1OAZL

Ige fv spe7 complexed with a recombinant thioredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
b'AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN 1
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 19
structure length 108
sequence length 108
chains with identical sequence N
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oazL00
4L4VA 1VGEH 3L7EB 1EAPB 1PD6A 2Z8RA 1JK8A 4Q6YA 1G7HB 2XACC 5HVGB 2E7CA 3W9DA 1U8HB 1BFOB 4KRPC 1HDMB 3O8XC 2GTZB 5DVMA 1WIPA 3L5WA 3PWNB 2EYRB 2J4WL 3AREC 4J1UB 4R7NA 4HEPG 1P2CA 4OZ4A 3VWJB 4OCYL 4WHTA 5CD5C 1QG3A 4Y19B 2PO6D 1BQHA 2R2BB 4JY5L 5AZEL 1JZ8A 5L0QB 5EZLB 1EBAA 1T20B 2WANA 4HIHB 1JP5A 4HJ0C 5FCUH 3EAKA 1RHFA 3T0ED 2UUDK 2ARWA 1IZJA 5C0AB 5F88A 1DL7L 5GHWH 2GKIA 3LRSB 4G80A 3L3HB 1SEQH 3C5SA 4Y4FC 3FO2A 1K3ZA 3TPUB 2P45B 3OKDB 4Z77B 4JFDA 1TJIH 4PJEE 4RMTA 2MPAL 4LEXL 2R1XA 1PBYA 5GS0C 1YEKH 4F57H 3MR9A 4Y16B 1K8DB 3IXAB 4LNRA 4Z0XB 1CFNA 1JZ4A 3MLUH 1M7DB 2BSTA 1UFUA 1BAFL 4NQXB 1UWEL 4R4FL 2VSCA 1WCBB 4M1CD 2NXYD 4XHQA 3V6OE 4EEEA 2ZUVA 3GM0A 3CFCL 2N56A 4GOSA 4S1RL 3O3BB 3BZFA 3UTTE 3UEZA 4BFEA 2P5WE 4DZBA 3QUMB 5D7JA 3IDGA 3WD5H 3ZKSD 4ISVA 3K1DA 3PQYB 1CQYA 1G7MA 5FUZL 4XPAL 3LDBC 3DV6B 3SBWC 2P7TB 4P2QD 2I24N 4KQ4L 3L9RA 4TULH 4QXGL 3QDHA 3ILPA 2EZ0D 1BEYL 4LDLB 4F15C 3UTPE 3HPLA 4HK0A 4N0YL 5F7DA 4ZUSB 1Q8MA 4XI5C 4R4BB 2Y72A 1IAOB 5C07E 3C09B 1JRHI 1PG7L 2N4IA 1ES0B 3HLAA 3JV6B 1QRNA 4ZDHA 3RWHB 4HUKB 4P2OB 5JW4Q 2XZCL 1UEMA 4Q9QL 3RAJH 2G75A 2VDOL 1FFNA 1MQKL 4HPOL 3WEXB 1N59A 3EO9H 3W82A 4ESKA 3I6KA 3QJFB 2CDGA 2E7BA 3B4NA 1CFBA 1J1OH 1UKSA 2HRLA 2Q8BL 2H32B 5IVXB 1F58L 5IJKC 2YPVL 1NC4A 3MNVB 1LK3H 2D7TH 3D69A 4QHLB 5EB9A 1NMCB 3L5XL 4OFIA 4JFHE 3VD5A 2FJFB 4OZFA 4WW2B 4WFGE 2Q7YA 4OZFH 3QI9C 5E5UB 4A6YA 5HVHB 4A6YH 2V7HA 2GAZB 4BK5A 2HH0H 1UJ3B 2F53E 4P99A 3HC3H 5INCA 2O93L 3CLEH 1OAUH 2F54D 3O3AA 3IGAB 2EE3A 1JPFA 1ZHKA 1QVOA 1YEIH 4WO4B 5IBUB 5EUKB 4Q2ZB 3RY6A 2I27N 1YPZF 2IF7A 4OLVL 3P4OB 5IROA 2NY7H 3F62A 1BJ8A 3O2WH 3IKKA 1X3DA 3OXRB 4M61B 1L7IH 4YX2H 1AI1L 2QV2A 4AIXA 4OKVA 1AHWB 3WS6A 5LVEA 4PP1C 4K3GA 4L29A 2QADC 5ACLA 4L5FL 3MFFA 2JJVA 4JRXD 4UTBH 5LWYH 1ED3A 4Y5XC 2ICEB 4H20L 1I75A 4B5EA 2OS7A 1A7QH 4GFTB 3RZWA 3NFPB 3T0VA 1F42A 2AK4D 3SEPA 3SPVB 1DSFH 1L9MA 2WBJA 4JY4B 5EA0L 4N8CH 3OB0K 5IQ7L 2P5EA 2B0SL 3L95B 5AYUL 5HHNB 3S96B 2ESVA 3M17B 3QIBA 3TJHC 2WUCH 2E6PA 4L9DA 2XOTA 3VXOA 5ICYB 4JDZA 7FABL 1MIEH 1I9RH 2GHWB 1I1CA 4RNRA 2QQNL 4MCYA 4WVRA 1WLHA 2H26B 4WFED 3DX6B 2JELL 4KVCH 4XVJL 4URTB 4S10A 3MLTB 2DI8A 3S3JA 4WUUB 1FFOA 4JO1H 1DBJL 3LAFA 4L4TE 3TN0D 1U8NA 2WZPD 3NIGF 3WFCL 3ALWA 3W11D 3CZFB 1CVRA 4HC1L 5A3ID 5KS9A 2VE6A 3IDUA 2ZUSA 4GKNB 2O5ZL 1RUMH 3QCVH 5C0GB 1SEBB 3MLPA 3GK8L 4LKCB 1J1XL 3CVHA 3H42L 1A7PL 4XPHL 3UZVB 5GSVA 1DQMH 3CVHH 1G7PA 4LGRB 1OWRM 1CL7L 3QHZH 3SCMB 4MVBC 4NCC2 2BFVH 4LHUD 3NIDE 2AKRA 4G9FE 1A6AA 5DD3H 1AGDA 1RVFH 3OJVC 2XPGB 3MGAA 4F7TB 3SE8H 1IGJA 1FZJA 3H9SD 3BAEH 4Z8FH 1OLLA 2GT9B 5JW5B 2R29L 1LP9B 2PTVA 1Y18A 4ONHB 4MAUH 4TUJA 3KAAA 4EKXA 1MHPL 1B4RA 4KHTH 5A2JH 4PRIA 1CGXA 1IC1A 2IH1B 3PP4H 2A83A 3L3JB 4U1IA 5CCKL 3LKQB 1UADC 2A0LD 4QHKJ 3C60D 2LQRA 4AM0A 1U8KB 3MQIA 2QJDA 4G6FB 3TFKC 4P49A 3X17A 4ALAH 1T2QL 3Q6GH 2GSIA 5B4MC 3QEHA 3DLQR 3AAZA 3EYVA 4MQ7B 1YNTA 2C7UA 4AIZA 1EXUB 4XMPL 1QYGH 4WJ5A 4EN3B 1U3HB 5IB4B 4MCZB 1CFTA 1ORSA 4JB9H 3MV9B 2WLYA 3VFSB 1DBBL 1HYSD 3CFKB 2FH8A 4CAGA 2VLKE 1PAMA 3D3VD 3BO8A 1EO8H 1NGPL 5E8DH 3RBGA 1HHHB 1TITA 1GPOH 3CDFA 2ZUQB 5ALCH 2CLRA 3MRNB 3WS6C 2EDFA 1D9KA 5D7SH 1YYMH 1INQB 4D94A 2C3XA 5E99L 2QSCL 2LE9A 3EJZD 1S9XA 4RIRA 5AWNL 3L5HA 5D6DA 1DEDA 4I3RH 3WUWA 1WAAE 4HUXA 2X6MA 4NQCB 5HHQB 4PJIE 4YBQD 5BZWB 4GRLB 4M6MH 1S78C 4N8VA 3HMWL 2KL6A 3ARDD 4L3CA 2B1HL 4HDIA 1AGBB 3UAJD 1C1EL 4YDJA 3LQAL 4Y2DA 1UEYA 5FHAL 3HZVB 5D7IE 3DETC 2VAJA 4UT7H 3UX9B 5JPMB 4KKBC 5A43C 1FYTA 2AGJL 3H9YA 4JDTL 4KV5E 1T5WB 3R06A 3RUGB 4MJ5B 4PGCA 1TJGH 3HCVA 1AO7A 3LEXB 1RY7B 4CMHC 5T3XE 1UM4H 3ZZ1A 3LH2H 3RGHA 4ZPVB 1OQXA 4WCYH 5IMKA 2NXYC 2GFBB 3TYFA 3QXUA 1KPVB 1TCMA 3NTCH 4CU7A 1BVLB 4U1NB 1A9BA 2IBZY 2R9HD 1PQZB 3OAYH 5EUOE 4NCDA 2EXWD 3CSYB 2GUOA 5KVEH 1W8OA 1FZMA 3TT1H 4Z7VF 4YHKL 2OR9L 5E2VH 4BZ2H 3RU8L 1U58A 3QAZB 2NX5E 3I9GL 4QWWD 3K3QA 1UB6A 4Y19D 2FRGP 4JFZL 1MCOH 4OZIF 4LGPB 3VW3L 2V17L 3BEWB 2E6QA 1C5DA 3QSKB 1KNOB 2NYYC 4U1GC 4WFHE 4X80H 1HIML 4WI8A 3ZSSA 3RPKA 1QLEL 2PR4L 1N6UA 4I77H 3HFML 4RWYH 3HUJF 2Y06L 4XXCC 2Z92A 1FFRA 4K3DL 2NY4D 2R23B 4F7MB 3LN5A 4G7VL 3OR7B 3VI3E 3FO9B 4JDVA 4PJEB 5HD8D 1AD0B 2GJ6E 1FAIH 2X1PA 2HLFC 1KIRB 4OFYA 1HEZA 4Y16D 3H3PH 1T1WB 2QQLH 2YN5A 1JNNL 4HJJL 4EIZC 2FJHA 2FEDD 3BIKA 4HZLA 2FEEL 1EIBA 3PGDA 2Q76A 3PXHA 1MCRA 3I75A 1U93A 1JRHL 3DGGB 5E8NA 3UTTB 3VFVB 3LPGA 1G7IA 5ACZA 5L88H 1QACA 2P5WB 3SE3A 2PTTA 3HE7D 1LK2B 1YEDA 1EMTH 4XCEA 4X7CC 1F5WA 4KJYA 4FNLL 5DRXA 5C0EB 4HLZH 4HWEL 5GRXG 1BFVH 2VLLB 4OCWH 3X13B 12E8L 3BRDA 3T2OA 3VFNA 2X05A 5TE6H 3EYUH 3DMMB 1T22B 4RX4A 1MIMH 1ZGLP 5I1HH 1GZPA 2NTFB 1ZT1B 3NFNA 