1OBFO

The crystal structure of glyceraldehyde 3-phosphate dehydrogenase from alcaligenes xylosoxidans at 1.7a resolution.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
335
structure length
334
Chain Sequence
TIRVAINGYGRIGRNILRAHYEGGKSHDIEIVAINDLGDPKTNAHLTRYDTAHGKFPGTVSVNGSYMVVNGDKIRVDANRNPAQLPWGALKVDVVLECTGFFTTKEKAGAHIKGGAKKVIISAPGGADVDATVVYGVNHGTLKSTDTVISNASTTNCLAPLVKPLNDKLGLQDGLMTTVHAYTNNQVLTDVYHEDLRRARSATMSMIPTKTGAAAAVGDVLPELDGKLNGYAIRVPTINVSIVDLSFVAKRNTTVEEVNGILKAASEGELKGILDYNTEPLVSVDYNHDPASSTVDASLTKVSGRLVKVSSWYDNEWGFSNRMLDTTVALMSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
publication title The Structure of Glyceraldehyde 3-Phosphate Dehydrogenase from Alcaligenes Xylosoxidans at 1.7 A Resolution
pubmed doi rcsb
molecule tags Glycolytic pathway
total genus 116
structure length 334
sequence length 335
chains with identical sequence P
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
O PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1obfO02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1obfO01
3WGGA 3ZNPA 1HLDA 3E18A 3PIDA 2O4UX 4DBVO 1B3RA 1C3VA 1ISFA 4D79A 1M6WA 4BNTA 2E82A 1YQGA 3OIGA 2PR2A 1DIBA 4J49A 1BXZA 4N54A 1GZ6A 1D4FA 2P5UA 4XD2A 3HSKA 2X23A 4GKVA 3FSRA 3VPFA 1AXGA 2X0NA 2IZZA 1F8FA 1Z7EA 2X6TA 3C3XA 1EUDA 5ICSA 4CLEA 5K6AA 1HYHA 5J9GA 1ZJZA 1V3UA 2Q1TA 3EMKA 4ZQGA 1D8AA 4ZJUA 4ZHSA 2VWPA 4WKGA 4RF4A 5JSFA 5JE8A 1BVRA 1P3DA 1RYEA 3DOJA 3TZHA 2WD7B 3DHYA 1DRUA 3VPXA 1KY5A 3S2GA 3TRIA 1ZSNA 1TEHA 5TS3A 1HLPA 1ZK2A 2EKPA 5B37A 1CJCA 4JBIA 2OORA 4WUVA 3GAZA 4ITUA 4PLGA 2O48X 5F5NA 3QY9A 3RCBA 1DLIA 3PDUA 2BH9A 3GFGA 2POQX 4YAEA 2AQ8A 1SB8A 3PHHA 3WR5A 4KUGA 3W6UA 4EJMA 4HUJA 4Z6KA 3WYEA 2VWGA 1Y8QA 4E2ZA 5ES3A 1U4SA 4OAQA 5DDIP 4QO7A 3H2SA 5JMWA 4D0SA 4ZRNA 2C20A 3OQBA 2XPCA 3Q1LA 5T8KA 1NFRA 2OO5A 2B5WA 3DZBA 4M86A 2ZQYA 1JLLA 4WE3A 4YRBA 3KEOA 1VC2A 1GZ3A 5JY6A 2VOJA 3IQDB 3MJTA 2D0IA 4TQGA 2OP1A 3ZWBA 4BNGA 1J4AA 5H82A 3KYDB 1K0UA 4BNYA 3GZNB 3M2TA 4EGFA 3ZHYA 4KTTE 5F1KA 5KTKA 1MXFA 4XZ3A 5IXYA 2O23A 1O5IA 1MFPA 3JD4A 5LC1A 2JD2A 4KP7A 4AG3A 2ZCUA 3DOOA 4U6SA 4J4TA 1HSZA 3DWFA 4HNGA 1B26A 1SOWA 1GU7A 1VJ1A 3IAHA 1YB4A 4URFA 5DOVA 3FNFA 3LLVA 2PZLA 5JDCC 4WLNA 3IP1A 4Z0HO 1KBZA 3INGA 4CMAA 2GLXA 1EUCA 3OF2A 1EK5A 1E1LA 3PGXA 4GLOA 2HU2A 4PLTA 2G1UA 3QVTA 2I3AA 3AUSA 4IS3A 2DQ4A 2O3UA 4Y6RA 3AK4A 1QYCA 1WW8A 4PG6A 1N1EA 4GGOA 5CG1A 4OO3A 4R16A 3ITDA 4TKMA 4ALNA 3TL2A 2V7PA 1MC4A 1TB4A 3JQ8B 1VKNA 2HMTA 3LYLA 1VJTA 5CP8A 1ZO8A 4DRYA 3IL2A 3ZNNA 1JVBA 3PRJA 1ZK3A 5ENVA 4Y98A 5I9MA 1U3TA 2VUSA 4TZTA 3FF4A 1Q1NA 1N7HA 4W9NC 4TWRA 4UUPA 3TZKA 3K31A 5I8WA 3OJFA 2VUTA 3LC7O 2P91A 3ZWCA 1R15A 4RZIA 2Y1DA 2V6MA 3GFBA 1QP8A 1FDUA 3FBTA 1R4MA 5EQDA 2I67A 3A9WA 1HDXA 4FPXA 1G6KA 4AVYA 5BSGA 1RYDA 3GA0A 4NU6A 1XCBA 3KOUA 2Y0EA 4MIEA 2EIHA 1I30A 3F1KA 4Z9FA 2P9GA 3OM9A 5FF9A 4U6QA 4F46A 1IYZA 4NIMA 3CEAA 1LU9A 1NP3A 1WPQA 3JSAA 3I52A 1EDOA 3H3FA 4IBOA 5IAAA 4D3DA 4IJWA 1QYVA 1HKUA 1PGNA 1ZBQA 4XA8A 2VRCD 4KWHA 3MJEA 4A0SA 1RM3A 3R6DA 1IE3A 2QW8A 2X86A 1IUKA 1UDAA 3JYQA 3VH4A 4BO3A 4WLUA 3WGZA 4XCVA 1PJ3A 1HL3A 1KVQA 1N2SA 1GPJA 3FNHA 4XRGA 3UXYA 3DEYX 4D44A 3VZQA 1O6ZA 3IDSA 3M1AA 3K5PA 5A3JA 1H0KA 1DAPA 2IRWA 3RAJA 1TVEA 1SCUA 2B69A 2HLPA 2X7HA 5CHEA 5TF4A 5A9SB 3VTZA 3IS3A 4YAIA 5KCZA 1D7OA 2X0JA 4J7UA 4M49A 3OBBA 5G4KA 2PY6A 3V1TC 1ML3A 3Q2IA 4K9DA 4CMBA 2WD7A 4MKXA 3PJEA 2CVQA 1HE4A 3BMOB 4R1UA 4XQCA 2VRCA 5JAQA 1JWAB 5CFZA 2QZZA 1HDZA 4XQGA 5JY1A 4CM8B 2DUUA 4R69A 4BNUA 2X22A 1EVIA 1H6CA 2Q2VA 3K92A 1U2DA 5JYEA 2RBEA 4D42A 2JCYA 4AJHA 4FSHA 3WTBA 1X0VA 4CLOB 5GZ3A 1H2BA 1I32A 1LTHR 2O4CA 3H8VA 4J0EA 4OSPA 1Z74A 2EGHA 3BA1A 2AA3A 2A9FA 2PWZA 1B0AA 3P7MA 4D0RA 5AXCA 4MP8A 1K5HA 4FJ1A 1P1JA 3QVWA 3PI7A 3INRA 4CM4B 4E5YA 5DBGA 2AMFA 3FPCA 1AUPA 2FP4A 4ZQHA 3H5RA 4PLFA 3FCOA 3ZZNA 3JQAD 3M6IA 1A71A 4CM1A 5K9ZA 2VNAA 5IXSA 2DFVA 3GUYA 3D4PA 2RHRA 1GY8A 1P0CA 3SXPA 5GMOA 1C1XA 4R54A 2ZB7A 2BGLA 3WGYA 5DCWA 3TN7A 3O38A 5KVQA 2IEBA 1JWBB 3W4IA 1MP0A 4CLDA 3QE3A 1T24A 2QIOA 1AGNA 1U2GA 4Y9DA 4OHUA 2UDPA 3NT4A 5IZ4A 4GSKA 4I5DA 2P4HX 5AXBA 3HQ4O 4H16A 4R5HA 2B4QA 4GLLA 3MEQA 3JQ7A 5EL0A 3R3SA 4I9HA 2HKIA 3DAFA 4HFNA 3D1LA 1KEPA 2CDCA 4GX2A 1VLLA 4L9RA 1SO8A 2P9EA 3D3WB 3ROMA 4B79A 4BMNA 2X5JO 2ILTA 3GGOA 4K6FA 3RJ5A 3UKOA 2HAEA 3B20A 1QRRA 1EE2A 1XGKA 1PZEA 4YJHB 4CR7A 4E13A 1I33A 1Q7GA 2YV2A 1AN9A 2ZATA 1Q2XA 6LDHA 2Q1WA 4BNZA 3I9MA 4AJOA 3AI2A 1VPDA 1Y8RB 1H6BA 2H9IA 3NX4A 3PWZA 3QWFA 4EI2A 5JNLA 3VTFA 4O59O 4W82A 5T5QA 3JQ8A 2HK7A 5G0VA 3CTMA 2ZCVA 3MCVA 3OIFA 1SZJG 4AJ4A 4CMIA 5EESA 4BOYA 4QQRA 1HDOA 3IUPA 3F47A 1LLUA 4B8WA 3CPSA 2FR8A 2WYUA 3DHNA 2W8ZA 1VSUA 3HDHA 3E6AA 3WIEA 4F6CA 2ZTMA 1JA9A 4CPDA 1Y5MA 4IUYA 3E82A 1E3SA 5JDCA 1B15A 4YJFA 2EKLA 1NPYA 2EW8A 2I65A 3LF1A 2W2KB 4NH4A 4NNJA 3ONEA 1FJHA 4RPLA 3W4KA 1ISJA 4JLWA 2H63A 5L7YA 5COAA 3Q11A 2W98A 3JYOA 4XYBA 3RROA 2FPIA 4E2WA 4WCFB 2GD1O 1U3VA 5H81A 3HNPA 2I3GA 4XDZA 4WPGA 4E21A 3ZWVA 1ZZEA 4LGVA 2YQ4A 1HYEA 4FOOA 2I76A 1LXCA 4W99A 3KXDA 3W8FA 4R1NA 2VOEA 4XYMA 4B7XA 1Q0LA 2WD8A 4DQXA 3TOZA 2J5RA 