1OAZH

Ige fv spe7 complexed with a recombinant thioredoxin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
122
structure length
122
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
molecule keywords THIOREDOXIN 1
total genus 21
structure length 122
sequence length 122
chains with identical sequence J
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oazH00
5FYKU 3G5XA 4GKSB 2X7LB 3ZYZA 3BZ4A 2G75B 2NMSA 5FB8A 4WVRA 5DTFB 1XF2B 2CO7B 1GGYA 5C0BB 3DMMA 1AGEB 4XNQB 1N6UA 2VLJA 2HMID 1T04B 4WTZA 5CMAA 5LWYL 2A9NH 2EO1A 2NY6C 1MVUA 1IM9B 3QUMA 1DSFH 5EFIA 3QG7L 3LPFA 1I7UA 3LEYH 4JDZA 1L7TL 2Y36H 5AEAA 5C8JA 2OR9H 4Y4FB 1HN1A 1WFNA 4WI7A 1TNMA 1NQBA 4XPGL 3IDGA 3QNXB 3BEWA 5DFWH 3WEXA 2BSED 5HHOE 2OYPA 1NCDH 4M48H 4EEEA 3DO7A 4OZIF 1WAAA 3VG0L 1S7RA 1KIUA 3HE6B 5GS0D 1TZGL 1INEH 2VNCA 3QUML 3VGDA 3MC0A 1A4JA 1UJ3B 5EO1B 5HHVH 3W9DB 1CLOH 4PFEA 1AXSB 4PYHA 2D3VA 3MLYL 3VDCA 1X7QA 1RIUH 4WU7A 1FFQA 3GJFB 2V2WA 1FV1A 5DJ8B 5CGMA 3G5ZA 2ZSWB 3IFOB 3K4DA 2HKFL 3S96A 3ZKMD 5M7QA 2V7NA 4R0LC 3RY4A 4YUEH 3K8KA 3SJVD 5I1HH 1FFPB 4ERSH 3IJYA 1HH9B 3HC4H 2NXYB 4WEUD 1C16B 5H2BB 1DUZA 2VXQH 3VXRE 4PJ7A 2Y72A 4FTVE 2ADIA 4KKCD 1ZTXL 5C0AB 1NC2D 4L3EB 3S97C 4B5EA 1R5WA 1F58H 4PJ9A 4LSRH 3KYMA 3FT4A 3QEQE 4A6YH 5CJQL 1KIRB 4YHKH 1BPVA 3KYAA 4KI5C 4LNRA 3VXUA 3RGVA 4DGVL 2HFGL 2FCBA 5FGRA 1T5XA 3MRMB 5JQ6H 2VXUL 5HGHB 4HPOH 1CFBA 4X5WA 3SBWC 4Y4HC 1EX0A 3HE7B 3SY0B 1ZWIB 4PRPD 1QP1A 4NNYB 4WTZG 5ENWB 4JFDD 3EZ8A 5KS9F 4P3WA 2DQFA 4K9EC 3MMEB 4ORGA 3U1SH 5DRNA 1A4JB 3W9DA 1MCPH 4HIIA 3CPLA 1ED3A 1L6XA 1NC2A 3BESR 3OGCA 4KZDL 3MRHA 2BCKA 4OI8A 5J3HC 5KOVC 4PUBH 4TPRL 2XG5A 4BKLA 3RQ3A 1WBYB 4RAHA 1LHZA 1A4KA 1JNNL 4Y16C 4P57B 5ITFB 3PGCB 1I3GL 5IM7A 1CDHA 4PGEB 2ZKHL 4HW6A 1UWEH 1XGUA 2WBJC 2B20A 1A14H 3MNZA 2LU3A 4OZHB 7CGTA 1QRNE 3MRRB 1SQ2N 1PGRB 1MUJB 1FZJA 3FO2B 4RRPG 5F96H 1DR9A 1FORL 1GOFA 3HPJB 4UT9H 4LCWE 4F7EB 5ID0B 4EUPG 3SDCD 4WJ5B 1RULL 1A7OH 3AREA 3QUXC 4KUCD 4L9LB 3CMOH 2WZPD 5C08D 3VXUE 4HCRL 3S35L 1BBJB 1RI8A 5SWSA 4HKXB 2NY5H 2YBRB 1KGCD 2GKIA 2EIBA 1TZGH 4QHKJ 1INEL 3BFOA 4D8PA 3LZFL 1OD9A 1BFTA 4UT7H 1MIEH 1BQUA 4OLYH 5F1NA 5IMKB 1XGYL 4P2QB 3RVXC 2MQ3A 3P4MA 4MA3A 3HI1A 1QLFA 4IMKA 2B5IB 3WD5L 1IEBA 5FYJD 2YBRA 3I84A 5MP6L 2CMRH 5DA0B 5C09A 5HHQB 3VXMA 3QDGB 5AG8A 1MQ8A 3SQOL 4HSQA 1OCWH 1RUMH 3RWHA 3DYMA 5A16A 5IVXB 4UTAL 4DCQB 3QIUD 2HMIC 4M7ZC 1B0RA 2WV3A 3G6JA 4POUB 3BP5A 3WFHB 5DR5H 3G04A 3SDDD 4LCIL 25C8L 1K4DB 2RB8A 4UQ2B 1DBJH 3EYQC 1Z9MA 4NHUB 1NAML 5E6YA 4Z7QE 3Q48A 1MJ7H 2ZP0T 4DK3A 2DIJA 3O6KH 3PV6B 1CCZA 1S7WA 5LGJB 1YMMA 4YDIH 4JAMB 3LN4B 4DUWA 4O4YH 2D4FA 2ITDB 4R7NA 2OQJA 1SYVA 2F5BL 3AAZA 1R3IH 4JPKH 4LLVA 4LAQL 4Y19B 2VDKL 1FC2D 4LVHC 5EOCH 1ZLSL 4OD2A 4HUMB 2AJXH 3RWGA 3GSWA 3SE8L 2H2PC 2CJUH 4YIQA 5C92A 4YE4H 1OT1A 1FVCB 3GSQB 3ZT5A 1J7VR 4R9HA 1SJEA 3O3AB 2ZCHL 5CZXD 5DGRA 3DVFA 3HUJF 15C8L 4LGSB 5FHAH 4ELKB 1CFSB 1E0OB 1KJ2B 2HA1A 1CFQA 1WIOA 3D18A 5C0DA 3CXDL 3OAUH 2VXTH 3C8KA 1L7IL 1RIVH 3WDJA 3ARFA 2ADGB 5IROA 1GSMA 4X6FA 1H8SA 5F7EH 1HXYB 1ZK9A 1UQSA 1ZANL 1B6DA 4Y4KB 1PG7H 5INCB 4R90L 3MA7A 3KYNA 1CFNB 2G5BB 4TSBL 1U41A 3DUHA 3SKUD 3ULVL 2DL2A 1YEIH 1WC7B 1I7RA 2HJLB 3QCVH 1NMCC 2BNRD 1BIIA 1QEWB 2G9HA 3MRGA 5B38G 3BIKA 4WV1C 4H1LA 1I7ZA 3GKZA 1I3RB 1JUFA 4UOW0 5DHVA 4C58B 1FNSH 2KQNA 4NN7C 3W39B 1RHHA 1QACA 1WWAX 5IROC 1GC1L 5GRUL 1YEFH 4NQED 2GJ6D 4JFOB 4M9PA 5FYKD 4P9ML 3UTQA 3ARFC 5JMRA 3FB8A 3QO0B 5A3IC 1D5MA 5I2IA 2XWBA 2NR6C 3FT3B 4M1GH 3R0MA 1GL4B 1QA9B 5DVNA 3IDXH 1MCQA 4HC1A 4LCUB 4YH6A 3FFCB 2AJ3B 1XZ0A 5DI8B 4LLMB 2DQUH 2R9HD 4JN1L 4EVNA 2EC8A 5DQJB 4YX2H 3L7FB 2W91A 4TTGA 1U8NB 2BVPB 3BT2H 4LCIH 1RURL 3BDYH 1I8LA 2XKSA 3MBXL 1WZ1L 3ZYIA 3AXLB 5HYQB 5BQ7A 5KSBE 4OTXL 1MJ7L 5D96C 1DSFL 3QG7H 1OP5K 4X4MA 3LD8C 5TJWK 4IRSB 1MCRA 3QNZB 4WUKH 3PG2A 2YPVH 4KUCF 3JV4A 2P47B 5ESAA 4KJPC 3H3BC 4YFEA 5IW1A 5I71B 2W60A 3UDWA 3ZKNC 3MACH 4X5WB 1PW3A 2VDKH 4LIQE 1IAIH 3LSOA 5I30H 1FRGL 1JVKA 4QHKI 1OARH 3GBML 3MJ9H 2Z31D 3QCUH 4QEGA 5D7SH 4BFGA 3LS5L 1NBVL 2OSLB 2CDFB 1NC4D 1ROWA 2NTFA 3VFSB 2QTEA 3DI3B 3PWVB 1FE8H 4FXLA 4XZUB 1VFBB 3X13B 4F3FB 4G7VL 5C0GB 4OZGF 1SBSH 4PJ8C 4N8VG 3CXHK 4JGJA 1PG7X 4KK9D 2WQRA 1HH9A 3IJHA 1ZANH 2GSGA 1EFXD 4U05A 1AHWC 5HI4C 3H6JA 5J1TC 2DAVA 1D6VL 1G7QB 3PHQB 3B6SB 1KULA 4JRYA 4JFEE 2CQVA 3LN5B 3WKML 2XT1B 3REWB 3BXNA 2NY1D 4ONHA 4B7IA 1YMMB 4YHIB 1AY1L 3FONA 1B0GA 5L7XH 4HT1L 2Z92B 3GRWL 2P8MA 2E9BA 5F7FA 4X98B 1HH6B 4EI5C 3WHXB 3G6DH 1I1AA 3K80A 4HPOL 2MWCA 2VYRE 4EBQH 3NN8B 4PJCA 4FQQB 4XVUC 4HF5H 4U1KA 3GI9L 1EJOL 4Z7OF 1P69B 1RY7B 3U1SL 4GRWB 3EJZD 1U8PB 4NN7B 2CDFA 3RP1A 5IBTH 1S9XA 4V1DA 1MJUH 1IC4L 3DRQB 4F80A 1CE1H 3HZVA 4X7TA 3CFIC 1QBAA 5K9OA 1JN6A 2ZCKL 3QUKA 5IJVB 1I85A 1G7MA 3RDTA 4YWGH 1RURH 1S7SB 3A0OA 3BDYL 2MOVA 2O5XH 4MQXD 2CRMA 4PJBA 3O3UN 1OAZH 4H8WC 5I1AA 5E00B 3R4DA 4G43A 5E9DA 4Z78B 5JXEA 1C12B 2UYLA 1GGBL 2FHFA 1X5JA 3CZFB 2EDFA 4M7JH 4HJJH 4TSCH 3RL1B 2AEPL 3DVGA 5JIHA 2VWEC 1JTOA 3CUPA 3GSUB 4KRMB 2FX7H 5CJ8A 