5C07B 3R8QA 3I02B 2YSSB 3JWDL 3PL6A 1F45A 2LAAA 4JHAH 2HG5B 5LJYH 4P2OD 5EC2A 5K93A 1BF2A 1DUYB 3LS5L 1IAIH 3MACH 3LCYA 3B9KA 1GGCL 3MRRB 2O26U 3GGWA 1BP3B 5JOEA 1F4HA 1BZ9A 1ZLWH 2AV1B 5EU6E 4KJQD 3WIFA 1S9KC 3EYOA 4R90L 1WEJH 3IFOB 1VEPA 4PV8A 1OTTC 3MLXL 5K9KB 4NKDA 1QSEE 4U6VL 2HVJA 1R6VA 2F53B 3CK0L 4JVUA 3JV4A 1AFVL 3UPAA 2RB8A 4XP6H 1X5AA 3ARFB 1OARL 2BSRA 1HNGA 3GJEA 3IFNL 4PJ8A 4CVZA 3BGFB 5T3ZD 5GSRB 1KLUA 2F19L 2C3VA 4XX1G 1T5XA 5I2IB 3WS3B 4MLIA 1BVZA 3SKUD 1WT5C 1Q0YL 1JI1A 4WHYH 1I85C 1A6UH 1O7SA 4NN7C 3FQTA 4DVRL 4QRTA 3AB0B 4OIBA 2VXTH 2PYEE 5F93C 1TQCB 5HHMD 3BPCA 1BQSA 5AUMA 5L2JB 5CUSH 2W65A 5C0IA 2FYYB 2HJLA 5HHOE 2EECA 3SKOA 1A1NB 4KROB 3VFOB 4P4KD 5H35B 1KJMA 2VABA 4U1SA 1AQDA 4LSRL 4NYLA 1RJYA 2FHFA 5E94A 1WFUA 4DN4H 4UB0L 4BUGA 2JIXB 4Z95H 4M7ZB 4GH7B 3KPQB 5MHSE 4LPVA 1MVUA 5DYOA 2WIIA 1LD9A 3VD7A 6CGTA 4HPYH 1DFBL 3MGTB 5F3HA 2Y5TA 4PGDA 3WFBL 3VFMA 2DM7A 1DCLA 4H1LG 3ZTNH 4XVUD 2DYPA 1Q9KA 4P23D 5L7XH 1SQ2N 1CDGA 3AMKA 2YOCA 3CX5J 2MCG1 4HGKC 3RA7H 2XA8L 4S1QH 4MNQE 1DQLL 2X09A 1IFHH 4H8WC 1X4XA 4L4TB 4N0FB 4WUUD 4JAMB 3EOAA 1BD2D 3GI9L 4MJ6B 1NFKA 4DW2L 2W91A 4YZFE 5FOBA 3VXRA 3FRPG 3QPXH 1KV3A 1FL6B 1WBYA 4YQXL 3GSUB 2OJEB 3P0YL 3UBXB 2APFA 1K6QL 1UM6H 5T1MA 3FT2A 4FQPA 2Z8SA 4GQ9L 4K23H 3B9AA 2AJ3A 2FD6H 4X83A 4HIEB 4O58H 4DKFL 2GI7A 3SCMD 4N0RA 5CZXC 5L9DH 1CZ8H 5DD6A 3QDME 1CVSC 1NJ9B 4NQDE 2C1OA 4HUUB 4G9FB 1NAMB 4XH2B 4PRPA 3QPQC 1MI5A 3TWCL 2M1KA 3GUTB 2X4QA 4YBHA 2UZIH 5CJOH 3V8CA 5TF1H 4J3WA 1JGLL 4YDIH 4YR6A 4JGMA 4XZUA 3E6FA 4S1DC 3FN0H 3HZYA 3WMSA 3VXTB 5K59F 4XAWH 3RGVA 3MV01 4LLVB 5MEQA 1BIIB 5ILTL 3WSQH 1PZ5B 4NQTA 3BKML 3RWGB 1XGPA 3BIBX 3X14B 4H0HB 1KXQE 3MCKA 1IQDB 4BH7A 1J05A 3KNBB 5KVGL 1WZLA 3OZ9H 2W92A 1ZAGA 4G6FD 4Y5YA 3TGXA 3PIQB 4HX1A 1U92B 3CDGA 3PDOB 3LHPH 3P30L 5SWZD 1FVDA 3C8KB 3FJTA 4XCYB 1FG2A 4U0RB 1D6VH 2IGFL 3GMMA 4EN3D 5EBWA 2ADGB 3L3IA 1ORQA 2VXSL 3BMWA 5EZOH 1R0AL 5IB3B 4ZUVA 3T04D 3RNKA 1F8TL 4G42A 3PV6B 3OPZL 4K3HA 3N85L 3ZE0F 4LSQL 2VLKB 5AD0B 1R3KA 4XPBH 2W9LA 4WU7A 4WEBL 3DTXB 3QNYA 4X8XA 1VFBB 1MCDA 4L1DA 1AH1A 3TH4T 4ZPTB 1G7LB 4L1HA 2D7MA 3BP7B 5F1NB 5C0ND 2D31A 3RQ3A 4P46B 4PJIB 5GGRA 3OJMB 3S5LG 1E27A 3HNVH 4JFQA 1JYWA 3V5KA 4GRLD 5ESVA 5JIKA 3T0WA 1QFWM 4CADA 2OLDA 3D48R 1G7JB 4UQ2B 3BI9X 3LEYL 3LV3A 5D7IB 4YLQT 5DA4A 1BM3L 4LLYA 1ZT7B 3IDMB 2V2WA 3KYNA 3UTSA 4KPHH 4X5LA 3CLFL 2HFEB 3I3BA 5KBNC 1NCUA 2FL5A 1IL1A 2BCKA 1Z9LA 4WEMB 4ZO6A 1YA5A 1UVQA 4G3YH 5HJ3A 5DUMH 3SDAD 5C08D 2FEDC 1VKXA 4JFYB 1NH6A 4Z7QE 5TPWH 5JOFA 1NLBH 2DLEA 1MUJB 1RZFH 2LTQB 5JW3H 3L6FA 3ZHDA 5H94A 3WIHL 3C5JA 3MLYL 2CJUL 1MRDL 4R96A 3OWEA 5FHBL 2Q7NA 3MUY1 4OIAA 2AEPH 4W6YB 1K4DB 2VXUL 5ANME 2XXMB 3EOTL 4TQEL 5EIIA 1FVEB 1MY7A 4K3EH 4P3CL 3WXVL 2NX5B 1KB5A 1FH5H 1BJ1J 4P5TA 2WQ8A 5FUCC 1KB5H 4PJCA 1A0QH 2VDKH 1S8DA 3SE9H 2HMIC 4EQ2A 5DK2B 3V0AC 4I8DA 3BWUC 4OF6A 4ODTH 4OZGE 4GUPA 4DGVL 4Q9RL 5B38A 2X4OA 4KUCF 5DK0A 3DROA 4MAYA 3RHWF 1NPUA 4OF3A 4ZFOB 1KYOK 2Q1EA 3VCLB 2YPKB 3E6HA 1K9TA 1YEEH 4WNQB 1RZJH 4WTZG 5CINL 35C8H 5MP6L 3MOBL 3NIFE 4FQ2H 3P0VH 4Z7WA 1KSRA 2GJ6B 1IEAA 2X7LA 4X99A 4HHAB 5FO9B 3P77B 5B39G 1LNUB 1J1PH 3PABA 5DJYB 1T1YA 2OK0L 2X4TA 1MQ8A 3QG7L 2OTUB 1U8IB 1YNKH 4JVPA 1VADB 1YY8B 5T5FH 2ICWA 3A6CL 4IDJH 5D5MA 4HFUH 4Y5YC 3BZEA 3OF6D 5CILH 4C59B 2P5WD 5IB1B 4K07A 5C0RH 3RVVD 1YUHA 1GGUA 4ODSL 5H2BB 1NBQA 5IR1B 1XGUB 1KJ2A 1KJ2H 2CKBB 5BOZG 4UU9B 1OCWH 5CKAA 1B2WL 1I7RA 3BPNB 1ZEAH 1OT1A 2VJXA 3LKSA 4IBLT 1ZGLA 4ENED 2EDXA 4MB4A 5I8KL 1NFDA 3UTPD 2FR4B 1BBDL 4G6JH 1N5YH 2YWYA 1EGJL 4NUGH 5I8EB 3MV8D 1A7OH 3MRPB 3U2SB 2BVTA 2C26A 1IC5L 4GXVH 4RQQB 3TIDA 5JPNB 4QXTB 3B5TA 25C8L 3VH8B 5BS0E 1ZV5A 2EYTB 4P4KC 1X5GA 3RZCD 5D70H 2GCYA 4I18B 3L7FA 5EU6B 3MBXH 1QKZH 2ITDA 4Y1AE 4AY0A 2A1WL 4NP4H 5DHYA 1RK1B 5C92A 4NT6B 3VWKA 3P9MA 4JFHD 4UIMA 2X89A 3VG0H 2LU7A 4HWZA 1QSEB 4R0LB 5FCSH 2ZJSL 1FNSL 3WDJA 1YEGH 1TDQA 3IETB 1T0MB 5FO8A 3T2NH 2F53D 2XNAB 5MI0C 4F7CB 5HDQL 1MFAH 4PJXA 3TBWA 4RA0C 2I60L 3ARFD 1UA6H 1PGRB 2ADJB 1URLA 2VISA 3TLRA 3VJ6B 1RZIB 5BXFB 4CVXB 1WQVT 1Z9SA 3T0AA 1GC1C 1KBGL 2VQ1B 1XR9B 2J6EA 4LLWA 4ZSOA 5IFJA 2J6EH 2W0FB 1P7QD 1CF8L 4BQCA 1I1FA 4HXAH 5KSUA 1OGAA 1T2JA 1FAKT 5E1HB 2OTWA 1RK0A 1NCTA 2ADIB 1MCPH 3EO1B 2ZPKL 1HYRC 4Y4KA 3S36H 5I1DA 2PYEB 5KS9F 2GY7B 2R2HB 1RD6A 3O3EA 1YDPA 5HHOB 3AU1B 3DUUA 1IAMA 3JTSB 1LO5A 1U0QA 3JSSA 4KROD 4OD1H 4HGWA 1W72L 3B3IB 2BNRA 1MFNA 3B2UC 1KLGB 3RY5A 1M7IB 1IGYA 3TIEB 4GG6E 3GI8H 5JUEH 3BWAA 3FN9A 4G8FB 3KXFA 1MFDH 1RZJC 3C6SA 3G5VB 4N5UA 5DJAA 1NSNH 5ADPL 1WFTA 4GMTL 1YN7A 5TDNB 1AGEB 4HCRA 1JHKL 4JFEA 4HCRH 4M4RA 1QR4A 2R2EB 4QTHA 3W2DH 4BM7A 3BN9D 1CGTA 4ACPA 4HAFA 4KK8D 2W60A 5KAQF 4MNQB 4F7EB 5LGJA 2YS4A 3SOBL 1T1ZB 4RFNC 4IEFB 2CXKA 2QQKH 5H8DA 1S9WA 3MNWB 3QUXB 4GRMB 3LKOA 4M9PA 1J8HA 2X4PA 4Y4HB 2NZ9D 3LRHA 3V4VL 2VWEE 5LQBH 3MLWL 4EI5C 1OY3B 4R8WH 2JCCE 5D7KE 4MWFB 2VQUA 5JW4M 4XNQB 4PJ5A 4RMWA 5SX5H 5HYSG 2WV3A 1NEZA 5EU7C 4F33B 4B7IA 2RGSA 3PWPA 4GMSL 1X4ZA 3QDMB 5DMGD 2R39A 