1E6WA 2DBZA 1DRWA 2EW2A 5AOVA 1NQAO 2DPHA 3U4DA 3D0OA 3DBHA 3ON5A 3F5SA 4WCDA 4W9NA 3BYZA 4E5PA 1CQIA 3I5MA 4MVJH 4Q3AA 4PG4A 4CM9D 3DBLB 4XWYA 3VAZA 3EZLA 4PZCA 4XEHA 2YDYA 5JO9A 5IF3A 2CSUA 3DZHA 4YRDA 4YXFA 5JAMA 3AFMA 4BGVA 1QSGA 2WE8A 2CZCA 1LLCA 2JD0A 3KSUA 4LRSB 1XR3A 2D2IA 3AY7A 4NBRA 2GZ2A 2F1KA 5TX7A 4IINA 2YY7A 4LCJA 3IJRA 4YQZA 4OXKA 1LRJA 4YB8A 3BMOA 2Y93A 4MDHA 1SC6A 1ZH8A 4RLHA 1X15A 3ZWXA 1PJQA 2DM6A 5KVCA 4CM8A 4KTVE 4CM7A 3V1YA 1UXHA 3ZNOA 1T1SA 5T73A 2EG9A 5JYFA 4CM9A 2VZ9A 4P4NA 3FPLA 4TVOA 4Y8VA 3UW3A 5H83A 4DREA 4CLOA 4IZIA 2C5AA 3PIIA 3VPGA 3QQPA 4I5GA 2CDAA 3ZI0A 3NTQA 4DMMA 2BF7A 1LBEA 4RZHA 1EE9A 3BMQA 2B4RO 1NQOA 4Q3CA 3QJ5A 4D3FA 1LDGA 3L4BC 1PZHA 1YE3A 1I3MA 3TPCA 4BS9A 4E32A 3VPSA 1GQYA 4YT2A 1PJ2A 1SOVA 1T2DA 3H9QA 4MP6A 5DF1A 4BKOA 3DMTC 4YYZA 3PYMA 5KVVA 3NV9A 4R4JA 3WGHA 5EPOA 5I7EA 3K30A 4OOEA 1ENYA 1DIRA 3KLPX 2O3JA 1LLQA 3WBFA 4W7IA 3TSCA 4CR6A 5HRUA 2V6GA 4I9UA 4U0KA 3T7CA 2PD3A 4LVUA 2CD9A 2IYPA 3I9KA 5A04A 3ETEA 1P74A 3U4HA 4ND2A 2I99A 1T4DA 1BXKA 1NPTO 1A72A 5U1PA 5G2OA 1ID1A 1TT7A 2B37A 1E0DA 2RH4A 3D3WA 3ETDA 4ALJA 1GPDG 1PR3A 1H93A 3TZQA 3QSGA 2Z5LA 3OJOA 4I8XA 2DBVO 3DBRA 4R5MA 1NWCA 2BKAA 1LDBA 2WDZA 4LSWA 1FF9A 3IP3A 1NPDA 4J91A 1N9GB 1YVEI 4PLWA 4A5OA 4XQ9A 5JS6A 3CINA 2ZIZA 2FR0A 5GY7A 1U9JA 1PGOA 4RPGA 5TJHA 4UEOA 3NT2A 3A06A 5IDYA 1V6AA 1RWBA 4NI5A 4GPD1 4NFYA 4P4GA 2WMDA 3I6QA 1EVZA 3E03A 4OKNA 1BW9A 2NQ8A 1LDYA 2OMEA 2PGLA 3HN7A 4GVLA 4QEDA 3VH2A 2DT5A 2GRAA 2O2SA 2O3SA 2ZB4A 2DPGA 2DLDA 1R0LA 3ASUA 4L4XA 4OMUA 5CDTA 3RFXA 5U9CA 4DUPA 2XXJA 2W2KA 4IDEA 5T64A 4D41A 1UZMA 4JJFA 3DC2A 3PJGA 5KOIA 1QYWA 4FIZA 1UP6A 3TOXA 4XDYA 3UCXA 5HBRA 4B7UA 1S7CA 1P31A 1HE3A 1PWZA 4J43A 2W2LA 3UGKA 3IKTA 3LDHA 1HF3A 1IB6A 4QUKA 1FDWA 1YO6A 4DL9A 1P44A 3QWHA 4EEXA 1NXQA 1UAGA 1FDVA 1U7HA 4G5HA 1Y8QB 3LSYA 4AJKA 5KJ1A 2GF2A 3WGQA 3O4RA 3IMFA 5KWEA 5IFLA 3FNGA 2Y1FA 2UAGA 2ZJ0A 4O0LA 9LDBA 2BFPA 3KUXA 4RF5A 5F3RA 4ESOA 4CLXA 5HA5A 1J0XO 4D3SA 4IXWA 3ZU3A 1EDZA 3O8QA 1E3EA 1PL7A 3OQ1A 5A3VA 1VSVA 4XGNA 4IS2A 3B70A 5F1OA 5B1YA 5BQFA 1F17A 3C1TA 3PHGA 4DPLA 1M2WA 1W6UA 4ONEA 4YVFA 3RUCA 3FWZA 3ADPA 3JD3A 1YKFA 4PZDA 2VYVD 4IY1A 3MZ0A 3VKUA 1UH5A 1F14A 4BUCA 2PZJA 3EZYA 3UCEA 4GQAA 2OOSA 4JCOA 3CKYA 1J49A 5C5IA 1QKIA 4WEOA 3UF0A 1S6YA 1L7DA 2VRBA 2JD1A 2I5PO 3PJFA 4CJXA 3W1VA 4ALKA 1C0KA 1Y9AA 4MO2A 1YJQA 1VRWA 3ZV6A 1YDWA 3GGPA 4AJIA 2Y1EA 5AVOA 3NYWA 3OHSX 3ZV5A 3JYNA 1JKIA 3SJ7A 4IMRA 2IZ0A 1UUFA 3I83A 1X14A 5TQVA 1L1FA 2G5CA 1YJ8A 5T67A 2Q50A 4B4WA 1YOVB 3INTA 4HKTA 3QWBA 4Q3DA 1Z7BA 2EHDA 3KHUA 4K6CA 4KQWA 4DGSA 1ZEJA 2WYWA 3I4FA 1O0SA 3KEQA 2VYVA 4QECA 2O3RA 1YBAA 3DTTA 3C7CB 1HDRA 4CMEC 4XQEA 3GRKA 2VWHA 5HS6A 1BXGA 4E33A 1KC3A 3H7AA 4TVBA 2EP7A 1I8TA 5I8ZA 1EVYA 4L4RA 1GTMA 3HHPA 5C7LO 3HN2A 4TROA 4BVAA 4D7AA 1HDYA 2Y0CA 3D5QA 4JGBA 5KIAA 1BDMA 1JKJA 1D1TA 5A4DA 3GR6A 3QVSA 3ZV3A 3AUAA 3L4BA 4J9UE 2C54A 4C7JA 5I7SA 3EVTA 3OICA 4BGEA 5CDUA 2E6UX 4FD3A 4B4VA 1GEGA 4ND4A 5DBFA 5L7TA 1SPXA 4ZQEA 3U62A 3RC9A 4OSOA 3DMTA 1PX0A 5TGDA 1V35A 3GEDA 3SLGA 4ZRMA 1NHGA 1N9GA 4TZKA 4EUFA 1DXYA 3RI3A 1RJWA 2Q22A 1ONOA 3VVBA 1U5AA 5MGBA 4I1IA 3MOGA 3RUHA 1HZJA 3F6YA 2VHXA 5KVSA 3JQ6A 1HE5A 2BMAA 4J4HA 3E9MA 2CVZA 3GMDA 4ND5A 4RDIA 2FRDA 3AUUA 5G4KB 3ENKA 1ZVMA 1W4ZA 3LC1O 2A35A 1ZEMA 3WX0A 1SAYA 2WM3A 1K3TA 4YAGA 1WWKA 1XU7A 4YJGB 4BGIA 4IMPA 4BKUA 4ZU3A 4N5LA 2JAPA 3G0OA 2Y66A 3OSUA 3RBZA 1I3LA 3HZZA 2FWMX 2BI8A 2D3TA 2CF6A 2CF5A 3DBVO 1P77A 3RFTA 3BTUA 1WLYA 1KY4A 4ALMA 4BNVA 3GVIA 2X1HA 5L7WA 2GSDA 1JKFA 3QIVA 1ZK1A 2ZTLA 4B3HA 3PK0A 2UUOA 4IQ8A 1Y81A 3G49A 2A4KA 3PXXA 4FJ2A 4RVGA 2O2YA 1YRLA 2FZWA 2Y1OA 3BHMA 1B14A 4OXYA 3JQ9C 4J90A 1EUZA 1VM6A 1MX3A 4MPDA 1C1XB 1LDEA 3ASVA 2XF8A 3FHLA 3D7LA 3UVEA 1OFGA 2EWMA 4FOSA 4O1MA 4JP2A 1M6HA 3H9EO 3PEFA 2B5VA 4GX5A 1UXGA 4CMKA 2R00C 2C07A 4L0QA 3ZHZA 4UUOA 1E7QA 2HJRA 3DZGA 2GCGA 2ET6A 4BO4A 4EW6A 1IOLA 2RH8A 1DB3A 1JDJA 1IULA 2CFCA 5JAIA 1WDKA 3GVHA 5ADHA 3I9NA 2I66A 3JQ7B 4IJUA 2GN6A 1XA0A 4W6ZA 3GG9A 1KEWA 2AQKA 3EY4A 3JQAB 3PVZA 1LC0A 1GDHA 4DLBA 3ABIA 2J5KA 2HQ1A 3IJPA 1HYGA 4KDFA 1M75A 1NAIA 3DFUA 3F1LA 5TC4A 3RUDA 2O3QA 3WLEA 5DT9A 3G1UA 2D5AA 1PIWA 2X58A 2J3KA 4AFNA 1OMOA 3F9IA 2PGJA 3ANLA 4A03A 3GEGA 1YOVA 1E3WA 3GDGA 2FN7A 3RUFA 3MTJA 2AXQA 5KJ6A 4CMIB 1JTVA 3K96A 5COBA 2WSBA 5L95A 4MVJF 1NX6A 2O50A 4UVDA 1DIHA 3HDJA 2LDBA 4JX8A 2ZYAA 5KKAA 2FZEA 1I2ZA 1PJSA 2UV8A 2VTEA 5L9AA 2JFHA 1R6DA 2DAPA 2G17A 2RHCA 1E5LA 1K6IA 4YEDA 1A7AA 3DZKA 1U28A 4YJFB 3CSDA 2QQ5A 3KYCB 3BMNB 4AICA 3ANMA 5J23A 1GZ4A 4J7CA 2Q45A 4XJSA 1NR7A 1LI4A 4XJTA 1L7EA 3PLRA 4BO0A 1R0SA 3UCFA 4BNFA 3VDQA 4F6LA 1TA4A 3LQFA 2X9VA 4EITA 1X7GA 3WSWA 2H5LA 2NU8A 5FI3A 3SC6A 1P0FA 2OFPA 2WWRA 4I9NA 4S1VA 5I9LA 4WLFA 2C7GA 1YXMA 3DBHB 4QXMA 1D3AA 5JCJD 2QRJA 4R3NA 4CL8A 2PA3A 2VN8A 4P8RA 3GNSA 3JQFC 4CMEA 2GZ1A 1KOLA 1WAMA 3WGIA 1PGJA 2FSVA 2Q4EA 5ILOA 3E5RA 5KJFA 4CUZA 4BNIA 3TL3A 1E3IA 3RC1A 2VWQA 1DAOA 4U7WA 4IM7A 2GZ3A 1NQTA 3I9OA 2FR1A 3C7AA 1BTOA 1EBFA 2YUTA 4I08A 1PWXA 2C82A 3GMSA 3A28A 2Q49A 1I3NA 1YQXA 3LVFO 1IY8A 1C14A 2VZ0A 3GUCA 5B4TA 4YAKA 