4O2EA 4OFYA 4JO4H 5DJXB 3KWWA 5I30L 2X1OA 1NFDA 5D71L 3MJ9L 4MZ2A 3QCUL 5D7SL 4POYA 4UT7L 5T1DL 3DUSA 3MLPA 5I15H 5D1XA 5BW7C 2ZNWA 2XWBB 3BN9D 4ZSOB 4B41A 1ACYH 3LKRA 4PJCB 3KJ4B 1QR4A 4NRZA 5C0EB 1JJUA 1QLRB 4JCLA 2Z35B 2WBJA 2MPAH 3QYCA 4LEOA 4TNVF 1FH5H 3W11C 3NH7H 2VLRB 1NMBH 1YEJH 4HUXA 1ACZA 1ZEAL 3IXAB 5DK0B 1FCGA 2X7LA 5D1QC 3I6GB 3TYFB 3BISA 3ULUC 2R4RL 4O2FB 3HCVA 4OKVB 1CDIA 4ENEC 1I8IA 1D6VH 3KVQA 4DFHA 3WHE1 3AS1A 1GOGA 2W65B 5I8OH 4JG1L 4DZ8B 1CYGA 4KQ4H 4Y5YA 1N8ZB 1G9NH 2AERT 4LFHG 3W81A 3ARGA 5C0CD 4Y19A 1HHJB 5ALBH 2E7MA 1QBMH 1S5IL 5HYJA 5HGBA 4MNHB 4KU1A 5CJQH 4WW2B 2LTQB 4AT6B 3UJTH 3GMOA 3DXAE 1OPGL 4YHYB 2D0FA 1MOEA 3P4NA 4HF5L 1GGTA 1YNTB 2G5RA 5D7KE 2C4FU 4R4FL 2W9EH 2NY1C 4KRLB 1CZ8H 4RGNC 4OZGA 1II4E 1T22A 1EO8H 3GSOA 2I5YL 1MVFA 2WIIB 3OKKA 4UIMB 1MJUL 1UQSB 1H8NA 2OP4H 2VOTA 3BH9A 5FUOL 5FECA 2HTKD 4P0DA 2MHAA 3GIVB 3D6GA 5TE6L 3OJMB 1N0LA 4PR5B 3BH8B 1TJHL 5E9DD 2QQKH 3NABL 3WNPA 5IMLA 1CFNA 3NCCB 5IP4A 4GRMB 4AEEA 3TPUB 1QSEA 3QULB 4DQOH 5BQ7B 4XPBL 2Y5TA 4LPYA 3W2DL 1DQJB 3S37X 4H88L 3OKNA 1IL1B 2D2OA 1IAIM 5DYOA 3PWPE 4OD3H 2W60B 3CSYA 4RFEB 4L29A 3QWOB 3B9KD 2X09A 3GSXB 2FZ3B 1QO3B 4TVPL 5DEFB 3TVMD 1CICA 3ARTA 5ICZA 2DBLH 3N1QC 1I1CA 4HCRH 3BPLC 4OFYD 2IAMD 5A16B 3RWHB 2EICA 4NDMB 3WHXA 3EYFB 5MENB 2OSLA 2RAMA 5DK3A 4P9MH 4O58L 1KACB 1MIEL 4OLYL 5IOPB 4X8XA 4N68A 4JO1H 4WDIB 3B83A 4MAUL 2HVKA 3G5XB 3MV9B 2PO6B 5I71C 4CAGA 5IW1B 2HFEA 3RVTD 1U3HB 5A40E 4PJIE 3QFJB 5HYSA 1YDPB 3BSZL 4QRRD 2F8VA 4M43L 2IANE 2J8HA 1A1MB 4GKNB 1D5ZB 1X5HA 4X6DF 5JMOC 4PJAE 3GHBH 5E0QA 2R23B 2Z0BA 4OJFH 3TV3H 6FABL 5F88A 5BMFH 2BCKB 1XF5A 3DLQR 4BK5A 2CDEA 5E08L 2J6EA 1TJIL 5DR5L 3L95B 1HYSC 2ZUVA 2CR6A 2EEAA 4X4XB 2EE9A 5CZVL 3EAKA 5DUBA 1RZKC 5F7YC 1D9KA 4Y4FA 4LDLB 5DMGC 2IQAA 3WXWL 4HIEB 4P9HH 3QUZA 4NBXB 1F4YH 3O3BB 4WW2F 4JDVB 4Y4KD 1BMGA 4FQJL 3NA9L 2N7AA 4OT1H 1BQSA 2EXYC 3DO7B 1W2KT 4GLRI 4ZUVA 2GK0A 5E8EB 4YXLL 1AR1D 1ZMYA 4XVJH 4ZTPL 5I1EL 5GS0H 2Z8VC 5BV7C 3ARDB 4OD2B 4QOKD 5HYFA 5F7DB 3C5SA 4ONOA 4J3UA 4HPYL 2YSSB 4P2RD 5FUOH 3HUJB 2AGJL 2VXVL 1UADC 4N1CA 4D9RE 4KJWD 1Z9OA 1WBZA 3MLVL 4RX4A 1TJHH 4LSVL 3CFDB 4LPWA 3VWKC 1KJ2L 2YZ1A 3RIAK 2GAZB 2R1WA 4N8VB 3GJFH 2BC4A 1EXUB 3CVHH 3TEUA 3Q1SH 4JM4L 1D5BA 1MHCA 3MV7E 1NCUA 4OD3L 3PWPA 1WWBX 1CL7L 4Y8DC 1G6RA 1XT5A 4LIQH 4PJXE 1KJVA 3FB8B 4P5KB 5FUCE 4J6RH 1AGCB 3RWFA 5HGAA 2XKNA 2VZUA 3TBVB 2FWOB 4I0PB 1DQMH 2AI0H 4PRNA 5IMMB 1PY9A 1W0WB 4YK4B 3RWDA 2DYPD 4IJ3B 4J1UB 1I3RA 2EC9T 3ARBA 4OFDA 2VLME 1QLEL 4JO1L 5IB3A 2PYFA 3X12A 1H5BB 4BFIB 3EDDA 3G6AA 2VDOL 2C1OA 5AD0B 5KSUA 2A9MH 3TZVB 1ERNA 1UWXK 3FAXA 3SDXE 3ZTJH 2HT4C 5BMFL 2VR4A 3LAFA 4UV4L 2ZUWA 3MV9D 1KCRL 3QDGD 3LOWA 4OZHA 4G8EA 3ZE1E 5HJ3B 4CUCA 2DWDB 1WZ1H 3V9FA 4PJ7E 4W4OA 5I6XC 4MDIA 1EEZA 1TIUA 1MH5A 3N1MC 2PXYC 1D5IH 5IGXL 2D7TH 5SX4I 4XH2B 1KPUB 2FIKB 3DIFB 3FQUB 4WJ5A 3QEQA 4RGOL 3IFLH 2DQIL 2HFFA 4GRWH 4GW1A 2OTWA 3VGAC 3VRLE 3ZHLA 4OCXH 4AQOA 1MCEA 4CJ0A 3HI5H 3WBDA 4KK8C 4Q6IA 1MNUL 3PXHA 1CIDA 4LKCA 3CFJA 5I1GH 3AMKA 4HHAA 5GS0L 4OZIA 1OARL 1ACYL 3GBMH 3WJJA 2AJYH 5EUOB 4PJIF 4M7ZB 3PWUB 4PS4L 3BGMA 2XFXA 4G6FD 4DK6A 2YPKA 3K3QA 3TBWA 5HVFB 3EOAA 4PJFF 1NMBL 2F8OA 3QDMD 3RTQC 1XGTB 2QKIB 3AU1B 4FQXC 5IVZA 1CG9B 4KRPD 4U1SB 4X7SL 4Z7WF 3CFEA 3BP5B 4P2OB 2Z8WC 3MNZB 4Z95L 1UXSB 3RPIA 4KH2A 1ZHLA 4ZFFB 2PW1A 5DD0H 5IFAL 4ZUUB 2OJEA 4KVCL 5IBUG 1T83A 4N0UE 5BZWB 1CTNA 4F2MB 3PV6A 3MJ7B 4EQ3A 2HH0L 4LIQL 4NT6A 4KK5C 3EOTH 5ALBL 5FA4B 3C60D 3IKCB 2GFBA 5GRJH 2CGRH 3EFDH 4BYHA 3GRWH 3DSNA 5DFTA 1BBDH 2DQFB 4Y0GA 4FABH 2HRLA 4KI5D 5DJYB 2EKSA 1PDKA 5DS8A 3Q6FA 2ICES 2H6PA 4HAGA 3D85A 3MRPA 3VXSE 3D3VB 3KYKH 3VXMB 1A7NH 4Y5XA 4G43B 1CGYA 3T2OA 1ITBB 4TOYL 1WBZB 1UKTA 1W8OA 5I75C 3BZDA 1GAFL 4JHWL 4HWUA 1JNHB 4FFVD 3T65B 4JZOB 4QRQB 1H5BC 1MAJA 4HD9A 3U46A 2AW2A 2BSRB 4ZMAT 3MRFA 1RZFL 3IT8D 3QIUA 2A74A 1H3WM 2XI9A 3H3KA 3JWOH 1ZT1B 5JW5B 2O5XL 4TVPD 1NGWB 1PQZA 2NW2B 3KYNB 2HP4A 3RDTD 4HAFA 4PP1D 1KIPB 4LKXB 4ZOBA 35C8L 3U46B 3WLBA 3QUXD 2FR4B 5CBAB 5CLTA 2NX5B 2BVOB 5C08B 1F3DJ 1UWGL 4RISL 4UI2A 2ATPB 3TNMB 2DQIH 4BUGA 2IBZY 3EJZC 1RJCA 4N0FA 5FO7A 5CEXB 2I9TB 3ROOB 4CVWA 4DGIH 1HZHL 4MCZA 5LXGH 5I1IL 5ESQA 2GITB 4LCYB 5F9OL 4YEEA 2D7MA 1SEQL 4UV7L 4WFHD 1ZGLM 3IDJB 4ODSH 4U1MB 4AIZB 4EI5D 1SMAA 5C0JA 4GS7B 3HUJA 1A7PH 4RFOH 3FCTA 2BVTA 5DZLA 5A2IH 3O4OB 4NN5B 1PY4A 2EE6A 3L3HB 1I8IB 3PXJA 3PABA 2VE6A 2DI8A 1N7MH 1JP5A 3RHWK 1DUYA 4HUUA 1UB6A 1YEJL 2JJSA 1B4JH 2BVEA 4OD1L 3LCYA 3T04D 4OAWA 1IBGL 2J3SA 1DEEA 2OI9C 3MRBB 1HXMA 1P1ZA 4NQCA 1QPXA 5I6XB 5C07A 4WY7H 3DX6A 3QHZL 1BEYH 4LSTH 4MQTB 4MX7A 1PQZB 3BOVA 4W68A 3QO1B 3ZE1F 3OV6A 4JG1H 3BE1L 3TT3L 1BD2B 4JE4B 1AIFA 4LSRL 3GFUA 4HH9B 3M17A 4MHHI 4F7TA 1QBLL 4X6CE 3O6FC 3MCLL 1A7QL 4HCRA 1ZLVH 3X11B 1T20A 1NLBL 4P3DA 1T66D 4FABL 1PKQA 3VXUD 1Q38A 1MQKL 1O5DT 1T1YA 1I1YA 5EUKA 2YC1A 4OZIB 4U33A 1Q9KA 2ITCB 3WIHL 3UTTA 2DM2A 3PWUA 4NJ9L 4WO4A 3QWQB 3UTSD 5EWIL 4DW2L 5E8NA 1RZ7L 2OJZH 1GAFH 5CGYD 3SCMC 4U3XA 5FOJA 2EEBA 2GSGB 