4PB0L 4NQDB 1NANH 3DX8B 3ULVE 1A9EA 2BDNL 1VCAA 2ID5A 4JPKL 4G8GA 1ONQB 3DX7B 3BFOA 3OMZA 3LSOB 5J57B 4UINH 3UXFA 5I6XC 4RWHA 4X4ZA 1QLFB 4MJIE 3QCTH 3JXAA 5KOVC 4NN5B 2Z31B 1ZE3C 3VG9C 5JHLH 1CU4L 1PW3A 5DI8A 3VDCA 5FGSA 2EYSB 4N5ED 5JR1L 1BQHG 4XGZB 2PCPA 4FXGB 1QLRA 1S9YB 4NWUL 1JZ3A 3AS3A 1S7SA 3F7YA 1G9MH 1TTUA 4LVEA 1WTGT 1WZ1H 3GSOA 3UZEA 1CT8B 5F21B 3V0WH 1MHCB 5ETUB 2Y6SC 3BYYA 3PV7A 2Y7QB 4D0BB 3SDAC 2I5YH 3T1WA 5FV2A 4QYOA 4JZNA 4ZFGH 2A6DB 4DZ8B 3FO1A 8CGTA 4ZXBD 1QFWI 3G5YB 1QO3A 2IQ9H 3MLVL 2X44D 2CDEA 2DDQH 5BQ7B 5SWSA 3KPNA 3L3OA 3WYRA 4OLWH 3QCUH 3GBML 3SN6N 5IVNA 1G9NL 2HT3C 5CMAB 4YHIB 1OPGL 1FL3B 2EO9A 2B1AH 1IT9L 2PUQT 3LKRA 4NO2B 5FK9B 5E9DE 2ZKHH 3F7QA 4M48L 1XGQB 3P4MA 3FHQA 1X5XA 4LU5H 5CP3A 4P46D 4KI5C 4NO3A 4U6YA 3QA3A 4MD5B 1AGCA 5CP3H 4NNYB 3G5ZA 2DRUA 2E8YA 4LK4A 4TPRL 5HI5D 3SDDD 5TFSL 4AG4H 3BT2H 3QUYB 1BWMA 2ENSA 2FJGB 3SGKA 1NKRA 5I1IH 2SEBB 5ABDE 2RJMA 3V8OA 4TUOA 1IEBB 1GL4B 2V9TA 1MWAB 3IAQA 4XC1L 1JPGB 5FYJE 1BZ7A 4H25B 1DQDL 5SWQA 4OV5A 4GG8A 1ZWIA 1JF5A 1LEGA 3HZKA 4PGEB 5EOQH 2Q8BH 1MH5A 4MX7B 3TA3A 4QT5A 2FGZA 3FB5B 4XP4L 1KOAA 3BN3B 1INEH 5K9JL 3IF1B 1KPUB 3MLRL 1KF9B 2AI0L 3GNML 1QNZH 2I9TA 4HJGB 1OAXL 1RUPL 1KCRL 1KPRA 5MENE 4HUMB 5EPMA 1REIA 3FO0L 2Q6WB 5CP7B 1OSPH 5GISH 3ZKQD 4P57A 1EFXD 1BMGA 1XF4B 1QOKA 2AXGB 3MODL 5KVFL 3PDDA 4OZFG 5T33H 5ANMB 5GJSH 3VXUE 1E6JH 3FOLB 4RAHA 1T4KB 2EE2A 2NX5D 3E2HB 5DEFA 5GZND 1DVFB 3RTQC 5EZJA 4G7YL 4PY8J 1ZT4B 4BKLB 4FFYL 3V0VB 1Q9WB 1R3JB 3RDTA 4JG1H 4I5BA 4WI6A 2AABL 3TZVD 3O6FC 2JK5A 2DWEB 2VLMD 1C7TA 4OZGB 2VZTA 2BSSA 2PXYA 1EHLH 5DJ2A 4IRSB 3KPSE 1ADQL 2VERN 1GGIH 5CGTA 4K94L 1ZMYA 2CR6A 3T4YB 4XNXL 2J88H 2GJ6D 3O6KH 1V3MA 3PJSB 4N0UE 4KK5D 5EA0H 3ZT6A 3WE6B 3HC4H 2B0SH 1MPAH 4WU5B 2AK1H 1R5VB 2ZUUA 1G9MC 4TNWF 4XPFL 3OKOA 1CE1H 2PW2B 5EIVA 4JANB 2PO6A 1A6WH 4M7KH 3X3GH 3SGJC 4XT1C 4LSPH 1CGSL 1ZOXA 5E8OA 2BVEA 2WINB 1HHGB 2OZ4A 2ZSVA 1DN2A 2DQIL 2OZ4H 2OP4L 5FYLH 5KVDH 1VFAB 1B0GB 5E6IA 5C09A 3NPSB 2FH6A 4FFZH 1J0HA 4D0DB 3STLA 3LQMA 2I07B 1YECL 4GAGL 4JKPL 1CD1B 2BVQB 3BUYB 5LGHL 5IGXH 3KJ6H 4ODBD 1KEMH 4M62L 3ZT5A 4Z7NF 5FF6A 5TDPA 1BOGA 3U0PB 2YK1L 4N1CA 4ZD3H 1FCCA 3DYPA 1CLZH 5EBMA 5HYFA 1PLGL 5DVKA 4RDQF 3SDXA 2EICA 2XWBB 4OI9A 2X4UA 5BS0B 1TVHB 1KIPB 4NBYB 1WWWX 3BPOC 2C9AA 4HUVA 4JPIB 4I9WD 1RJZB 4Y1AB 3SGKC 2NY5H 1ZLVH 4Z76A 1DLFL 2YA1A 3LKPA 4YXLL 1W8NA 3FOMA 1JPST 3TCXA 3JWOH 1QSED 3OAYK 5GRYA 2JB5H 3AFLA 2CRIA 1PX3A 1DBML 1F6LL 3FCTA 1MFCL 4TUKL 2MNUA 4AT6A 2QBWA 3FONA 4QHNA 5KAQG 3WL9A 2X4RB 4X6BA 3O45B 3L3GA 4UQ3A 4PG2C 4CL7A 1N26A 1G0YR 2B39A 3TCLB 5BZDA 4NO5B 1SBSL 4IS6A 1U2HA 1JMZA 3UROR 4IMLA 1B9ZA 1CDYA 2VITB 2KUTA 3W9EB 4M00A 1A3LH 2IH3A 2WP3O 4TVPE 3JVGC 4FTVE 3U82B 3D87B 3OHXB 5C3TA 4OSUL 2QHLA 1R3LA 5F89B 5CGMA 4M5ZH 5IOPB 5F6HJ 1I3RA 2PYED 4XNUL 4ZQKA 3C5ZB 4V1DE 2YUXA 3EJYD 3EYQD 3RDTC 5IEKB 3LN4A 2DWDB 2NTSP 2IQAB 5HHOD 1JV5B 4XAKE 3FT3B 3BDXA 4OF8A 3BD4A 4GG6B 1L7TL 1QFPA 3S37L 4U31A 4G6KH 4P5KB 3O9WD 5B3JF 2ERJB 1E4WL 1JCKA 1T89A 2NY2C 3VMPA 1TPXB 5I1LA 5FM5O 4X9GA 2FECI 5DWUL 1U95A 2FX9L 4ZFFA 3VXSE 1WZKA 1HN1A 3WUWG 3VD3A 2FGWL 5HGAA 4NOBA 1WC7A 2Z8VC 4MNQD 3C9NB 3G6AB 3MXWL 5DRNA 2PNDA 4YPGB 4N8VG 5IFAL 3OR6B 5HHPA 4J4PD 4J6RL 2AEQH 4JRXA 1JNLH 1LE5B 3F12A 4HQQL 1I7TB 3KPLB 5F6IB 4Y4HD 5TE7L 3MBEB 4X6CE 4NQSB 3HA0A 2AK4A 2VKXA 1EEYA 3GSWB 3Q6FB 2JCCB 1TZHB 5F71A 3IS1X 5E6IC 1GGYA 4NFCA 5FYKL 4TSBL 1N5AA 1JHTB 5HYQB 1X5YA 5EDXA 1QSVA 2WM0A 5A16B 4IMKA 2Y9RT 5TH2A 3U30C 3RX8A 2YD9A 4TN9A 3JV0A 3QDMD 4WW1A 1YJDH 3SDYH 1ZLWK 4HFWA 5IIEB 1BPVA 2BY3A 5IP4A 1BF8A 3D85B 2XWJA 3ROOA 3BQUA 2EH8L 5DD1L 4MJIB 5D4QA 1V7MH 2DQTH 4EOWL 4JVWA 5I75C 4QOKE 5JXED 3TN0A 1FPTL 2H9GB 2AP2A 3Q1SL 2NY1D 4X7TB 5JNYB 3C2AL 4NQEE 2NY5C 2AJZB 5EU5B 5FYJU 4X4ME 1IAIM 4WY7H 3UYPA 3U1SL 3CGTA 1T1XB 4ETQA 3A6OA 4HUWB 3BGMB 3QHTC 1HQRA 3JWOC 5AG8A 4IRZH 3DO7B 5GRJL 5D7LE 4L8SB 5FECA 1M6OB 2YUVA 4KTDL 4QCIA 3SY0A 3ZYOA 2OQJB 2YMXL 3QIUD 1F4WH 1I8LA 1L0YA 1HWGB 5J3HD 3KLHD 3PWLA 5I18H 2GJJA 3L5IA 3H9HB 5GQBA 4OJFH 2EIBA 4OCNC 3P11H 2AQ3A 2OJZL 1P1ZB 1WITA 3DUSB 4P3DB 2CIKB 3C6LA 4V2BA 4Y5VB 5BW7C 5D1QA 5I73B 3HMXL 1A1OB 4UDTA 1XEDA 2EC8A 4QNPE 3RVXD 2W0KA 3WIIL 2NW3A 2ZCLH 3CFBB 4YEFA 4Z7UE 3HTLX 3BP6B 1FIGH 3MCLL 5E9DB 4PJGE 3DWTA 4YAQA 3QT2A 3GMOA 4PGBB 4OD3H 1NCAL 1TZIA 5L2KD 5DRWB 1U8MA 4NUJB 4KK9D 1FJ1B 3MRLA 4YE4H 4HLZG 4Z7OF 1HHJA 2XZQL 5ENWA 4PJCF 2V5TA 43CAA 4FQXB 4YUEH 5C0BD 3QUYD 1J5OL 4KTEH 1C08B 1CXHA 4GAJH 2IADB 1MRFL 5HTSA 1OAKL 3LS5H 4LLQA 4MJ2A 3WDIA 3H7BA 2AXFB 5DT1L 5FOJA 5DSCA 1T89C 3OJDB 2CMRH 5AZ2H 4POUB 1OGTB 4GRWE 1XZ0A 3MMEA 3KS0H 5IBLC 3I2CH 4X4YB 5I30L 1W0WA 3WJLA 1AC6A 2BOBB 1I9JH 1N6QH 1G6VK 2G9HB 4NGHL 5CSGA 4R90H 3D3VA 4TTDD 2P8PB 4F37F 1I1AB 3FHAA 3UYRH 5MENB 4YIQB 3LQZB 3TNNB 5GS0L 1T21A 1E6OH 3CK0H 4PRHD 3KLAA 3RVTC 5K9OB 2E9BA 3VXUB 3HS0B 4QHUB 3BIAX 4HWNA 1BJMA 1FGNH 2N7AA 1UC6A 1Q94B 2YD6A 3TBSB 5D5MF 4GBXD 4PRDB 5EORL 4MJ4A 1K8IB 3RNQB 3V7AG 5BOPA 1GIGH 4GAYB 2IPKA 1NC2A 1NGQH 2BC4A 