1OBFO

The crystal structure of glyceraldehyde 3-phosphate dehydrogenase from alcaligenes xylosoxidans at 1.7a resolution.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
335
structure length
334
Chain Sequence
TIRVAINGYGRIGRNILRAHYEGGKSHDIEIVAINDLGDPKTNAHLTRYDTAHGKFPGTVSVNGSYMVVNGDKIRVDANRNPAQLPWGALKVDVVLECTGFFTTKEKAGAHIKGGAKKVIISAPGGADVDATVVYGVNHGTLKSTDTVISNASTTNCLAPLVKPLNDKLGLQDGLMTTVHAYTNNQVLTDVYHEDLRRARSATMSMIPTKTGAAAAVGDVLPELDGKLNGYAIRVPTINVSIVDLSFVAKRNTTVEEVNGILKAASEGELKGILDYNTEPLVSVDYNHDPASSTVDASLTKVSGRLVKVSSWYDNEWGFSNRMLDTTVALMSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Glyceraldehyde 3-Phosphate Dehydrogenase from Alcaligenes Xylosoxidans at 1.7 A Resolution
pubmed doi rcsb
molecule tags Glycolytic pathway
molecule keywords GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
total genus 116
structure length 334
sequence length 335
chains with identical sequence P
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
O PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1obfO02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1obfO01
3MJ4A 4ALMA 1MUUA 2G82A 2VWPA 1ISHA 3ONDA 4YAGA 1J4AA 4XIYA 1KVTA 1O95A 4ZICA 3K5PA 4IDDA 3KUXA 4CLRB 5TT1A 2R00A 3KVOA 3H9GA 4I9UA 1HSOA 3FWZA 4MDHA 1JQBA 4XB1A 5KJ6A 3C7CB 2A4KA 4A27A 4ALIA 2OXIA 4IPTA 1ONPA 3IAHA 1GEEA 1CIVA 4O0LA 2CVZA 5I8ZA 1E77A 2NV6A 1LDNA 4BNFA 3OJ0A 4XGKA 5B4UA 2PKQP 5B37A 3VTFA 4UAGA 5HBRA 3WGOA 4J16A 1E3LA 3AUAA 2HMTA 3FPLA 4DIBA 1KYQA 3OIFA 1ZIDA 5CPFA 4EDFA 2WYWA 5CHEA 3UCXA 4HY3A 2BI7A 1RPNA 3Q11A 3MEQA 2W98A 3LU1A 4ND2A 4NDNE 3E6AA 1G0OA 4RVDA 1VE9A 3GY0A 3JYNA 5F5NA 4ZQBA 2ZCUA 3I83A 3ZWPA 2YQ4A 2DC1A 3HB5X 3VTZA 1BVRA 2JFGA 3NTRA 5C5IA 2YFHA 3DWFA 4XRGA 3ZW9A 2BELA 4OH1A 3BTUA 1LRJA 3GOHA 3B20A 3VPSA 4FIZA 2PFGA 3X2FA 1RM4A 1TI7A 5KJ1A 2HJRA 4DQVA 2WTBA 1DIHA 2NVWA 4NHEA 1ZZEA 3H5NA 4J0FA 1Z6ZA 3LT2A 1HZJA 1EQUA 5FEUA 3RVDA 3PJFA 3JTMA 1TLTA 1LQTA 1ENZA 5LDHA 3IUPA 4YR9A 1LC3A 3DL2A 1WVGA 3PWSA 5F5LA 1BXGB 4BGIA 1NPTO 1R37A 2CDCA 1E1LA 2CF6A 4PLPA 1E3EA 1EE2A 2V6FA 1FDSA 1JLLA 3QSGA 5F1PA 1TVEA 4OHUA 4BKPA 4YXFA 3JD2A 4RLHA 3W6UA 5JMPA 1NVMB 1EFKA 4OL9A 2NTJA 1O89A 2QQ5A 4MIEA 1W0CA 4LISA 3KTDA 4Z9XA 4IDCA 1ADGA 1B16A 3JQGA 5G4KA 2DAPA 3LQFA 4CUZA 4BNXA 1XELA 4KWHA 4XWYA 1IZ9A 1MC5A 1VKOA 4FJ0A 2VWGA 5JAQA 3DQPA 1MXFA 2FSVA 3LF2A 4WCFC 1EZ4A 3FN4A 1I3KA 1XIVA 3CKYA 3DFUA 5TGDA 2DLDA 2EGHA 1HE5A 1LDYA 4CLEA 1PZEA 4EYEA 2OMEA 4PFJA 1Z82A 2J5KA 4D44A 3PP8A 3ZV3A 4MJLA 1CETA 3ZWNA 2AW5A 4QO7A 4PLFA 2ZYGA 3EAGA 5H82A 1GYRA 5G0WA 1PTJA 2UYYA 3INRA 4BO4A 5KKCA 3F9IA 3M6IA 1V3TA 3C3XA 2WD7B 2GSDA 4BL5A 2PKQO 3NTOA 3TJRA 3OFSA 4J4TA 4NBWA 1HDGO 3AI1A 4P8RA 2YFQA 2C5EA 5G4KB 1GUFA 2BGLA 2NU8A 3C1OA 3PIIA 1FJHA 4Q3DA 2B5WA 3UXYA 5ENVA 4M49A 1NTOA 4EJMA 1WPQA 4MP6A 1KVRA 3KM0A 1WDMA 1K0UA 2NM0A 4JX8A 4J1NA 1QR6A 1YQDA 1N2SA 3N58A 2C0CA 4N54A 8LDHA 4FSHA 3OEYA 1T25A 1ZNQO 5TLSA 1RWBA 4BNIA 1B8VA 3TDKA 4BNLA 1YE3A 2O3RA 4BGUA 1EDZA 3WYBA 2OOSA 4TZTA 2VTDA 4BGEA 2DQ4A 2C7VA 1C0KA 4AJLA 3OEWA 2BI8A 1H6AA 3HQ4O 1MFZA 4WEOA 5BSFA 1GR0A 5IG2A 3Q9NA 3QVTA 1XQ6A 2X0JA 1AN9A 2FN7A 3JQ8B 4KP7A 1UXHA 4UREA 4CM1A 2HMUA 4RDHA 4LCJA 1BXGA 1DHTA 1J6UA 3JQFC 1Q0QA 4J3FA 3EZYA 2P9CA 5KCZA 4DBVO 1DIAA 4ZU3A 4UVGA 1KY4A 3F46A 3HDHA 5I9LA 4R4JA 2AQ8A 1UZLA 1ZFNA 2P2SA 2EEZA 1VJTA 2HCTA 3Q6IA 2PY6A 2DBVO 2BGMA 