4EN3B 1U8NA 2D7QA 2DLGA 2DIAA 5C0AD 5I1DB 1RZFH 3IU4H 1MFAL 4GG6F 1T21B 4IOFC 2ZKHH 5DGQA 3DVNB 3HA0A 2ZOKB 4MNQD 3QPXL 43CAA 1F00I 1IAMA 5J11B 3HCVB 4HXBH 4MNQE 2VLRD 2FBJL 4PJHA 1WGOA 1NH6A 1WISA 1PG7W 1A2YA 2XN9A 1X4YA 4RMVA 1OAUH 3F5WB 2ICWB 1MFEH 1AXTH 2PTTA 1TNNA 1XIWD 4UNUA 1CFTA 2ADFH 2PYEE 2CLRA 1NPUA 4UAOB 3SDYL 2R29H 4GUPA 4IOIA 4NGHH 1A6ZB 1XR8A 1XGYH 5DURB 2EZ0D 5CJOH 4AY0A 1GRWA 3DNKA 2AXGA 1OCWL 1KPRB 1RUML 3QUKB 5F3BA 4MGXA 5C6TL 5DUPH 3DRQA 5CZKA 2R2HB 1SM3L 1INQA 4B0MM 5C2UB 1A9BA 3QZWA 4XI5D 1K9TA 1S9YA 4KQ3H 3V5KA 2HJFA 5GGRY 2C3WA 4JFEA 3T4AA 4ZUUA 3SDXF 1NCBH 1ZT1A 1MI5D 4OJFL 3TV3L 4QKXB 6FABH 5GRVL 2BSRA 4NZUL 3UTPD 2PO6D 1LDPL 4NQXA 1LP9B 3T0VA 4RIRB 4NUJB 4X9GA 1WTGT 1UH3A 4N8CL 4R4ND 5E4EB 5B38B 5JZ7C 5CZVH 2AABH 4LGRB 3QDAA 5HHME 4OZHF 3T0EA 4YIQB 4PJ7F 4WFGE 4I8DA 4U6YA 2Y5TB 2P8MB 4OUUB 3PV7A 3IFLL 1T1XA 4XVUD 4L4TD 4RNRB 4WFED 4HGMA 2ENSA 5HY9A 1CGSH 1TLKA 3EYUH 4ESKA 1FPTH 1U36A 4L1DA 3VRLF 1UH4A 2HKHH 3RZCC 4MSWB 4XNXH 3U4EA 1NANH 1IT9H 6CGTA 3VRIA 5DK2A 3VFMB 2XICA 5DRWB 2XOTA 4G3YH 3RY5A 5IFHL 3VWKB 3L5WA 1L7IH 1RIVL 4KAQH 3BDBA 3MRFB 1T0NA 4ZQKA 4M61A 3V5DA 1VFAA 1XGQA 1TXKA 5F3BB 1OTUD 1FZOB 1MI5A 4X80L 2V2TB 3MFFA 1U8OA 1C1EL 3LN5A 1MVUB 3QUMB 3QI9D 4OGXL 3LRSA 1EGJA 4V2CB 3SDDA 4R90H 1F11B 4Z7WB 1A5FL 1FGNH 2CDEB 3QFDB 1NC2B 4JM4H 2HH0H 3B5GA 3QCVL 4M3JA 2EIZB 1WT5C 4UU9B 3EOTL 5IK3A 1K8IA 5C09D 1AO7D 5JXAL 5C0CE 4G8GB 1DQLL 2NY7H 5DJYA 1ETZB 3WFBH 3X12B 3ILQC 4CN4A 1JHKH 3LB6D 5GZNC 4NHCL 1HCVA 2ADFL 3BD3A 1D6EB 3S5LB 3O2DL 2X4PB 1L0YA 4XCYA 4NC0B 3LQZB 5SWSD 4V1DB 4Z7UA 3NTCH 1WSST 1YQVL 3I50H 4XNUH 2XN9D 1CD9B 3EO9H 2X70B 3FB5B 3WKNA 4U31A 4CMMB 4MNGE 4L8DA 3DROA 5EORL 5GHWL 3DSFH 1OF2A 5B4MC 5CHNB 4NZTL 4MVBC 4QYOB 3TPKA 4I18C 3MRLB 2JKXA 4KV5F 3V79C 4XRCB 2W07A 2FJHB 1LDPH 3RWEA 3T2PA 3MO1B 1LO4H 4I3RH 5FYLL 3ETBF 2X4SB 1T2QL 3GK8L 2YK1L 5E94A 2R0LL 5CIPA 5MHSE 3LRSB 2AABL 4X0KA 2HTKC 4XCFH 5FYLE 2IGFL 3HMXH 4EUPH 1JV5B 2B4CH 2FJHA 5I18H 1N59B 2YPVL 1QFWM 4I5BB 1EH9A 4HWBH 3HC3H 4P4KC 5E4EC 4NO3A 1X6NA 1Y0LB 2CRZA 3OG6B 4MD5B 3F7RA 3NACH 3C2SA 1JV5A 4ZNEE 3HI5L 3VI4F 3MOQA 4OF7A 1EFQA 3FOMA 3RVWD 2BVQA 1U93B 3TBVA 4JZJA 4PJXF 2YD3A 8FABB 5E95B 2DKSA 2X6MA 1KEGL 2G60H 1MELA 3RUGA 5ADPH 4JVPA 4N9GB 4O51B 3GIZH 1NGZB 4GMTL 4RGND 2V2XB 4M6OL 1YY8A 4OFIA 4P57A 5ITFA 4KAQL 5KBNC 3PF2A 4XVTH 3OB8A 2BSTA 5C7XL 3G6JB 4X80H 5ECJE 3VXOA 4ENED 5IB2A 2P7TA 4RAVB 3T3PF 4GAFB 5KSUB 4HIIB 2Z92A 4NKIH 3BPOC 2OZ4H 2BSSB 4D9LL 1IL1A 3V0WH 4WO4D 5F7NC 1OAXH 1WFTA 3CH1A 4HKBA 1JGUH 1ZHNA 4M7LL 2J4WL 3MGOB 2NXZC 4PRBB 2GJ6E 5FYKE 1HHHB 4F7CB 4U0QB 4DOHE 4JN2B 3WFBL 4XAKE 1BQLL 4PB0H 2IAMA 3C60B 4WRLA 4AEFA 4O00A 2F15A 4PJ9B 2H1PH 2X4UB 3O2DH 1BZ9B 3FFDA 1MRDL 4K3EH 4OZGB 5F89A 3ARYA 1BBDL 1JPGB 4PIRF 4O02L 3WS6A 4FMKA 1T0MA 1KB9J 1VGEH 1VENA 2ZJSL 4MJIB 5ERWB 2X4TA 1EJOH 4HDIB 1OGAB 3M1BA 1FN4A 2FZ3A 2A74B 1K3IA 1TFHA 4DW2H 1CGVA 1A1NA 4PJ5E 4Y5YC 4FQCH 4K8RD 4M1CC 5D8JL 5EORH 4PTUA 5GHWH 3RUGB 3PP3K 2XNAA 1VFAB 1XGQB 2DM7A 1NEZG 3S88L 4JY5H 5JHDD 4CVXA 4LDOB 1OQOA 5KTEL 1BVLA 1OT2A 3P9MB 3O6LL 3PDOB 4KDTA 5GJSL 5L2KB 5HHMD 4JY4B 4QHLA 3QPXH 2HVJA 1LE9A 3OKYA 3FMGL 4EI5A 2RQ8A 4Q0XH 1KBGL 3KS0H 3SCMD 3HB3C 3ILQD 4BQ6A 4NO5B 2ADJA 5T3XD 5DLML 1QFWI 2BDNL 2IADA 2YRZA 3LKPA 3D25A 1MLBA 2FATH 5LAXA 3BRFA 3U4EB 3QHFH 3ARQA 4WU5B 2I07B 2CKBL 3VGBA 4X4ZA 1FBIL 4F7PA 1TETL 2CIIB 1BOYA 1HZHH 2X1PA 2QSVA 1P84K 2DQTL 1U3JA 3VXPA 1B9ZA 3VU2A 1IAOA 5LG1A 4RMQA 3B3IB 4LLWA 4M6OH 5EBWB 4F9PC 4ETYA 4RNRA 5FM4A 4LHUD 2DQJH 1IQWL 2H6PB 3BUYB 3UEZA 5IHZA 1YEHH 1MFDH 3ROLB 1OAYL 4TULH 5EZOH 2ORBH 1P7KA 4K7FB 4YGVB 5I8EA 3MV7A 3OBAA 3U30B 3O9WB 4OB5L 5GQBA 2F54A 2VDLH 4WHCA 1B4JL 4OD1H 4U1IA 5EC1B 5HI4D 3C87A 4JRYE 5JNYB 1S5HA 5BRZA 1O0VA 4JREC 4HK0A 3RWJA 1BIIB 5MEQB 3CZFA 3RA7L 4N8CH 5KSAD 5E94B 3L3OA 4Z0XA 5IFJA 2CRYA 4L8CB 4M7LH 3DX6B 1T89C 4QTIL 2OTWB 3OR7B 5EOTA 2GSIA 4BUHA 1ZGLB 1D6EA 3PP4L 1P53A 3OXSA 1I3VA 1WITA 3EJYD 1J8HD 3AB0C 3KLSA 1MPAL 1MRDH 1A7QH 3BHBA 4JKPL 5DJ2A 3SJVE 4EIGB 4X5XB 1Q9OB 3IDYC 3OR7A 3QFJD 3FB5A 1AC0A 1WWWX 4LCYA 4OBRA 2UY6A 2LAAA 2J5LC 4WHYG 4FFYH 3PDDA 5EU6A 2WSKA 3MRQA 4EXPX 1N5AB 3QPQC 4ZS7H 4HMDA 3FHQA 1X5AA 5J12B 4LRIA 5DJDB 4KVNH 4J8RB 4GBXA 4GQPH 4GJTB 3P73B 5ILTH 2BRQA 3V5HA 3GI8L 4U1SA 3S3JA 4PYGA 2EE3A 1NMCB 3V0VB 5KOMC 3MCKB 4TUJA 3CD4A 3TYFA 2OK0L 2AJVL 1MFAH 1F97A 4OM0L 2VH5L 5CIPB 3W2DH 1XGRA 1PZUB 3HC4L 4BH7A 5CUSH 1PFCA 1U8KB 3KPSB 3JTTA 3D9AL 5C2BH 4HXBL 2FWOA 3QUXB 5J1AB 5E7BA 5IBUB 2J88H 4YDJA 4JQXC 1R5WB 5D2NB 2IAMB 3C60A 4WWKC 2NY7L 4I0PC 2W0LA 4RMRA 4PRHE 5JHLL 2FDBP 5FF6A 4ALAL 4WW2A 1AGBA 3K2UH 2WM0A 4NJAH 4X9FA 3LY6A 3TVMB 3MRNA 5HYJB 5J8OA 2V9RA 1AXTL 1MWAL 2Y25A 2AJ3A 3D85B 4XZUA 3CK0L 2DS4A 3O2DA 3HMWL 4FXKB 1A9BB 5JQ6L 1I1RA 1I8KB 4NGHL 3EDJA 3QEUA 4FA8A 3MNWB 1ZA3B 2BMKA 3TN0D 1WBXA 3I3DA 5JPMA 5DRNB 4P46D 2FX9L 5F7MC 1P7QB 4NQXB 3MUJA 1BREA 1PLGH 4JFDB 4XNMB 3DBXB 1FYTE 5H37H 4LPXA 2PETA 2NPLX 3HRZA 5DUPL 5E2TL 1GGIH 1VEPA 3MRMA 3KPOB 4M02A 