2JL1A 2RAFA 2Q2QA 4RORA 3EW7A 4IDGA 4PLYA 2Q1SA 3VHRA 3OA2A 4NFHA 4YJGA 5G0UA 4QFCA 1P1IA 2HK8A 3AM3A 2D5CA 3DHEA 2OZPA 4L4SA 3WBBA 4XGIA 4D45A 5EMHA 1M67A 3ZWYA 5LDHA 3VH3A 1G1AA 3S2EA 1UZLA 3MJ4A 4BNWA 3AUTA 5HTOA 1FDSA 1PZGA 4UULA 3PYLA 3QA9A 2BI7A 4B7CA 2C2XA 3PYXA 1OOEA 3LLSA 4YBZA 2V6FA 4II2A 1C0IA 1XELA 2ZB3A 1SB9A 3BMQB 4R9RA 3DB2A 1C0LA 4XRRA 3ZNQA 3ZWAA 4IQ0A 4BO2A 3ST7A 4R3WA 3RBVA 2YFHA 4K28A 4LMPA 4TRNA 4KUEA 3DZIA 1B8UA 3FRJA 3IUSA 4O6VA 4XB1A 3KLMX 1BVUA 5TRTA 1Q7BA 1LA2A 4RPHA 1QYXA 3LT4A 1E7RA 3W6ZA 4OXNA 3HDYA 3H3JA 2CVOA 3OEWA 1P1FA 1I01A 2GDZA 3SLKA 3BTVA 3BTOA 1O8CA 4GWGA 4J16A 1M76A 3ZWPA 4FBGA 4WK6A 1GV0A 4BNXA 4TRMA 2OGUA 1N92A 1DJNA 3RUAA 4DIBA 4E5MA 1HT0A 1UXIA 4E5KA 3SJUA 3B1KA 4FQ8A 1H6AA 1XYGA 4UVEA 3JTMA 1ZXLA 3JQAA 4IJVA 4J2HA 5BT9A 4KQXA 4BB5A 1QYDA 1PTJA 1PZFA 4NZ9A 3TF5A 3RSHA 2NTNA 3DBRB 4DPMA 4BO6A 3JQ9A 3H6KA 3OJ0A 1K89A 3FTPA 2ZQZA 3AWDA 1XKQA 3CE6A 3D64A 4GGPA 1PQWA 3GK3A 3I6IA 4FS3A 4EZBA 3B1FA 3OIDA 2OHXA 2GN9A 4WOJA 3CMCO 3ICCA 4Y6PA 4CLHA 4QTZA 5GZ6A 3CUKA 3E1KA 2IDZA 4NBWA 4BNLA 4YQYA 3RC2A 5B12A 2YYYA 3S2IA 1P9LA 1BW9B 4MP3A 3F5QA 3ANNA 4HXYA 2TMGA 3L6EA 1YONA 1KVRA 2VHZA 4CQLA 4PCVA 3NTRA 4MVJD 4Q9NA 2FSSA 3EDMA 4C4OA 1ADGA 4M55A 1EQ2A 2E49A 4BO8A 3KYCA 1UJMA 4MVJP 3BMNA 4B8ZA 4BO9A 4E5NA 3EUWA 3K6JA 2NQTA 2CNBA 3H9JA 4WGGA 3TNLA 1ONPA 2QZ9A 1CWUA 5I9NA 1K2WA 3QVXA 1KERA 2GPTA 1IZ0A 2VHYA 4NR0A 3QP9A 1ZIDA 5IDQA 5L45A 3PTZA 3GH3A 1R12A 4TMFA 2IYOA 3JCZA 4RF3A 2HMSA 2NTJA 4M8SA 2GO1A 3UICA 4DQUA 1DSSG 4Y6SA 1PS8A 3O9ZA 3PQFA 3ZHBA 2DTXA 1ORRA 1MLDA 4B4OA 2PKQP 1F06A 1U1IA 4RPKA 4WNCA 4MIOA 3IC5A 3P2YA 3RKUA 3VZRA 2UYYA 3HB4X 4Q3NA 5IG2A 4MVJA 3GEMA 4YA6A 3NKLA 1XU9A 4R68A 4WOKA 5L3ZA 5MDHA 1ZMOA 2NUAA 1MG0A 2GN4A 1KVTA 4IDCA 5ER9A 1X0XA 3O8QB 4FGSA 4QX6A 3WS7A 2OBYA 1B8PA 5EJ2A 1EK6A 2E37A 5IDWA 4CMCA 4J2OA 1IPFA 4AJNA 4CODB 1Y5RA 2YDXA 4BKPA 2Z1NA 1EFKA 4Z0PA 3R1IA 3GVCA 5DULA 3DONA 4GVXA 4NJMB 4AJEA 5L4NA 3ZGYA 2YHUA 3C24A 4FDAA 4R41A 5B4VA 3LU1A 1U4OA 3JQFA 4R01A 5F21A 4CQMD 3LK7A 3AJRA 4IDDA 4DPKA 5JC8A 4PLPA 3EGOA 2EP5A 1ISMA 4QO8A 4MINA 2X9NA 1DDOA 1P1RA 4XKJA 5I7FA 1OI7A 1QV7A 1KVUA 5L40A 1Z73A 3RQSA 3T4EA 1Z6ZA 4IQGA 3WNVA 5DCYA 3FBGA 2QRKA 3OQ6A 3TFOA 4R51A 1GEEA 1E7SA 1BMDA 2G82A 4MKRA 5ITVA 4EUEA 3QWAA 1G0OA 5BR7A 3L9WA 1OZAA 1YL5A 4NFSA 2FPGA 4XYEA 2JHGA 1YWGO 1BXGB 3A1NA 1KEVA 1KEUA 2C7VA 1YQDA 4CQMA 4U8GA 4ID9A 4UAGA 1MUUA 2Y67A 3EAGA 1E1MA 5COQA 3PQDA 4GAEA 1M66A 1ZJYA 1B16A 1LDMA 3ITKA 1NYTA 3CMMA 4IGFA 1JN0A 1SNYA 3GDOA 8ADHA 5TNXA 3JD0A 2X9GA 1NASA 1RM5A 1YGYA 4PVCA 3M1LA 3NDJA 4X54A 4PIVA 1MA0A 4H3VA 2A94A 3E9NA 4UEJA 3AM5A 4J1NA 1DO8A 3MWDB 2Y1GA 1QR6A 4FFOA 5L4LA 3HDQA 2PGDA 3PGJA 1ZKMA 4KOAA 2A92A 1V9LA 2J5QA 3L07A 5F5LA 3RU9A 1NAHA 3NJ4A 2PH5A 1ISIA 5A9TA 1EEHA 4C7KA 4YDRA 4FW8A 1CDOA 5THQA 4ZGWA 4WJZA 2C59A 3OA0A 4JROA 2VHVA 3JQCA 4LN1A 4BGUA 3QW2A 4CM5A 1A4UA 3RD5A 3V8BA 3H4VA 3HUDA 1WDLA 2BELA 2QYSA 1XEAA 2W90A 3KZVA 2PK3A 3WFIA 4DLAA 3AM4A 1PQPA 1FK8A 1UR5A 5KJCA 3GDFA 1MFZA 3X2FA 1AE1A 3GVPA 5ENDA 5IN4A 4XR9A 2QG4A 3FWNA 3CZRA 2YFQA 4TKLA 1ZNQO 3K9QO 1GYRA 5B4UA 1T1RA 1ZK0A 4L74A 4ILKA 4YT8A 1LDNA 3GN1A 2AE2A 4H7PA 4JBGA 3TQHA 5HWSA 2P2SA 1VI2A 3MTGA 1NM5A 3I3OA 2EF1A 4E6PA 2AEFA 2PLAA 5I7VA 1E7WA 4RLSA 3L4SO 3HWRA 3I23A 4A73A 1FMCA 3NRCA 1MC5A 1IL0A 1UXJA 3ZU2A 1I10A 2EEZA 1HSOA 4R1TA 1X13A 3VVCA 2J6IA 4PG5A 4WEQA 1HDGO 5IDXA 3WB9A 2BFMA 5G0WA 4IDFA 2GYYA 3ADOA 4E12A 1EMDA 1U5CA 4ND1A 4GI2A 3JV7A 4RVSA 2BD0A 1Q0QA 1GCOA 3AI3A 2NADA 1SMKA 4CM6A 4GMGA 2FHSA 1ZSYA 4ROSA 4FJ0A 2NNLD 5TSDA 1C0PA 3R0IA 2EERA 4INAA 1BHSA 1EFLA 5T6BA 4E31A 2YV3A 1HRDA 1JVSA 1ADFA 1E6UA 3O03A 5DNAA 3UFXA 4DC0A 4QFDA 2WEKA 2ZKLA 3A4VA 1BG6A 4NJMA 1P45A 2QYTA 4NBTA 1LSOA 2XOXA 4R1SA 2PZMA 4RJTA 1DC5A 2YHIB 3MOIA 1DFGA 3I4CA 1DRVA 1A5ZA 1W0CA 2VYND 2ZB8A 4WLOA 4IIVA 3S8MA 4A2CA 1O89A 3PHJA 5C7OO 3D4NA 1TI7A 1DHTA 1HZZA 3LF2A 2GR9A 4NPCA 3GPDG 9LDTA 5GZ1A 1E3WB 1H9AA 1HEUA 2NM0A 2VHWA 3PWSA 4KUHA 2NU9A 1A27A 4IZHA 2P5YA 5KJEA 1LLDA 4AL4A 4EEZA 1RKXA 1O95A 1RM4A 2RIRA 2NVUB 5C7IO 2VZ8A 4RCVA 3RIHA 4HBGA 1F12A 3EHEA 4FC7A 4AJ1A 2Q99A 1VL0A 2C29D 2Q3EA 4FCCA 4J1SA 1IPEA 4G2NA 3GHHA 3PJDA 3K73O 3DMYA 4PFJA 2VYNA 2Y0DA 4BNKA 4J1TA 3M2PA 1V8BA 4M89A 3PFWO 1LSUA 1CYDA 4NBVA 7MDHA 2AW5A 2VNSA 2DKNA 3FR8A 1W8DA 1XHLA 3LT2A 5TJ9A 2AEMA 3T7EA 5ICMA 3VC7A 3FTNA 2DFDA 5FWNA 4CMHA 3NGLA 4OQYA 1LJ8A 1DIGA 3RUIA 4DBZA 1ZW1A 1KETA 1UP4A 1WDMA 1N1GA 4ALLA 4EJ0A 4CUKA 4IXTA 1Z75A 4BV9A 4JJIA 2PFGA 3Q6IA 4HNHA 4O63O 5U4QA 2NVBA 2DUWA 3K2BA 3KO8A 3Q9NA 3K2EA 4HWKA 1CF2O 1CIVA 3VOSA 1DC3A 1PJ4A 1Y9EA 3ICPA 4M54A 1OC4A 5LCXA 4J0FA 3UAGA 2B0JA 2FY8A 4L73A 1LNQA 1JU9A 4KWIA 5CDGA 5IN5A 2NU6A 1CRWG 4YJDA 4JN6B 2W4QA 4E2YA 1KYQA 5L51A 4H15A 3DR3A 3QVOA 3N7UA 1R0KA 1V3VA 2HRZA 1H2HA 4GX0A 2DBRA 4DIOA 3FD8A 4BQRA 1C1DA 2I6TA 3H9GA 5A5FA 2D4AA 3ZDFA 4IIUA 2F00A 1R4NA 3NJ8A 1X1TA 2WTBA 4HFRA 4IPTA 1UZNA 4B3IA 4HP8A 4JJGA 2Y1CA 4Z0TA 3WIDA 2DTDA 3W8DA 1PGQA 3WG9A 3IOYA 4EUHA 1WP4A 3WSVA 1ZFNA 2X8LA 3BAZA 1GR0A 1EVJA 4Z3KA 2J3IA 2ZYGA 3DXFA 2OXIA 3ONFA 1PGPA 1GYQA 5C37A 1DC4A 