3ASUA 1M6HA 1DRUA 2QYSA 3R6DA 1MGOA 3H8VA 5A9RA 1UDBA 5EPOA 3JQGB 2CVQA 3CE6A 2B5VA 2X4GA 5ILOA 4L4RA 4WJZA 5JYAA 3U4CA 4GH5A 2VYNA 3OH8A 1EBFA 1GUYA 3VDRA 1GDHA 2C2XA 5TJ9A 4AJPA 5G0SA 1IB6A 2ZTMA 1SEPA 3LC7O 2OFPA 5EN4A 3PGJA 3JYOA 1PGOA 1E3SA 1B15A 3NJ4A 4GWGA 1P1JA 3U09A 2NU6A 1ZW1A 1LSUA 4QTZA 3RUDA 1OZAA 2Y1GA 4OGWA 3JQAD 1EQ2A 3U62A 1HETA 3DBRA 4BNYA 4CM7A 1VI2A 3HSKA 1AXEA 4OIMA 4R68A 3WJ7A 3VDQA 4AJOA 1E6WA 2Z5LA 3OIDA 1NP3A 4QUKA 1QV7A 1UH5A 4ZN6A 1QG6A 1PZGA 1WWKA 2HK7A 2OO5A 3RAJA 3P2OA 3AUTA 1DBVO 2PWZA 1GD1O 2X23A 5JE8A 2IZ0A 2QX7A 1QMGA 3JQ7A 1CERA 1IUKA 1VC2A 2A35A 4CV2A 2VHXA 1Y6JA 1LJ8A 3DAGA 2Z1MA 1PJTA 3PJGA 1ZKMA 4JJIA 1K6IA 2VT2A 4BO0A 4IXWA 4P4NA 5THKA 2OHXA 2Q2WA 2Y1EA 3Q1LA 1IHXA 3F1KA 2BFPA 4WKGA 2OP0A 3AOEA 1I3LA 3CZMA 1LBEA 3AOEC 3AY3A 3U4DA 4KUGA 2Q3EA 1XYGA 1C0IA 3I9MA 4Y67A 2FWMX 4GPD1 3D7LA 4WPGA 4MVJA 2B83A 3IIEA 4OXKA 4I08A 2I76A 7ADHA 3GZ4A 5JCJD 3T4XA 1QORA 3S2FA 5BQFA 1WXDA 2I9PA 2Y1DA 3AWDA 3IKVA 1ZXLA 1OAAA 3K73O 1QYVA 4CMCA 1M67A 4NPCA 3WGZA 2E48A 1T2EA 1E1MA 3DBHB 3KOUA 1P77A 4HUJA 3E18A 2ZJ0A 3RKUA 1E1NA 2AA3A 2E49A 2JD1A 4NK5A 1CYDA 4LVCA 4DVJA 1WNTA 3C1AA 3RJ9A 4QX6A 4UVEA 2IDZA 1B8UA 1ZCJA 3KV3O 3ETGA 3EYWA 2GERA 3VOSA 4HWKA 4XQGA 1Y5MA 2J5QA 4GSKA 4HP8A 2A9FA 3HNPA 4RQUA 3OMLA 3Q0EA 3CPSA 4HNGA 2VTEA 2OGUA 2X5OA 2ZYDA 2NUAA 2B36A 3DB2A 5C7IO 1U5AA 4YEDA 3E5RA 2O7SA 2Q2QA 5KVQA 2PH3A 4YAEA 5JCJA 2EP7A 4K6CA 3U9LA 4J2HA 4PRKA 4YRAA 2Q1TA 4IXTA 5JAIA 2AG8A 4B79A 3GGOA 3K9QO 3GN2A 5L3ZA 3FD8A 1C14A 1U3WA 3F1LA 4NH4A 4CODB 4AG3A 4C7KA 5L95A 3AI3A 4FFRA 4W4TA 3SLKA 4R9RA 4XYMA 1Q2XA 4N18A 3OQBA 5JPIA 3WS7A 3L4BC 1N9GB 2WM3A 1O94A 1ADCA 3OP4A 3U5TA 1G0NA 2AQKA 4D0SA 3BAZA 1SAYA 4RDIA 3ZWBA 2V65A 4IDAA 1H2BA 2NWQA 3O4RA 2Y1CA 1LSOA 2C5AA 5TJHA 1OC4A 5BNFA 1NVGA 5DCWA 3PIDA 2CZCA 3GNTA 3H7AA 3Q2IA 2HKIA 3CIFA 5C7LO 3QP9A 2D0IA 1F12A 2NACA 5KJEA 3QRWA 3QA9A 4PVDA 5DF1A 3ZWMA 4EEZA 2B37A 3IUSA 1R4MB 1TEHA 4YAIA 3TF5A 2IZ1A 1ZUD1 3JQEA 4XYBA 3QVWA 1X15A 1O6ZA 1YL7A 1E7QA 2X7HA 1IYZA 1U8XX 1U9JA 3KYDB 3G3EA 4Y6RA 4BNJA 1NWHA 1DJQA 5JDCC 4UUOA 5JLAA 3ZW8A 3DHEA 4BNKA 2J8ZA 3ZV4A 1VL6A 2DKNA 1NQTA 2GZ1A 5CDYA 2D59A 3GH3A 4NNJA 4YJFA 1GV1A 3TSCA 5B12A 1XEAA 4AJKA 3ZHYA 4YJDA 5MDHA 1CWUA 1EVYA 4ESOA 4XDZA 3KXDA 3L6DA 3PQDA 4OXYA 1YQXA 3W8FA 2PNFA 3I4FA 4W7IA 3IL2A 1GU7A 1E92A 4KWIA 3ORFA 3WIEA 2ET6A 3V2GA 3RU7A 5JCXA 2TMDA 2YHIB 1B2LA 3ZV6A 1JU9A 2CDBA 2CY0A 3EGOA 4RVUA 1SOWA 3IJPA 4XEHA 4BNGA 3PQFA 1GL3A 1L7DA 2VRCD 1I10A 3CUKA 4FC6A 3PHHA 1ZXBA 4OM8A 2FHSA 4IJUA 2HRBA 1Q7CA 1I32A 1VRWA 4AJNA 1EFLA 4G81A 3IDSA 2GN4A 4GQAA 2NVBA 1I3NA 4CM5A 5DCYA 1P0FA 3G79A 3H4VA 1NQ5A 2R00C 2ZTVA 4J91A 1WMAA 3Q9UA 2UDPA 3K31A 4RPLA 1X7GA 4EW6A 3MOIA 3VPFA 1KVQA 3N7UA 3I9LA 4ALLA 4J9UE 1LLDA 3DZFA 3TFOA 3UKOA 5EL0A 4Q3NA 1ENOA 1NBOA 1GUZA 4XDYA 1JVSA 5IDQA 4DC0A 3DZJA 3AY6A 4JROA 4Z0PA 3GNQA 2P5YA 5F1KA 1JKJA 4TWRA 1ONNA 4RL6A 2FR8A 2FR1A 3KEOA 4UUNA 4LGVA 3FRJA 3SJ7A 1H6BA 1A4UA 3BXXA 2YY7A 1JWAB 3ANLA 1MFPA 1SBYA 2CDAA 1GADO 3TWOA 1WLYA 1GPJA 4F46A 5JS6A 3K96A 5MGBA 1PS8A 1GV0A 3S1LA 1LTHR 3DTTA 4J9VA 2CNBA 2Q50A 4WECA 3QVOA 1ONOA 3NEPX 4HV4A 5KKAA 1QKIA 2UUOA 2YYYA 3FSRA 4GX0A 4J2OA 4ALKA 3NT5A 4R3NA 1YBVA 3D5QA 5L4LA 4KQXA 1EBUA 4XB2A 3TZCA 4BO7A 5HTOA 5ES3A 1XHLA 2J3KA 1I36A 1LUAA 1BW9A 5G0VA 3HFGA 1VL8A 1UZMA 3WGTA 2H6EA 4Q39A 3WNQA 4OKIA 4DREA 1F17A 