3A67L 3G6JE 5DJZA 3ULUH 5LBSH 3RP1A 4NZTL 5JO5A 5I74B 3ARSA 3K81A 4UV4H 4DVRH 1CDHA 1J10A 2VDQL 4RDQG 3S88L 5IT2H 5KN5B 4GW5B 3KPSB 2ZOKA 3VRJA 5ISZE 1ZTXH 3HI1B 1LO3L 3FRUB 4K71C 1U41A 5IHLB 3L7EA 1NFDF 1EAPA 4WHYG 4DFIA 3SJVE 3TT3H 3IFPA 1KN4L 1GGTA 5F3BB 3ARRA 1G7HA 2IBGA 4LSRH 2FB4H 3W5NA 1K4CB 4N0UB 3WHE1 5JMOC 1U8HA 1BFOA 5KOMC 2QQQA 1HDMA 2GTZA 3MLZL 3PWNA 2EYRA 4Q74A 4J1UA 1UH4A 3VWJA 5EU4B 2Z91B 4Y19A 4R4ND 5IVZB 2WP3T 2R2BA 4CJ1A 3NPZB 4X5WB 3CUPB 1PDKA 5I8OH 1F02I 1RIHH 4LIQE 4BA8A 1C5BL 4HS6B 5EZLA 1I8LC 1T20A 4YHLL 4HIHA 2NR6D 3QEGH 1AXTL 4OQ1A 3U0WH 5C0AA 4OFDA 4ELKB 2J8UE 4TTGA 3LRSA 3L3HA 3C6LC 2AJSL 4PJXF 4JM2D 5IB5B 5J7CC 4HZAA 1VGEL 5FA3B 3X11B 3U48A 4FG6D 1PKOA 4YQXH 4IOSD 5EO9B 2AJUH 3IRPX 3TPUA 3OKDA 4Z77A 1ND0B 2HN7B 1K6QH 2NXZC 3QUZC 1V7NH 1OAYH 4Y16A 1K8DA 2NY0D 2XTJC 3IXAA 4Z0XA 5J13C 4DK3A 1CG9B 1M7DA 3K8MA 3EJYC 4NQXA 1WCBA 4KKAD 3E8UH 5CAYB 3V2AR 2Y07H 1QA9B 1DQTA 3O3BA 4X4XB 1GHFH 4OCLC 3JWDC 2UWEE 1PVHA 3ZKXC 3QUMA 4DGIH 2YPLE 4UMGA 3QUMH 1JGLH 2GK2A 3PQYA 3MOAH 3NA9H 5FCUL 5FDWB 3DV6A 3OKMB 4NNPH 2P7TA 5D1ZD 4G8EB 5EN2B 2VH5H 2GW5A 3FQWB 4HIIB 5GHWL 4NNXB 3WJLC 1KXTB 1SEQL 4ZUSA 4CKVX 5D1XD 4JO4H 4R4BA 1V3LA 2YA0A 3TVMC 1EZVY 1DANT 3MRHB 1TJIL 4XWGH 1ES0A 3JV6A 4J4PC 1YEKL 3RWHA 4F57L 4P2OA 1YEHH 3ZE2F 2F5BH 2VSDA 1XF5B 3QH3B 3CC5B 3MLUL 4PFEA 3WEXA 4CRPA 1TTGA 2NNAB 3P30H 2A6JB 1JWUB 3QJFA 2HYMA 4LCCB 4FTVB 4K7PH 2H32A 3ZKMD 2H32H 3GSVB 4FOMA 4E9LA 3AM8C 5IVXA 2FECL 3MNVA 4QHLA 4V1DB 2BMKB 2FJFA 4WW2A 3KPMB 4UT9H 4F37K 3ULUC 2AJYH 1D5IH 5HDLA 1A21A 2EDJA 2HJKB 3GHEH 2GAZA 1T0NA 1UJ3A 1PSKH 4TULL 4UUJB 1I7ZB 1CICB 1MCNA 1MHEB 2D9CA 2V2XB 3IGAA 4WO4A 1M71B 5EUKA 1HXYB 3MFGB 3BXNB 4Q2ZA 5T3ZH 1T7XA 3P4OA 2A9MH 4OGAD 1Z5LB 3LEYH 3VXSB 5DO2D 5J6HB 4OCRL 1R24A 3RAJL 3KPRE 4BFIB 2DN7A 4Z18A 3F7VB 1RFDH 4M61A 3EO9L 1DE4B 3ARBB 1AHWA 3MJ9A 3VWJC 1RUKH 4HG4J 2BK8A 2RBLA 1J1OL 3MJ9H 4WTWA 1T7ZA 1EUTA 1F3DJ 1UYWH 3GB7B 2ICEA 3HR5B 3WKMH 2VR4A 1JTPA 1LWRA 4LLDB 5HPOA 3EDDA 1LK3L 4X6CB 1QSFD 3MBED 4ZODA 3BJLA 3NFPA 4B7LA 2VLJD 2QKIB 3KLHC 3REWB 5CGYC 3SPVA 1FFPB 2IAMC 3ZDXE 4JFDE 5JHDE 4JY4A 4OTXH 2IANE 2HKHH 4A6YL 4AQOA 4KY1L 4WI3A 3QDJE 4EDWL 2HH0L 4O02H 3SQOH 3TYGH 1CTOA 3L95A 5FYKU 3HC3L 5HHNA 3S96A 1IAII 2APTA 3CLEL 3M17A 1OAUL 4PJ7E 4BFBD 1EEQA 2DICA 3ULVD 1YEIL 1HKLH 5ICYA 4ZUTB 2BJML 4JZJB 3DIFB 3D85D 1QBAA 3QHFH 5FM5M 4IOFD 1V3KA 2H26A 2NY7L 2VXVH 3DX6A 3O2WL 4AYFA 4QOKB 1B88A 1MJUH 3MLTA 1INDH 1KG0B 3ES6B 3P2TA 4WUUA 1L7IL 5HI4C 2HTKD 2ICES 3NFSH 1JZ7A 1NQBA 3O6LH 1JGDA 3CZFA 5EBLB 3VGFA 3ESUF 4UTBL 4GKNA 4F7PB 2O5YH 5C0GA 1A7QL 3IAGC 1JF1B 1SEBA 1KCUH 2AV7A 5BV7B 4WFFE 4YHNB 4LKCA 4Z78B 4ZS7H 3H6JA 5EFIB 5B38G 3PG2A 5DRZB 5D7LB 2YD5A 5DEZA 1N64H 4N8CL 4P5MB 1QRNE 3SCMA 3D0LA 4QRPA 2VLRB 1DP0A 3S37X 5FV1L 2GIYA 4WV1B 1YY9D 4TTDC 4L3EE 1QTYT 2WUCL 5F1IB 4ELME 4L9LB 4WIQA 2XPGA 1MIEL 1I9RL 1VGKB 3U46B 4F7TA 1MCQA 4U6HB 3F8UB 1SVZA 4KVCL 4OIIH 5DJ0B 4NBXB 3B9VA 2GT9A 5JW5A 5CBAB 3S98A 2RCSH 2VOTA 3CDYA 3GO1H 3G9VA 4XPTH 4MQXD 4JO1L 4TSAH 2Y36H 3WCYA 4DEPB 3STZB 2OMBA 4Z7UB 2GJZB 4PJGB 4LASH 3D1MC 2IH1A 5E9DD 3ZTJH 3L3JA 2UVFA 4RCAA 1DTUA 2ILLA 1RUML 4HKXB 4O5LH 3QCVL 3LKQA 2XRAH 3HE6C 5FGCE 4Q9CA 5DFVD 3HB3D 3MXVH 1U8KA 4S2SB 4OZHE 1DQML 3CVHL 4RMRA 3ZYJA 3Q3GB 4E42B 1UJ3C 3QHZL 4FP8H 4N9GB 2PN5A 1EPFA 3VGBA 1BZQK 1MOEA 1CDUA 25C8H 2BFVL 3U79A 4MQ7A 2UVEA 4XTRC 5FYJD 1EXUA 2FBOJ 4WO4C 1MEXH 5DD3L 5E7FA 5DC4B 1RVFL 2R0WH 4GRWB 4I0PD 1U3HA 4EN3A 5IB4A 4MCZA 4NJAH 2DQGH 3LS4H 3MV9A 3VFSA 1A5FH 1BECA 5MEPB 1Z0MA 3CFKA 2R69H 2QTEA 2AAVA 3X12A 4Z8FL 4JFFD 3V9FA 4FMKA 1HHHA 2CDFB 3MRNA 4MAUL 3VFUB 5T1DH 5D71H 1INQA 4KHTL 3CXHK 4LDOB 2ADFH 1UKQA 1T83A 3FZUC 3PP4L 5F7MC 4NQCA 5HHQA 1NGWB 3VXUD 5BZWA 4GRLA 4UDUB 1RURH 2MWCA 4X6EB 3VMNA 2J12B 1X44A 5CZVH 1AGBA 4AENB 4ALAL 3HZVA 1JYNA 3T65B 3SO3C 3GBLA 5JPMA 1IGFH 3KYAA 2B4CH 1X5HA 1PEZA 3G6JB 4FG6C 1WFOA 3VFWB 1T5WA 3RUGA 1QYGL 4YEEA 4MJ5A 3IRZA 1EK3A 4FQLL 3LEXA 4PTTB 3BKYH 2X41A 2NY0C 5ISZB 4WUKH 5F72S 4JB9L 4M9OA 5DUBB 32C2B 3BOVA 4XNMB 4ZPVA 4LOUD 3AREB 3SJVB 5BJTB 1SJXA 2YHGA 1EO8L 5E8DL 3P40A 1C12A 1GPOL 4PTUB 1KPVA 1V8HA 1NMBH 4U1NA 5D96C 2XFXB 5D7SL 1PQZA 3SDXF 4KZEH 2JJSA 1YYML 1PEWA 3CSYA 2B20A 3OL2A 2V2TB 4F58H 4I3RL 4UAOB 5C9KA 3SDCD 3O3UN 1NEUA 3AY4A 2FX7H 3D2UD 5DMYA 3WO3B 15C8H 4M6ML 4LCUB 5ADPH 5I15H 1XH3B 5EOCH 5TDOB 5M95B 1H3XA 3BEWA 1KNOA 4UT7L 3BHBB 1XF3B 4Y4FB 2R1YB 1ZSDB 4M7LT 5DQDH 2L7JA 3S34H 1OTSD 4X6DE 1EEZB 1FV1B 1TJGL 2J8UB 4EZMA 4QRQB 1SHMA 1XCQB 1ZLSH 2GEEA 4PRIE 1WWCA 1UM4L 2R23A 3JUZA 3LH2L 4F7MA 3OR7A 1FGVL 2R56H 4WCYL 4NRXB 4PJEA 1AD0A 5KZCB 1KIRA 3N0PB 5E2WH 3ZKMC 1T1WA 5HDBF 5ELIA 5KW9H 5DZOA 5F7HA 1TTFA 4NWTH 4BQBA 1KENH 5I1AB 3U9PH 2P24B 5KVEL 2VUOA 2F5AL 3TT1L 4PGJA 2F54E 3B5HA 1CXKA 5E2VL 3V6OA 4BZ2L 3LIZH 1RULH 3E3QC 3BRGC 3LDBB 4XWOD 1A4KB 3DGGA 1KIUA 3UTTA 3FQRB 2YWZA 1EO5A 3VFVA 3OF6A 1CD0A 1NEZG 2UWEB 4HF5H 2BNQD 1UG9A 1ZS8B 1LK2A 1MCOL 2YPLB 4F15B 5FM4A 3MRGB 4YHPB 5E4IA 4X80L 4DN3H 2Z35B 