 3QDMA 4OQTA 2Z8RA 1PFCA 1DQJA 3QUYB 1JZ8A 5DMKA 4XZUB 3C2AL 2V9QA 2I5YH 4H0IA 2OS7A 2AXFB 5IKCA 1A6ZA 4OD3H 2EECA 5I1AA 1MRCH 4HIHB 1UENA 5BJTB 1IBGL 4HIXH 3FFDA 4G3YH 3QJFB 1PZUB 4XGZA 3HE7D 3T0WA 2J6EA 5FUOH 1HQ4A 5D9SA 4LHUB 4WEMB 2X4OB 1S9WA 4OGAD 1QSZA 3MOBL 1INDH 2QJDA 5D5ME 4AEEA 3LQAH 5D2LB 1K4CA 3KNBB 2P8PA 4ZUWA 2FHCA 3E2HC 3SKUD 1X5LA 5DMIL 4XCYA 3P4OB 2V5SA 3HCVA 3J8F7 3VWJC 2VQ1A 1D5ZB 3GGWA 1WIPA 3CJJA 1KJ3L 3MMEA 4WEBL 2FX8L 2ZSWB 3V9FA 2EZ0D 2B1HH 5AYUH 2FYYA 3BJLA 4B7IA 5B8CB 4WFGD 1CDBA 1AI1H 1C7TA 5C0AA 4O02H 1IAOB 1JWUA 1GXEA 4OIIH 3MRQA 4X7SH 3GMLA 2DQEH 4PRAA 3PQYB 5FM5O 3V4VL 4U7KA 5DURB 3QXAB 1EO7A 5DD3L 2C3VB 3UTOA 4OCXH 4TNVK 3BGFC 4FQ2L 1YQ2A 4H20H 4J3XA 2QKIB 4H1LH 2XRAL 1GOGA 3D87B 3D69A 2WBJA 1VFOA 2YWYA 1C16A 5FA4B 1OAKH 3MYJA 4NRXA 3SDCB 4Q74A 4DN3H 5D1ZB 3PL6B 5C07D 1WQVT 5K9OA 5F1KC 1G6VK 4KRPC 3NZ8B 1VFUA 1X5JA 3GRWH 3OKYA 3V5KA 1QLFB 1MJ8L 1U91B 1CXLA 5KSAD 1MIEL 1NFDE 5EZOL 4Y4HC 4TQEH 2H26A 5TFSH 3ULVD 1G9MH 1N4XH 5E5MB 2WANA 4R97B 3CFDB 4YWGL 5DRWA 1CXKA 1PKQA 1ZHNA 4RIRA 2K7QA 5LXGL 4WI3A 2VLKD 3RBGA 2OQJA 4OZFA 3QDGE 3RDTB 1NUNB 1A6UH 4JRXD 5I1JL 4LSPL 2ARJB 4R96B 4V1DA 5KG9A 2GK0B 5T3XE 2BSTA 5DEFA 2YMXH 4ONOA 4ONHA 2UYLB 3BRFA 4U6YB 1FORL 1T1YB 2VN7A 4R26H 3C8KA 3HA0A 2Q8AH 3WN5B 4Y16A 4PJXF 1IQWL 4KTEL 3L5JA 2JLLA 5FUCE 4KKLC 4XPAL 4WFED 3B9KD 3B2UD 2J12B 3RNKB 2ESVB 3MREB 2RHEA 1YJDL 4I3GA 1GAFH 3I6LE 3LIZH 4PJBE 2PW1A 3RKDC 1T21B 5EUKA 5D7IF 3BP7B 2XWBB 4NN5C 5T1DL 2XZZA 2Y4SA 4CGTA 4JKLA 5IW1B 4YGAB 4MLSA 1CICC 5JW4Q 5I16A 4ELME 4YHYC 5F21B 3VFRB 5GGVH 1CXFA 2X1PA 1NDGA 1VPOH 3EOYG 1J05B 4U1JA 3MROB 4TPRH 1WAAE 2APFA 4UV4H 3S97C 3HE7B 4XWGL 2OX5A 2E7MA 2GTWA 4N5EC 3RVXD 1VDGA 3B2VL 2Q20A 5J89A 1ZVSA 5C08E 