3LQMA 3FRUA 4ZOAA 5DWUH 3IRZA 3CFKB 3ES6A 3VE0B 5BZWA 5GGSB 4JFQB 3FT2A 4L8BB 4NZUH 5IR1A 4MAYD 3MTRA 4ZD3L 5F21B 4BJLA 2LE9A 1TCMA 5FYJE 2B4CL 2ESVD 1KCVH 4QOKA 1FZKA 1N3NA 1R3HB 1E28B 1FVEB 3U0TB 4PD4J 4OCNC 1S9WA 4C54A 4P2OA 5D5ME 1KCKA 1FORH 1HSBA 3V7AE 1N5YH 1NANI 3IJYB 4LVNC 5DD5L 1KT2B 4YDJB 1SVZA 1YEEL 1QKZL 2ICWA 2BZDA 2E9WA 3MLZH 4PP2B 5AZEL 1AC6A 3QP3A 4Z7UE 4LVOC 2P5WE 3RZCD 4JDTL 4XVJL 2XTJB 3AB0B 2EDYA 3WO4B 3HG1A 1T1ZB 3ZKSD 3HC0B 4MAYA 3FB6B 4GMTH 1R3KB 1KELL 3THMH 4CGTA 5L9DL 1EERB 4QRQA 4L9LA 5JDJA 5IFHH 4R7DB 1YDPA 4XX1G 4NWUL 3B6SA 5DMKB 1JGVH 2DKMA 4AG4L 3RAJH 4XP9H 4EDWH 4P5MB 5CKGA 3ZYOA 1AH1A 1YPZB 2AXFA 3EW3B 3MNVA 3D87B 5F6HJ 2XY1A 2ZOLA 4HJGB 2Q8BH 3UPAA 5SWZB 1XH3B 5EOQL 2PTVA 3RPKA 5MI0B 4PJDB 5C71A 4OV5B 4G42A 4M4RA 1RZGA 4LLYA 4P5TD 5LGKA 1MFBL 3SE3A 3FAWA 4JM2B 4NP4L 3A6BL 5KN5B 3CC5A 1F13A 4ZG1A 5FKAB 2A6IB 3DX7B 1N26A 1PKQB 2PUQT 2ZG1A 4LFHD 1IKFH 4ALAH 2FJGA 1DQLH 4A6YB 3MODH 4UU9A 2D7PA 4UNVA 5JXEC 4JDVA 2GITA 4MCYA 2Q3AA 4ODUA 4QRPB 4KKNA 5EOCL 3RDTC 3MRIA 2V7HB 3FO9A 1A7RL 4TNWK 3GSQA 4WO4B 3QSKB 2HN7B 4XCNB 3VD4A 4PLOB 3AM8A 5C9KA 3IXAA 1BFVL 4P46C 5I17A 4CVZA 4Z5RA 3TYGH 4OM1H 2ZCHH 4K7PX 5I8EB 4K23L 3FO9B 2H45A 5KAQG 2F54E 5AYQA 2EYTB 1KN4L 3V7MA 2L0DA 4JHAL 5E70A 4GKZA 5EO9A 4NRZB 1AO7E 3O6LH 2VSCA 5F7EL 4PRDB 1Z9LA 2MKWA 4G8GD 3SGKA 4AIOA 1X5LA 3B9KC 1F11A 2X4RA 4W4NA 1QTYT 1V5JA 3JWDH 3TNMA 3PWNB 1GZQB 4L8SC 3E6HA 5E6IC 1U92A 3KWWB 4HS6A 5J1AA 5F9WC 4PRIE 4OKDA 4PJDA 4JQVA 5DVOA 4JCMA 3RVVC 5D72L 1B0RB 5I18L 3SKNA 3QNYB 3VH8B 4MCZB 4WW1A 1VPOL 5HTSA 4E0RA 2FNBA 3K2MC 3QCTH 5EPMB 3QJHA 2NY0C 3TBTA 4XX1E 2JIXD 2GY7B 3MBED 3MLZL 3CVIH 4OF8A 1MLCB 2CKBH 4HK0B 2P4AB 5ADOL 3TO4A 1QFPA 2P5WA 3RNKA 2AJZA 4PGDA 1E6OL 3C8HA 4R3SA 4UIMA 1ZA3A 2BMKB 2EE2A 2FB4L 3TH3T 3MA9H 3EHBC 4PLJD 4LMQE 2DMKA 2DLTA 4PY7B 4P23C 5ADPL 3O3BA 1VGKA 2DLHA 2ZNXA 4GRMA 5LVEA 1JGVL 4AG4H 1VB9A 1JF6A 3S5LG 1DQQA 4M93C 2QHLA 4OSUL 2K7PA 5GSRB 2VDLL 3KYMB 4K94H 1MCWW 4MAYC 3QO1A 5JW3L 5JZ7D 4G8EB 1IGCL 5D7IF 5JR1L 5JA8B 4KC3B 12E8L 1RUKH 2PKDA 1MCIA 1OAQH 3W0WB 3ZDXE 2P24A 1T1WB 3V0WL 4LARH 4DAGL 5I1KL 2HRPL 4PGEA 1I8MA 1J0HA 5LBSH 4MDJA 4FFWC 3F5WA 5DD3H 5SWSE 4PJFA 3CFDA 3BPNB 4WGVB 5E5MA 3P4MB 3DI2B 4RGNB 1MCFA 3BP4A 3QDJD 5TDOB 1MAMH 3MACL 5D70H 4PJHB 3DUUA 5FYKL 3HFMH 1NUFA 2PO6A 2A2QT 4G8FB 1FRGH 5D1ZB 3VW3L 3V6FA 4YXHH 4D0CA 5HGDB 4P48A 3ZDZE 2D31B 1JNJA 3J8F7 1ZLWK 4M1DL 1LO2L 3KGRA 3BW9B 4KPHH 5J6HB 1LGVA 4K23H 1EFXB 2IANA 2AQ1A 2M26A 4P99A 4JHAH 2APBA 1HCFX 2QR0A 1XIWC 2E5EA 5KW9L 1H3PH 3MFFB 5IMOB 3TA3C 4ZFOL 3JWOL 2OK0H 4L29B 5IT2L 3FTGB 3HPLB 4F33A 5GJSH 2VH5H 4DKAA 3QEHB 1RU9L 3B9VA 1FZKB 1N3NB 1WBYA 4YXKH 1NJ9B 4NKOA 1J10A 4KMQA 5D1QB 3D9AH 5C2BL 3OTTA 3KLAA 3FMGH 3TGXA 3RU8L 3IU3B 4Y1AE 4P4RB 4R8WL 3S36X 1VPOH 4MA3B 2CLZB 5JHLH 2OM5A 1ZT7B 3GMRA 3MLUH 4X83A 3V2AR 2CRIA 3E3QE 3V4VH 5F9WB 4AJ0A 2P5EE 1I1AD 4LPVA 2JF1A 5E5MB 3CK0H 1J1XH 1P4IL 4ZFGL 3HG1B 5D7JD 4L5FH 4OLUH 3SDCC 3H9HB 5T5NG 4YHZH 1E4KA 4EN3D 5ALCL 2IBBA 4ODUB 2FB4H 2HJKB 5GS3A 4QO1A 1Q72L 3KPRB 1NFKA 4NQCB 2QQLL 4PRAA 3BZFB 5AD0A 1U8PA 4NPYA 3QDHA 5IHUH 4MXWH 5FHBH 1SBBA 1FN4B 4D94A 1QYGL 4KTYA 1NDMA 3LHPH 5B39A 2H32A 3B43A 3T4YA 1IC4H 1U3HA 4LVOB 3VXSD 1GPOH 4JO2L 2DQGL 4GKZB 3E2HB 3U9PH 4ZUSA 2C26A 2ZOLB 4HJGA 4WY7L 2JJUA 4DVBB 5D7JA 1MY7A 3MUGA 4ZD3H 5SV4A 4I48A 1MCDA 4ONHB 1HHIB 5DHVB 3SE9H 5BRZB 3D85D 4M7JL 4OCRH 3K1DA 1FGVL 4NSKA 1CVRA 5IG7A 1L7TH 2Y36L 2V6HA 2DQEL 3LRGA 1KCSH 4HLZG 1I1AB 1QRNB 1YEEH 1T89A 3PHOB 1NCAL 4QHUB 5D2NC 1BLNB 2J7LA 5D70L 5A2FA 4FFZL 2EYRA 4ZSOA 2MJWA 1KPVB 2KZ1B 4JKPH 4JDTH 4EOWH 3NIFE 5DDHA 1KENH 2VLKB 1QLRA 3U48A 4CVZB 5HHVL 3KXFD 4DGYH 4JRYD 3I85A 1EAPA 3OKOA 4ODWB 2BVPA 1IARB 3SDAD 1NCCL 1MI5B 5IHBA 2YRLA 4PJCF 4RAUA 4BZ1L 1CLYH 1YN7B 3O41A 5GGRB 1WCBA 4ELKA 4U7SA 3QQ4B 3RVXD 4TVSa 1H8OA 1NCWH 1H3PL 3PJSA 3ZKMC 4Z77A 3LQAL 1YEGL 2FRGP 3ZDZF 4X4YB 1LEIB 1FFPA 4Y2DC 4HX1A 3VD7A 3C09C 3RI5F 3VXQB 5DMJB 1CIUA 2H8PB 2NY2B 4MQXC 4D9RD 4HKJB 3MRPB 2R4RH 1FL6A 4HKBB 2AJVH 1J88A 4U1LA 3QZWG 5I17B 4I1NB 4QOKE 1JPFA 4WENB 3O81A 3V6OC 4GKSA 1FV1B 5DJ8A 4I5BA 3DXAD 3LPGA 3I75A 4WI8A 2JK5A 5GS1C 5IJVA 5KANI 1OM3L 3I6LE 4UIKH 1HDMA 3D39A 4AEIH 4OGZA 1QG3A 4PJBB 4A6YL 4RSVA 3N1GC 3PWJB 2QADC 1QEWA 2LFGA 3GSNL 5A43C 4UBDD 2WQ8A 5E1AA 1YPZF 2HFTA 2Y06L 1QBML 2C1OB 4YDVA 4XP1L 4YHZL 4N9OB 1ES0B 4QXGH 4O51A 4LBEA 4U7KA 3LRHA 3X3FH 5KVEH 1MCJA 3TH2T 2E3VA 4JFHD 4MXWL 3FQTA 3BH9B 4R26L 1A3RL 1D5MB 5I2IB 2QJDA 2VDQL 4NQUA 4JFOA 3BKCH 5C6TH 4LASL 1HK6A 3TWCH 1IGYA 4HS3B 1DQQB 2OP4L 3H9SE 1PD6A 2W0KA 4OZ4B 3QG6A 5CSGA 1A6VH 3FQWB 4YHLL 4X6BA 3REWA 5ISZB 5TE6H 2D4DA 4Y16D 3EDFA 4NN6B 2KQMA 3MLRH 5F9DC 4B7LA 5GGQH 5GZND 4XXCC 1OLLA 1UWEL 1LEKA 5LJYH 3BZ4B 3K1KC 1DN2A 1OQXA 5T3ZE 3V0VA 43C9B 5FO9A 5MEPB 3CSYB 2C4XA 1INDL 4HWZA 4BELD 3BPOB 1KYOJ 2A6DA 2UWEE 2Y5EA 3OB0K 4RAVA 5CKAA 1FFNB 1HI6B 1TZHA 3C8DA 1DDHA 1RK0A 3OSKA 5T3XE 3F7VB 4F3FA 3BP7B 3CDYA 3CVIL 1BFSA 2AEQL 2XFXB 2AEIT 4BSVA 4UDTA 3L3KB 5HVHB 3GUTA 