5C0EA 1DDHB 4I77L 4F9LC 2VLLA 3X13A 5DURD 4B0MM 4RWYL 1RUAH 4G6AD 3MRJB 1R3HB 4JY6B 2E7LA 4GAFB 5HGHB 3DMMA 1T22A 4WWKD 3MV11 4MSWB 2NTFA 4UNVA 1ZT1A 2NZIA 2H41A 5C07A 2XT1B 3I02A 2YSSA 2OX5A 2F58H 1FAIL 5HGBA 4L8CB 3FB6A 2HG5A 5J4MA 3H3PL 1DUYA 5JTWA 2QQLL 1U9KA 5HHXH 5FB8B 4XVSH 4LSUH 3TBTB 1HCFX 1T83C 3RVWD 4HK3N 4TVPD 3QDGB 3MRRA 4PYGA 4HAGA 4FTVD 4PJ9D 1S7UB 4PJBE 2X4NB 1P9MA 3K7UA 1JFQH 1WBZB 5EOTA 4HIJB 4I48B 5L88L 4V1DD 1AR2A 5F9WC 3IFOA 3SKMB 5DVNA 1EMTL 4ZTOH 2R15A 4U3XA 2B4CC 2MKWA 1J9CT 4NRYB 2ZCKH 3EDFA 2PETA 4N1HB 5K9KA 2NW2B 1RZGB 4HWBA 3TO4D 4GT7A 4Q58C 4XAKD 2A77H 4HWBH 3SQBA 2F53A 1AP2B 1BFVL 4OCWL 1CGUA 5HYEA 1CICD 3ARFA 5GS1C 4UNTA 5TE6L 4A2MA 2HP4A 3EYUL 1MIML 5I1HL 3OGCB 2QADB 5GSRA 3TM6A 3QR2A 4HH9B 3PWVA 5JIPA 4Y5XB 5GGSB 3UJJH 5K9QG 2EXYD 4G6MH 3WS3A 5GPRA 5IFHH 3VXSD 5F70A 3KPRB 3BDYH 5E00A 4RFOH 1IAIL 4WI4A 2VDRH 3MACL 5DEGB 1JPSL 1MCLA 1G7QB 2CQVA 3AY4C 1U91B 3ARBD 3WN5C 4DKDC 5C71A 4ZNCD 3KLSA 1T7VA 3QAZC 2L7UA 1ETZB 4EVNA 3NN8B 4XP4H 5L2JA 2FYYA 4ONGH 5E08H 3D9AH 1WEJL 1A1NA 4OFPA 3H9SE 1RV6X 3BD3A 4HWUA 3GNMH 4PGZA 3UMTA 5I0ZA 5H35A 3FO2B 1AE6H 4JFDB 5JHDB 5CJBA 2IANB 2BVOB 5IWLC 2JIXA 3QDJB 3MR9B 4MZ3A 4QGYA 4U4BA 3KPQA 4JR9H 3QQ9D 2OL3B 2J1KA 1J18A 4PBVC 1LQSR 4PR5B 4XP6L 4PJ7B 4XP1L 3MGTA 1X4YA 3ARVA 2AEWA 4YHYC 2JTDA 3OKNB 1ZLVK 3GSQB 4JRWA 1KJ3H 4Q97A 5FEBA 4N90E 3TBVB 1CS6A 4C56D 4QOKD 5J89A 4GS7B 1QPPA 5KSAD 4L4TA 4XNZC 3INUH 4GXUM 1A6UL 4JAMA 5F9DC 5JA8B 3STBA 4MJ6A 2R4RL 2VXTL 5F7KC 3V5HB 1SMOA 2X42A 4NQED 5CUSL 1FL6A 4BUHA 3GSUA 3RWCB 4HK0B 1VACB 2OJEA 3ARZA 3FTGB 1UB5A 2HWZH 3UBXA 4XRCB 3DSFH 4AEHH 3U7WH 3H0TB 4XC3H 1NCCH 5D7LD 4I0PC 3OGOE 4HIEA 1QRNB 1LE9B 4DN4L 4BQ6A 4Z95L 2X9XA 3LB6D 5DDHB 5JIHA 2EE9A 1NCBL 1NJ9A 3RPIB 1GGBH 3DMMC 4HPYL 4HUUA 4L3EB 4G9FA 1NAMA 4XH2A 3DARA 1NDGB 4ELMB 1NAMH 3ZTNL 1BQUA 1IILE 3GUTA 5L7XL 2IFFH 4U05A 3OKEA 1E28B 2EDRA 1OTUD 2DM2A 4KJWD 4H26B 3RA7L 3VXTA 3BEVB 4S1QL 2Q8AH 1DBAH 2IWGA 4MMZC 4ZOAA 5FYKD 1IFHL 4LLVA 5KSBE 4U1KB 1BIIA 4P4RB 3MX0A 2WK2A 1CE6B 1PZ5A 3RWGA 4XP5H 3X14A 5GGSY 1YEJH 1IQDA 1OD7A 3QPXL 4PG9A 3KNBA 4M62H 4MA3B 2XTLA 5FGCB 3G5XB 4X6FA 5EZIH 4OZHB 1UM6L 2H8PB 2ZOLB 4QHKI 4OM1H 5BRZA 4K23L 5DLMH 5IMLB 4ODXB 2FD6L 4O58L 1U92A 3CZJA 3PDOA 4XBGB 1NUDA 2XN9D 5L9DL 1CZ8L 4LF3B 5EO0B 3C8KA 3N1FC 4LOUC 3ULUF 2IFGA 4XCYA 2HTLD 3OB8A 2WSKA 1AKJD 4KKCC 3MFFB 2ADGA 5CEYB 1F6FB 2K3TA 2UZIL 4QRRE 1H5BC 3IKCB 3PHQB 5CJOL 3PV6A 5TF1L 4YDIL 1P4LB 4NFDA 2VLKA 3FN0L 5AD0A 3L3DB 1X9QA 1CK0H 4XAWL 3MRCB 3WXWH 2VXQH 3DTXA 3HN3A 1XIWC 1VFBA 4ZNEE 3WSQL 2M8XA 2VUYA 4ZPTA 1G7LA 1WAAA 3BP7A 5F1NA 4LCWD 3HZMB 4D9LH 4P46A 4PJIA 4ZUWB 2ZSWB 1NANI 3WFEH 3OG4B 1AGFB 4J3TA 1FFQA 2QR0B 3OZ9L 3PF2A 1G7JA 4UQ2A 2VMFA 1RIUL 4ZS6D 5D7IA 2WIMA 5DC0A 4J2XA 4CMHB 1JMXA 1A4JB 4U7KA 5DUPH 3LHPL 1ZT7A 1MLCB 1IM3B 3T77B 4MHHG 3EBAA 2JKXA 2NXYB 1F4XH 1FFOB 2HFEA 2M26A 1Z3GH 4LMQI 4KRPD 5EZOL 3O8XD 5MERB 5T3XH 5GRUH 4JFYA 5GGUB 3ARED 4K7FB 3SJVD 1XF2B 3FKUS 1MUJA 4XPBL 4LRIC 1HQ4B 5CD5D 5FUCE 4JN1H 4ZOCA 3HNTL 5C6WH 2R1WB 3DI3B 4MA8H 1K4DA 4U1GB 4K94C 5J9PB 1FVEA 4HJ0D 4EDXB 3HNVL 2AKRB 2NX5A 3VI4F 5CJ5A 1IKNA 4PRPE 4F80A 2ICCA 1AR1D 1B4JH 3WFZA 1QD0A 5J11C 2FGWH 1OW0C 5DK2A 4FABH 3P4NB 2EKSB 5DMKB 4OLYL 4KPHL 1E4KA 4X6DB 4ZFOA 5GS0D 1J87A 2V7NB 4J6RH 1NGXB 5I76B 1C7SA 3VCLA 2YPKA 2RHEA 4YDVB 4PBXA 4PRIB 4Y0GA 4G3YL 5K9QI 5DUML 5TE7H 5DVLA 2A83B 3RJDA 1OP9A 4MXVF 1OQOA 5TPWL 1NLBL 1IARB 2GJ6A 2HRPH 2X2YA 3REVB 1MCIA 4PJ9C 1RZFL 5JW3L 4HHAA 5FO9A 2KBGA 5ITBH 1LNUA 1F3JB 5DJYA 1CXLA 1T6WA 5EC1B 3GDBA 2AEPL 2F54B 1U8IA 3OKLA 1VENA 1VADA 4K3EL 3OXSB 1YY8A 1FH5L 4OCMC 2EDOA 5IVXF 1KB5L 1A0QL 1IGMH 2C3GA 1KELH 4W6XB 2VDKL 3T3MF 5IB1A 2YPLD 2ZG2A 3SE9L 4AQ1B 4WW2F 2XKSA 1DLHB 5H2BA 3NACH 4LVNC 1XGUA 4OD2B 4XI5D 2DLTA 4ODTL 1JZ5A 1X5FA 4U0RC 2CKBA 1TQBC 4UU9A 3QP3A 2IMMA 2CKBH 1QFWH 3Q1SH 4I4WB 3ZDZF 5HHME 4YH6A 3C2AH 5B39A 3MUHL 1YZZA 5DHVB 1RZJL 2FR4A 3L3KB 35C8L 3FB8B 5I8EA 4FQ2L 3P0VL 4U1JB 1S7WB 3MRPA 4KXZI 3U2SA 2ZG1A 1QUNA 4RQQA 3QG6B 1CD9B 5JPNA 4QXTA 4JKKA 3VH8A 4P48A 3GKWH 1J1PL 2BY2A 2EYTA 1GCFA 3QI9D 2VDPH 1YNKL 5AAWA 3H8NA 4I18A 2CD0A 3R06B 4PJBB 5EU6A 2W9EH 3K74B 4RRPA 3BH8B 5T5FL 4XNYH 4IDJL 4HFUL 5I66B 5INDB 4U33A 1I1RA 1IAKA 1RK1A 5CILL 4NT6A 3QFDB 1PG7W 4N8PA 3UJTH 5C0RL 4U3HA 1IGTB 4JKMA 1NFIB 1QSEA 3DHMA 4R0LA 3PUCA 1KJ2L 3IETA 3I85A 1BD2E 1OCWL 2XNAA 4F7CA 4M3KB 1ZEAL 3LMJH 4YJZL 5HI3C 1NCAH 3TNMB 2ADJA 1QQDB 3VJ6A 2G5BB 5BXFA 4CVXA 4G6JL 1N5YL 4NUGL 4CDGC 4NN7B 4PP1D 4POYA 2QADD 1XR9A 2VQ1A 2LTQC 1YQVL 1A7OL 2VDMH 4JFPA 4GXVL 4FN0A 1ZVYA 2W0FA 1Q9LB 3JTTB 1FL5B 4LHUB 3AXLB 2ADIA 5D70L 4F9PA 3EO1A 5IB2B 2BZDA 2PYEA 3G6DH 1FVCB 3MUGB 2R2HA 3MBXL 2Z92B 3P3YA 4NP4L 3BRFA 3H9ZA 2V5YA 5HHOA 2P48B 3AU1A 5E5RB 4NGHH 3H9SB 4PV9B 4RSVA 3JTSA 5D2NE 3VXQB 4RAUB 4LVHC 4PLNC 3B3IA 1B0RB 4K9EH 1RJLB 5CJQH 2LV4A 4OFVA 1KLGA 1S7VB 1NDMB 2NMSA 4JFDD 4Z7WE 5GZOC 2IAND 1M7IA 3TIEA 4JCMA 1YEGL 5C1MB 1OHQA 3QDJD 3T2NL 3RKDC 4G8FA 1MFAL 1RZ7H 3G5VA 4KJWC 1UA6L 