3FQTA 1FVEB 2X4TB 2A6JB 4K3DL 4ODSL 5FGRA 3UBXI 3WDIA 5HYSA 1X6LA 3MXWL 3MRBA 5E99H 2CDFA 1II4E 1XF5B 1AFVL 4WW2B 1G7MA 1KYOJ 2DQUH 1ZS8B 4C56E 5ITBH 3WS6A 5EBWB 5C0RH 2ED8A 4KROC 4DAGH 3O2DL 3OKLA 3T65B 3NPSC 4PJ7F 3IXAA 4J12A 4BELD 3DGGB 3UZEA 3WE6A 2VDPH 2IG2H 1IGYA 5CZVH 4HFUL 4Q0XH 4OZGB 5LQBL 3AAZB 1NCTA 4NKDA 2G2RB 1FAKT 4OQTL 4KTYA 4OAWA 4M93B 2A6KA 1T66C 2Q86A 3G5XA 1TDQA 1TZIB 4BQ9A 2O5ZH 3N9GL 3D85D 4JANB 4Y4FC 3TBWB 1TPXB 1U8MB 3DV6B 3EO1B 5J7CC 3K81A 4RBPK 2DMKA 1CL7I 2EDKA 3CNKA 3I9GH 3FO2B 3T2QA 1D3CA 5A3IC 4KHTH 5CAYB 1DVFD 1TQBB 5CGMA 1XGPB 3BKYH 5C07B 4LIQH 2X4QA 3FZUD 4JFDB 4O51A 2HWZH 1A9EB 5C0GB 3IFOB 3QHFL 3RA7H 3U0WL 1CGXA 2DQFA 5HDQH 3GKWL 5JIIA 4U0QB 2IPKA 2XZCL 1LNUB 5IEHA 1JF1A 3RWDA 1RZ8A 1IAKB 1XF4A 1AGEA 3QR2A 3Q2CA 1BM3H 2VLKB 4B50A 4CNIA 4JQIL 4BSWA 9CGTA 1JJUA 3LH2L 5EWIL 3MCLH 4OB5H 2YWZA 2BVTA 1FFNB 2NW3A 3IKCA 4PRBB 1IL1B 2EDJA 2BP3A 4NO5A 2OR9H 3VXNB 4DFIA 3GBNL 1F90H 3SCMD 4DOHB 1T6WA 3EKCA 5CJ5A 3L5XL 3RVVD 1JWMB 1T22B 3VXOA 3BQUC 1JNHB 3HTLX 1EZVY 1MCQA 4NO0A 3VXUA 3U7WH 1T5WA 1P4IL 1HKLH 5IOPA 5IHUH 4XCCH 2DJ4A 4FQQB 1YC7A 1CCZA 2ZKHL 3EBAA 4J4PC 4U31A 4P2QE 2WBKA 1TZHA 3BIKB 3B9KB 3ROOA 1MFBL 4PJDF 3X11B 35C8H 4LARL 2XPGA 1OW0C 1ZWIB 2KZ1B 3VMOA 4IDLA 2X7LA 4I3RH 5CKGA 3UCRA 1G9NL 5GISL 3E6HB 4MAUL 5EPMB 2L7UA 4X6BB 3I6GB 4AJ0A 1EMTH 3O8XB 4UUJA 3PXHA 2YUWA 5H2BA 4ETYA 1N64L 3SE9H 4PJEA 5J6HB 1B0RB 4O2FA 2I60L 4TOYL 4HCRA 2YHGA 1Z0NA 3A6BH 5DI8B 1RIHL 4M8VA 1T0NA 5C2BL 3MLPA 2ADIA 3K1DA 3P40A 5LGHH 1TNNA 3G04B 3MRJB 1DSFL 4K94H 2NYYD 2V17H 4Z8FL 3BSZH 3CSPA 3FQWA 4K7PX 1FIGH 4I2XA 4HGWA 4Y1AD 4XP4L 1I7UB 1IILE 4RGMB 4LKXA 4OM0H 1TQCB 3RIFF 1FL3B 3FOMA 4TULH 2D7PA 2ICEB 4H1LG 5L9DH 5SWZD 5EC2A 1YPZA 4Y5YA 5IM7B 