4P4LA 4DMMA 1QLHA 1XGKA 1E1KA 2FZEA 3H5RA 4Y8VA 4CLOA 3C85A 1SMKA 2GPTA 3H9EO 4YJHB 1CRWG 3NKLA 4BB6A 2OUIA 4GGOA 4RZIA 1EVJA 5AYVA 5J23A 3DBLB 3OETA 5K9ZA 1H5QA 1P9LA 1E3JA 4Z9YA 4QSMA 3KB6A 2YV2A 4F6CA 3RC7A 4I5EA 5JO9A 5T8KA 2V6BA 3NV9A 4IDBA 1KC1A 2V6MA 4HFMA 5CP8A 1DLJA 1D4FA 2GZ2A 3ZWVA 4M55A 3ANMA 3WGYA 3DO5A 1D1SA 2NQ8A 4B4WA 1KS9A 4KZPA 2X8LA 4RVFA 4FFPA 3HDYA 2X22A 2YW9A 4YTEA 2JHFA 4Q3BA 2AHRA 5IXSA 4BO3A 2X9NA 3E9MA 1HDRA 4GX5A 3E9NA 4OJNA 3ZNPA 2POQX 4MVJE 3OF2A 3AJRA 3LT1A 4A7PA 5L4NA 1CJCA 5KVVA 3DEYX 1XLTA 4LW8A 1HWYA 3LK7A 1PGNA 3H9JA 3ROMA 1UR5A 2EXXA 2WYVA 1C1XB 4Y9DA 3S2EA 1NAIA 4J1QA 2FR0A 5DZSA 1F06A 5EIOA 3DBRB 5CEJA 5IDXA 3GLQA 1PL6A 3D4PA 2VYVA 1UP6A 4CLDA 3PYMA 3WWZA 3NT2A 1ZSVA 2AMFA 2Y0CA 5EQFA 3ZHZA 3WMXA 3KSUA 3D64A 3I6QA 4Q3CA 3QQPA 5T5QA 4IDEA 4IUYA 1JN0A 2EIHA 3ICPA 2QW8A 5F3RA 1D7OA 1P1IA 3FF4A 4CR8A 4MVJP 3PXXA 4YACA 4CV3A 4RVHA 3H5AA 5C37A 1Q7BA 1P74A 1HT0A 5IZCA 4JLWA 1H94A 3IKTA 1NFQA 3UCFA 5DULA 1W8DA 5JFOA 1DOHA 1AHHA 1ISGA 1LI4A 3GAZA 1T2DA 1ADFA 2PA3A 2QHXA 3P19A 5CG1A 3GVIA 1HDYA 3A1NA 3G1UA 2LDBA 1UDAA 4II2A 2Q4BA 5TNXA 2JHGA 3PGXA 3JQBC 1GEGA 3AY7A 4L4XA 4EBFA 1VJ0A 2Q22A 3GHYA 1M66A 2EW8A 4DRYA 4DXHA 1DAPA 1LXCA 2DBQA 4DIFA 1HXHA 1LLUA 4TQGA 1D8AA 2Y99A 3H6KA 4BVAA 3TL2A 3GGGA 3ITDA 1N5DA 5ICMA 3X2EA 4GMFA 3BMCA 3IOYA 3KYDA 1YBAA 4XZ3A 4RVSA 3RJ5A 3LF1A 4MVJG 1Z75A 4GAEA 4Y98A 3JQFA 3OM9A 4WGGA 1DRVA 3RC2A 3SX2A 3KBOA 3QE3A 2BLLA 3WSWA 4CUJA 4I9HA 4BMSA 3KSZO 5CDTA 2P5UA 2RAFA 3VH1A 2OORA 1KY5A 5TF4A 1P1RA 1TXGA 2BFMA 4EI2A 3HUDA 3WQSB 1R4NA 4D46A 1U7TA 2Y0EA 4E6PA 4DLAA 2PKRA 1AHIA 5JO0A 1YOVA 1SOVA 4NBRA 4RO0A 3JQAA 4W9NA 2O3UA 1PGQA 2YHIA 3FR8A 4JJFA 1EMDA 3DC2A 4CM3A 4E0BA 4R41A 5FI5A 4DBZA 2PGDA 3B6ZA 4AVYA 2Y67A 3VVCA 5JDIC 5JYFA 3NGLA 5IDYA 1H9AA 2ZK7A 4U0JA 5T6BA 2XPCA 1U5CA 1NXQA 1U2GA 1K5HA 1BWSA 5COQA 4B3IA 2C7GA 2DFDA 3AUUA 1J5PA 3QJ5A 4YJGA 4BQRA 4E3ZA 4GVLA 1U4SA 1A71A 2WE7A 3N74A 4II3A 3SC6A 4JP2A 3BHMA 4ITUA 4BKUA 3U4IA 2Q1SA 4NJMA 3LLSA 5L53A 1ISIA 3D4OA 2Y68A 3VH4A 4HNHA 2NQTA 1MG0A 5F1OA 4ONEA 4W9NC 3QLJA 1PR9A 5IFLA 2O48X 1HYGA 1R12A 1XA0A 4F45A 4TRJA 1QYXA 4K9DA 3L9XA 1ZO8A 3ZU4A 4R9SA 3AU8A 3VZPA 3DBLA 4W7HA 3KYBA 3W4JA 1QP8A 4WLUA 4GBJA 4PG4A 4X54A 5GY7A 1E7YA 4NI5A 2FPPA 4BO9A 4CQLA 3WG9A 1UXIA 1SNYA 3WGQA 5I9NA 2Y05A 2AE2A 3EK2A 3K6JA 1R16A 1HF3A 3CH6A 1BXZA 3OJEA 1QLJA 2PZKA 4ZQHA 1Y9AA 4XGNA 1PIWA 1U3UA 4CMAA 1W6UA 2FY8A 4A0SA 2Q49A 4HFRA 1BXKA 3OICA 4D7AA 3TOZA 1E5LA 4J4HA 1R4NB 4R16A 4Z0TA 4BNNA 4YT8A 5HS6A 4CMEA 2DBRA 1B26A 1A5ZA 2C29D 4QQRA 4BNVA 4R1UA 1IE3A 1DXYA 1ZH8A 3GG2A 4PN3A 5A4DA 3UF0A 4PZEA 4BKRA 1ULUA 2ZATA 3K8ZA 4U0KA 2D1YA 2O7QA 3PPIA 2IE0A 3I52A 4NR0A 2G5CA 1IULA 2WEKA 3WLFA 1BW9B 3A14A 3GK3A 2JAHA 4KUEA 4LRTB 5ADHA 3H2ZA 1PZFA 4FB5A 2O2SA 5LC1A 3VHRA 2GYYA 1RKXA 4PLTA 2EF1A 2R6JA 4ND4A 3ZHXA 2YV3A 4LSMA 1BDBA 4YQZA 5EESA 5EERA 4FGSA 4DWVA 4DYDA 1X7DA 4GSLA 3LYLA 5I7VA 1DEHA 3GNSA 4CMIA 2P4HX 1TT5B 4IQGA 3MTJA 4ZQGA 5KJCA 4B7UA 1H6CA 4CR7A 3UAGA 5GZ3A 2HRZA 4PRLA 3R3JA 3MCVA 4JCOA 4CMGA 5JDIA 1UP7A 4KDEA 4U6SA 4RPGA 1C0LA 3Q2KA 1R0LA 2Z1NA 3EDMA 2IRWA 5U1PA 4OYRA 2B4RO 1PS0A 2VT3A 3WYCA 1A27A 1EVZA 1U1IA 1UZNA 3LZ6A 2J3HA 3IS3A 4B4UA 1Y9EA 4WLNA 3RASA 5JAMA 1E7SA 1MA0A 2NTNA 1K6XA 4DUPA 1ISFA 3WGGA 1ID1A 4A10A 1T4DA 1T1RA 2D5CA 1KC3A 3FWNA 2QIOA 3D0OA 3TPCA 1ZJYA 4F6LA 4J49A 1I01A 