1ZKAA 3Q5YA 3C60B 1AGEA 4OM0H 4C55A 4QO1A 4GLRH 3IS0X 2J6EL 3X3FH 3BKJH 3KYOA 4MNQA 1LP9F 4HXAL 4F7EA 5SWZE 1KEGL 3MA7B 5DRXB 1MCPL 5LCVH 4HUNB 3MNWA 3QUXA 4G9DB 5CJXC 3S36L 1G1YA 4Y4HA 1WUNT 4MVBD 2DMBA 2Y1VA 4DWHA 1E4XH 2D0FA 3BH9B 4HD9A 4OD1L 2RR3A 1GOHA 4RBPK 4OUOA 4MWFA 2KKQA 4XNQA 2DM3A 2H2SD 5CLWA 2APXA 3UC0H 4F33A 1QRND 4CW1B 3GI8L 5JUEL 4OI7A 3QDMA 4GXUN 5DR5H 4AMKH 4P2YA 4NQDA 3V79C 2R8SH 1LEIB 4L3ED 5IW1B 1NSNL 1PY9A 1ONQA 1IQWH 3LSOA 1R3IH 1NMAH 4HCRL 4BZ1H 3OQ3B 1Y6KR 4B41A 1NC4D 1B3JA 2Z31A 3HKFA 3W2DL 4ZAKC 3QJHB 4PV8B 1EZVX 4F2MB 4JQVA 1CDIA 5KSBB 2EYSA 2VDNH 4NKDB 1I1YB 4IRJA 3TFKD 4I18C 4XGZA 4FXGA 2QQKL 4J7RA 1S9YA 5CIPB 4Z5RB 2G5RA 1S5HB 5B4MD 4JZOB 4YHMH 43C9B 2J7LA 4L3AA 5LQBL 5C08E 2VZOA 1MLBB 4R8WL 4FXKB 3ALPA 4ORGB 4CVZB 2XY2A 3R4DA 1CT8A 1MHCA 5ETUA 3IDYC 4ZSOE 2Y7QA 3TH2T 4D0BA 1QZ1A 4N1EA 4IIQC 2A6DA 4DZ8A 4NSKB 3RUGF 2MCPH 5AAMA 2YC1A 3SKNB 3G5YA 3O11B 5JXAH 4E5XB 4UINL 5BQ7A 5CEZH 4HBCH 4QRRB 3BPCB 5HVWA 2ED9A 1HOCB 3GJFB 3QCTL 4M6OH 5C0IB 1D5BB 1D5MB 2MHAB 4U2YA 5K33A 3VXPA 5I17A 4IJ3C 4LVOC 5JHLL 4KI5E 5CMAA 2JJTA 5KVMC 1S78D 3RJQB 1N7MH 4NO2A 5FK9A 1TZGH 5IKCB 3ULSA 4TOYH 3DETD 1AR1C 2NY4B 1XGQA 4HV8B 4KKBD 1G9ML 2V5SA 2WIIB 1IVLA 4YPJA 2ESVD 4X8JB 4MD5A 4NNYA 1WZ1L 1RU9H 1F3RB 5C7XH 6FABH 1S9VB 3RY4A 3QUYA 5GGQH 5F9OH 1WWBX 1JGUL 2SEBA 3KVQA 3ESVF 3V0WL 2DQHH 3IDIB 3MRDB 1IEBA 4DUWA 5I0DA 1U3JA 1MWAA 1MWAH 2I5YL 4H25A 3TJEH 4ZFGL 4PGEA 4DJMA 4NJ9H 4MX7A 2K9UA 3FB5A 4Z9KB 2IQ9L 4QRSB 2DDQL 3IF1A 1KPUA 3HE7B 4OLWL 5FOBB 3QCUL 3HI6L 2EH7H 3GSNB 4HJGA 4PJEF 2IG2L 5D9SB 3ARGC 1ERNA 3GMRB 4PJHE 2Q6WA 5CJ8A 5CP7A 2R0KH 3VXNB 2QLVB 2B1AL 3B83A 4PJ5E 1XF4A 5CSZB 2AXGA 4IDLA 4NO0B 4OF5A 2ZKHL 2NYYD 4P3WA 3W81A 4TSCH 3WV0A 4LU5L 3FOLA 3HNSH 1T4KA 5J1AB 4PRPB 3O2DA 1DVFA 1A3RH 3VRLE 3MV8E 3O2DH 3JUYA 2FHCA 4M3JA 1ZT4A 3BT2L 2F8OA 3V0VA 4AG4L 1Q9WA 4BKLA 5GXBB 5HBBA 1XCTB 4DK6A 5I1IL 4OCRH 1SJEB 4NN6B 2DWEA 1UZ6E 5IMOB 1I8KB 3GZKA 1P53A 5IBUG 4OZGA 3IDJA 1EHAA 5EU3B 4IRSA 5EOQL 2HLFD 4QHMB 2DLFH 3QISA 5ITFB 3OTTA 1INEL 4PRID 2JB6B 1P7KB 2Z31C 1J05B 4R97C 3T4YA 1OAZH 1CFSB 3CSPA 3WHXB 3G04A 1QNZL 2WBWB 4PBWD 1M05B 3MRKB 1JGVH 1KULA 3PJSA 1OSPL 3HI5H 4IRJC 3IT8D 4Y5YB 5GISL 1W0YT 3WE6A 5HPMB 1A6VH 4ODHH 4KY1H 4EDWH 3DVNB 4WU5A 1R5VA 3TESA 4O2EB 5T33L 1VESA 4JANA 5GJSL 1E6JL 1MREH 2DL2A 4AEEA 2BJMH 3U4BH 5DHXB 1P5VA 2Y4SA 2WINA 1HHGA 2GSGA 5ID0B 2HFTA 4JG1L 4ZUVB 2R4SH 1VFAA 4PJDE 1B0GA 3HRZB 2ED7A 1K2DB 3RL2B 2XV6B 4NDMB 1BIHA 4D0DA 2CO6B 1FC2D 1EHLL 2I07A 1CD1A 2LU3A 3I6GB 1D9KD 4PP2B 1KUMA 2BVQA 3BUYA 4I0CC 5FO7B 5HHMB 1GAFH 1EA9C 4OLXH 5I16A 2R0LH 1UCBH 1GGIL 3MRBB 3T0XA 3V5DB 4P4KB 3VA6A 2J88L 3NCBB 5FA4B 3U0PA 3PHOB 2AJXH 3GIVB 3WJJA 4Y8DC 3LEVH 3BW9B 2EC9U 3O6KL 1MJJB 2XWBA 4E41E 3QXDB 5E56A 4GW4B 4NC2B 3HC4L 5JQHC 1MPAL 2ZG3A 4ZO7A 2AK1L 5BS0A 1TVHA 1KIPA 3D25B 1CE1L 3GIZH 3CNKA 2X1XR 1OTTD 2V2WB 3K4AA 1A6WL 4M7KL 4P23B 4JPIA 3X3GL 4LSPL 1RJZA 5MI0B 4Y1AA 4EUPB 4OBSA 3WNKA 4HKZB 3BMVA 5ALBH 4ODVH 5LXGH 2OZ4L 3ET9F 5KVDL 5FYLL 1N2RB 1F13A 1FLRH 1QFUH 3FB7B 2A73B 2CLVB 4FFZL 1A7BA 1I7UB 3DRQB 4JLRB 4JHZA 1BD2B 1F4YH 4NZUH 2MFNA 1M4KA 1W2KT 2DQFB 1G6RB 3KYMB 3EOBB 4LDEB 3KJ6L 5IGXL 1A6TB 1KEML 1VB9A 4RGNC 2XA3A 3T8XB 2X4RA 5D7JC 3O45A 1A2YB 2ATPB 2A6IB 3TCLA 4K7PY 4KU1A 5M94B 4NO5A 4ZD3L 3K8LA 1KB5B 1CLZL 1J0ZA 3ZTJG 3GKZA 1FNLA 1F97A 2VITA 3QQ3B 3W9EA 3FAWA 4Q6IB 5JOPD 3OHXA 5DS8B 1QFHA 4LPXA 3JWNC 5F89A 1J0KA 1MRCH 1N0XH 5IOPA 2H2SC 1DVFC 1KYOJ 2XIDA 2DQEH 3KYKH 3C5ZA 1CR9H 2IBBA 3GHBH 2NY5L 5E03A 5IEKA 3M1BB 2DWDA 1HILA 2IQAA 5D2NB 4PJFE 1JV5A 4QY8B 2EEAA 3U0TB 4XXDB 3K8KA 3FT3A 3JWOL 5IBTH 4Z7WB 1EVUA 2JB5L 3D39E 4M6AA 4MDJB 4RFEB 4GG6A 3V4UH 4OFYD 4BK4A 3DO3A 3IJHB 4UV7H 2WWMC 2E7MA 4P5KA 5FKAB 3P73B 1T1YB 3DBXB 3GMLA 3NIDF 4OF7A 3MOQA 1NBVH 1H8SA 4RFNB 3T3PE 4Q9BA 3GBNH 4CNIB 4J3OC 4YNYB 1IGCH 4FQQA 4N90D 4EI5B 1SJVA 5SWZB 4XVTL 1A3LL 3C9NA 5HHVL 3G6AA 1K5NB 4YPGA 1JZ2A 5T1KB 3OR6A 4YXKH 3ARWA 1LE5A 2AVGA 4M5ZL 1I7TA 4FQLH 3RY6C 3KPLA 4Z0BH 2H3NB 4HMDA 3VGAC 4LP4A 5CZXD 5IROC 2XICA 3GSWA 3Q6FA 2JCCA 1TZHA 3NPSC 1JHTA 2VO5A 3ZE1E 5HYQA 2C3WA 3AUVA 3QPQD 2OMNA 2CIIB 4G43B 4I0KA 5FIEA 3PL6D 5I6XB 1HWHB 3GSRB 5A16A 4NQUA 3VG9B 4G6KL 2BSED 3EFDH 4LAQH 4S1DD 1J8KA 5HYIA 4KMQA 4LQFH 4APQA 5IIEA 3ULVH 5IUSA 3VDBA 3LPFA 4CVWA 1KTDB 2WBJC 4MJIA 4I1NB 1S5IH 1YMHB 2LABA 3HAEB 4P0DA 1AXSA 4HS3B 4ZO8A 4UIMB 5DFTA 1NCDH 2H9GA 4HWZB 3QIBC 2AEQL 3SGDH 2YBRB 1JNLL 4X7TA 2AJZA 1WAAF 3TBWB 5FFLA 1DQJB 1T3FA 1BHGA 1F90H 1LO4H 4PJIF 5C08B 3SDAB 2JJUA 1T1XA 2XQYG 3B9EA 3QEUB 3DRTA 3BGMA 4HUWA 1FGVH 8FABA 4L8SA 1H15A 1M6OA 2FCBA 5E70A 5D7IF 2FATH 4ZSOB 5HYJE 1NCNA 2F5AH 3IVKA 2D0HA 1YJDL 4KV5F 4MA1C 3SDYL 1FDLH 2OTWB 3H9HA 4OFKA 3KHQA 2B8OT 1P1ZA 3DUSA 2FIRT 4LGSB 2CIKA 4P3DA 4Y5VA 4C57C 2OR8A 5CBEB 4M5YH 5BMFH 1A1OA 4PJAE 4QRRD 1MELA 4KKLC 2FLRT 1JWMB 4U0QB 4JKWA 1V7ML 2DQTL 5KTEH 3F6IA 1FNGB 3U9UB 2VLME 3R8BB 4NRZB 1FZOA 3KPPA 4ORZC 3CFBA 1EERB 5EUOF 4NZJA 3S36X 3BP6A 3MJ8B 4JE4B 1T7YA 3C5ZC 