3VFPA 1S5IH 5HHQB 4X7DC 2VL4A 2GSIA 3H42L 4PJCE 3MRPA 4ZTPH 3M1BB 1FYTD 4BSVA 3I6KB 5FF6A 1A22B 4P5TA 5CBEA 3RWIA 1ZTXL 3LKOB 5HYJE 1MIML 2MJWA 1OT1A 1YJDC 3QWOB 1RHHA 2O26U 1FV1A 1IM9D 1J1PH 3W0WE 3D85B 5IFAL 1ZANL 3P30H 1K8DB 3C6SA 1LP9B 5F7FA 5SWSD 3MA9L 1HINL 2BDNH 4NC1E 4HEPG 5FM8A 4Q6IA 1DVFB 1IAIH 2VC2L 3U9PH 1AIFA 5JQ6H 4NZRH 4DVBB 3WIIH 4P4KA 3LHPL 3V4UH 5DJDB 4MS8C 1D5BA 4OT1L 3PNWA 4PJFF 3F7YA 1R0AH 3WLWD 4NT6B 5C09A 5EO9A 3TH4T 3VXRE 4QRRD 5D93C 5L7XH 1Q0XH 3QQ3A 1YN6B 5D1QC 4TUKH 3SE4C 5GS1A 2DLTA 4DGYH 3BZEA 4JKPH 3QCUL 5GGRB 3MGAA 3W2DH 1L9NA 2VLMD 3B6SA 5DK2A 1L7IL 5BQ7B 1CGYA 2JE8A 3C5ZA 3IDMB 1QQDB 4UNUA 1J8KA 5DT1L 5KN5A 3CVIL 1IGIL 2YPKA 3SCMB 3NCJL 2IFGA 4ZUUA 4JY5L 1RZGB 1KTLA 1AP2A 2H2SC 1MREH 5FUZH 5KANG 3LOWA 3OBAA 4HLJA 4YEFA 5HI4C 4XBEL 1I3GL 3RX8A 4POZC 1NGQL 5ICXB 4YFLF 1SMOA 2QHRL 3DX9B 2WW8A 5DR5H 4LHUG 4XT1C 3VFVB 4DGVL 2F5AH 4JAMA 2VXUL 3TBSB 3WIFA 3VWJD 2P45B 4MA3B 4CVZB 1NANI 3ZE0E 3IYLW 3HMWL 1KG0A 1JK8A 2ZCHH 1W72B 4EIGB 3BPOB 4CMHB 4OZIA 5DC0A 3ULUE 1H5BC 2PCPB 2OTWA 4FHBD 5FOBB 2NY2C 5LWYL 2X41A 3KPTA 4PUBH 4HMDA 4MD0B 1FZJB 1QRKA 2G5RA 1EX0A 4KV5E 3QIWC 2EEBA 3S96A 1U3HA 3SKOB 4RFEB 3LMJL 5FHAH 3OHXB 3KDMA 2OJZL 3KPMB 4PLJC 4X9FA 4ZTOH 4ZSOB 3NAAH 2CJUH 5CEXB 4WWID 5EN2B 4IS6A 5C9JB 2XI9A 3BN9C 2DM2A 5BZDB 2XTJE 7FABL 4LCUA 5ANMB 4Y1AB 1IGCH 1FRGL 2LU4A 3CXHJ 4Z78B 1DBAL 5E6ZA 3ES6A 4NZUH 5ERWA 2F5BH 3SDYH 1JE6A 3MRHA 3O6KL 2VXQL 5IR1B 5FKAA 1EUUA 4R90L 5EZIL 3MNZA 5GS0L 2K3TA 4LCYB 4YDKH 5KSBE 4F33B 3EJYC 4Y4HD 3L9RB 4G7VL 3M8OH 5SWZB 2NY6C 5HHOE 2BVYA 3V7AG 4E42B 1HHIA 1I1AD 1QSEA 1T7XA 2C7UA 5I2IA 4PRHA 1U8HB 1OHQA 2R2BB 5BV7L 1FYTB 1KIQA 5D7IB 4KMTL 2MPAL 4QF1A 1KPUB 5AZEL 3H8NA 3V0AC 1CT8B 1FZOA 4LPWA 4ZUSB 1XF3A 