3L4SO 3S2IA 5EINA 3JYQA 3ST7A 3DMTA 4IMRA 4I8XA 5JNLA 1JWBB 4XD2A 1X7HA 1BHSA 1P0CA 3JQ9A 4L73A 4L0QA 5FF9A 1PWXA 4L74A 1G6KA 1XG5A 3FNGA 3GF4A 1WAMA 4TRRA 4PIVA 1T2FA 5CDUA 4C7JA 2NU7A 2VOJA 4QEDA 3GUCA 1HRDA 5I7FA 4MINA 1ZJZA 4ILKA 4ND3A 1GQQA 2AEJA 4JGBA 4ZA2A 3RBZA 1EUZA 2E37A 3BMNB 1HTBA 3DR3A 5KVCA 4CQMA 2E4AA 2V7PA 3U0BA 1ENPA 4FPXA 4IJVA 1X0XA 3HJAA 1DO8A 2YHUA 1SZJG 3INTA 1PEDA 3MWDB 5DBIA 3VPGA 3MJTA 2DUWA 4ZJUA 4ZRMA 3FI9A 1A72A 5C3MA 3BTOA 1NHGA 2QYTA 4B8ZA 4YVFA 3WLEA 1IL0A 3ZV5A 4DPKA 3ETEA 1U8FO 3OSUA 4RZHA 5A3VA 1B7GO 1NVTA 1DFGA 4H15A 4FFMA 5BT9A 2GR9A 1DRWA 2GGSA 1Q0LA 1DFIA 4M54A 4MKRA 3VPHA 4FW8A 4BO6A 4R5MA 1IOLA 3WGHA 4XQCA 3PHIA 4B3JA 5G2OA 4BS9A 5BR7A 2JJYA 1PJ4A 1E6EA 4CL3A 2PK3A 3TZQA 5B4VA 3AM4A 5A06A 1CDOA 2EKQA 5JSFA 4XX0A 2I3GA 3C24A 3TN7A 2O23A 3UW3A 1VSVA 1X1EA 2NTVA 4Z0HO 3K92A 2FP4A 4JXKA 3DHNA 3PYXA 4CMJA 4DGSA 1Z7BA 3ZWYA 4A5OA 4EUEA 4IQ0A 1NHWA 5TC4A 1PJ3A 2OP1A 4IBOA 5AXCA 2Q99A 1BTOA 4BO1A 4GMGA 2O3SA 1C1DB 3RROA 3ABIA 1AGNA 1V6AA 1YOVB 3CSDA 4JP3A 4PG5A 1PL7A 2C20A 2WSBA 3PJDA 4IIUA 2D5AA 4JBGA 1I3MA 4MP8A 3ZWXA 4MVJH 4M89A 4MO2A 2VRCA 2ZTLA 3BMQA 4CM8A 4U8GA 4D43A 3BZUA 2NLOA 1HDZA 5LCXA 3OECA 4Q3AA 3FNHA 1R4MA 1HE3A 3WQRA 4XJTA 2BKAA 5CDGA 2B35A 4CUKA 1XWFA 3JQDA 1ORRA 2PZMA 1K3TA 3EW7A 3OA0A 3VH2A 1B3BA 3PDJA 3KO8A 3JQ9C 5DBFA 1H93A 4N5NA 4CLXA 3EUWA 1ZSNA 1KBZA 2Q1UA 1T2AA 3S2GA 3V2HA 1M6WA 4GLOA 2VZ0A 5TT0A 4J43A 5HA5A 4FDAA 4DL9A 1YH3A 4CV1A 5CG2A 5TRTA 2ZB7A 2ZIZA 2Y93A 2GN9A 5A02A 1M75A 1B14A 4YJFB 1GCOA 2EV9A 2BFOA 2FRDA 4ROSA 2VN8A 4TKLA 1NPYA 3VZRA 2PD6A 4BNMA 1K6JA 2W2KB 3UN1A 2J3JA 3WICA 4FR5A 3QVXA 3STHA 4GX1A 2QRKA 2YJZA 4WLVA 3HZZA 4IS3A 3G17A 2IEBA 2DFVA 4YB8A 4E5NA 3JYLA 5DNAA 4UUPA 3GN1A 3NGXA 3GMSA 4FC7A 1E3IA 2WMDA 4WUVA 5HWSA 2G1UA 2X0NA 1WDLA 3V1YA 3EMKA 4QXMA 3AFNA 3QW2A 4XR9A 4R3WA 3WNVA 5L4SA 3L0DA 2ILTA 2P4QA 4RF4A 3GFBA 1GYPA 3TL3A 2E6UX 3AUSA 3BMOB 3JD0A 4K6FA 4HADA 4E31A 1R0KA 1E5QA 1M76A 4TSKA 4IY1A 4MIYA 3JQ8A 1N9GA 4P4GA 3SEFA 2Y0DA 3RKRA 4UVIA 4PZCA 2HAEA 1V0JA 1BG6A 2VWQA 2YQ5A 2H1SA 4FD3A 1P1KA 5T8KC 2PH5A 3V5NA 3T4EA 3M1LA 1PJLA 4NK4A 3UH1A 3L4BA 1YJQA 3BMQB 4BO8A 4EJ6A 4H7PA 3BMCB 4XKJA 1P45A 1GFSA 4R54A 2VOEA 4LMPA 3JV7A 5DT9A 4AJ1A 3RUAA 5ER6A 1H6DA 3BMNA 2RH4A 1Y8RA 5TIIA 3D3WB 2EKLA 2X9VA 2HSDA 1JAXA 5M6DA 1V8BA 4DQXA 4Z9FA 3TQHA 1U4OA 3NAQA 3QVSA 4I5FA 4OKNA 3ADPA 4U7WA 3LLVA 1W4ZA 4TKMA 3OHSX 3GRKA 1AUPA 4E33A 2WJPA 4XGIA 2Y1OA 3MJEA 2VQ3A 4BO2A 1LSJA 5T67A 1Y81A 5THQA 3WTCA 3GG9A 4L9RA 4K28A 2UV8A 1DLIA 1UJMA 2O50A 5ENDA 3C8MA 1GQYA 2SCUA 4MVJD 3GDOA 3NX4A 5J9GA 2F1KA 3HB4X 3TRIA 4KDFA 4D79A 2LDXA 2DBZA 4YBZA 4CQMD 3PZBA 1DC3A 3E82A 3FHLA 3QY9A 3EC7A 1PS9A 1ZBQA 2JAPA 1KIFA 5A9SA 8ADHA 5B1YA 4AL4A 2PD3A 3QWAA 4ZQFA 4DLBA 3DZKA 1YVEI 3P7MA 3ZCXA 3W8DA 1Y8QA 3GFGA 4TVOA 1NFFA 5JYDA 4IGFA 2J5RA 2XXJA 3ZN2A 3RC1A 4L76A 3P2YA 3ROKA 1S6YA 3JSAA 1XQ1A 2GD1O 4IMPA 5JXWA 2VYVD 2ZKLA 3H65A 4TROA 1N1GA 1ZK3A 3I6IA 4WOKA 2GASA 4XCVA 4PLZA 2VHVA 1PQUA 2VUSA 3FBTA 2JFHA 3WWYA 4GLLA 1G1AA 3JQCA 3BA1A 2ZB4A 2IYOA 1SEVA 1P44A 1HSZA 4BUCA 4R5HA 3VVBA 1Z7EA 3W1VA 2HK8A 2O3QA 4HFNA 5A05A 4CM4A 4E5YA 3ZH2A 1XU9A 1X1TA 1PJ2A 3PRJA 1PGPA 5DP1A 3NT4A 3DOOA 1Q0HA 3HWRA 3LT4A 1IZ0A 2WE8A 5TS3A 1PJQA 5L7YA 2ZB3A 5ITVA 4BOYA 5A5FA 2PLAA 2H5LA 2EHDA 4PLVA 3GQVA 2C07A 1PQWA 2X9GA 4IZIA 3UCEA 1I8TA 4EZBA 5JC1A 1SO8A 