2IXBA 5BNFA 5BSEA 4F45A 3V2HA 1N8KA 4JIGA 3S55A 3ENNA 1TLTA 4MOWA 5CDYA 3G3EA 1B2LA 3R3JA 3ZWMA 3GAFA 4FFLA 4UUNA 1KC1A 4E30A 1DFHA 3AOGA 4CL3A 3BHIA 5FFFA 2Q46A 1OAAA 1U3WA 3I9LA 3S2FA 4UVGA 5TLSA 2X5KO 3KSZO 1LC3A 2DBQA 3AOEC 1NVMB 1Q7CA 3D4OA 3VZSA 4BNHA 5G4LA 3O26A 4W7HA 2X4GA 4WNIA 1QORA 1PL8A 2BHLA 4GWKA 3WWZA 2NV6A 2O7QA 1I3KA 4LISA 1GUZA 3HADA 4GH5A 2YHIA 3HG7A 4BNMA 4J6FA 4EYEA 1EZ4A 4ZA2A 4CV1A 1DOHA 1WMAA 3PZRA 1B7GO 1HWYA 1XSEA 2ZTUA 4DLLA 2HDHA 5A9RA 1PL6A 4IDAA 3RVDA 1QG6A 3ROQA 1T4BA 3Q2KA 4AJLA 3EVNA 4E3ZA 1IHXA 1T2FA 2AE1A 3UOGA 4JXKA 4KMSA 1A4IA 1YB5A 4R9SA 3V1UA 1EQUA 1AXEA 4YRAA 4IGEA 2X5OA 3MJCA 4PLZA 5LDGA 1LEHA 2IEDA 3KBOA 1SBYA 3FI9A 2NVUA 2JAHA 1SEPA 4BMSA 1QV6A 1LUAA 1Z45A 3WMXA 4BQPA 2J8ZA 3RWBA 4YR9A 3EC7A 1MV8A 1NHWA 3LZ6A 2B83A 2Y68A 3ORFA 4CQLB 4PLHA 1HETA 1I0ZA 2FMUA 2NTVA 4M87A 3NT5A 4NU5A 3B1JA 3NEPX 3JQGB 3F3SA 1PJCA 3BHJA 5BSHA 1NVTA 4FFRA 3ROPA 4BIIA 1U8FO 3C1AA 8LDHA 1A7KA 2BGKA 4N5NA 3GF4A 2NVWA 1ZUD1 4S3MA 3W4JA 3WLFA 4XYGA 1GADO 4QT0A 4ZD6A 1PEDA 2V65A 2WE7A 1NTOA 3AI1A 3HFGA 4RV9A 5JXWA 2P68A 4II3A 3WDSA 5CEEA 1FXSA 3GVXA 3UUWA 5CEFA 1NNUA 1GL3A 3GQVA 3SBOA 3LC2O 2Y05A 4BNNA 4PZEA 3K8ZA 2NSDA 1Z82A 4XIYA 1MB4A 3GNQA 3V5NA 3P19A 1H5QA 4XX0A 3JYLA 5KNLA 1E3JA 4RQUA 1AHHA 2HMUA 3SVTA 1ISGA 5JBIA 2P9CA 3I1JA 1P1KA 1TT5A 4RGBA 1BWSA 1O94A 4DIFA 1DPGA 1QLJA 4KDEA 3WMWA 2V6BA 1ZK4A 4NBUA 3HB5X 3PHIA 4CV3A 2ZJ1A 4Z3DA 3GHYA 4CLRB 4J9VA 3WXBA 3GOHA 5L4SA 4HX5A 1E77A 1OC2A 4U5QA 1ENOA 3D3EA 1I24A 4ZQFA 1U3UA 3NDIA 1P1HA 2DTEA 1MG5A 4Q3BA 2NLOA 3AU9A 3JQBC 3DAGA 1VL8A 1PU2A 1GUFA 3DOCA 3WGOA 1TXGA 4RVDA 4A10A 5JCJA 1R66A 1YBMA 4BV8A 5ER6A 2Q2WA 1N5DA 3ZV4A 3U5TA 3DL2A 2AEJA 3NDRA 4AJJA 2PKRA 3DQPA 3COSA 1ARZA 4YACA 1ENPA 3TFQA 2QHXA 3RU7A 4GKBA 5JYDA 1V0JA 2Y99A 4OOFA 5G0SA 5A5EA 2E4AA 3B6ZA 4GSLA 1VKOA 1H9BA 1KS9A 3ZH2A 3TJRA 4E2XA 3E9QA 1ONNA 3KSDO 1D1SA 1DBVO 3CIFA 5IJZA 1QXSA 4N18A 4UVHA 5C3MA 3ZHXA 2G0TA 4LRTB 3U49A 1WVGA 1GAEO 4OM8A 4CUJA 1LQUA 3ZU4A 1NBOA 2Z1MA 5JO0A 3S1LA 3SC4A 3ONDA 3ZCXA 1GFSA 4D43A 4CQMB 3BTSA 4JP3A 4A26A 4FR5A 3L9XA 5CAEA 4L8VA 2PTGA 5DN9A 3CXRA 2Q4BA 2FPPA 4MVJI 1DLJA 3WNQA 1A9YA 4RO0A 5EINA 2XXBA 5FEUA 1GV1A 3VH1A 1IHYA 2JHFA 3UHAA 2OL4A 3KYDA 2RCYA 1ZCJA 1NFFA 3WYCA 3GZNA 4FGWA 2IE0A 4DA9A 3MJSA 4NDNE 3ZWNA 4BO5A 2CDBA 3GRPA 3GC6A 2PV7A 5JW6A 3ROKA 4EDFA 4OYRA 2BFOA 4PG7A 1UDBA 4CR8A 2GN8A 5DBIA 1I36A 1FDTA 1WNTA 1JQBA 2AG5A 1UP7A 4HFJA 4QSMA 2NACA 5AQ1A 3PFFA 1OBFO 4JK3A 5JLAA 2R00A 4YPOA 4ZICA 1CEQA 2E48A 4BB6A 4JNKA 4YCAA 4DVJA 4ZQBA 5TT0A 1NFQA 4MKZA 1ISHA 3AOEA 2HMWA 4F3YA 1F8GA 1U7TA 1PR9A 4WCFC 3FR7A 3VZPA 1UDCA 4FFPA 4FB5A 4MIYA 4HY3A 4D46A 1T2AA 1NQ5A 5EN4A 3RASA 2GERA 2DC1A 3SX2A 3OEYA 2YJZA 3C1OA 1MXHA 3JQGA 1BDBA 4E4YA 3QV1A 3TDKA 2J3JA 4EBFA 4RPJA 5F1PA 3E48A 1LRLA 1J5PA 4UVIA 4BO7A 3RFVA 3W8EA 4DWVA 3C7DB 3P5SA 1X7HA 3Q0EA 4OGWA 3JQEA 4P4LA 3KM0A 1PQUA 3L77A 1O9BA 4Y67A 3WFJA 3OP4A 4NK5A 5JCXA 3UH1A 3I9JA 4RVUA 5IZCC 4BNJA 2BFAA 2H6EA 2PD6A 4BO1A 1ADCA 4Q39A 1DFIA 1LX6A 5ITWA 1RPNA 3DDNA 3DO5A 1LSJA 2IODA 3H2ZA 3DFZA 5A03A 2NWQA 3X2EA 3ZW8A 3MWEB 3E5MA 4FFMA 3JYPA 3RUEA 1X1EA 4N7RA 4DQVA 5G0TA 4A27A 2JFGA 2JKVA 2VCYA 1ZXBA 4DYVA 2B36A 2EJWA 6ADHA 5K0ZA 3JD2A 3H9UA 1GUYA 2O3TA 3VKVA 5JDIC 4YT4A 1P33A 3HJAA 2D59A 2HO5A 4CLRA 3RKRA 3PLNA 2JCXA 1YL6A 4DMLA 1XG5A 3WWYA 4IDBA 3DTYA 1PJLA 2EJVA 2UUPA 1UAYA 2ZK7A 3WQSB 5A05A 4CMJA 4FFNA 5DCUA 3LT1A 3BMCB 4ZVVA 4GX1A 2B4TO 1WZEA 2EXXA 1NR1A 5JYAA 1LRKA 3Q3CA 5DP1A 1HTBA 2QRLA 4M1QA 3PHLA 3VDRA 3QWIA 3IKVA 1E1NA 3OETA 5A9SA 3AU8A 3U9LA 2ZYDA 1GQ2A 2O7SA 1J6UA 4UREA 3G1TA 2H1SA 1Q0HA 3GZ4A 1PSDA 4G65A 3PZBA 1U8XX 2JCVA 3BIOA 3OECA 4LK3A 3UN1A 3V2GA 3U4IA 4B3JA 4JQCA 3PPIA 4OL9A 5CG2A 3F4LA 2YV1A 2CY0A 1H6DA 4Z9XA 1ZSVA 3U3XA 3WQRA 4TRJA 1E7MA 4MJLA 3KETA 1T2EA 1XQ6A 3EYWA 3PDJA 4YWJA 2DU8A 2GNAA 1PJBA 1YDEA 3MJVA 4JBHA 5BNIA 4I5FA 3QLJA 3VPHA 1E1KA 2HCTA 3C85A 3G79A 4OKIA 2BGMA 4YT5A 2HJSA 1XWFA 3JQDA 3JQBA 4OQZA 4HV4A 1K6XA 3DZFA 4ZN6A 2YW9A 3AY3A 3F46A 1AHIA 1SEVA 2C0CA 4NG5A 2VUUA 3IIEA 4CM4A 3KB6A 2P4QA 3WTCA 1YL7A 3L0DA 3WYBA 3BXXA 3WOHA 4KZPA 5ILGA 5L53A 1W73A 1E7YA 1B8VA 4YTEA 4MVJG 1PS0A 2D8AA 4OH1A 2NU7A 3AW9A 2BLLA 5M6DA 4XB2A 1WXDA 3AY6A 3GG2A 1T25A 1YS4A 1BSVA 1JAXA 3D5TA 5CPBA 3WJ7A 2IXAA 1QMGA 3FNEA 4BKRA 1WZIA 3F4BA 4NJOA 2AQIA 1EBUA 4LSMA 1MGOA 1RM0A 4ND3A 2J3HA 5DP2A 5JAZA 1I5RA 2YQ5A 1WMBA 5HS4A 5K6AC 2PKQO 3TZCA 4LCEA 4FC6A 5TT1A 1VL6A 5CPFA 3U09A 3ZN2A 3KVOA 1HDCA 4OIMA 1GD1O 5A02A 4BHTA 3L6OO 4DC1A 3V2UA 2OBNA 5FI5A 1E5QA 4HADA 3U4CA 4TRRA 2R6JA 4P38A 3ZW9A 3RJ9A 2SCUA 3OFSA 1NWHA 2X0IA 1G0NA 3SEFA 4YJHA 3PWKA 4NK4A 1V3TA 3FN4A 1ZMTA 3RBXA 1K6JA 2Q1UA 4LMRA 2GASA 2W2LD 4CV0A 1E92A 1Y8RA 3A14A 2GGSA 5THKA 2BRUA 4A7PA 3NTOA 4TSKA 1LQTA 1CQJA 1A9ZA 1C1DB 3WQQA 1X7DA 5A1TA 3ZWOA 2CUKA 2VTDA 4N5MA 1R4NB 1JAYA 4RDHA 1YB1A 1E6EA 3CZMA 4HFMA 3GNTA 2TMDA 4G81A 5T8KC 3ETGA 5DZSA 4AJ2A 7ADHA 4PG8A 2OP0A 1F0YA 4J3FA 2HK9A 4E0BA 2D1YA 2CMDA 5JPIA 3GLQA 4BKQA 3U0BA 4NQZA 1LSSA 2HRBA 2PZKA 3P2OA 2R2GA 5AXAA 4WCFA 1XIVA 2UVDA 3E8XA 3T4XA 3PQEA 4K26A 2DVMA 1YBVA 