5FF6B 2ICEA 3V7AG 1KENL 3E8UH 1IQDA 1F4XH 3QXAB 2W0FA 4IEFB 4LKCB 5IOPA 3O6FA 3U30C 3QA3B 3CU7A 2AV7B 2WIIA 1HHJA 1KTDA 3QEUB 4Y4KC 4BZ1H 3MLWL 1BQHA 2F74A 4E42B 4ZFFA 1H3TA 3ILPB 5DSCA 2Z8SA 5GGUA 1HHKB 4LCCB 1VERA 3AY4C 4Y16B 2X1XR 1AR1C 4QHNA 3WIFB 2Q87A 3LDBC 3TO4D 2VITB 3SPVB 1ZHKA 2R69L 2VZOA 4M5YL 3MGOA 1OAQL 1NBYA 1AD0B 3JUZA 2JJSC 5IQ9B 1ZXQA 5I1HL 4LF3B 3DTXB 1JGDB 3N1FC 2EDHA 3RGVC 5D1ZC 1BX2A 4CVXB 3PL6B 4KXZI 1NBYB 1A1MA 4GKNA 4JFXA 1REIA 2OTUA 4PJ9C 5E2VH 5H94B 3LKQB 3N85L 3GGWA 3NIDE 3D1MC 1NKOA 3H0TB 4KKBC 1UH2A 3LKNB 1G9MC 1QBBA 4ZXBD 2QSTA 4LEXL 5HYEA 3MRRA 4GKOA 3QAZB 1FCCA 3HFML 1TQBB 2GFBB 4QT5B 1CDBA 3KPNA 4YHMH 3HR6A 2CJUL 1EEUA 4HUXB 3JTSB 3X3FL 4YAQB 2P43B 1NFDF 3MV9A 4NKDB 3EO9L 1V3MA 3U4AA 1XCQB 3SKOA 5FDWA 5C0RL 1RZJH 4C83A 2FO1A 3CXDH 2X9YA 1UCTA 3DHJA 1A6VL 5ACZB 3V6OE 4BQCA 5DVLA 1RJYA 1MWAB 2YUVA 4QRRA 4TPRH 3ESVF 2QQNH 1KCUL 1UEYA 4P4KB 4UINL 3ARBD 4JO3L 3RZCA 1EHAA 2NQCA 3WJJC 4Y5VA 2VZ1A 1CGXA 1INDH 5JO5A 4DKFH 4NM8L 3VRJB 3RU8H 3QFDA 1IC5H 1MHHB 4P5TA 4TRPL 5GRYA 3CNKA 5B22A 1GGCH 5D72H 1CK0L 4GO6B 4PRNB 4LDEB 5FKAA 5A1AA 3IYLW 5HXMA 5C08A 3QUZD 2FECL 5KSBA 2XKNB 3CC5B 1YMME 4HIXH 1T22B 1SJEB 3AREB 2NY1B 3MLXL 1D9KB 2FEEI 5FKPA 1WEJL 1W72B 5GRUH 2AV1B 2LQRA 3DMMC 1GIGH 2CPCA 4H1LG 2K3TA 3T77B 4PRPE 4WUUB 3STLA 3IVKA 1FJ1B 2Q7YA 3EJJX 5HYIA 3JVGA 4J4PD 5JOPD 3DUSB 3IDXL 4WI6A 3K74B 5ISZD 5JNYA 5JW4Q 3KPOA 3OAYH 5FGSA 3MRKA 4JN1H 3UTTB 2GAZA 4Q9QL 4FXGA 3DX8A 1T83C 4CN6A 4UTAH 3V6ZA 4JO2H 1F2QA 5D2LE 4QRRE 4XBEL 2OZ4L 4PRID 1F6AB 3FT3A 4L4JA 4DJMA 1A2YB 2XN9B 5JW3H 3WDIA 1KCRH 1WIPA 5I66A 5JR1H 5F1KC 4G6JL 4JJ5B 1KNOB 1OAXL 4YK4C 5J06A 4JY6B 4KROC 3N50A 3WJLC 4DVRL 1A6WL 4LLUA 3N85H 2L7UA 1Y18A 5DC9B 3TVMA 1D5IL 1FG9C 1U8OB 3RVTC 4PBXA 1W0WA 3RWDB 5J57B 5C09B 3RGVB 4PJEE 3BVNA 3L5XH 3BN9C 3RIFF 1BZ7B 3ALWA 3O4LB 4Y7MA 4NNXA 3OPZL 4O2CB 4EZMA 3LS5H 4M00A 3CDGA 4S1DC 5DC0A 1AQDA 4RAUB 3E6FB 2VAAB 1BQHB 2AJYL 1QR1B 2WP3O 3MRJA 5I74B 1QSFE 1RZJL 5D8JH 1IAKA 1ETZA 2YPLE 4MS8C 2R9HC 1ZS8A 4PJCE 4Q97A 4XWOC 4PJHF 2F58L 1JPTL 5JOEA 3V6OA 2V5YA 3OAUL 3IAQA 4XAWH 4YBLC 1DE4B 1U6AH 2R0KH 3CX5J 1S7VB 5SWZD 4LAJH 2FHBA 4IIQC 3QWRA 3VGGA 4HXAH 2DKUA 2A6JB 5D5MA 5HVGB 5LQBH 5IM7B 1AXSA 5IMLB 3CH1B 2RBLA 4L9DA 4ZUWB 3ULVH 1MJ8H 2ZUTA 3NMEA 4L4TE 1AY1H 1T3FA 1QNZH 5CP7A 1TQBC 1IEAB 3GO1H 3IF1A 4XCEB 4Y4HD 3NZ8B 4CU8A 4Y5VC 5T1KD 1P5UA 5F44A 1WEJH 1QSED 4D0BA 5BRZD 4D3CH 1QD0A 1M71B 4WFFD 3NVQA 4J12A 1HEZB 1H3VA 1T66C 2A77H 2ZG2A 1N59A 3I6LD 1GC1H 3WJLA 5F9JA 4PV8A 4K3DH 1QSFA 4OZFB 5K59F 3BKCL 4RMTA 4L4VE 2Y7QB 5FGBC 3EOBB 4X98A 1UM6L 3VFRA 3WIFA 5J6HA 2MKLC 3E2HC 4LHUA 1U3ZA 2AS5M 2HG5A 4F57H 2APXA 4MLSA 3T8XB 2ZCKH 2KH2B 2PW2B 4G80B 3WL9B 1M4KA 5KVMC 5GGQL 1GOHA 2GCYB 1GPOL 2DQGH 3H9SD 2AV7A 2BNRE 2R0WH 3RA7H 4YHIA 2VB5A 1TZIB 3ZE2F 1IEHA 1RUQL 4U6VL 3T0WA 4FG6C 4HJJL 1LO0H 5F6IC 5HGGS 3ARGD 5C0CA 2WANA 4OCRL 2V9TA 3QH3B 4AEHH 4XCYB 3P30L 5DMYA 5IV2B 2PW1B 3PWPB 4TNVK 4LK4A 4QHMB 1AD0A 5FUZL 3WSQH 4J3VA 2K1MA 3RNKB 5T1DH 4DN4L 3V95A 5LXGL 5I1IH 1R5VA 5DJZA 2FO4B 1J05B 2R1WB 3AFLA 3MV8A 4K2UH 4N8VA 4XPFL 3MLWH 4WFGD 5DRXA 3UBXB 1KCLA 1JZ7A 2NTFB 4GSDL 4HJ0C 1DVFC 3O3AA 3MOBL 1JGLH 4Z76B 1OP5H 3RWEB 3D2UA 1JPTH 5KZCD 4XAWL 3EYOA 4X6FB 4IRSC 4LCWD 1Q9LB 2ADGA 1OOAA 4MWFA 4PJIB 3T0EE 4MQSB 3RL2A 2X9WA 4C56A 2BVOA 4MX7B 5T3XH 3RGHA 3MA7B 3CLFH 3VD3A 4XNQA 4YBQC 2VR9A 2X4QB 1G9NL 1ND0A 1XF4B 4NQDE 1F4AA 3BE1H 4PREA 4UIKL 4CVUA 1UACL 1S5IH 5C0AE 3KPNB 4NJAL 5B3NA 3GMOB 2EXWD 2HN7A 1VDGA 4ZFOB 5BCAA 4HUWB 4G8GA 5TF1H 3TBWB 3T0BA 3HMWH 5MEOA 3BD5A 4KKAD 1HHGA 5ITBL 2ITCA 2X05A 3UTQB 2A77L 2HT3C 2YR3A 2BNQE 4X99A 1BM3H 1OTUC 3VFVB 2FD6L 1UZ8B 4HK3N 1W8NA 4H0GA 5CD5D 5C0RH 5JUEH 1H5BA 1S9VB 2KZWA 4P5TC 3B2VH 4GG6B 1RZ7H 2BOBB 2NR6D 3FQTB 4OKVA 3BKYL 4QTHB 3OHXA 4RX4D 5GGTA 2NCMA 1YN7A 2QQNL 3WFEL 2FIKA 2YXMA 2PCPA 3FQUA 4JKKA 1UEMA 4S1RH 1RV6X 3IU4L 5CJ5A 2MNUA 2FLRT 1WICA 4JZNA 4YBHA 1IC1A 4ZXBA 3KPLA 2XZCH 1JZ5A 2V7NB 4J3TA 1RUQH 2H8PA 3VG9B 1I3UA 1GGBH 1JRHH 4NRYA 3ULVF 3FOMB 1BZ9A 3FFDB 1U8IA 1O7SA 2R4SL 3HE7C 3CAFA 1VA9A 2ADIB 3UBXI 3BO8B 2EDDA 1CR9H 1A47A 5CWSA 1QHOA 4JDZB 1ZHNB 4PJXB 5KS9B 2A1WH 1CF8L 2QKIA 1ITCA 3VG0H 2EIDA 3BZFA 3B5HA 5E1AB 5I76B 3VXUB 1EFXA 4KK8D 1K3ZA 4MAUH 4WFHE 3GB7A 5FYJL 4N0CD 2WAHA 3SGEI 3MOBH 1F5WA 2IEPA 1RIUL 3RX8A 3TESA 3BI9X 5F70A 5IMOA 4Q9QH 32C2B 1A8JH 1J8KA 5I16A 1FH5L 2NX5D 5B8CB 3KXFE 4XBEH 5GGUB 5DSCB 1NEZB 1JYNA 4KQ3L 4LOUC 1AQDB 1OTTD 4G6KH 5DFVD 4BZ2L 1PYWA 5D1QA 3IJSA 3MUGB 3G08A 4ZUWA 3MRDA 4KI1A 4P4KD 2JJWA 2DF3A 2VXQL 2YEZA 4ODTL 2V5RA 3QIUB 3IFNH 3V4UL 1ZOXA 1IM3B 4F15C 1TZIA 4DVRH 3F7YB 1NGQL 5DMGD 4YBQD 1FVEA 3U0TA 3B2UD 1VFUA 1A6WH 3ZDYE 3QIWB 3IS1X 1N2RA 4KQ4L 5C1MB 4PJ7B 3VJ6B 2XXCB 1F4WH 5EH1A 2EDTA 1CFTB 4F8TA 5E2VL 3C2AL 5BO1L 5F3HA 4FQJH 3PL6A 4Q6YA 5J9PB 3I6KB 5I8CB 1KIRA 1U95B 2QSCH 3BIAX 1LP9F 4TYUA 5ITBH 4IIQA 3JV6A 3VGHA 3TCLA 3TBYA 1P9MC 3L3GB 1DN0B 5DS8B 1MWAA 2PXYA 1OWWA 3EOBA 3IS0X 4QRPD 4O2FA 2EC9U 1ZWIA 1G0XA 1IT9L 1JMZA 1T1ZA 