2CF5A 5CEEA 3LSYA 1LEHA 4DPLA 4L75A 4PLYA 4B4VA 2PR2A 4CL8A 1ZSYA 3LC1O 4TVBA 1WW8A 3DDNA 1RM3A 1P1FA 2G0TA 1YL5A 4D41A 3U3XA 3CMCO 4GWKA 4D3SA 3GDGA 3ZI0A 1XDWA 1H2HA 4INAA 3HDQA 4CM8B 5EQDA 4YWJA 5ILGA 2NVUB 1CEQA 4S1VA 5U4QA 3K2EA 4M86A 4EGFA 5IXYA 2FPGA 4IQ8A 2QZZA 4NFSA 1I2BA 3B1KA 1T2CA 1ML3A 3GEMA 1GQ2A 1C1DA 3FBGA 3IMFA 4NMHA 5TQVA 1VLLA 4XJSA 3CZRA 1YRLA 2BMAA 5B4TA 5IZCC 2HJSA 3PJEA 3ROQA 4EITA 1ADBA 1FDTA 3HDJA 4EUFA 1GAEO 3TOXA 2GF2A 4O5OA 4Q3EA 1YB5A 4MVJI 3OA2A 4WCFA 1JKFA 4ND1A 1RM0A 2GUGA 3PK0A 4NFHA 1MC4A 2B69A 3JQAB 3E8XA 3GHHA 3VPXA 1J49A 2E82A 4RORA 2I66A 1HDCA 2NSDA 4FQ8A 2OBNA 1YO6A 2DM6A 1SCUA 2VNAA 4D0RA 1YS4A 3NTQA 3O38A 3P5SA 1WP4A 2NVUA 2C2YA 5KNLA 3KSDO 2VHWA 1UP4A 1NNUA 2YUTA 1QYCA 1XU7A 4MIOA 3NJ8A 3PHGA 3R3SA 3ZWWA 9LDTA 1HE4A 4FOSA 2PD4A 3V1UA 1U7HA 1WZIA 3WR5A 3OBBA 3TZHA 3B70A 5DN9A 2FZWA 3AW9A 4WE3A 4I1IA 4Z3DA 3ITKA 1SC6A 2JCYA 4QT0A 3F6YA 5LDGA 4CMEC 1IY8A 1LU9A 4BNHA 5DP2A 1NASA 3EVTA 3IC5A 3DOCA 2B0JA 3AI2A 4YRBA 1XCBA 3OIGA 3SVTA 4MVJM 1UXKA 2EWMA 4IIVA 5L9AA 4B7XA 1V35A 2W2KA 3LDHA 2XXBA 4TRMA 4F3YA 3RBVA 1LLCA 1ULSA 3CXRA 1Y7TA 3ONFA 5K0ZA 1NPDA 4DLLA 5DOZA 2W2LA 2GZ3A 3PVZA 4PVCA 1LDEA 1BRMA 3ZWAA 3DBVO 2HO5A 2XF8A 1DC5A 1PZHA 1HDOA 1MB4A 1BSVA 5IN5A 1FK8A 3UGKA 3F4LA 4RPKA 1KOLA 1E0DA 4D42A 5IZ4A 4DQUA 4GVXA 2DT5A 5AXBA 1LRKA 4BGVA 4PG8A 1JA9A 3JCZA 4FJ1A 1C0PA 4R01A 1GYQA 5JW6A 2DVMA 3GC6A 1GTMA 2Q45A 3M2PA 2CFCA 4N5LA 6ADHA 1E7WA 4YAJA 3W8EA 3H3FA 5FFFA 3ZNOA 5I7EA 2H9IA 4G2NA 4DTIA 3WX0A 2QRLA 3QWFA 1BVUA 4ID9A 5FI3A 2OL4A 4JBIA 2RHCA 4J7CA 3EZLA 3DZHA 1H9BA 3FPCA 2VHYA 2DUUA 4DYVA 3K2BA 4JK3A 2JD0A 5T57A 1E3WB 3H9QA 3PQEA 4OOFA 3AM3A 1E7RA 3PZRA 3UFXA 2O2YA 1DHRA 3VC7A 1VJ1A 2WD7A 3AK4A 2G76A 1NFRA 3WDSA 4D3FA 1NQAO 2HDHA 4NU6A 5JYEA 2Q46A 3WQQA 5BSEA 3A9WA 4RV9A 4PLGA 3WBBA 3F5SA 2A92A 4IGEA 2EW2A 4YPOA 1PJSA 4FCCA 4OMUA 3DFZA 3OQ1A 3BTVA 3RC9A 2HUNA 4RQTA 4B3HA 3RFVA 4RVGA 3SC4A 5L7WA 1R15A 1HKUA 3WJAA 4E5KA 3PLRA 4ZD6A 4WNIA 3H2SA 3V8BA 1T4BA 1J0XO 3ZU2A 4ALJA 4JJGA 4CMHA 1R0SA 3WB9A 4O63O 2ZQZA 1TA4A 3ENKA 3F47A 5A9TA 1QRRA 3M2TA 1E7MA 3DOJA 1P31A 3RQSA 1YJ8A 3PI7A 4U6QA 5IN4A 4WLOA 3WFJA 4HKTA 2RH8A 1I33A 3FTPA 4KOAA 4RF2A 3PFWO 3V1TC 3O03A 4XRRA 1MG5A 2RIRA 3AU9A 4BKQA 3ASVA 2NU9A 4YT2A 2AG5A 4XIJA 1YDEA 4XR4A 3KZVA 1A9ZA 4YT5A 5HRUA 2IXAA 1GY8A 3KYCB 4IZHA 1Q7GA 4PLCA 3JQ6A 2J3IA 3OJFA 1PX0A 4WLFA 4ZQEA 5CPBA 3UUWA 1YGYA 4WLEA 5GZ1A 3GVCA 4YDRA 1HLDA 1F8GA 3WBFA 3C1TA 4YJHA 3FNEA 2Q4EA 1FDWA 2Y1FA 3KRTA 2TMGA 4IS2A 4RLSA 3KETA 1WMBA 2W8ZA 2OZPA 3R1IA 1VL0A 4NJMB 4OQYA 4MKZA 4G5HA 2JKVA 5JC8A 4JN6B 2D8AA 1NR7A 1XKQA 2W2LD 4JBHA 1IPFA 4D3DA 1YWGO 3H9UA 4RCVA 3EVNA 1ZK0A 2YDYA 3WFIA 3GEDA 3DAPA 3DAFA 3EHEA 1MV8A 2X86A 3ENNA 3GVHA 2VUUA 1E6UA 1Y1PA 2BD0A 2QG4A 3BYZA 1UXGA 2BFAA 4E2YA 1UXJA 3BMOA 4BNWA 2P91A 3I9KA 4CPDA 4YT4A 1LC0A 1ENYA 4Y6SA 4NQZA 4BNUA 1ISMA 1A4IA 1T24A 3DMYA 4L8VA 3F5QA 3GT0A 2EGGA 1DPGA 3M1AA 4RF5A 5A9SB 2I65A 1SB8A 1KEPA 3IQDB 4KTVE 4OOEA 2EKPA 2GLXA 1FDUA 2BF7A 5CAEA 5FYDA 3T7CA 2IODA 3GEGA 1N7GA 1YKFA 2FSSA 4CMBA 1EDOA 3BHIA 3EY4A 1DIBA 1LRLA 4PLWA 1T1SA 2RBEA 3I9JA 1V9LA 5I9MA 1UDCA 3RFXA 1Z74A 4E13A 4MPDA 3GMDA 3JD3A 1EVIA 3GVPA 3O8QB 4OQZA 3CINA 1I24A 5G4LA 2F00A 1O5IA 3F4BA 2HMVA 4G65A 5CDSA 3INGA 2UAGA 4J7UA 4JNKA 5KWEA 4IJKA 4BV8A 4NBVA 4NU5A 5TX7A 5JBIA 4NZ9A 4QFCA 4J4BA 3L9WA 2R2GA 5AVOA 