4PGBA 3VFPB 4M4PA 5DRWA 3OKKB 1ZHLB 4NUJA 4WY7L 1H0DB 1FJ1A 3C6SB 2A74A 3QULB 3ROLB 3I3EA 3QWRA 3RX5A 4IRZL 1YN7B 4DVBB 4FQXA 1XAUA 1FQ9C 3ZDYE 5I19H 1C08A 2A6KB 2IADA 3MPCA 4QLRA 2NY6C 1F4WL 4R2GD 2AXFA 1JPTH 5FYJH 4HT1H 1NBYB 3PP3H 3OJDA 5I18L 3UTZB 1OGTA 1TPXC 3DV4B 4OJFL 4R6UA 3P11L 4X4YA 2BOBA 2ITCB 4JQXA 2G9HA 4MXWL 3V4PH 4MDIB 1T66C 4RAVB 3GM8A 3VI3F 2P8PA 1I1AA 1MFBH 5MENA 2ZWLT 4PJHB 3MRIB 4YIQA 1R5IB 4ZFZB 3RTQB 3TNNA 2ZCLL 4HS8H 3WHE0 4PJ5B 1YMME 4XBEH 1FIGL 4MS8C 1HSBB 3UO1H 1Z9MA 5K9OA 3O6FB 4NO0D 4OD3L 3VXUA 3HS0A 2W9DH 4QHUA 1DUZB 5TGBB 3ZLQC 2P8LB 2HMID 1KT2B 4YE4L 1Q94A 4DFHA 3TBSA 3BP4B 1BREA 3MV8B 4PRPD 4PRDA 5I71B 4NIKB 1MI5D 4UBDC 1K8IA 4YUEL 4KH2A 4BQ8A 1D9KC 3QZWB 3IFLH 4GAYA 4JG0H 4KTEL 4GAJL 3BZ4B 4YXHH 4PY8I 3I6LD 1UM5H 4U6TA 5D6DC 1QR1A 1JPSH 2VC2H 4ETYA 2JF1A 4HMCA 3SGEH 3RZCB 1OP5H 3RGVD 4APQC 2CKNA 5AZ2L 2CMRL 1QBMH 1AXIB 2Q87A 2PW1B 5KN5A 4I9WE 5L6YH 4GW5A 3KPSA 3I2CL 3HI1A 3TBYB 3FRUA 1I9JL 1N6QL 4M1DH 4Y2DC 4LCIH 1MJ8H 2RIKA 5F7WC 5F3BA 1ZLUH 3UYRL 3DXAA 4A2LA 1I8MB 4PY7B 4N0UA 1E6OL 1TMCB 2FX8L 1CDCA 4P2RA 4XP1H 5EU4A 2Z91A 1FGNL 3FO1B 5IVZA 1UZ8B 4L8SC 4X5WA 3CUPA 2ED8A 1UKTA 2N1KA 1GIGL 1XGYH 1P7QB 1BLNB 4HS6A 4PJDB 1NGQL 2A9NH 5D93C 3LN9A 2EDYA 2ZNXA 1JNHB 1L4IA 3ULUL 5LBSL 4ELKA 5C2BH 4CGTA 4UV4L 5F1SA 5IT2L 2R4RH 2OXHA 1ZTXL 5IB5A 4OB5H 5FA3A 3X11A 2CPCA 3T08A 3KJ4C 1EJ6A 3TT3L 2HN7A 3BPOB 3QQNA 4FQ1H 3VFRB 2FB4L 4E41B 1YC7A 1CG9A 5EBGA 4K8RH 5J06A 5JQ6H 1A6ZB 2ZP0T 4HLJA 1C5CH 1NCBH 1GOFA 3UBXG 3ZL4H 2DQUL 3O4LE 4YDLC 3WNPA 5FAAA 3WFDH 4KDTA 4FQXC 3CU1A 1KCVH 2EDEA 5I8OL 4WI2A 3VFTB 1RIHL 5ID1B 1TVDA 1RUQH 2FIKB 2Z93B 5FDWA 4FQHB 3OKMA 3QEGL 3CU7A 4G8EA 5EN2A 1YC8A 3U0WL 4KK6C 5TF0A 3GFUA 3BVNB 1NL0H 3OAZH 4U6XB 4NKIH 4NNXA 1TFHA 1IJ9A 4LLUB 4JQXC 4YDKH 3SE3C 3NZHH 4DKEH 2AJUL 3NCEB 3MRHA 1UQSB 2VAAB 1V7NL 1OAYL 3RIAF 4P5TD 3QH3A 3CC5A 5EIQA 1FNEB 2NNAA 2A6JA 3AS1A 4LCCA 1U3YA 3E8UL 4FTVA 4TVPH 2Y07L 2DBJA 3B2UD 3GSVA 1JE6A 5IESH 1GHFL 3FMGH 3QXAB 4V1DA 4YZFF 2BMKA 3PL6C 5F6HI 4DGIL 2QSVA 2YA2A 4LPUA 3KPMA 3QUML 2HJFB 4PJFB 1LO0H 1MAJA 3V6BR 5DJCB 2NY2B 3MOAL 3NA9L 3B9KC 1JYVA 1N4XH 4NNPL 1QHPA 1UWXH 1F6AB 2HJKA 3MV7A 3D39B 2UV3A 1SBBA 2VH5L 4UUJA 1I7ZA 5JIIA 2E6JA 1CICA 1NGYB 2HA1A 1MHEA 2V2XA 3OKOB 2C3HA 1M71A 5F9AC 1HXYA 3BXNA 4JO4L 1PYWB 4EI6B 1G9EA 3BISA 3PGFH 4XWGL 5GGVY 1Z5LA 4LLAA 1RIUH 2YD4A 2BVYA 3VXSA 4J8RA 5J6HA 1BFSA 1YEHL 2F5BL 4BFIA 3WLWC 3OAUH 3F7VA 3KR3H 1HI6B 1E4JA 4EI5D 1DE4A 1FN4B 3C08H 3ARBA 4K7PL 5T1KD 4ZXBB 4PJ8C 3GB7A 5IV2B 3HR5A 4LLDA 4X6CA 5KG9B 3D6GA 4UT9L 4CVUA 2LFGA 4DAGH 2QKIA 3REWA 1FFPA 2EDNA 2AJYL 1D5IL 1BOGB 1LHZA 3ELAT 4X9IA 5CHNB 2WBKA 2MQ3A 3GHEL 1NUFA 3HNTH 4KFZC 1PSKL 4WHCA 5A2IH 1BFTA 5I75B 5GGTA 2Y23A 5L2KE 2XZAH 1R5WB 5GGTH 2P4AB 2E9IA 5TJWK 2DIBA 4AZ8A 3DIFA 5LAXB 4XB7A 5T3ZL 3SDDB 2A9ML 4I13B 4K8RC 4ZUUA 5C0BE 4QOKA 1RFDL 3ES6A 1KG0A 3VWKD 3DPBA 2X89D 3LZFH 1RMFH 1RUKL 4OLYH 3MJ9L 2YD7A 5EBLA 2D9QB 1UYWL 4KDTC 4X4MA 3WKML 4F7PA 1KN2H 2Y6SD 1JF1A 1X7QB 4YHNA 2D4FA 4R2GC 4Z78A 5BV7H 4R7DB 5EFIA 5DRZA 1OT2A 5D7LA 4OTXL 2HKHL 4P5MA 5DD0H 3DVGB 1SMAA 1EFXB 3OX8B 4KDVA 4YBLC 5DGQA 5EUOB 4O02L 3SE4A 2VLRA 3SQOL 3TYGL 5HYJB 4PRHE 3GMPB 5F1IA 2HT3D 2H1PH 4L9LA 1HKLL 3MJ6A 4U49A 1T7WA 5C0CA 1A1MB 1VGKA 3U46A 3QHFL 4AK1A 4Y4KD 4U6HA 4PJAB 2UY6A 2VXVL 1QBLH 4O2CB 3TZVB 4Z7QF 5CBAA 1MJUL 1G0DA 1INDL 1JUFB 4KI5D 3MGOB 4J3VA 3M07A 3NFSL 3STZA 4Z7UA 5J6GB 3O6LL 1ACYH 2GJZA 2JJWA 2UZXB 5DQJB 2XQBH 2O5YL 4HKXA 1JI2A 3KXFD 1KCUL 5D72H 3S3SA 4ZS7L 4S2SA 3CPLB 4KZDH 1CQKA 1T0PB 3RGVC 3D18B 4NHUB 2VN4A 3Q3GA 2YRPA 4E42A 1N64L 3FFCE 2J5LC 2G2RB 4N9GA 4YHZH 2ATKA 4PLJD 4PRBB 1A14H 5HGAB 4OZGF 2ZCHL 1BWWA 3EDKA 1WC7B 2DOCA 2E8ZA 2APWA 5ICZB 3QRGH 4UTAH 3RWIB 3VH8G 1J8HD 1MCKA 3FQXB 3EW3B 9CGTA 1H3PH 3MC0A 4OIIL 3UJIH 1JHLH 3NIFF 2HVKB 3PXJA 2RCSL 3GO1L 2CDFA 4XPTL 3UBXI 3VFUA 4HMEA 3MLSH 4TSAL 2Y36L 2FWOB 3RTQD 1FSKB 4RRPG 1YMMB 2AJVL 5CD3B 4PJ5D 1GSMA 2PYFB 5IG7B 1CLOH 4LASL 3T0DA 3O4OB 4LKXB 3O6FD 1NGWA 3BSZH 4O5LL 1U6AH 4PPTA 2XRAL 4UDUA 4HFWB 3MXVL 4X6EA 5F97E 1NAKH 4G8GD 2XWJB 4AENA 2VZSA 1YQVH 4OI8A 2DAVA 3T65A 4ZYKB 4K71B 4FP8L 2H6PA 1IM9A 5DVOA 5D2LE 4NQVB 4YWGH 3G6JA 3R0MA 1D3CA 5JMRA 3VFWA 5JDSB 2YKLH 1D6EB 4HH8A 5JZ7C 1MEXL 2R0WL 4NJAL 3QIWA 4PTTA 5E8EA 5ISZA 2IEPA 2DQGL 3LS4L 5DUBA 32C2A 4XNMA 2ORBH 1A5FL 1Q0XH 5FM8A 2RFXB 2R69L 3SJVA 5BJTA 1PFCA 4XCFH 5DMJB 4HGMA 4PTUA 2XFXA 4D0CA 1SYVB 5T1DL 5I9QB 5D71L 3BPLC 2V2TA 3QNXB 2ADFL 4QRPE 3UPRB 1PJ9A 2FO4B 4LCUA 1RURL 1XH3A 5TDOA 5CZVL 5TE4H 4MD0B 1A7RH 5HY9A 5SWSD 1IGFL 3BHBA 4LIQH 1XF3A 4Y4FA 2R1YA 1ZSDA 2B4CL 1UACH 4M6NH 1KEGH 3QUZB 1EEZA 1PKQE 1FV1A 2J8UA 5J13B 4QRQA 1UENA 3HPJB 3O3DB 1XCQA 2MOVA 3BKYL 3N1PC 4P5TC 1MNUH 4WUKL 3U6RB 3MREB 4YAQB 4KTYA 2BERA 1KC5H 3TO2B 2FSEA 1TZIB 4M7JH 1KIQB 4OT1H 1J0YA 4NRXA 1DR9A 3E3QE 1AY1H 2HLAB 1F11B 3E1F1 1NMBL 4MAYC 4KZEL 4RZCA 3QYCA 4E41D 1TETH 4LEOB 5I1AA 2P24A 3BJ91 3WNOA 4KKNA 1J12A 4F58L 5E2UH 4RGOH 4ZO9A 2F74B 1MCEA 2D3VA 3O9WB 2LU4A 2FX7L 