2C5EA 3KV3O 2PD4A 4CV2A 4XIJA 3NGXA 4WLEA 4K1LA 3GPIA 4L75A 3H65A 5CEJA 2X0RA 1NVGA 1ULUA 2VT2A 4WECA 4RQTA 2PH3A 5TIIA 3ZU5A 5EQFA 1BRMA 3DZJA 1Y1PA 4U0JA 4PRLA 1IZ9A 4Z9YA 4NHEA 4PLCA 3KRTA 4UUMA 4WLVA 3H5AA 1PJTA 4PVDA 5DOZA 1VE9A 2EV9A 3NAQA 4L76A 2XAAA 3DBLA 5JFOA 2AHRA 5JC1A 3BMCA 5BNTA 3NUGA 5FYDA 5IZCA 4P22A 3WJAA 1ULSA 2GUGA 1YH3A 4UEKA 4RVFA 1VJ0A 4LVCA 5AXDA 1KVSA 4CM3A 3BZUA 1T26A 4FN4A 4PGFA 2LDXA 4PLVA 2C2YA 3PP8A 5A06A 4RF2A 1N7GA 2WYVA 4WASA 3ULKA 3N58A 4ALIA 4MVJE 1I2CA 1DHRA 1ENZA 1UXKA 3OMLA 3WICA 1R16A 3OJEA 2AQHA 4Q3EA 1DIAA 2EKQA 4NMHA 1BGVA 3CH6A 1DJQA 3GY0A 3H5NA 1HXHA 1JW9B 4GL4A 4RVHA 5JDIA 1E3LA 4GBJA 4IJKA 5KKCA 3LT0A 4J7XA 4OJNA 1B3BA 2OUIA 2YZ7A 1T2CA 2VQ3A 3OH8A 3KTDA 1CETA 4DYDA 2PNFA 3AFNA 4XYLA 5HM8A 3OJLA 2WJPA 5T57A 2JFFA 3G17A 5BSFA 2Z95A 4BL5A 3RC7A 3HE3A 2FOIA 3Q9UA 4EJ6A 1Y7TA 4W4TA 1GQQA 1H94A 5CDSA 2I9PA 3HFSA 5EIOA 1I2BA 3C8MA 1PS9A 4B4UA 4J1QA 4AJPA 2AG8A 3GN2A 2IZ1A 2HUNA 4I5EA 4LW8A 4O5OA 4XR4A 4CMGA 3L6DA 1KIFA 4YAJA 3TZ6A 3QHAA 4PRKA 1Y6JA 2HMVA 4PN3A 1XDWA 3GGGA 2EGGA 5EERA 3GT0A 1GCUA 3STHA 2HSDA 3WGTA 4DTIA 1GYPA 3DAPA 2VT3A 4XGKA 2B35A 3JD1A 1R4MB 1HE2A 2JJYA 1R37A 1ADBA 1DEHA 4RL6A 1DC6A 4GMFA 4MVJM 1XQ1A 2QX7A 2ZTVA 3EK2A 3KYBA 4BMVA 1QLHA 1XLTA 4J4BA 3TWOA 3N74A 3QRWA 1TT5B 5AYVA 4DXHA 1CERA 2G76A 5JMPA 3ZWWA
chains in the Genus database with same CATH superfamily
2WWFA 4MS4A 1E5TA 3WGNA 3IX7A 4NBKA 2W71A 4Z8YA 3WGGA 4ARZB 4RCZA 3PL1A 1U81A 1PT5A 4JELA 3GRUA 1W87A 4DBVO 3BERA 4RS4A 3JZMA 1M6WA 2AXNA 2B8JA 3MM4A 3ILSA 3DJYA 4RK7A 1TAHA 2WFMA 1DX6A 2PR2A 1DIBA 2PDAA 3N07A 4XM1A 1Z4OA 4YO7A 2WJYA 2ZZMA 4DLSA 1WS6A 3VVMA 2Z6VA 2P5UA 4IIFA 1UBEA 1KK3A 1YASA 3DMRA 1XDUA 1TCUA 3FSRA 5A62A 1O4WA 1F8FA 2QUZA 1EUDA 4OU5A 1N2IA 1QGYA 1ZNWA 4U2KA 1JHUA 3DZ3B 2MR5A 4GO1A 4WGFA 3RYHA 5J9GA 2W2TA 4QYMA 1ZJZA 3DLCA 3SX0A 3V4SA 4BX9A 4I1PA 4DDMA 1H2XA 1KJ8A 2EFEB 4JVLA 2C94A 2VBGA 4UHFA 4ZAZA 4ZIRA 1GNQA 1RJFA 1P3DA 3PDCA 821PA 1EEXB 4HAVA 3TZHA 1QCCA 5D1HA 3SDSA 4XWAA 1TRHA 3AONB 2ZJ4A 1XP5A 5EZYA 1RYYA 2CXTA 1T8WA 2EKPA 1CJCA 2OT3B 3I37X 1ODJA 4JBIA 4IIGA 4LBVA 1V95A 3KWFA 3T5CA 4DCGA 5LBUA 1P9WA 3GAZA 2I0FA 3S0JA 1NSTA 4LOLA 4MUMA 2QU8A 4IXMA 4G5XA 4PLGA 5T4HA 4YRRA 4ENQA 3F74A 1DTEA 3PDUA 4Q7MB 1MAHA 2ZIEA 2IU3A 1PQ4A 1NBEA 2PUHA 1KFKB 2AQ8A 4G26A 3UMGA 3FAZA 2ACEA 3IPYA 5FWAA 2O19A 2FRXA 5LDDC 3LCRA 4YRQA 1GRQA 1L5RA 3FZNA 4RELA 4D6PA 1N77A 2KB0A 2WHQA 3HB7A 1N6OA 1YK0A 3O4IA 3VTKA 2CCGA 3ROEA 4B87A 3ROZA 4ZRNA 4Q7KA 1OR8A 5FP0A 5BV1A 1V7ZA 4PYNA 3OQBA 1ODLA 4H35A 1VDMA 2XPCA 1XDDA 1EFRA 5T8KA 4RIFA 2B5WA 1XZFA 3WMRA 4US2R 3BBPA 1UQRA 3L0IB 1IN5A 3BJIC 3GCZA 1VC2A 3IQDB 3KEOA 4OQEA 1UKVY 4MZDA 2QORA 2E0IA 2E1RA 1TNDA 4TMYA 4TQGA 4CKBB 2Q6IA 2QZ4A 4JQSA 3RHTA 1DIOB 5CCXA 5I4CA 5H82A 3IE0A 3IIJA 4RK1A 1I6WA 1KI3A 2PCJA 3TCXB 3GZNB 4K3VA 3M2TA 1MVOA 2ZT5A 4H7JA 4EGFA 3KSAC 4Q48A 3ZHYA 3I28A 4KTTE 2EKDA 1WCIB 1GZSA 1LVUA 2O5EA 1NLZA 3OVMA 1I2DA 3O95A 2KX7A 1QPZA 1KOJA 2EWWA 1BQEA 2ZS8A 4MW1A 4U6SA 2EBFX 3SMQA 1K6MA 3PC8C 2JFQA 4HNGA 4OI2A 2IUUA 3IAUA 1SOWA 3SQDA 2PUBA 1XYVA 1U0BB 3FNFA 2PZLA 3ZLTA 4KK3A 1SA0A 5K3EA 5LP6A 1DZ3A 1YHNA 4OQLA 3L8HA 4CZ2A 3HUTA 2ZBDA 2N0SA 4CMAA 1D6MA 4UJ5A 1PYGA 1XT6A 2QSYA 2D7CA 3PGXA 3EPRA 1DKQA 4GLOA 4B2IA 5AHKA 4E94A 1JB9A 3K0CA 2HJGA 4G5OA 4HDSB 4PLTA 3EP5B 4D9IA 1U2TA 2PXXA 1EAMA 3AUSA 3H17A 2DQ4A 2QTAA 4FCVA 1D0VA 1ZM4A 2PKEA 4O4LA 3ZTTA 3ZCUA 2B8NA 4PG6A 1N1EA 3KTFA 2JDID 3KZOA 3G85A 2IOQA 4OO3A 1DC8A 2D1QA 4E7OA 4EL5A 2FMTA 3MF4A 4TKMA 2NXWA 1XCPA 2AJDA 4ALNA 2VKQA 4BBAA 1P5JA 2WAOA 4MQEA 1TO6A 3CE9A 2GPSA 1K7SN 2HMTA 1V11B 3LYLA 3OWOA 2WIJA 3EWNA 4GE0A 4P3KA 4X6YA 1PKXA 4QSHA 5D6OA 5A2QA 2CV0A 4WVFA 1PN3A 4OXXA 3IL2A 1KPHA 2OV1A 3BE8A 1PR2A 3G2PA 1PV2A 2NQ2C 1T5SA 3ID6C 5BN5B 1P81A 3BXEA 4LXYA 3P9ZA 2PMDA 4XEUA 2JKZA 2I78A 3K31A 3OJFA 4I1RA 4YJ3A 2H1LA 2ZSFA 3P4XA 5AJVB 1CLEA 3K9FC 3QJGA 4LJAA 4WMLA 2Y1DA 1KYZA 4YDHB 5CX4A 5HJ2A 4CRWB 1M1YE 3AXTA 3GFBA 2WUDA 2OYRA 1Q83A 1QP8A 4IFIA 5EQDA 2HNKA 2PX0A 1OV4A 2I67A 1Z0JA 4TUYF 3TPFA 4FPXA 4AVYA 1KR2A 3EXHC 2FPIB 1USVA 1EM8B 2GKGA 4PIMA 2EIHA 4HO1X 2AJTA 2R62A 2P9GA 3OM9A 2ZANA 4N8SA 3O31A 1JIIA 4EGAA 1E1QA 1BE0A 1T2VA 1SCAA 2OXFA 1NP3A 4FWTA 1MAUA 3JSAA 4O1HA 1Z5WA 1WF3A 2BM1A 1UMBA 5IAAA 1B0PA 2YMQA 5AICA 4ARZA 1QHFA 4D3DA 1LTQA 4P53A 4XA8A 2P5TB 1ZBQA 2J6HA 2QJOA 5CLGA 1GM5A 3DEAA 4HVLA 4OGKA 3CC8A 3MJEA 3MTEA 3NONA 5IVHA 2Q3HA 3FVVA 3TH5A 2QW8A 2X86A 2NSHA 1UEIA 1RDFA 1UDAA 3JYQA 4I9GA 3BAFA 4LSZA 1AIPA 4RS3A 2YJ6A 3SNKA 4Q4JA 4XCVA 5KYUA 4XCQA 2JEOA 1ECGA 1N2SA 2ZTHA 3DGEC 4J94A 3IJ5A 1JPVA 3CKMA 2VP5A 3ND5A 3AMVA 3CUSA 3DEYX 2HSEA 2V59A 1O6ZA 3IDSA 1SFRA 2FZCA 3E58A 3M1AA 4N01A 2E21A 2FFRA 3L8EA 1I7LA 4B3MB 4REMA 3GBPA 2X7HA 3GCDA 4X8MA 1YR2A 4P33A 1GRNA 4LJ9A 4D9MA 1QB7A 3PHCA 1XZJA 2OV3A 3G13A 3C48A 4DLPA 5J5CA 3T7RA 2ZT7A 3LFUA 3OBBA 3FIUA 4BE7B 3NDPA 2R1TB 1FP6A 3V1TC 4K9DA 1XZHA 3D02A 1Z83A 4CMBA 2VCHA 4FI3C 3AHCA 4MKXA 4ZVNA 4Y2XA 3T3OA 3BMOB 1HE4A 3HYRA 3OZCA 4X84A 2JFNA 2VRCA 3KDPA 4EO9A 4IV5A 1VMIA 2AFVA 2H08A 2QZZA 3E9CA 5AVWA 3RH0A 1SUIA 4HN9A 