1R6DA 5A03A 2X5JO 1N1EA 3L77A 5CFZA 3D4NA 3ICCA 1TB4A 3RUEA 2VZ8A 4CM6A 4J7XA 3A06A 3DBHA 2NNLD 4GKVA 3WIDA 3HHPA 4QO8A 4CMIB 2EJWA 2X6TA 3IP3A 3E5MA 1P3DA 4IJWA 2JFFA 3RFTA 3RUFA 2VYND 2Z95A 4HBGA 3VH3A 4BNZA 5U9CA 4YA6A 1JW9B 2BRUA 1CF2O 1D3AA 4O59O 4ND5A 1S7CA 1BMDA 2PV7A 4J6FA 1YBMA 4FFLA 1I2CA 2GDZA 2FPIA 2C59A 4AJIA 1HYEA 2UUPA 4ZRNA 5L51A 1ZMTA 2I5PO 2NADA 3PHJA 3H3JA 4D45A 3RIHA 2X58A 3G0OA 4BIIA 3RUHA 2YV1A 4BB5A 1E3WA 1KEWA 2JL1A 3TNLA 4R1NA 4NBTA 4BV9A 6LDHA 3L6OO 4PZDA 3RU9A 1B3RA 1JTVA 2I6TA 3T7EA 1HYHA 1X14A 5H81A 2ZB8A 4NFYA 3QIVA 4NIMA 5A04A 3A4VA 3ON5A 1X0VA 3I4CA 4M8SA 2P68A 2I3AA 1F8FA 3WSVA 5KOIA 2G17A 3JQ7B 4LVUA 4R69A 5JDCA 4R51A 3PFFA 4CLOB 5L40A 3B1FA 1YQGA 3PTZA 3GUYA 3MJCA 1RM5A 4WNCA 4Z3KA 5FWNA 3ZU3A 3MWEB 5AOVA 3CMMA 3PLNA 1NX6A 1YXMA 1EK5A 3KEQA 4E2ZA 5HS4A 5I8WA 1K89A 2PTGA 1V3UA 2YDXA 3PHLA 4YJGB 1AE1A 3JD4A 3UVEA 1ZEMA 4MVJF 3G49A 4UULA 3ZU5A 2X1HA 4E2WA 2ZJ1A 2AEFA 4ALNA 3GPIA 1N92A 3O8QA 1M2WA 1QYDA 2GO1A 1ZK4A 3C7DB 2HMSA 4CMKA 5A1TA 1O9BA 1KETA 1JDJA 3B1JA 2DTEA 5BSGA 1W73A 4BQPA 1F0YA 3QWHA 1BGVA 1N7HA 1DFHA 2V6GA 1PWZA 1NYTA 3U4HA 2EJVA 1Y8RB 4FJ2A 1RYDA 1I2ZA 3TZKA 1PJBA 3HG7A 4J1SA 1DC4A 3WOHA 3COSA 3NRCA 2OBYA 3ULKA 4CQLB 4AJ4A 3W4IA 4RF3A 3ANNA 3DONA 1GZ6A 5GZ6A 4E21A 1D1TA 4E12A 3FNFA 3RI3A 1ISJA 2B4QA 2C54A 2I99A 4H16A 2AQIA 4B7CA 4LCEA 4CR6A 5DBGA 4RGBA 4WCDA 4TMFA 3TFQA 4FFOA 4AJEA 3S55A 4U5QA 3ONEA 3WTBA 4GKBA 3AM5A 3QHAA 3ZWOA 2Y66A 1Y8QB 4XQEA 4WK6A 1K2WA 4J1TA 1YDWA 1I30A 4A03A 2VCYA 3MJVA 3GR6A 1V3VA 3UHAA 4A73A 1LQUA 3IJRA 4HFJA 4BKOA 4KQWA 1ZK1A 1PU2A 1FF9A 1FDVA 4NG5A 1MXHA 1NM5A 3GGPA 3GRPA 4CV0A 3WXBA 2DTXA 4O1MA 3DHYA 2AQHA 1U3TA 3I23A 3NYWA 4A26A 2D3TA 3PWKA 1LDGA 9LDBA 4MOWA 3QWBA 2IEDA 1PR3A 1CQJA 4I5DA 4B4OA 4L4SA 4PG7A 3ADOA 2HQ1A 3NDIA 4AJ2A 4M1QA 3WGIA 3MZ0A 1YONA 2GN6A 2X5KO 2O3TA 2AE1A 4PLHA 1WDKA 2JCVA 4IINA 5KTKA 5L45A 1KEUA 1MX3A 4Z6KA 3KHUA 3ZDFA 3DZIA 2ZTUA 3DTYA 5GMOA 2WD8A 3MJSA 1VM6A 3ZGYA 3HE3A 4FN4A 3OQ6A 1HLPA 1YB4A 1HEUA 1OMOA 3GZNB 3SLGA 3FTNA 2VUTA 4BMVA 4YAKA 2B4TO 3O26A 1XSEA 1HZZA 5DOVA 4QFDA 1Z73A 1PJCA 3ZWCA 3R0IA 1N8KA 5CEFA 1OI7A 4CQMB 1WZEA 2BHLA 1DSSG 3HADA 3S8MA 1H0KA 3QWIA 3DMTC 1NWCA 4BO5A 4P22A 4AJJA 4I9NA 1TT7A 2EERA 1LLQA 3LVFO 4RJTA 4PG6A 1X13A 3GA0A 5KJFA 4CM9D 2QRJA 5ICSA 4FFNA 5AXDA 4E2XA 1FXSA 4KUHA 3I3OA 2I67A 2ZQYA 5K6AA 1EE9A 1EUCA 4TRNA 2CUKA 1GZ4A 1QSGA 4J0EA 1KVSA 3ZNQA 4E4YA 5A5EA 1LDBA 2O3JA 3KYCA 4M87A 1O0SA 5IJZA 4UEJA 3RBXA 4LN1A 4OAQA 4OSOA 2CSUA 4GGPA 4ZHSA 1Q1NA 2GRAA 2DPHA 3W6ZA 3K30A 2GN8A 1T26A 1UAYA 1KERA 1GPDG 1OC2A 4W99A 5JAZA 2PGJA 1DDOA 4CLRA 1OOEA 2JD2A 1LDMA 4R1TA 5T73A 2O4CA 4W82A 4AFNA 2FOIA 3A28A 1I0ZA 4R1SA 4PGFA 3WYEA 4CM9A 4WCFB 3SBOA 4FS3A 1SB9A 2X0RA 4HXYA 4GL4A 1PL8A 1EUDA 2XOXA 4NBUA 1PGJA 3NDJA 1GCUA 1A7AA 1XR3A 5AXAA 2W4QA 5ITWA 3TZ6A 4WOJA 5IF3A 5DDIP 3I9OA 3OJLA 3RD5A 2PZJA 3D3WA 3I9NA 4E5MA 2W90A 4WEQA 2IZZA 4ZGWA 1LA2A 1YL6A 5IDWA 3PWZA 3V2UA 1AXGA 1SPXA 3E9QA 5HM8A 2PGLA 1U2DA 1YB1A 4RPJA 1PSDA 3W4KA 2AXQA 2IYPA 4AJHA 4GX2A 4GI2A 5EMHA 2CD9A 3GZNA 4J90A 5DCUA 4EJ0A 4W6ZA 4H3VA 2HU2A 2DTDA 4IDFA 3DZGA 2GCGA 3GAFA 3GVXA 4LSWA 5K6AC 3VAZA 4XYEA 2PZLA 1VSUA 2CVOA 1F14A 4YCAA 5F21A 2YZ7A 3FCOA 4BHTA 3RUIA 1TT5A 3Q3CA 1EEHA 4N5MA 1P33A 2EP5A 3RSHA 3MOGA 3JQBA 3HN7A 3I1JA 5EJ2A 3VZSA 4OO3A 3WMWA 1JAYA 4DIOA 4B8WA 4ZVVA 4S3MA 2RCYA 4BNTA 