4KHXL 4LSPL 4W4OC 4KTEH 2B8OT 4QXWA 3UTZA 2CIIA 5SX5K 4LCCA 4AH2A 1G6RH 4JHBA 3RKPA 3RHWF 3WFEH 2HJKA 1MF2L 4PBWD 1A1OA 1TTGA 4NFCA 1E4KC 4JVWA 1J8HB 1KCUH 1UB6B 5D7IA 2VQUA 1CXHA 2XZCL 3JWDL 5DK2B 3VFMA 2NY5C 3CDCA 3EO1A 5C0FB 4JFYB 4U1GC 1NMAH 2XRAL 1HXYA 4PGDB 1BGXL 4DKEL 4BZYA 5D2NA 3HHRB 3TC9A 5EFIB 1K4CB 1PSKH 3D39D 4DKFL 4NM8H 3VXRA 2WWMD 5BV7L 4N0UB 1QRKA 4TRPH 3D39E 2EDEA 4KROB 2E6QA 1O7VA 4BQ9A 2B1HL 3CMOL 5JXAH 2EYRB 3KLDA 1VGKB 3VJ6A 1JGEB 4OCMC 4TVPH 1T7WA 3FQNB 1X5GA 5J89A 3M17B 5D6CB 4M93B 5TQ0L 4F58H 3LZFH 1NUDA 3C60C 4WWKA 5D7JC 1QLEH 2AJSH 3MOAH 1OSZB 4O58H 4ELMB 5I1LA 4K3DL 2EXWC 2P8PA 2M1KA 2UZXB 1CDGA 3NBNA 1H15A 4QY8A 2Q8AH 3QG6B 5IV2A 3OKEA 1FZOA 2ZG3A 3KAAA 3VXSB 4C83B 2X40A 3D3VE 2A9ML 3L3IA 5L0QB 3FRUB 4Z0XB 3MX0A 4X6BB 5AUMA 1RUPL 4R4BB 3BSZH 3LIZH 2OL3L 2CDGB 4IBLT 5C6WH 3BPNC 3OKEB 3LKOA 2UVFA 1KLUA 1I1YB 2GQHA 1T2QH 1ZVYA 5D1XD 3QJFB 2EIEA 4PJ8A 4JRXD 3WS3A 1P4LA 1TTUA 5CJXC 5LBSL 2R2BB 2ENYA 4ZDHA 4AEHL 2D31A 2G75A 5FB8B 1G7JB 5IIEB 5FO8A 4H5SA 1BAFH 3SDCA 3ZHDA 3BO8A 3RGVD 3QJFA 1EEQA 4ODBD 3NA9H 4HHAB 1FVDB 2F54D 1T7XA 1J0KA 3SOBL 1JZ2A 1RZGB 4LLYB 3CIQA 3CH8A 4YE4L 2R8SH 2DYPB 2J2ZA 4K2UL 4XPFH 1ND0B 1J86A 1CBVL 5F7KC 5J7CC 3V8CA 1YNTA 3ZYJA 3HB3D 4WTWA 3IVKB 4KTEL 2GK0B 5E8EA 1H9VA 4WUUA 1IZJA 5KVDH 1U91A 3KPMB 4A6YA 5I16B 3RBSA 1G6RL 5T1KA 2AGJH 2VXVH 1MF2H 1NEZA 2F58H 1UT9A 1NFDB 1IFHL 1EUTA 1XIWA 1TITA 5C0BD 4YEFA 3ARFB 1FNEA 3VFVA 1XGUB 4DUXA 1S9WB 2OXHA 4K71B 3ZDYF 4M7LT 5HY9B 5I66B 3FJTA 5INDA 1W0VA 2KPNA 2ED7A 4BSWA 2H9GB 1KJMB 4PJAF 3TZVD 1LD9B 1MSPA 4IHOB 5F1IA 5E9DE 3SDAC 2OMBA 4KK5D 4JQVC 3O0RL 4K9EL 2FJGB 3BKMH 2BXZA 2P46B 4FQLH 3U82B 4J6RL 1PZ5A 1BWMA 1BD2E 2KL6A 3OKLB 1DBMH 4K7PH 4LHUG 5MHSD 1FO0A 4NNYA 1BD2D 3BMWA 3DV6A 3HR5A 4TTDC 2MFNA 1EGJL 4A2LA 3ME0A 5DJCA 1YEFL 1Q72H 3DETD 3VFNB 4P59H 3KYKL 4XC3L 5IHUL 2FBOJ 3CZJA 3TNNA 2X1WL 2VLJD 2VKXA 3DX9B 1JE6A 3T65A 5ICYB 1M7DA 3QIBB 1UXSA 1UM6H 3LHPL 5IW6A 1P84J 3PWVA 1XZ0B 2E6PA 5BW7A 4QNPF 3S88H 2NXZB 3AVEA 4IMKC 5EOCJ 1T0MB 2Y9RT 1K8DB 1S7VA 1ZT4B 5DO2D 3T8XA 5EU7E 3ULUE 2MTPA 1RSFA 2R0WL 3ZSTA 1UB5A 35C8H 4N0YL 4EI5B 4RBPK 2P8LA 5JDSA 3JZ7A 5LCVL 1YNKL 4Z7WA 4XXDA 5IB4A 2DQEH 3UO1H 2XTJC 1CN4A 1CR9L 4K3JL 3VXTA 2OXGA 2I07A 4OV5A 2BDNH 4RGOH 4LQFL 2LU4A 2YA2A 3ARZA 3QH3A 4KKAC 1DN0A 4D2NA 1FO0L 2EDNA 3OZ9H 3RVUC 2R56L 3JV6B 5HSFA 3SKMA 3A67H 2CXKA 3OWEA 1SEQH 4LLWB 5EBWA 1HHKA 4R96B 3EUUA 4P5MA 4HQQL 4OUOA 2P8PB 1KLGA 4K8RL 5C0IB 2D7OA 1HEZA 4JRXE 2IPUK 1TMCB 1SBSL 1TVHB 4GOSA 4OCSL 3X14A 1R3KA 4K8RC 3HE6D 1U58A 2QBWA 4M1CD 2I9LB 5F89B 3ZKXC 4QNPE 5C0DB 1ZLVK 5JQHC 5HHOD 4R4BA 5EU4B 1FAIL 5GGVY 1MREL 1MJJA 3PWJA 3Q5TA 4X5LA 1F6AA 4G6KL 2P5WD 4I2XE 1HNFA 2VLRE 1DL7H 5CBEB 3QHZH 2OR7A 3P9LA 2WW8A 2VDNL 4ODTH 2M8XA 1WAAF 4ETQA 5E00A 4L8CA 5I1AB 5T3XL 4CDHA 3TJHC 5HYSB 4S1SL 1F8TL 5GGSY 3P9LB 3KPSD 2VL5A 2CH8A 2IPKA 5K93A 2R2EA 3FN0L 3LD8B 2EDJA 2QSCL 5ANME 5GRJL 3WEXB 5HI3D 4Z7NF 2JB5H 4XP1H 4LRNH 3W9EB 1LE5B 5BOZG 5MEND 3H7LA 5GXBB 5E7FA 3TO4C 1FHGA 2C7UB 4ZO6A 4OLVL 5TF1L 3D48R 2X4PA 1QVOB 3L3DB 2EH8H 3GMPB 4QRSB 4FS0A 4LVNB 4NJ9H 4ODWA 3BUYA 1KF9B 2IQAB 4HUUB 3DXAB 3BMVA 2A83A 4IRJA 4Y2OA 3UX9B 3JXAA 1UGNA 2WK2A 4KHXH 3D18B 4LSPH 3SO5A 5IVXE 2LU7A 2W92A 1RJZA 3QRFM 3L1OH 1DUZB 4LLDA 1DE4A 3O9WA 2EDKA 4UTBH 4C55A 5E6IB 4NQTA 4R2GB 3VWJC 5C0JB 4JHWH 3EYVB 1OP9A 1VEMA 4Z18A 2VMFA 1YN6B 2BVYA 3S36H 1OAZL 2N56A 3DJ9A 2P48B 5FGCE 2Y6SD 4Y88A 3KJ4C 3D0VA 2GHWB 1ZV5A 4WW2C 2FBJH 1I1AC 2CUIA 1JPFB 1BOGB 3I9GH 3UO1L 4Z7WE 4JLRA 3GMRB 2YN3A 3MZGB 2AJZB 3R1GL 4OV6F 4XCEA 4WNQA 4L4TA 3S34L 3SGDI 3BVNB 2VABB 5SX5H 4GAYA 9CGTA 1NAKL 4L3ED 3FO2A 2YHGA 3CFBA 5I75B 2Y4SA 4DZBB 4E0RB 1UCBH 5EU6B 4M8QB 5IEKB 3E8UL 2P49B 2ZPKH 3M45A 1MWAH 2R39A 3RTQD 4ZFOA 4XP6H 5CJOL 1A6UL 4JFPA 4Z7VF 4AT6A 4LHQB 3TNNB 4UV7H 4IRZH 1XMWA 4YHNB 1HWHB 4XNZB 4MS8D 2X4TB 1S9VA 3SE3C 3QULA 1SM3H 3NH7L 1UZ8A 2YKLH 3PE9A 1ED3B 1T6VN 4G80A 2GK2A 3LIZL 5F8RC 5F6IB 1LK2A 1HYSD 5D7IE 5BS0D 32C2A 1N4XL 1NSNH 2BY2A 4NQDD 1QR1A 1OGTA 2XWJB 3DO3A 2PYFB 4PJAB 5I1CH 3ZTJG 3ARXA 4G6AC 4WI5A 4IOSD 4IRSA 2FJFA 2ED8A 2FEDC 4RMSA 3QZWB 2Z8RA 2NZ9D 4W81A 4S1SH 3GMLA 3HI6H 4ODXB 4ZFZB 4HBQA 1KCVL 3L7FA 4DUVA 3P4LA 3T0ED 3JUYA 3MJ7A 3PWPD 1UJ3C 4GAGH 4PTUB 1QBLH 3EYUL 3HZYB 4OQ1A 5FUCC 3F65A 4LRNL 4NCC1 3H3PL 2XTLA 5EN2A 3UJJH 3GUTB 4XMPH 1QKZH 2PN5A 2UVEA 5CEZL 4AMKH 4YHML 2BHZA 4I9WE 1J12A 4IRJD 4KXZH 5EIIB 1EAPB 3OKOB 1K85A 4FQQA 3HAEB 2R8SL 2BNQA 3KDMB 5KAQF 1FYTA 1CBVH 3WNLA 1S7XA 2O5YH 2MCG1 4JY4A 4Y5VB 5F88B 2DWEA 4NCDA 2PR4L 1UJTA 3CPLB 1CXLA 3SDAA 3I3EA 4P2RA 5L8JB 3F12A 1OAKH 4M7KL 1J9CT 4LSQL 4OI7A 1OB1B 4OFKA 1FFOB 3RAJL 4UINH 2JCCB 1C12A 4AENB 4ZO8A 4P2RB 4ZS6C 5JPMB 1EV2E 5TDPA 4Z7VA 4M62L 4U0RB 4GH7B 4JFFA 5BOPA 4H88H 3P9MA 5EOQH 3ARSA 2YS4A 4S2SB 2XRAH 3T77A 1NJ9A 5KN5A 1GGCL 4NP4H 3QNXA 2QL1A 4HUWA 5DZOA 4FQLL 3UCRA 3GMMB 1DCLA 2BVUA 3GSVB 3MV8E 1BFOB 3T3ME 5JW4M 1TPXB 3MODL 1CLCA 1LO3L 3U4BL 1F90L 3FO0H 4OQTL 1ONQB 1GIGL 2P8LB 4AIXA 3BP6B 4PG9B 4IRZL 2AJSL 