4IZOA 2REXB 2X22A 1YQEA 1EVIA 2I1VB 1E2NA 2QSUA 2IL1A 3GV0A 3D8HA 4NC9A 5AP9A 5HKKA 2FE4A 2Z08A 3O84A 5DXFA 5FBRB 4BXOA 4CDGA 1U2DA 4UU8A 2YIJA 1UM9B 2JCYA 2RGDA 4AJHA 2SNIE 4JXZA 2O4CA 1I32A 1CUIA 1SURA 2XDWA 4MMXB 4ZODA 4R8RA 1QR2A 4JC0A 4JMPA 1CJMA 2A9FA 2HBZA 1B0AA 1PVDA 1XO1A 2PWZA 1BD3A 1F48A 2QUHA 3P7MA 4J75A 1B4DA 4XLZA 5AXCA 4YHHB 1IRXA 4KK4A 2J4DA 3IOMA 1IN7A 4S05A 2QVBA 4ZQHA 4PLFA 1Z37A 1PT6A 3M6IA 1A71A 4B74A 4CM1A 1NRWA 2I3ZA 2M1XA 4RWZA 5IBRA 3DMNA 2DFVA 3AKEA 3IVRA 3NHZA 5AK3A 3R24A 1P0CA 5BYJA 3SXPA 2HEGA 4B45A 1VSQA 2AK2A 1Z0IA 1BX1A 4PTZA 5CFNA 1H23A 1V9SA 2ZROA 3I8OA 1SCQA 4HYTA 3O38A 4LTDA 2BJWA 5KVQA 2ECKA 2CKMA 1MP0A 5C46F 3ZDZB 1QGUB 1US8B 1TCCA 3FKSD 4JWTA 5K09A 2FTKE 1U2GA 5SYAA 1XVUA 4DSOA 4OHUA 1P0QA 4DLWA 1OFUX 1BEZA 2I4TA 3NT4A 1RVV1 3N5CA 3OG9A 2X0FA 1MO3A 3T7JA 3ZBUA 2DCUA 1GTG1 5IZ4A 1XNQB 4F97A 2LRHA 3O90A 4HWRA 4KACA 2B4QA 2ZDHA 1GGKA 1JQDA 4I9HA 4I4TF 2BW0A 1CR4A 5K20A 4JLUA 2VJAA 1Z2NX 4LY9A 1KYVA 5KAPA 1NN5A 4L9RA 3CXUA 5DN6A 5TV2A 1Q1QA 3GGOA 4D4KA 4O4JA 2OB2A 1AB6A 3KR0A 2HUPA 3EIQA 1T9GS 2HAEA 1T3LA 3FMPB 3QXSA 4HDSA 4R1MA 5ECWA 1EE2A 4KN8A 1A82A 1QYIA 4NU8X 4X5OA 4JJEA 3SJBA 2OFFA 1Q2XA 5EOVA 1JIQA 4BNZA 1HE8B 4G8JA 3DM9B 1J2RA 1H6BA 2H9IA 3H1PA 3PWZA 3K1YA 3QWFA 1I4LD 1N34B 2VSQA 4W82A 3VTFA 4F4CA 4F84A 2PL5A 3ORRA 2GAJA 3GLIB 3IVCA 4KN9S 1UK8A 5G0VA 1V11A 2ZCVA 1GOTA 3EPPA 2RGWA 3MCVA 3OIFA 1HY3A 3SYTA 4DSAA 4BOYA 4KE6A 4QQRA 4BU0A 3ZD6A 2OCAA 3IBSA 1TQ8A 4GC5A 1QJCA 1Z8DA 4KMMA 3T9EA 2WYUA 1ABBA 1CULC 3AC0A 3T5DA 3DHNA 3HDHA 1VSUA 5BN5A 4JR0A 1UK9A 5JAUA 4Z2AA 1JA9A 3EA0A 4WXPA 4WUTA 1FUEA 2PX2A 1JG3A 4E1BA 3MERA 1KJZA 2FPOA 1FJHA 3JVDA 5A5VA 4MR8A 4HDMB 3W4KA 5K8VA 2XZLA 5COAA 3U26A 4NPAA 5LU8A 3Q11A 3TZLA 1ZHOA 2ISSD 2EL7A 2FPIA 3N8GA 4LJ4A 1JNYA 2GD1O 2ZJAA 1R1DA 5H81A 4KB5A 1V2HE 4XDZA 4WPGA 3LQ2A 4GQBA 5B6JA 3TG8A 2YQ4A 3B6IA 1HYEA 2I76A 2QX4A 2C95A 1L5KA 4EHAA 3N6VA 2X8BA 4D3YA 4ZO4A 2IYRA 2LTAA 4R1NA 3W8FA 1MABB 4RTNA 1Z25A 1DJMA 4HCJA 5E1BA 4JGIA 4B7XA 5TVGA 1ULTA 2GF0A 4ARIA 1WCWA 5C5CA 5F12A 2PSJA 3TOZA 1E6WA 4DEYA 2OWDA 2O8FB 4I5IA 3RWMB 3U4DA 4EY4A 2VTBA 3D4BA 3FI0A 3FHTA 2R48A 4CKYA 2KMLA 3H4IA 4WCDA 2FPKA 4E5PA 2PFKA 5AKIA 3FRIA 4MVJH 4Q3AA 2FPSA 4PG4A 1C9JA 3QKRB 5BXYA 3CH4B 5JO9A 3OCCA 1XX6A 5DHQA 4YXFA 1FP4B 1WPGA 3AFMA 3PNYA 2WE8A 2CZCA 4HLQB 4UDXX 5IRCD 2NXEA 1SBNE 1CFZA 1IHUA 3AEYA 5LQJA 3FUVA 1RI5A 1GPWB 5D3ZA 4OGGA 4PNPA 4NBRA 3LBIA 2BDUA 2F1KA 2V7WA 3CLSC 2G4LA 3MFQA 4N9WA 1KP9A 1UJ4A 4JQYA 2J46A 2YY7A 4XSGA 3R75A 3IJRA 4OI1A 3A3KA 4GMHA 3HU2A 4WFKA 3NHFA 4YB8A 1XTRA 5AI5A 3BMOA 4MDHA 3EPLA 2H1VA 2N1BA 4TSRA 1GQFA 1DAEA 4LHWA 4OHFA 3P9NA 4ISBA 1H85A 3R74A 3EIHA 4HLDA 5KVCA 4BQOA 2A0YA 4K6OA 1S3IA 3VU8A 5A4JA 2YUIA 4W9RA 1J70A 3NETA 5AJYA 4EFNA 4EY7A 5T73A 1I4WA 2WT8A 2MOKA 3EA5A 2VZ9A 2COEA 4IEEA 4HRAA 3WV4A 1JG7A 2Z4SA 3FPLA 1A7JA 2A2ZA 1LVHA 1UM9A 4TVOA 1W19A 5ECDA 5H83A 4JT8A 1I4OA 2CDAA 3KQWA 4QFBA 3W9BA 3STYA 3JR3A 1HH4A 3WDLA 1JR3E 4RZHA 2QMUA 3RDPA 5GJVC 3WRYC 3HXQA 3C4JA 3M4NA 3CM0A 3AVPA 2EFCB 4PYOA 4R0VA 3L4BC 1TAUA 3ELUA 4F8JA 3TPCA 4E32A 3ZOKA 3N3BC 1ZRHA 1DKNA 5FUWA 3TDNA 1TLLA 1JYSA 1ZH0A 5D85A 1T2DA 2WU0A 1JP7A 2ZJ7A 3H9QA 4TLEA 3ZG6A 4MXDA 4DHWA 3VPDA 4OHBA 4Y9TA 3RSCA 3VKHA 4LF7B 2JZOA 3B6JA 5KVVA 1KWKA 1NSYA 2CHQA 4YLYA 2G06A 4KR2A 2ZRPA 5EPOA 2P2YA 1LNSA 3HJHA 1ZVJA 4BAGA 2Y6VA 3K30A 4GQIA 1H2RS 2X3FA 1QGUA 1US8A 3AEZA 5DRYA 4BNYA 3KLPX 1KIAA 2KPOA 4F12A 4HT3B 3GRFA 3ILYA 2VP6A 3IB6A 3W5DA 2V6GA 1G41A 4I9UA 4JR2A 4U0KA 3T7CA 2ZT8A 2ZZKA 4I4CA 1R0WA 1JEAA 1CUGA 3KHSA 5AVKA 3I9KA 2R8ZA 3WWPA 3ETEA 4L1KA 3C6QA 1U0JA 5AOCA 4FCWA 2GN1A 4IR7A 1T4DA 1FTNA 3TNJA 1NPTO 5U1PA 1W75A 2JVKA 3IFSA 1P7PA 1RLUA 5A7GA 3SBDA 1FSFA 1GGJA 2XNHA 1D6NA 1D07A 4PANA 1CJSA 4ALJA 3R6GA 1U1CA 1N0UA 1K08A 3JWEA 3MWGA 2QI9F 1IM5A 3DBRA 1TU3A 4QUGA 2GA8A 4F71A 2VHJA 3C3YA 4YCDA 2BKAA 1LS6A 4BLTA 3LWDA 2R65A 3ONVA 1E2BA 1LBSA 1JRLA 4GDMA 1SXJB 1H1LB 3OJXA 2FR0A 3C45A 3G8CA 4EJ2A 2VXCA 5FRDA 1U9JA 2ZDQA 3UJNA 3KC2A 3V1LA 4J0JA 2WB2A 3QEOA 1LPBB 1XDSA 3VNAA 1Y3BE 4CKEB 3NUZA 2HFJA 5A2GA 2B5OA 4P4GA 4RHYA 1Z5ZA 5JH7B 1X7ZB 4OKNA 1OFIA 4PF1A 1YTLA 2NQ8A 1LDYA 2OMEA 1RI2A 2HRRA 2KLHA 2PGLA 4QEDA 2VS1A 4M60A 5FPTA 5I48A 1U6KA 2DT5A 2FSHA 4EPWA 2ZB4A 1Z0SA 5DHTA 3ILVA 5DYWA 1R6VA 4OMUA 1SUEA 1V7QA 4DG8A 5LWQA 3GLTA 4IHAA 1ZMBA 3SIPA 4JB0A 4YP9A 1Y63A 1VJDA 2SKCA 4HDMA 4B5KA 1HQDA 3DC2A 2PS9A 2WDPA 3I6ZA 1T4CB 1QYWA 3UCXA 5KOIA 5H7XA 3THWB 2O8DB 2BGRA 1OXVA 3BFJA 2VF5X 3EEYA 3O92A 4IYJA 3IKTA 1R8YA 4EY5A 1HEIA 3LDHA 2ZWPA 4AG6A 4ZHQF 2G25A 1XUOA 4Q82A 5K3DA 4UZFA 5TQ2B 1MABA 4V0KA 4DDVA 3QWHA 5HJEA 5ENZA 1FXWF 1UDXA 1C3OB 2EF0A 3E7PA 3LWZA 1TJPB 2F8LA 2ZYHA 3BIFA 3LLUA 5DXJA 3TPZA 4EIWA 4FKBA 1Y8QB 3GLVA 2WJ4A 2FJPA 4JI1B 2QNBA 2O8FA 4TKVB 1PCXA 3EVCA 3B82A 5DW0A 4CEHA 3ISJA 1KKUA 5JD5A 3BM5A 1NT4A 5MN5A 2YJNA 4GMDA 2H2FA 2HREA 4G9GA 4JOCA 4KKXB 2FLWA 2UAGA 2ZJ0A 3AIIA 4D3ZA 1IM8A 2PMBA 3QKRA 4Q1FA 3TJZA 5DYYA 3ZDYB 2C7PA 3NI2A 4RF5A 2OFWA 1P0IA 1GSAA 4ZCLA 5HA5A 3YASA 1FP4A 4IXWA 1L5QA 3ZU3A 2RGXA 1ZH2A 1YSCA 2RH5A 1IOVA 4J2TA 2ZPAA 4KE8A 