2ZYAA 1CQIA 1QV6A 3CTMA 4IDGA 1MP0A 1VKNA 5AQ1A 5JY6A 2UVDA 2VWHA 4E32A 2WWRA 3AOGA 4O6VA 3UOGA 3JYPA 5COAA 3RUCA 3BTSA 3AFMA 2WYUA 3LT0A 5KVSA 4BMNA 4HX5A 2X0IA 5I7SA 2DPGA 5G0TA 3LC2O 1Y5RA 1EK6A 4LMRA 3SXPA 1HDXA 5A3JA 2RHRA 4E5PA 3HFSA 1FMCA 4FBGA 4UUMA 3BHJA 2AEMA 5JMWA 1HE2A 3PYLA 4XA8A 3U49A 4WASA 2BH9A 4C4OA 4UEOA 5ER9A 4IM7A 1OFGA 3NDRA 3ETDA 1C1XA 4I5GA 5BSHA 1RJWA 1U3VA 4DC1A 4UEKA 3BIOA 3L07A 4DPMA 1L7EA 4N7RA 5H83A 1QXSA 3GDFA 4TZKA 2FMUA 3I5MA 1ZMOA 3MTGA 1DIRA 2HMWA 3D3EA 4LRSB 2H63A 1NAHA 3GPDG 1DC6A 1PQPA 4MKXA 1KVUA 1L1FA 1A9YA 5KIAA 5L7TA 2BGKA 5C7OO 4YYZA 3FR7A 5BNTA 1RYEA 4CLHA 3KLMX 1P1HA 2HK9A 3SJUA 2P9GA 4E30A 1QYWA 5IAAA 2VNSA 4FGWA 3QV1A 1BDMA 3ZNNA 2JCXA 2D4AA 4JQCA 1MLDA 5JY1A 3PDUA 3CEAA 3C7AA 1IPEA 5COBA 5T64A 1ZVMA 3E48A 5BNIA 2C82A 2QZ9A 1B0AA 1IHYA 2CMDA 2EG9A 4FOOA 4AICA 5TSDA 4YQYA 1I5RA 1DJNA 1A7KA 1ARZA 2D2IA 1U28A 4Q9NA 1JKIA 4EEXA 4XYGA 1UUFA 2ZCVA 4K1LA 1NQOA 3KLPX 1JVBA 1ZK2A 7MDHA 3D5TA 4XYLA 1GZ3A 4EUHA 4Y6PA 3PEFA 1DB3A 4KMSA 1NR1A 2DU8A 2VHZA 2Q2VA 2J6IA 1O8CA 3DXFA 3D1LA 4OXNA 4DA9A 3E03A 2HLPA 2VRBA 2IXBA 2WDZA 1LSSA 1OBFO 4PCVA 1VPDA 3JD1A 3RCBA 3RWBA 2O4UX 1B8PA 4UVHA 1LX6A 4LK3A 1Z45A 3VZQA 1DIGA 2Q1WA 4XQ9A 3E1KA 1ZEJA 4OSPA 1KEVA 4CM4B 3O9ZA 4YRDA 4CJXA 3VKVA 1DAOA 4URFA 3ZHBA 4KTTE 2GNAA 4QECA 4A2CA 3OJOA 3F3SA 4NJOA 2P9EA 4P38A 3IP1A 3G1TA 1LNQA 4JIGA 4UVDA 4MP3A 4K26A 1C3VA 3UICA 3VKUA 3ZZNA 4DMLA 3DZBA 3L6EA 2VZ9A 3ROPA 2A94A 1HL3A 3HN2A 1UAGA 1R66A 4RPHA 5G0UA 2XAAA 3NUGA
chains in the Genus database with same CATH superfamily
4W9RA 2W2NA 1XMOB 4QODA 2D0OB 4LOAA 4B47A 4W8GA 1OXXK 1KDPA 3GGSA 2C2BA 3BWEA 2G82A 1TOAA 2YC4C 1AX9A 1JBQA 2HREA 3Q7TA 4KXVA 3B1YA 1ISHA 1GNRA 1SFRA 5LJLA 5JNTA 5JTTA 5LB2A 1J4AA 3E4CA 2Q5LA 4XIYA 1KVTA 1O95A 4ZICA 4N12A 5I7AA 3K5PA 4CLRB 5ICCA 2I3BA 5TT1A 3KVOA 5G1PA 5EC8A 5TPWB 1CW2B 4M36A 1GPKA 3DHWC 1ZU5A 2OXIA 4NATA 4IPTA 4ML3A 1ONPA 1HO3A 1K06A 1RAHA 1CIVA 3GGDA 4O0LA 5EMNA 2VXCA 1L8XA 3QLVC 4ZVMA 2EX0A 4BNFA 5D5HA 1ZKDA 4G1UC 4LK2A 1PYOA 1AO0A 1H69A 2I7DA 4DQLA 2GEJA 1FP1D 1SXJD 2ONJA 5K09A 5KTPA 3R9XB 1RRCA 3BVPA 1A9QA 2YKGA 1NYLA 4WFQA 1OVMA 4J16A 1E3LA 1JKXA 3A1WA 3OIFA 1BA3A 1ZIDA 1KZYC 3VX4A 4YRFA 3FMGA 4QICA 1KZHA 3KT6A 4Q3KA 4JYZA 2C7RA 4LNUB 3NP7A 1K8YB 2PS0A 4QREA 4UU7A 4CKXA 2HT6A 3C41J 3EAFA 3H05A 4PHCA 2M6LA 3O8CA 1GFIA 4JLPA 3MEQA 3Q11A 1VYHA 4NDNE 5FD8A 3SYKA 1CHDA 1G0OA 3GIDA 4RVDA 4DXAA 1VE9A 3AP1A 3L7CA 5F5NA 1EWYA 3PQVA 3IQFA 4UE6A 4ZQBA 3RTAA 2PSEA 3U31A 4F9FA 4R1PA 1EDBA 2CNNA 1U9IA 2DC1A 3SQNA 2WHPB 3HBLA 2JFGA 3NTRA 4WZBB 1GKIA 4L4YA 3DWFA 5BYBA 1FRVA 3S1AA 5EMKA 1I6MA 1S3SA 4UAJA 3BTUA 4DMFA 4YC7A 2PFGA 3OOWA 1A98A 1ESZA 1H23A 2PX2A 4KFUA 1WULS 1DJLA 1SU7A 3P2IA 4NMMA 4JFAA 1VA4A 4JVOA 2HJRA 1ZOIA 3QH4A 3QPWA 1DIHA 4NHEA 4DQVA 4EO7A 1CJKC 1XPUA 2Z6AA 3T7IA 5KNBH 1Z6ZA 2G9RA 1HZJA 2GM9A 4DWOA 3PJFA 3C14C 1MKYA 1K7FB 2FZLA 1TLTA 1PNRA 3HA7A 2IOQA 3NS7A 4DAEA 2QMEA 3IUPA 1XXHB 1LC3A 1TKAA 3SJAA 3LXXA 4Q1BA 3W5UA 1WVGA 3PWSA 4ESVA 1QM5A 2WIKA 3TIXB 2HLNA 1BXGB 1MB9A 1NVBA 1U8TA 2X4DA 1B41A 3JWJA 3P4UA 4L8YA 3SOPA 3ZE0B 1E1LA 4PLPA 1XEXA 4LRQA 3GH1A 1H4VB 1E3EA 1U0OC 2V6FA 3QSGA 5IARA 1TVEA 1EP2B 2C57A 1WSWA 1ML4A 4LQLA 2XQIA 4RLHA 2FHPA 4AUMA 4EJFA 3QX3A 2VF8A 3DZ6B 2NSHA 3L7KA 3CC8A 4JU9A 4O3MA 1U8YA 3ZCRA 1R2QA 1O89A 3ZE9A 4MIEA 3Q72A 1W0CA 1ODKA 3VO1A 4D4GA 