4HZAA 5C0ND 5TF0A 4YQXL 2XA3A 1ORSA 2RR3A 3UTSA 2RFXA 4APQD 2YN5A 4H26A 1BHGA 4MWFB 4PJIA 2YMXL 1OSPL 2IALA 4JHZA 3TLRA 4KGJA 3PIQA 2IMNA 3JWDC 3KPPB 4I3RL 4RFNB 2VKWA 3SDXB 1M7XA 1RMFH 1TVBB 3TCXA 3UJIH 4C56E 5IEHA 1Z0NA 3MJ6A 5HGAB 3OX8B 5F71A 3FO1B 3TIEB 5HI5D 3F7QA 1MCBA 3KPPA 3WXWH 3C9NB 1GXEA 1D9KD 2BXYA 3FOLA 3S5LA 4ORZC 3FRPG 5GIRA 1F4YL 2IFGA 4P46B 3QUZB 3BPLB 4LQFH 1T04A 1QA9A 1YYLL 4UOJA 4Z7QF 1ZGLA 1T5WA 1SEBA 1KC5H 2YD2A 4O9HH 4R96A 4NKMB 5FOBA 3L7EA 2F53D 3AS0A 4MLIA 3QIWD 3LEXA 4NQEB 4XC1H 4D9QD 5DHXB 4GRWE 2FL5B 2HKHL 3DVGB 3VI4E 2GTZA 3FRPA 4P2CG 1BX2B 2FX8L 3M8OH 3GJFA 1DVFB 2J8UE 4K8RH 4Z9KB 4EXKA 3DYOA 2I9LA 4WEBL 4KK6D 1G9ML 1P2CB 2DD8H 1XGRB 3E3QC 1G0YR 1JFQL 3HAEH 4GAJL 5EUOE 5F7DA 4MXQD 3FQRA 1F45A 4U1LB 5KVDL 3ARDA 3QPQD 4ZAKC 5C7XH 3BKJL 4BFBD 3TO4B 4HEPG 5DD6B 3MLTA 1UZ6F 4Y4HA 3ZE0F 1KJ2H 4PLKD 1IFHH 3IKKA 5CP3A 5EIVA 3PJSB 4M6AA 3NPZB 4UILH 2NLJB 2WINB 1JL8A 5EU3B 3PP3H 2FH8A 3O6MH 3OAZK 3ULVD 1IM3A 3MPCA 2DMBA 1MJ8L 3WMSA 4MD4B 4Y19D 4LARL 4BSVB 4DAGH 4RA3A 4HUVA 5D5MF 3S4SB 4CNIA 3VFSA 3MROA 3QUXA 3IFPA 4E41E 3GMQA 5FCUL 5AYUH 4CKVX 3GSXA 3UXFA 4WFFE 5KSAC 3BKML 5GGTL 5IEKA 3SKJH 3ARDD 3SDCB 5IK3B 5L88H 1I1FB 2JB5L 4DZBA 4F9LC 3NCMA 3EGSA 1AFVH 4NHCH 4H25A 5HGDA 4P3CL 1F6FB 2EH8L 1EK3A 2V9QA 4CRPA 1VGEL 1WTLA 4M4PA 5F7WC 2HLFC 3DMMD 3OKLA 4XBPB 1Y0LA 4PRBA 1QLFB 1L9NA 5DEGA 2J8UA 1DBAL 4XC3H 2VQTA 1MLCA 2VITA 1LO2H 1OD7A 4OI9A 4U1JA 3ZTNH 4WHDA 3GKWL 4JFHE 3V52L 4CW1A 4EVNB 1RMFL 2Z31C 3FQXB 5T1LA 2P1YA 4QYOA 2A6IA 3DX7A 1FZJB 3KNBA 3QDME 1J1PL 1AXIB 1LO4L 1UENA 1CDJA 4Z7VE 4YXKL 2YK1H 3FN9A 4RGMC 4FTVA 4N0YH 1LO0L 4CW1B 4DN3L 3BDXA 2ILLA 3S34H 5H2BA 2DOCA 5BZDB 3VXNA 5E6ID 3FQNA 1G1CA 2VDPL 3BPCA 4DKDC 1E4XI 3CFCH 5B21A 2NX5E 4Z76A 1Z3GH 4APQA 3ARWA 5T5NF 3V4VL 4Z5RB 4XB8A 3QUYA 3NACL 3GSWB 1YQ2A 3IDIB 1MCWM 1P4IH 2QADB 4ZFGH 1PZ5B 1PAMA 5DQ9B 1CL7I 1A6UH 2VN7A 1UM5L 3BN3B 4Q6IB 1J0JA 5KVFH 3HNSL 3L3JB 3U7YL 5ACZA 4WEBH 3C6LA 1J87A 2PXYD 4QRPA 4YJZL 2FYYA 3HE7A 5E1HB 3KG5A 1R3LA 2ID5A 3TJHD 5L2KA 2ICCA 5MERB 2F9BT 5FCSH 1HNGA 2B5IC 1QYGH 2NY2C 1IVLA 3EFFB 3LEVL 1WVZA 4X7SH 5F7HA 4OB5H 3WUWA 5H35B 1FYTB 2IG2L 3Q3GA 4HFWA 2V2TA 3QIUC 3INUL 5EU4A 1QFUL 3U9PL 2HT4D 4ZAKB 3D3VD 5DHVH 1EPFA 4PRAB 4PGCB 4WI2A 4KZEL 1UXWA 3A6CL 2VLJB 1R0AH 4LSDA 4D9LH 2VDNH 3OXRA 4PRDA 5FO8B 2NW2A 1U42A 5IB5A 4YHOL 2NZ9C 4KRNA 3GMPA 1Y6MR 4KV5E 4QRSA 5FKPB 5HHOB 3HLAA 4HWNA 1FLTX 1U8JA 1YEKH 3CUPB 3SE4C 4OBSA 1UM4L 4WCYH 1BQLH 4PB0L 4JZJC 1JF1A 5CEZH 5HDBF 1FVDA 5SWQB 2AK4A 1ZVSA 4Z7OE 5I8KH 3TBTB 4EOWL 2Y6SC 4G8IA 2DB8A 2BNQD 2FECI 3BWUC 5E4IA 2C7UA 1X5XA 4K7FA 4OIBA 4OZIE 3QFJE 3ULVE 2G2RB 4U0RC 1P1ZB 4QF1B 5DHYA 1NCCH 4BSJA 4TOYH 1ZSDB 3IDJA 3HS0A 4U1MA 4YFLF 3X17A 4NN6C 5IVOA 4KUZL 5ID1A 1PX3A 3U9UB 5FGBA 1SJHB 2VE6B 1EXUA 5DHYB 2E8ZA 4GW5A 1NLDL 4L3AA 1ZGLP 4HIHB 2NXYD 2GJ6A 5IEHB 2X4UA 1R24B 3FO1A 2YZ8A 3TIEA 1BIHA 5K9KB 5EA0H 1NDGA 3RJDA 4J3WA 1XEDA 5CUSL 3L3IB 1S78D 1JRHL 5CMAB 4MDIB 2NY4C 3DUUB 3OR6B 1JUFB 3SGJC 5KSAB 1QSEB 4X4ME 1XR9A 2J88L 3NFNA 3WNNA 4HG4K 2YXFA 2C4FT 3IDMA 4NO3B 2VDPH 1BLNA 2YUZA 4XP4L 2K7QA 4B53A 4EQ2A 1A6PA 4AEIL 1FNAA 4UT6H 1DLFL 1EAJA 4M5ZH 1NAKH 4F37K 1NGXB 3QIBC 1PKQE 4LHJB 4OQTH 2ED9A 3T2NH 1JWMA 4EIZC 1A3LL 1MHPH 1JZ8A 1FBIH 4PJFE 5JHDB 4GBXB 1PEZA 4RMWA 1T1YB 5EUKB 5IUSA 1IGMH 3P77A 3HUJE 4PGZA 4QRPE 1VFOA 2ZUYA 4LCCC 4JPWH 5HPMB 1TENA 4XCCL 4P49A 2XZQL 3LV3A 1EEYB 4GW4B 1NGZA 2VDQH 5E99L 5J11C 4Q9BA 1YEHL 1GGIL 4HUNB 3BQUA 4N90E 5TQ2H 1OAYH 4QTHA 3L3HA 2VDRL 1IBGH 5D6DA 5DWUL 1P9MA 4PLKC 4PY8I 4BZ2H 3TA3D 2E7LA 4WEMB 3UJIL 1KTKE 5K33A 3WLWD 1U91B 3KPMA 4U7MA 4NQDA 3O8XD 1PEWA 1XF3A 2IF7A 3PL6C 2W65A 2YA0A 3P0GB 4HWZB 3FQRB 4LCWB 4JGUA 4YC2C 5EZLA 3MCKA 4C56D 2V2WB 4JR9H 3T0DA 1DEDA 4KJYA 3H42H 1GCFA 1QRND 4ZPTA 5HHMB 4LP4A 1KC5L 3IKCA 7FABH 1WCQA 4LCWA 2FL5A 4K07A 4N0CC 5D2LF 1FC1A 3SDAB 2F19H 3BAEH 4KROD 4NFDA 3H3PH 4XC1L 3ARRA 3WXVL 4NNPL 4TVPE 1YJDL 4KDTC 4P2QE 4AMKL 4NDMA 3ZMRA 1TPXC 3KPQA 5TH2A 5D7LA 5TFSH 4ZUTB 2JTDA 3GNML 1D9KC 1X4XA 1V3LA 5J3HD 3GSRB 5L9DH 4M6NL 3RUGF 3PHSA 5E56A 2DRUA 4OZFG 3BKJH 3UZEA 1J5OL 3EHBD 5T3ZL 4XPTH 1YPZA 2AXFB 5BVJA 1MCKA 5ICXB 3N06B 1KPRA 2F5AH 5I1DA 1Z5LA 1EVTC 3TPUA 3U36A 2YD9A 4JPIB 4KI5F 3MMEA 4I9WD 4ORGB 4KKLD 2Q86A 3FB7A 3RTQB 1PSKL 2ATPA 3JVGC 2BC4B 5BVPL 3VXTB 3W0WE 3R8BB 5I19L 3ARED 1IKFL 3MNVB 1DLFH 5HHOA 4Y19E 5L88L 3I6KA 1RJLA 5I8CA 4XHQA 1SJXA 3VMOA 3BZEA 3CSGA 3ROOA 3T3PE 1T1XB 5C0CB 2DJ4A 1A3LH 1MHPL 1LO3H 5GGRA 3U4BH 2ZUSA 5CLWA 1BFOA 5E2WL 3FO0L 2Z91B 5EBGA 3CX2A 4UZGA 1YMHB 2R1YB 5ETUB 2JCCF 2VR5A 4OF5A 4XI5C 1S7XB 5T33H 4TQEH 4J2XA 3HAEA 5HVWA 1CD0A 5TH2B 5MENE 1X5IA 1RD6A 3KXFA 3ARBB 2FX9H 1U8KA 3KPSA 5MERA 1LNUB 4NPYB 3SKMB 2ZUXA 1CFSA 1KJ2A 3MRBA 2OL3H 4WTXA 5GISL 4FMFA 5E2TH 3HAEG 4HIHA 3MJ9A 1E27B 2XWTB 2ATKB 5MEQA 1GZPB 1HIML 2NY4B 3GB7B 3GSNB 1VKXA 4P2QD 2X4OA 5KSAA 4DN3H 3EO0B 4J1UA 1JYWA 2Z93A 1FZMB 1E27A 3HE6C 3HE6A 3O3DA 1WC7A 4YFLI 3TBSA 1KTLB 1YECL 1OLZA 4TN9A 3KHOA 4PJ9D 4NN5C 3K0WA 1NFIA 