5A4KA 2MSKA 3IEXA 2BMFA 1WCYA 3PNPA 3PNBA 1M2WA 4R1PA 4ONEA 2BAGA 4M7RA 1XXHB 2JCGA 4QVGA 5BWCA 1EJ0A 2MMCA 3JD3A 2FP3A 2EKBA 1J5XA 2ZYTX 5I9IA 1XPUA 1AZLA 1RC1A 3EVFA 3LUFA 4XUDA 3U56A 4QBKA 2VHUA 5HIMA 1NXSA 4LE0A 3WVNA 2PZJA 5G41A 2QY6A 3UCEA 3E5HA 3VFDA 2VH5R 2OKGA 1V4NA 1U28C 3IURA 3S40A 5CTAA 5C5IA 1FRFS 3NG1A 3DCNA 3EOBI 4WEOA 2V4MA 1J56A 2BGWA 3TIIA 2VRBA 1EUCB 2FQXA 2JD1A 8GPBA 4FHCA 2P4SA 2VF4X 3OZUA 2QD3A 4DZRA 5BUCA 4KMOA 4LWPA 5EEHA 1YJQA 1W34A 2FVYA 1UXOA 1RWPA 2IYYA 2OCXA 4IQ4A 2JCSA 1D1PA 2Y1EA 3G23A 4QQ8A 5ELMA 1JKIA 4H08A 3UYKA 1E4VA 2CT8A 1UUFA 3ZE6A 3I83A 4H0CA 2BFFB 2ZS7A 2NW6A 4IOLA 4NDAA 5CXXA 3U1BA 5IYZB 3ZGVA 1VLHA 2BEVB 5T67A 1EP2B 1LLFA 2VA9A 4B4WA 4L28A 1N5MA 3W8NA 4LXIA 2OV6A 3INTA 4Q3DA 1QTQA 1NXXA 3LI2A 4QOGA 2EHDA 3RS7A 3O8OB 2Q3LA 3FJYA 1NNLA 1O0SA 3KEQA 2VYVA 5I5GA 5JROA 1R8JA 4ZO7A 4N8EA 1YBAA 4X41A 1BWRA 1DBIA 3IR5A 1LF5A 3F7MA 2F67A 2XWBF 2X2OA 3LDAA 3NFRA 3N2EA 3ZD9A 1XMVA 4C6RA 2I33A 1R0XA 2HTEA 3CHYA 3UAXA 3PUIA 2OZEA 2GH1A 3DUFB 4L4RA 1QIKA 3GLGE 3O1LA 3K72B 4E5UA 5C7LO 1JXOA 1WG8A 2VNHA 3BCRA 1EVLA 3DEFA 4OQMA 2ZIXB 2O6LA 4IGIA 1ZZGA 3VNQA 5LMNB 2M9MA 2ZI9A 3B1XA 1D1TA 4P82A 4CE6A 1ZUIA 2OHGA 1AGYA 4BGEA 2DEUA 3IBCA 3L8GA 2E6UX 3TZBA 4PO1A 4PTLA 4Y9RA 1G3MA 2ZYRA 5DBFA 3VQTA 1SBHA 1RMYA 5L7TA 3PGA1 4FHGA 2ZEJA 3I42A 4GNRA 3VX4A 5I7OA 5KSWB 1PX0A 3AJ9A 1V35A 3F8WA 3ND6A 2R5FA 1NHGA 4F4HA 4E5SA 1BJRE 2RAVA 2NPOA 1SXJA 3T8YA 4CFZA 1H1LA 2HCRA 5ALIA 3RI3A 1RJWA 1GUBA 4BUZA 3BPSA 3TX2A 3HWX1 4PPFA 4I1IA 1H2AS 2MDTA 3AF2A 2YWEA 3EXFB 2JFVA 3GFQA 3L7IA 3OZTA 4OAPA 3WLJA 3TRFA 4BMOB 2R3SA 1M8KA 3F6YA 3NUQA 5KVSA 1UJNA 3OZEA 5JH7A 4M22A 3FKQA 2BMAA 5EXPA 1X7ZA 1W36D 4UMDA 2CVZA 4ZVKA 3EVEA 1Y3IA 4BV3A 3ZI4A 1T0HB 2FRDA 3TLMA 3AUUA 2O2JA 3VVLA 5BUQA 1KXJA 4PCAA 4TV9B 3NB0A 4D0GA 3UJHA 5HKBA 4JB2A 2P90A 2A35A 3ONWA 3VU9B 3WX0A 2UZIR 1QWSA 4Q7EA 4YAGA 2IS6A 4IMPA 3RVNA 1L0BA 3CNQS 4D3XA 1T4CA 4W9MC 2GAAA 5LD2C 2F43B 1D4OA 5CT9A 3THWA 1SD1A 2O8DA 5IX8A 2X42A 1KTVA 3F2IA 2CF6A 3SIRA 4WFIA 1P77A 9ABPA 4DANA 4G89A 1ZJWA 3BTUA 1KJYA 2A84A 2B99A 4LRUA 5K8CA 1GNPA 3GVIA 4QYIB 1EBBA 2X1HA 4HYQA 5I7RA 1E2IA 2ZYWX 1C3OA 1FFCA 3HKCA 3QLUC 3QIVA 2ZTLA 3W6OA 1IBKB 5JYBA 4HQLA 4YQEA 2O1XA 3SSAA 3OCXA 2FEKA 4TKVA 5K3FB 2ZXFA 1RAHA 4EHFA 2OC4A 2JIZD 2XB4A 2FZWA 2Y1OA 3BHMA 3MT0A 3OD1A 1PSWA 2O8VA 3O5AA 4OXQA 4BASA 2OPBA 1II8A 1X7YB 1B0ZA 2GZSA 2YRXA 2GZHA 3VYSB 4PE5B 1EUZA 2D0OB 2IVZA 4HNUA 2ZJ3A 3BKXA 3WBKA 1C1XB 3GROA 1LY1A 4MAFA 1LDEA 3ASVA 1D04A 3BB3A 4KQ2A 5THXA 4M88A 4IRMA 1OFGA 1C8LA 5J5VA 1JJVA 1H1DA 3HZRA 4CMKA 3H9EO 1YZVA 2B5VA 2ZWAA 1KBOA 1UXGA 4YRZA 3GX1A 2R00C 3IRUA 4Z4QA 2QLMA 4MUXA 3N2NA 4RV5A 4LHXA 4B3DA 3V6LA 1R0RE 2HJRA 2W2QA 3DZGA 4BO4A 2FOXA 4GXQA 3R9KA 1RP7A 1VG0B 4XSHA 3AHFA 4QOSA 4CQJA 1WDKA 3QOFA 3A6ZA 3I9NA 3JQ7B 2G9RA 3TXXA 5JSHA 3JRNA 3L06A 2OSVA 4U8HA 4IJUA 1I0LA 4LZLA 4BBJA 4U3JA 4W6ZA 4V0LA 1Z3IX 1KEWA 3AV3A 1NUPA 2GF9A 1LC0A 2P62A 3PVZA 4H7KA 5JAHA 1MJNA 4DM3A 4KDFA 3FPKA 4BTLA 1Y1LA 2BTQA 3B3AA 1C7RA 3LUHA 3LY5A 2XCIA 1J24A 3W34A 4B17A 3RRNA 1S0UA 4Q4DA 1QG0A 3G1UA 1R6XA 3JZDA 2D5AA 3KWLA 3R5FA 5LUBA 2BFFA 3J81A 1DEAA 1HTTA 5E7QA 2X58A 5IYZA 3IP5A 2BEVA 4GKJB 4AFNA 2JAOA 2AF3C 5GQSA 2VK8A 3ANLA 4A03A 1H05A 1RYBA 2XLBA 3S29A 3FNBA 1X42A 3DDZX 2FN7A 3E9YA 3RUFA 3STTA 2AXQA 5TXGA 3R9WA 3RS4A 1SG9A 4I1OA 3ZIDA 2P2CA 1NBME 1NLMA 2FKNA 3L5OA 1LI7A 3O8OA 3QYPA 4OIFA 2ZYAA 2IELA 3KYIB 3QGMA 5KKAA 1Y7HA 4MVCA 2IWRA 1JU3A 5DTJA 3PFBA 3KVNA 5TPZD 3PEWA 2OZLB 4KAJA 4F4DA 4UMEA 4KXQA 4LF8B 1K6IA 3EJ6A 3H9BA 3NHWA 3PHBE 4TS4A 1Z35A 3OC6A 4YJFB 3TTTA 3QF7A 1YJCA 3QOYA 4W8OA 3BMNB 2WJIA 3ANMA 1GZ4A 3DUFA 1NR7A 1W5SA 1IWBB 3PLRA 2OXTA 3SQMA 2JDIA 4YRTA 3A11A 3B85A 2ZIXA 4Y1GA 4OATA 4QQFA 2PMFA 1HQYE 1PV1A 4QPNA 3GT4A 4ZVLA 4F6LA 1QTRA 3ICVA 5DIZA 2MSDB 3VBCA 3D8NA 1GPH1 4FT2A 5A4FS 4GI1A 4Q4HA 5FI3A 2P7HA 2NU8A 3SC6A 1CS0B 3TLJA 2E5FA 3UA3A 4YCMA 1R64A 4PY2A 4Y0NA 2OFPA 1IOZA 2WWRA 4I9NA 4S1VA 4PFKA 2DGDA 2FX3A 5J5AA 4WLFA 3UWDA 4EI7A 5GJWC 4QXMA 4O1IA 5SYNA 3L18A 4G8BA 5CXQA 4R3NA 4ZT3A 5FNVF 4B40A 4CL8A 4ENTA 1IIRA 3UYLA 4CMEA 2AR0A 3REGA 2D5IA 1PGJA 2FSVA 2Q4EA 2UYCA 3H13A 4FDTA 4CUZA 2GO7A 2NUAB 3TL3A 4BNIA 1OB2A 4C7XA 1L5HA 4BU1A 4GM0A 5ITZB 2E4ZA 3I9OA 1LFDB 2HHJA 1IH8A 3RG8A 1M0WA 4I08A 1PWXA 2CNNA 2Q49A 4JWKA 2VZ0A 4QU8A 4CGZA 2DP4E 4TUYB 2ZRGA 1KO1A 4TV9A 4WBNF 3EW7A 4TTSA 4L8GA 3Q7RA 3UMBA 3VHRA 1NDHA 4NYMQ 4L5IA 5J59A 3RS5A 2I6XA 2K4MA 5IKOA 1GQOA 2K87A 2JAUA 3AM3A 2F43A 3MMZA 4ZCMA 2W6JD 3F8TA 1CQPA 2ORYA 2OZPA 4D9FA 2XCRB 5E3JA 1JB1A 1W88B 2J0UB 3GI1A 2P41A 4HXGA 5EMHA 2Q2OA 1LWOA 5FWXA 3VH3A 5AVZA 4IOJA 4OP3A 1R10A 3V4PB 1P7VA 2WT9A 3BJEA 1G1AA 3PWTA 4QYIA 4BNWA 1YKGA 5K05A 1P80A 1AQYA 4UULA 3QA9A 4QNMA 3PYXA 2VQFB 2CD7A 1F2VA 2V6FA 2YVLA 4I2NA 2ZB3A 1XELA 2AVNA 4G0MA 4DC9A 4ZDIA 2IXDA 2ECPA 3BMQB 2AG1A 3DB2A 1C0LA 1XEWY 4U6NA 1HV8A 1RE0A 1VG1A 2FFQA 4XRRA 3ZNQA 2PUGA 4IQ0A 2UZ1B 5JOQA 4PAQA 4UHJA 3O2QB 3FM9A 4TRNA 4K28A 1C7QA 1ESNA 2QTFA 2V3VA 3DZIA 4F04A 1HOTA 4KPUB 1XHEA 2I7DA 1BVUA 1L1RA 5TRTA 3AB3A 3R2JA 3M83A 4RX1A 1Q92A 4WQMA 4F2PA 1QYXA 