5FXCH 4XHJC 5C92A 4HJGB 2Z9TA 3CLFL 1PAMA 4ZS6C 2DQTL 1GZPA 1IM9B 3K8LA 1K2DA 4TVPE 1CFNB 3FRUB 4BUHA 4LLUB 4PP2B 1FE8L 5SX4H 2BMKB 2FJGB 4F9LA 1C5DA 4HCRL 4PTTA 4NP4L 5SWSB 1U95B 4X4XA 3MRFB 3ZLQC 1A14L 4YE4L 4LRIA 1ZSDA 1OM3H 4G8GB 3W11D 5CCKH 4KKLD 2X40A 3N1PC 5EOCL 1UB6B 1IEAB 4NBXB 3FT3B 4FOMA 5HHME 3N50A 1QRNA 4KU1A 3MNVB 3L6FA 4HKBA 3RKDD 4OCYL 3U4BH 5HGBA 1XMWA 3CU1A 3RHWF 4L8DB 1FZKB 4F3FB 3S4SB 1GOHA 4O4YL 2VUOA 3B43A 1MCHA 1CICD 1GOFA 4YQXL 2G60H 1MPAH 5CS7A 3EUUA 5KS9E 4MAYD 3D0LB 5E2WH 3UTPD 3IAPA 2VDNH 4X8JA 4PRIE 1OWWA 3WJLA 3LV3A 5I1KL 1DQQB 5TDPB 2MHAB 4NGHH 3TBTA 4LLVA 1BIIA 1XF2A 1G6RH 4FQHB 5F3HA 1MNUL 2I27N 3HZVB 3THML 2CMRH 1XGUA 3KPPB 5EU3A 1ZHLA 4YX2H 3BPLB 2WMPA 3SJVE 2YA1A 1W72H 4EIZC 1TJHL 1NKOA 3H9SA 5TDNB 4BZ2H 3VWJB 3PWUA 1MSPA 1GZQB 1N0XL 1AD0B 2IMNA 4OF5A 4XMPL 4UT7H 3RPKA 3INUL 4FQ1L 5EU6E 2WQ8A 1J1XH 1YUHA 4JB9L 1NJ9B 1CDCA 1WK0A 4XPTH 5EU4B 1BFVH 1MHPL 4MNGA 1TIUA 2NY0D 1YECL 4ZODA 5FOJA 3E8UL 3WXVH 5AD0B 2ARJQ 1KENL 4PB0H 4GRWF 3MXVH 4NRZB 2EDOA 2YD3A 4D0CB 4L3AA 2VLRB 2YC1B 5IB3A 1OGAA 4HUMB 1T66D 1JGUL 4K8RH 4R4BB 4F9PC 1BZ7B 4R3SB 4LSTL 2ITDA 4Y4FD 1ZLSH 1OPGL 4MQ7A 5E2JA 4R7DA 2B2XH 5E00A 1XAUA 4UAOC 2HT4C 4DQOH 4XI5C 1PG7W 3LEVL 3O6LH 3IFNH 5A3ID 4FXGB 4OFYA 5DVOA 5F9AC 4XNMB 1ROWA 3C9NB 1HSAA 2NW2B 1MI5E 2AJSL 3S9DB 1A6AA 1H15A 1JRHL 4W68A 1EXUA 3WKMH 3DTXA 2Z8SA 1U41A 3BGMB 4Y8DC 1JYXA 1G0XA 4Y4HB 3MRCB 2JJTC 4L4TE 1S5HA 1S7SA 3NIDF 2R69H 4HS3B 1I1AB 1XGYL 5DSCA 3VA6A 4EUPB 3DMMB 5FHBH 1LO0H 3DURB 2VH5L 4K3HA 1YEDB 3B9DA 3Q3GB 4PGBB 1DQMH 1INQA 4NSKB 1PDKA 2V2WB 5LCVH 2G75A 5AG8A 2YKLH 3CFCH 3D39A 3BP4B 4WNQA 5FDWB 4YIQB 1IT9H 3OG6B 2X4SA 1Q9LB 3BQUD 4MJ4A 1P2CA 1AY1L 3CIQA 3PGFL 4MYWB 4DKFH 4I9WD 1BWWA 1JMXA