3VMNA 4KY1L 3DURB 3LKRB 4L3EE 1FZMA 4C4KT 3AUVA 3SOBH 3RX5A 4FN0A 5AZEH 2A83B 1FDLH 4IRJB 3V4PH 2R0ZH 3RVUD 1JHTB 2QLVB 3RKDC 2VZSA 5IWLC 4HJ0D 3HS0B 2C3XA 2OI9B 4O2EB 3U79A 3NCJH 4MA8H 4M6NH 1GJIA 3VFOB 3MJ8B 1DQTA 4YHPB 2NLJA 2GY5A 2C9AA 2WINA 1EJ6A 4V1DD 4YBLB 5IKCB 4JZJB 5DXWA 5T3ZH 3NFSH 4XWGL 4OIIL 1ZVSB 3BQUB 3JBG7 1CD1A 4FG6D 5DMKA 1OGTB 2XWJA 5BS0E 5GSVA 4GG6A 1K6QH 1KGCE 1KOAA 5K9QI 4Z8FL 4LPCA 3OKNB 4MMXC 4AQ1B 1MCCA 4QF1A 2GI7A 3R8QA 4UMGA 4G6JH 5EC2B 1GZPA 3EGSB 3O6ML 5E2JA 5HYQA 3F8UB 2X4SA 2XTJD 4PJXA 4PTTA 1T7YA 3OJVC 1EEZB 2LTQC 1I9JH 2DTML 1KB9K 5SWQA 4X7CC 2VLMD 3ISWA 4YZFE 1YC8A 1OHQA 4GFTB 2W38A 1SEBB 3BJLA 3KDMA 4R4NC 5TPWL 1AI1H 4GXVH 2RGSA 4NO2A 3UYPA 1ZAGA 3MGAA 4GW1B 5GRXG 2UV3A 1ULVA 3UPCA 4XXCA 5LKNA 4XNUL 4EN3A 4M1DH 1V05A 2B1AL 3GHEL 4MJIE 5C3LD 1OGAE 2OBGA 1TJGH 3KPLB 5B39G 2Z31B 2APWA 4OF6A 2VIRB 4KDWA 1GH7A 4HC1L 3S37L 2XZZA 4F7MB 2BOBA 3RUGE 3QDGE 3V52H 3ECBB 2NY0D 1NC4A 3GM0A 1T80A 4X6DE 1XGTA 4JY6A 3H2WA 3MRQB 4MDJB 1QOKA 3ARDC 5EZLB 1WUNT 3GK8H 4RFEA 3O2VL 2BRRH 4ODVH 4RCAA 2DTSA 4MYWB 2CLVA 5C07E 4BSWB 5K9JL 5C9JA 2NY3D 3H7BB 1QPPA 2IGFH 3HMXL 5MEPA 3ALPA 3VFTA 1JRHI 3CDFA 4R8WH 3NCYP 3TN0C 4QXUH 3HZYA 3T0EC 4UT6L 2FLBT 3VMPA 5F72S 4JB9L 4GRLD 3BGFB 5D9SA 2GTWA 1FO0H 1U58B 4XVSH 1J1XL 4QCIB 5D7LE 4YDLB 1KB5H 2YD6A 4LMQI 1I9IH 1BWWA 5HD8D 5J0BA 2E7LC 4H25B 4PG2A 3EDEA 2QADD 1HINL 1PKOA 3LQAC 1U93A 3KPQB 5B4MD 4ELMF 4KJPD 4CJ1A 3UYOD 1E6OH 1T4KA 1KEGH 5DJCB 4WWKD 4QY8B 5GS1A 5DRWA 1EMTL 4PJGE 2R23A 4OCSH 5E99H 4R7DA 3VD9A 1JTPA 2IH3B 3GMNB 2EDBA 1ZLWH 1D7FA 3AU1A 1NCNA 1A21A 4MNGA 3P0VH 3TM6A 4Y5XB 4F57L 1WLHA 4TUKL 4MJ4A 3LEVH 4JPIA 1MHHA 3AXLA 4N5ED 5KJRL 1DL7L 2EH7L 2N7BA 2Y07L 5JTWA 2IG2H 4AL8H 4MA7L 1U8QA 1CDYA 3CX5K 1WBXB 4I18B 4Q2ZA 1N0XL 2P42B 2MQCA 1CXEA 4U6YB 1U95A 4PJ5D 4JRYB 2UYLB 2YD8A 5T3ZD 2A9NL 3VH8G 4U6VH 5M95B 1LE9B 1KG0B 4RWYL 4OLEA 4KJWC 2EDQA 2IWGA 5CBAA 1NUNB 5KZCB 4NT6B 2Q7YB 1DQDL 1ADQL 3V0AC 1UVQB 3T1FB 5IMMA 2F19L 5IVNA 2X41A 4NO5A 4H8WH 2GTZB 1YJDH 4RA0C 3LEXB 2F53E 3VRIB 1XFPA 5JLZA 4XBGB 5ACLA 4OAWB 3JTSA 2EDRA 1G7LA 2B1AH 3GHEH 5IMKA 1P2CA 3L1OL 4P2OC 1QSZA 1CLOL 4NZJA 1CLYL 4MJIA 2ZZUT 3D0LB 3BQUC 3M07A 4WDIA 1J5OH 1JGLL 1KNOA 2YPLD 4XPTL 5EO9B 5JIKA 3L9RB 2NZIA 1Q9LA 3MO1A 4JG0L 1ODAA 4HH9A 4XRCA 1B6UA 1TCRB 4XTRD 5IT2H 4ODVL 5IG7B 1VKXB 3S4SA 1I7ZB 3OXRB 4FHBD 4QWWC 5HBBA 1M7DB 3QIBA 5C8JB 5DJ0A 2V17L 2BNRA 3QDJE 4NNXB 3LKSB 4PJEA 3MGTB 4EI6A 1ZTXH 43CAB 5DLMH 3NAAH 5D7JB 2NX5A 2D9QB 3L7EB 2VDML 3ARBC 3LS4L 1F4HA 1AGEA 1N64L 3W9EA 3LKPB 5EOTB 2PNDA 3QHFL 1Y18B 3TN0B 2P5ED 1MCLA 4PRHB 4BK4A 5E2WH 3ZKQD 4HS8L 4DGVH 3RIAF 5HI3C 2Z9TA 3BGFC 3FOLB 2VXUH 4H26B 5ALCH 2Q7NA 1H3XA 3AAZB 3MQIA 3UZQA 3NZHL 3VA2C 1UC6A 3VWJA 1RZJC 2A73A 1P6FA 1BM3L 1WV7T 3EOAB 1V8HA 2RIKA 4LASH 4HWBA 4PV9B 3NOIA 5CJXA 2YKLL 3VXOB 3B2VL 3P0VL 4U2YA 5EIQA 3ET9F 2WWKO 3KLHD 1YN6A 3ECBA 4LSUL 1B3JA 5C0BE 3TA3A 4F7MA 3PGFH 3P2TA 4H1LH 2DJSA 5FEBA 1P4BH 1HIMH 1U8HA 4IDJL 3JWOC 2W9DH 3B5TA 2NY2D 1X4ZA 2ERJC 2ZOKA 4FZ8L 3UPRA 1EHLL 4O2CA 5CINH 3CCHB 3IETB 2VAAA 4G9DB 1M71A 2J1KA 2VLRA 5ANMA 2YUWA 4APQB 1YECH 2VABA 4X6CA 2E27H 3PP4H 4CMHB 3JTTB 2C1PA 2MMXA 2E9IA 1KCSL 2GTWB 2I24N 3TO2B 1IQDB 4P5KA 3ARVA 5CP7B 4EDXB 1BJ1H 1JWSA 4D8PB 1F4XL 3C6LB 2NYYC 4G9FA 4AM0B 1AQKH 1B0WA 1HWGB 4IDLA 3UTSE 5E8DH 4WV1A 1T03L 1RK1A 3I02A 3F7VA 4D0BB 2VL4A 2M2DA 4KHTH 1AKJA 3VXMD 4YDVB 3GNMH 2D03L 4JFQA 1I8KA 5HHQA 4KVNL 4PRPB 4S0SD 4Y5XC 1EZVX 4TUOB 1FNGA 1OAKL 1IGJB 2YRPA 4OLXL 4OIIH 1WZKA 4NRXB 5KS9A 3GI8H 4PV9A 4XPHH 2Y7QA 2W0FB 3C5ZB 1QZ1A 3DBXA 3GMMA 3T4AB 1K6QL 4Z8FH 3G9VA 3V5DB 4FTVB 5ACMA 1MIMH 4MB5A 3PQYA 1YY8B 1U8IB 3G5VA 1QQDB 2DQCL 2XN9E 1DBJL 4BH7B 1NBZA 2P45B 5IESL 5L2JA 3NCBB 3RPIB 3DECA 4HFUL 2VO5A 2BFVH 5B8CA 2FGWH 4H20H 2JIXB 4XPAH 5CEZE 4NIKB 3N9GL 3D2UD 3RVVD 3OKMB 4LEXH 3EYQD 2AK4D 4FNLH 4QCIA 3DOSA 1AI1L 5ENWA 3JV4B 2DJUA 3IGAA 3QXDB 2AK4E 2F5BH 2COQA 5C09E 1DQJA 1HKFA 3ELAT 5EU7C 2EDOA 3WHE0 3U7WH 5JLZB 2SEBA 4X6EA 2HLAB 1T7ZA 3LSOB 1DFBL 5KVEL 5I9QC 2OMNA 5KG9B 4I3SL 5GS2D 2QHRL 4R26H 5E6IA 5IHZB 2J5LB 1J05A 4PR5A 3VFRB 2YMXH 1L6ZA 1IGIL 2W59A 3TWCL 1QSFB 4OZFA 3FL7A 3S7GA 4A2MA 3OMZA 2DLFL 1D5ZA 2VXTL 4KRPB 4CMMA 1OB1A 4F8QA 3UBXG 3M1BB 4JM2A 4JM2C 1CXIA 5GGVH 1QFOA 4YHLH 3UYRL 5CFHA 1J8HA 3LMJL 2HJFB 3ILPA 3DHMA 3O2VH 2BRRL 4JFFB 1JN6B 1YYML 3F7YA 4OGAC 4OZHE 3F7PC 5EO0A 5HHXH 1UA6L 3L3OB 3PQYB 3JWNC 2A0LC 1BGXH 3KYOA 3D5OF 4DKEH 4OLWH 5DEFA 5DJ0B 1U3HD 3WV0A 1CK0H 5D1XB 5DD5H 3AS3A 4KI5E 1KV3A 5FYLD 3TBYB 1Q1JH 2HVJB 3DGGB 3C08L 2YC1B 3MV7D 3LN9A 5TGBA 1AGDB 3KJ6L 3QXVA 1HH6A 5MI0C 1Q94B 1G7HB 5GS1B 3LKQA 4P5TB 5IW3A 3GJEA 5E8DL 5SV3A 2CXGA 1MJJB 1KELH 3THML 3QFJA 4ZTOH 4KFZC 4NFBA 2FO4A 1VEOA 3B9KB 4D0DA 4UUJB 2Q8AL 1T0NB 2JJVA 1YEDB 1C5CH 3QQNA 2VISB 3LKOB 1S8DA 5DFVC 2HT2D 3EO1B 3MV11 3DROB 3EKCA 1LNUA 4YX2L 5IB5B 5C0BA 4J3OC 2G5BA 5BJTA 1DUYB 2NY0B 2X1QA 3MBXH 5IF0B 1H15B 4AH2B 4U6XA 4WFEE 4G42B 2BNRB 2JELL 1FQ9C 4RWYH 2BFVL 1DBKH 3O6FB 4M8QA 4U1HB 1KYOK 1FYHB