5BRAA 5T4EA 4EPXA 1T5DX 1PLKA 2HC9A 3HBFA 4UU0A 4EBBA 1IVYA 4F2GA 1LBQA 3IP7A 3R5SA 3W6ZA 1X1DA 2HA7A 3FH0A 5KQRA 2BP7B 4I55B 4J0QA 4BFVA 4DQ0A 3E7DA 3DV2A 1M76A 2BGUA 3PGVA 4LZPA 1EE1A 2F90A 4WK6A 1Y8CA 3TD6A 4BNXA 4TRMA 4CFYA 1H0HA 1N92A 3L6UA 5EYPA 2ZUSA 1NW3A 5DM4A 1XJ5A 5EHXA 2P67A 2ZBPA 2JA2A 1TU4A 2HV9A 1S4MA 5KNBD 3EGXB 3CX4A 4MRVA 4YR7A 3DDCA 4INZA 5FQOA 2VJMB 5HUQA 1ORHA 2CDNA 4GEKA 1H6AA 2EFGA 4L08A 4BC1A 1XYGA 2XZOA 2XAUA 4UVEA 3RRZA 3V8VA 3JTMA 4IJVA 2VDVE 4K6GA 2VA8A 4KQXA 4Y30A 4QT4A 2EC5A 1EFVB 1PZFA 4X3CA 4K7JA 3DSRA 2F9FA 1WUJS 5IAJA 3KFLA 4BO6A 3T9CA 5B58C 3HJTA 4UQPA 3H6KA 1K89A 5FAKA 2IP4A 1OWMA 1Z36A 5CJPA 4CWAA 3CE6A 1ZOPA 4GKAA 4DB2A 1BU8A 1Q0SA 2GHTA 1VLMA 4CTKA 2IC5A 5EUCA 4K03A 2PT9A 3PFHA 3D31A 3ZC3A 2ZI4A 1W4RA 5F2EA 5HE8A 1L5SA 3WL5A 3CMCO 3ICCA 1GTRA 1TYCA 2QE7A 4N12A 4NBWA 1DADA 4YQYA 3RC2A 4BNLA 1VL1A 2YYYA 4EJSB 5KNBH 1XD2B 3PRKE 4JQOA 2JA1A 1I7NA 1Y4SA 2OZLA 5H9WA 4CT4B 5JR3A 1R6TA 5B7GA 5CXSA 1XPJA 3T94A 1EGAA 2Z56A 5DNEA 4TKUB 5ELLA 1OAKA 2A86A 4FE7A 2RHWA 2E49A 3BMNA 4B8ZA 1JYFA 1UPCA 4I4TB 2WVHA 3K6JA 4GP9A 4RFVA 1ONPA 2QN3A 4IH1A 1K2WA 3OO0A 1Z29A 2GPTA 1IZ0A 1R9JA 1ICEA 1THZA 1ZIDA 3EHDA 5IDQA 2GAIA 1P17A 2MIIA 2CW5A 4AI6A 2IYOA 3JCZA 3TQIA 2HMSA 2ZRDA 4ZRDA 4M38A 4H1VA 5AUPB 3JQRA 3C8DA 3UY4A 5KO2A 4B3BA 4KE7A 3A6FA 1H8HD 3P9RA 4Y6SA 1CBUA 5EZQA 3WAJA 3O9ZA 2E18A 1FX0B 1CS0A 2JI8A 3NORA 1EP3B 1YDFA 2ETVA 1GARA 2DTXA 2ERYA 3OM1A 3H5OA 5CNKA 2IW3A 4MW6A 2PKQP 1GITA 3VR2D 3GGJA 1U1IA 4WNCA 1KMHB 1CPYA 2XKBA 3IC5A 3MT7A 1SHUX 2I03A 5DHFA 2E4UA 3QKSB 4OKSA 3VZRA 2UYYA 2ORED 2C0PA 2XUJA 4O0MA 4MVJA 1SUSA 3TUXA 3CTPA 4YA6A 1ESMA 1I6LA 5LQNA 1H4TA 2NUAA 1V6SA 4YJKA 3V3KA 4OVKA 2GLUA 5IT4A 4IDCA 1DUSA 4PFQA 4XX1A 3O8QB 3WS7A 4JLPA 1UFVA 4MI1A 4MRAA 1Y8ZA 1B8PA 1RWVA 4OK5A 1C9DB 3SC2B 1JFRA 4U39A 3HDGA 3QF4A 3ESRA 4A0GA 2O8CA 1IPFA 2WUEA 2DWCA 4AJNA 3DMHA 4KLCA 5BN3B 3OTGA 3A6PC 3S2YA 4QHTA 1ZA2A 1PFVA 4TTPA 2YDXA 4KGVA 4OF4A 1RZRA 3PI6A 2Z1NA 3WKCA 1YU6A 2QY9A 2EJBA 2XJ4A 3BK7A 3FCAA 3KZMA 4FK8A 1GG5A 4HAWA 5IMSA 1Z28A 4EG4A 5DULA 4RTOA 2J0UA 4UDNA 3GWGA 5EQTA 1X1AA 3L7LA 3B5IA 3UAYA 3K94A 6NULA 4DF3A 3R6TA 1R9MA 3DP9A 1U4OA 5CVJA 4TV8F 1KH3A 3LK7A 3QPWA 2XOEA 4PO3X 3QEBZ 4IDDA 4EENA 1EXNA 5JC8A 3IPCA 1FJ2A 2EP5A 1OBVA 4OM7A 1RADA 3H6GA 1P1RA 2XMDA 5DNDA 2AUNA 4XI9A 1B93A 4ARSA 2UUBB 3VJRA 4JYBA 2XMZA 5L40A 2UZ1A 4UTNA 3ZQ6A 1Z6ZA 2FMFA 2YVUA 4WA8A 3TQCA 3RAPR 1Z22A 3F7TA 1WSAA 2H85A 4KPUA 5EVCA 1MC1A 1IC6A 4EB3A 2I9KA 1IY2A 4Q1VA 4WINA 3F9CA 5ITVA 2X9QA 2XHZA 4J0DA 1MPTA 1KPIA 1KY3A 1TYZA 3RGWS 1IIBA 3Q0IA 4NFSA 2WF7A 4FGLA 3CEMA 1YWGO 3EXG2 3W1EA 1Z2PX 1N6RA 3MVEA 1PRYA 1Q7EA 2BP7A 2C7VA 1KEUA 4I55A 1Z4JA 2B7CA 1PR0A 3AKYA 4HDRB 5IAKA 5AM5A 3OY2A 2YBEA 1YQDA 3QMWA 1F7UA 4CQMA 3DH0A 2CXHA 2F3UA 2C98A 3HN6A 4HGYA 4L0DA 4UAGA 3UQYS 1V6CA 1SIWA 3UB3A 1U0TA 4BYGA 5ALVA 1E1MA 5COQA 2JGNA 2MSEB 3PQDA 4GAEA 1M66A 3FKJA 2VJMA 3RTEA 1XEFA 4K0KB 3OZIA 1NYTA 2Y76A 3PXEA 4I50F 4DLRA 1NVBA 4N82A 1NJFA 4JP8A 4LTMA 1Q20A 1U0SY 2P9ZA 3E22B 3GDOA 4NL4H 1EFVA 5E3HA 3JD0A 2X9GA 2G9ZA 1NASA 4PVCA 4DJTA 3N0XA 2JJ1D 3KWMA 3NVMB 4PIVA 3ESCA 1YDGA 3QHQA 2OVBA 4MV0A 2QF7A 4X1YB 1VE3A 2BR5A 4KL8S 2BI4A 4ZV9A 3AM5A 4D9HA 1DO8A 3MWDB 1XN1A 4K5QA 4FYYA 1M8FA 2QM7A 3UOAB 5HF9A 2A0WA 2C9YA 1RFGE 3OFND 4YAFA 5DI9A 2XMSA 1Z4NA 4K9MA 1BKDR 3HI4A 2J41A 1E2UA 3MIZA 2C7RA 5CVVA 1SVKA 1GUAA 1Z88A 3OPVA 2PH5A 4AG5A 1W2HA 1G5FA 2QUJA 5C3UA 4I3FA 4C7KA 1TLFA 2DUJA 1QKKA 2P3SA 4P7FA 4ZQIA 4MV8A 1L5ZA 3OA0A 4JROA 2VHVA 1EXWA 3PNSA 5DM1A 4BBZA 4QODA 4DFDA 5AKLA 4CT5A 5CX1A 721PA 1ORWA 1PZMA 1SELA 3QW2A 2IIBA 1K7XB 4N5IX 4Q9JA 3A6KA 3RD5A 4EKDA 1FFXB 5GV8A 2CLDX 4DCMA 2P79A 1WDLA 1C3LA 4GKKB 2Z8YM 4JJ6A 1AGXA 1Y9ZA 3CRMA 4GIBA 4XOUA 3B1ZA 2PK3A 4YXWA 3B3GA 5ABPA 2CLHB 3NATA 2Z8XA 1CY2A 1RKVA 4DLAA 1NBHA 1UDWA 4BJ3A 3K70D 1RU3A 1UR5A 1YFJA 2Z9BA 2I54A 4I4TA 2G5PA 4W5RA 4A36A 1KNXA 1ZISA 1MFZA 4R8KA 2W00A 3PBKA 1COZA 4BPBA 2D8MA 4YMIA 4DNQA 3SVZA 2NTYC 1ANKA 3HKEB 4LQDA 1YZQA 2YFQA 3ZDDA 1EGQA 1JDUA 1T1RA 2C61A 1JDZA 5B4UA 3UV7A 1FFWA 3GEPA 4L74A 2DUNA 4YT8A 3H5VA 4HSEA 2AE2A 1F3LA 3BXGA 3O2SB 2AS0A 2EKZA 3MHTA 3IEPA 3SNHA 2N75A 3MTGA 1F4VA 5DV9A 3RK4A 5A0TA 1DC7A 1QVWA 3FYSA 3I3OA 1AS2A 2EF1A 2PXHA 3WK5A 3CVOA 4QU5A 1JYEA 5JG7A 4E6PA 2ZM6B 2BKXA 3C8UA 2XIQA 2HIGA 1W36B 1KZHA 2QRQA 1BEUB 3DNMA 3I23A 1HFKA 4OBBA 4YP7A 1NF9A 3MWEA 3M5DA 1V8ZA 3SOZA 5FBQB 2YINC 1IL0A 3DTVA 1UXJA 5EE3A 1YQWA 3ZU2A 2ZBEA 1I10A 1V1RB 1X13A 2DPXA 2N47A 4MLCA 2OCIA 1IJFA 5AVQA 4ACBA 3LGAA 1UK7A 4YRCA 1E1CA 4YV0A 1V47A 2I8LA 2GYYA 3C0KA 1Z5UA 1EMDA 3LHKA 4M7WA 4YMHA 4A82A 4HS9A 2JFWA 1RW4A 1T36B 1M1NB 1Q5PA 2FE1A 2HSGA 2PRIA 3AI3A 1XK6A 4NYJQ 4Y2QA 4CM6A 4GMGA 5ICEA 3ACBA 5CM8B 4M1KA 1O3YA 4TTAA 4JUAA 4ND8B 4WOPA 5TSDA 5BN3A 1KRWA 1ZJ5A 5AOAA 4B33A 4BFXA 1BHSA 1W5AA 2CXQA 3NBXX 3R09A 5T6BA 1V8DA 3PTLA 4E31A 3QELA 1N9KA 2ADMA 3TW8A 1ADFA 5DNAA 2C57A 5JSKA 4ZHQB 2QTHA 3J7AC 3X1WA 3K6SB 3H8JA 4NHOA 4LGYA 2ZKLA 4GU5A 4R0NA 4YPFA 3HUEA 1P61B 3O82A 3QVUA 4PONA 3U17A 3VBEA 1EZZA 2VFAA 1GRCA 4LGCA 1V26A 3PNVA 5KREA 2YHIB 3EULA <