5F44A 2WWKT 1AQKH 3O4LB 15C8L 1A4KA 2ZUTA 5I15L 5KJRH 3FQRA 2EDTA 5FUOH 2UWEA 5EOCL 3LD8C 1ZS8A 2YPLA 4O9HH 3GEWB 3MRGA 4YHPA 4O00A 2NY3C 2Z35A 5DQDL 3TVMB 4ZTPH 4RMVA 5GS2H 1JWSB 1DDHA 3S34L 3RHWK 3QWOB 2FZ3B 4GG6F 3MRJA 3JV5A 1R3HA 3NCJH 4JY6A 5KANI 1ZLSL 3MUJA 5HGHA 4XPGH 1QSFE 4MSWA 1J0IA 1KB9K 2R56L 2VLJE 3MO1B 4YHOH 4L8CA 2RQ8A 5E5MB 5E2WL 5GJTH 2JLLA 3MROB 4ZG1A 5KW9L 1S7RB 4NWTL 1CIUA 4PUBH 4YO0A 3NVQA 5FB8A 1FO0A 1KENL 3TBTA 3RDTD 1KTRL 3U9PL 2VDLH 4AH2B 1RZ8B 3O2VH 1CIDA 2E9JA 1FO0H 4PD4K 3MJGX 3W0WE 5T1LB 2YUZA 3CH8A 3QDGA 3LIZL 5IMMB 1QEWB 1RULL 3S4SB 4JRYA 4MQSB 1S7UA 2X4NA 1DEEB 1WBZA 4HIJA 4HF5L 4I48A 5TQ0H 4BSWA 4NM8H 3SKMA 3RFZC 3DURB 1U8LB 4NRYA 3T1FB 2JCCF 5F7YC 2NW2A 1RZGA 2NY2D 3IFPB 4UOW1 4DN3L 5DJ6B 2IPUK 1FZKB 3C8HA 1HHIB 2W07A 3VGDA 1AP2A 3D39D 1RUAL 3QIWC 2NY1B 1AJ7H 3OBAA 2KPNA 4YFLF 5J1SC 3ULVF 3CIQA 3VWKC 4AL8L 2VRAA 1D5XB 3OGCA 4MB5A 2EIDA 4JCLA 4HH9A 2F58L 4HKJB 2M2DA 4Y5XA 5GGSA 3C87A 1JGUH 3KPRA 5HHXL 3QIUB 4XVSL 4LSUL 5FYLD 5FKPB 5DEGA 4UAOC 4H5SB 4YC2B 2DF3A 3NH7H 1KTLA 1G7QA 1U91A 5E6ID 3NGBB 5C09D 3S35H 2IAMB 4UIKH 1BGXH 1ETZA 3IYLW 3NN8A 1JFQL 3QEQE 3IXTB 2VKWA 1FNAA 3EKCA 3HI6H 3MNZB 5EWIH 3ZHLA 4ZTOL 1TJHL 1UXWB 2ZCKL 1L6XA 2IG2H 4HK3J 5IHUH 5JHDA 2IANA 3FAXA 2BVOA 2A77L 4HWBL 3QDJA 4XB8A 4PB9H 3QRFM 4Y4KC 2OL3A 5JDJA 5F96H 4PR5A 5AYQA 2OL3H 4PJ7A 3RWFB 5L2KB 3U4AA 5I1JH 4HBQA 4I3SH 3IDXH 3PWUA 3OKNA 1JGEB 4AJ0A 3GSQA 5C0BB 3UJJL 4G6ML 2XWTA 5IFHL 3TBVA 3B6SB 3BDYL 4P59H 1U8OA 4RFOL 5IHZB 2BVUA 2VDRL 3CMOL 5I1GH 1CDJA 4DTGH 4U3CA 4M43H 5GGVL 4ODUB 1N3NB 3V5HA 1MCSA 1YNLH 4EQ3A 4ONGL 2APBA 5JLZB 5E08L 2FEEI 3D9AL 3RWCA 1VACA 3FTGA 4PLJC 2P8MB 4XRCA 4KMTH 4JFFE 1AE6L 3H0TA 1ROWA 1MJ7H 4KRMB 1LE9A 4JN2B 4X98B 4TNVF 5C6PB 3SKJH 4JR9L 5DDHA 4PRHB 5HYJD 1IC4H 4KGLA 1Q1JH 3RPIA 2EIZB 4L3EA 3RVUC 1NDGA 4ELMA 2GTWB 5CKGA 2IPUG 1I3GH 3J7HA 4KXZH 3DX9B 4GBXB 4CJ0A 1E28A 1KJ3L 1YPZE 5C9JB 5C0FA 1BOYA 4MXQC 4OLZH 2YXMA 4H26A 3BEVA 4QTIH 3HE6B 2O5XH 1WV7T 3WFHB 5IW6B 4K7PX 4U1KA 3INUL 3RWDB 1KCSH 4M93C 4P4RA 2E7HA 1CE6A 2QHRH 4PREB 3P9LB 3N1QC 2KH2B 2GK0B 3U36B 1T0NB 1JYXA 2L4OA 5IJVB 4N0CD 1S7XA 4MA3A 4KVNH 2CSPA 2HWZL 4D3CH 3U83A 4ODWB 3G5XA 4MNGE 2D03H 4OZHA 2H8PA 3DSFL 4YGAB 3U7WL 4AEHL 4G5ZH 2ZOLA 5C70A 2ICWJ 4XC3L 1NCCL 2J8OA 5IMLA 4ODXA 2BOCB 3TH3T 3CJJA 3FFCB 5IBLD 4GLRI 3C8DA 4XBGA 3K2MC 1R24B 4LF3A 5EO0A 1GGBL 3EDJA 4M7LH 2CLZB 4P9HH 1NAML 3A6BH 4JO3H 4OGXH 5CEYA 5ERWB 3AMLA 1MCBA 2IFFL 3KWWB 3IKCA 5DMIH 3PHQA 1E4XI 3RVTD 1P4LA 5KSVB 2OI9C 5J12B 3C2SA 3L3DA 2Q8AL 3MRCA 1EJOH 1DBAL 1WSST 3T0EA 1LEKB 1XFPA 2Q3AA 3V6ZB 3CAFA 4ERSH 2VNCA 3VXME 1YMMD 3NIGE 4DGYH 4XP5L 3SO3B 3I50H 1YEJL 4JM2B 4XX1E 4XMKH 3HZMA 2H2PC 4ZUWA 2ZSWA 4NFBA 4BSVB 1AGFA 5GIRB 2QR0A 3K1KC 5EZIL 3VGGA 2NQCA 4R9HA 4OM1L 1ZA6B 5DLML 4MQTB 2NY0B 1KJVB 3BQUD 1A4JA 5IQ9B 1L6ZA 1OL0A 1MLCA 1IM3A 3T77A 1U8QB 2HFGH 5D2LB 5HGDB 3T4AB 4F3FB 5D96B 1JGDB 1UT9A 3F5WB 4XBPA 2BNQE 5MERA 1WVZA 5GGUA 2DQCH 4K7FA 1XF2A 1P4BH 2AV7B 4GS7C 4C4KO 1CK0L 1HQ4A 3WXWL 1SJHA 2VXQL 5D1ZB 4P2QA 2R1WA 2P43B 3NCYP 1SYSB 2CRMA 3D0LB 3TA3C 4QRPB 1YEFH 1OM3H 1G0XA 5J9PA 1N0LA 1BQLH 4D9LL 1UH3A 5D1XB 1YQ2A 3WFEL 4EDXA 1MF2H 2IPTH 2E9WA 1FC1A 3EFFB 5EH1A 2DQJH 4XXCA 2O61B 5MEOB 3C6LD 5D1QD 5C0JB 5J56B 5DUPL 3QUKB 3MRFB 3P4NA 4NZRH 4XVTH 2EKSA 5DMKA 5HHVH 1F4XL 3BE1H 4X6DA 1DQQB 2NXZD 1PKQB 1Q9OB 3QUZD 2V7NA 4LPCA 1NGXA 5ESAB 5I76A 2XTJD 1Z3GL 4J12A 2AERT 2IBZX 4YDVA 5GS3A 1HSAB 5T3XL 2Y5EA 2CK0H 4YGVB 2V9QA 3M8OH 5GRUL 4FFWC 2Z9TA 4OCSH 2CGRH 1Q72H 3REVA 3TEUA 3ARPA 1Z9OA 2DIAA 4JN1L 2PXYC 4TNVK 2XG4A 5BRZE 2BXZA 5I1CH 2A38A 1F3JA 1AD9A 5EC1A 3QO0B 1NUNB 3MRMB 2F54A 3B8SA 3PP3K 4MA8L 2EEDA 2E27H 1CLCA 1S7TB 3OXSA 3ILQD 3O4LD 3CFDB 1VPOH 3CCHB 4LSVH 2AXJA 4IOIB 1B4JL 5DQ9B 1XT5A 3PNWB 1DLHA 3X12B 4UOJA 1HINH 2CH8A 4OD2A 4OAWB 4FABL 1I8IB 4HSQA 3TVMD 4P9HC 3BD5A 2PO6C 4ZFOL 4I4WA 3CXHJ 4KUZH 3VE0A 5DHVA 2EDBA 2B7DT 1NCWH 1QSFB 3L3KA 5DHVH 3FB8A 5DJ8B 2MQCA 1ZHNA 2VLJB 2HRPL 4U1JA 1S7WA 1CWVA 4I2XE 3T0EC 4YFEA 4NKOB 3QFJE 3QG6A 1JJUA 2DQDH 5ITBL 1T03H 3IU4H 5F9WB 5LG1A 4LSSH 4TNWK 1NC2D 3W0WB 1OP5K 3VDAA 5T1LD 4Z7VE 3ULUD 2R0ZH 4G8IB 1QSZA 4PJBA 3BH8A 2P46B 5I66A 4UT6H 5INDA 1IGML 1KELL 4X6CF 3QFDA 5GS1B 2WLZA 3F7RA 4QXWA 2VR9A 4NC1C 1ZLUK 1IGTA 4FRWA 4OZIE 1NFIA 5JW4N 4C56E 4GKZA 1Y0LA 3NACL 1P84J 3MA9H 4KDWA 1W72B 4M1CC 1CDBA 1FORH 1C12B 1UWGH 5SX4H 4CU8A 2CKBL 1QFWL 3CFEB 3V6FA 3DNKA 3THMH 3HUJE 3JZ7A 3RX7A 1WT5A 2EDWA 3TNMA 1QQDA 2G5BA 4JREC 1I85A 3K2UH 3WN5B 3VWJD 4J3XA 1T2XA 2C5DC 1A7NH 4HEME 1Q9LA 3JTTA 3N9GH 2EZ0C 3GKWL 1FL5A 3MCG1 4LHUA 1G1CA 2X4SB 3AXLA 1MAKA 2I26N 3NCCB 5ADOH 2VDPL 5CGYD 2IAMD 5IB2A 4WHDA 1FVCA 3MUGA 5C0AD 2W9EL 4JM4L 4XNYL 3QEQB 1BJ1H 4MXWH 3H9SA 4PV9A 5ESQB 3UJTL 1C8PA 4J23A 4RAUA 3VXQA 1B0RA 1RJLA 1XGTB 5FYKE 1S7VA 4C83B 4YHYB 1NDMA 1I4FB 4OQTA 4OQTH 4LHQB 1CXIA 5F7LB 4U1HB 5DZLA 3MYJB 3CD4A 3LMJL 1DN0B 1BX2B 5HI4D 4XNZB 4CMMB 2X1QA 4H8WH 3C60A 4KHXH 1LDPH 2Q20A 4MLSA 2VDML 1EBPA 5HGGS 5C8JB 4QNPF 1HH9B