3B3AA 4MUFA 4F4UA 4NICA 3H2YA 4Z9XA 4L5IA 2TECE 2ZJOA 5CYGA 5G4KA 2O5EA 5CVCA 3LQFA 2GEFA 4BNXA 1QG2A 3AG5A 4JBXA 3UENA 4X60A 3I1IA 4XWYA 1MC5A 3WK9A 4HLUA 3EF0A 2A67A 2VWGA 3G9UA 4KI0A 4KMRA 5JAQA 4MLZA 4AUKA 2FSVA 4M9XA 1V5FA 1KY3A 3LF2A 3M3PA 3ELWA 3L6UA 4ZMSA 1PR6A 1I3KA 2IQIA 1XIVA 4IMIB 3NNSA 5TGDA 2C83A 4LY6A 3DXZA 5KTNA 1R74A 1HE5A 1WU7A 5IEBA 3RARA 2W6NA 3U4QA 1WXWA 4X91A 4DRXB 4HVCA 2ZYTX 2QLLA 1ABEA 3SN6A 4JKIA 5FI0B 1KA9H 3Q15C 1BXRB 4UZSA 2A57A 4KQMA 2AW5A 4G86A 4OLBA 4PLFA 4F2PA 2IZ5A 4HS4A 5AKYA 3ENQA 3QLVA 1PTJA 4G4SP 5F3DA 1WTAA 4FDLA 4WZBE 2QX4A 4BATA 2ZJFA 2AXEA 4FILA 2GSDA 4DA7A 5JVDF 1O96B 4FYPA 3HRHA 4MWEA 3IAM1 4C03A 1N2GA 1EGAA 1E1DA 4J4TA 1Z16A 4RH0A 4DCJA 1AS0A 2C5EA 1JMYA 1GZDA 1YUMA 5KC9A 4ARCA 1GFWA 1CZRA 3A8TA 3AERB 2NU8A 3B82A 3F6EX 3KKKA 4HNTA 1KBQA 4UU1A 4KC0A 3ZXXA 2R47A 2B5WA 3UXYA 2X0FA 1YSCA 2FZ4A 1NTOA 4LQCA 4H17A 4X7BA 4EJMA 2PUHA 2OM2A 4LA4A 5JU6A 1NQUA 1R5NA 1TPZA 3EP5B 3W6OA 4JX8A 3L8MA 4MS1A 4N0PA 4P7KA 3BB4A 4G1CA 1RYBA 1UYJA 4F11A 4D56A 4A36A 1OAOC 1RW4A 1T25A 2VJAA 2A2ZA 2O2GA 1NW9B 1P2UA 4KEAA 4LZZA 3FVQA 4QUAA 4RW0A 3TDKA 4ESEA 4BGUA 3TGPA 1G17A 1EDZA 5EA2A 5G1OA 1IJEA 1JBEA 1TM3E 2OOSA 4CT4B 1M2NA 2DQ4A 2H0RA 1NQWA 2FPGB 1IRIA 1C0KA 2ERXA 2GZMA 2I2XB 3K05A 4N9WA 4AJLA 4EELA 6CHYA 4KHZA 1BRTA 5LZ8A 1KEEB 4RD4A 3QVTA 3KG2A 5FWYA 1RXSA 1KBOA 1OFHA 4NYMQ 4YALA 2C00A 3JQ8B 1OH5A 4Q1DA 2RHJA 5F1YA 1BO6A 1UXHA 2YMQA 5CJ2A 4UREA 1U7DA 3TUIC 1AQJA 1JT9A 2EWWA 3A6EA 3E05A 2R8BA 2AG0A 1ESEA 1XFDA 5H3HA 4RDHA 4OJMX 1YMQA 3IT3A 3V6LA 3GLGA 2WUEA 3Q98A 5IU6A 1SKAA 2JFWA 3CVWA 3RB8A 1ZNYA 3FRHA 1SVOA 1Q0QA 3JQFC 4J3FA 3RJZA 1D03A 5AOAA 3RLFA 2UYOA 5KCZA 2BFFB 4I4LA 4P7GA 5JWRA 3SBEA 1T8YA 1ODFA 4B3FX 2ZDQA 5I9LA 5CW1A 1ZFNA 2P2SA 6ABPA 1CP3A 4PM4A 2WHEA 2X2FA 3D7RA 5ALIA 1M6HA 1P1BA 2QYSA 4QASA 3R6DA 1JHMA 3GJ4A 5LXTA 1GR1A 1UDBA 3JQGB 4L5JA 3R7WA 3KD2A 3CE6A 4TS3A 1U2QA 2X4GA 4EZIA 4F5EA 1E2EA 4MYTA 4WJZA 4XM0A 4UDYX 3GLIE 1STOA 2MYPA 2RB4A 3D6AA 4ZO4A 2BHTA 3MGCA 1GUYA 4FS8A 1GDHA 2C2XA 2SHKA 2IDMA 2RK4A 5TJ9A 2WB4A 4R2KA 4K0RA 5BN5B 1P2SA 1IN7A 2GQ0A 3BSFA 4N6OA 2ZE5A 1Z2OX 3STYA 2IPXA 2QT0A 3E0QA 5H68A 1NG9A 5EIXA 3U09A 1A77A 2NU6A 3G2KA 2QD1A 2W7TA 1LSUA 1Z6AA 3JW8A 5DJ5A 4QTZA 1XWWA 3GLSA 4N41A 4EVQA 2Y1GA 4KHPB 1M3SA 3DE5X 1HDEA 1SA0A 3T6KA 5DHPA 4KAXA 1EQ2A 4KQEA 5BR4A 3C1UA 3EGIA 2FMIA 1IZZA 4BNYA 2B8JA 4F9GA 1T2NA 4R1MA 1QHNA 3KJNA 4G4SO 3LY8A 4CQJA 3BE8A 1RXCA 2GH1A 4LRYA 2BL4A 2G28A 4TTIA 1SXJC 4D9EA 4EHHA 1S0UA 1E6WA 2Z5LA 3A7EA 1NP3A 1ULTA 2BP7A 4QUKA 1UH5A 2WAAA 2GYWA 1CK4A 1PZGA 1RYFA 2OESA 4JV5B 5BOVA 3RNLA 2NZWA 1I6KA 1PEYA 1XMJA 2BKEA 3NC1C 1N9ZA 1J07A 3RAJA 2ODQA 1CV2A 4NTZA 3AUTA 4WXPA 2CV2A 2G09A 1DBVO 3GPLA 2QUIA 1J2YA 1GD1O 5AI8A 4HXEB 4MEJA 2IZ0A 3QX9A 5KX5A 3DV9A 3K3PA 2FEKA 2GAJA 1EFCA 4FDVA 4D9CA 2H2IA 2A35A 3W8NA 1D2CA 1DPFA 3HCBA 5HIAA 3FA2A 1PJTA 2QMHA 2XJ4A 4G1VA 2XKBA 2VP9A 4QBGB 5HRAA 1BWPA 4LAFA 4C4ZA 3W5BA 5THKA 3V1LA 4M99A 2Q2WA 1IHXA 2DHQA 3F1KA 3NBZC 2W0MA 2OP0A 3FVVA 3HVRA 2V97A 4KJXA 3AOEC 3AY3A 4G4JA 4OY3A 3U4DA 1B93A 1B0UA 1LVUA 2QN9A 2ZRIA 3QXHA 4K9QA 4LTDA 3PNVA 2Q3EA 1BQ4A 1KQPA 2RAUA 3I9MA 4DSTA 1JR2A 3JXEA 2B83A 4WZZA 2K7ZA 1XQXA 2OEPA 1G21A 2QJTA 4P2BA 2I76A 2R5NA 5FPSA 5NLLA 1JSCA 1SHTX 5JECA 1WETA 1XNHA 4NABA 2XCQA 1NXVA 4YV7A 1DVRA 5JCJD 4YRQA 2ZFUA 2WB2A 2UVPA 3BDAA 1QIFA 4FYMA 3BUSA 1ADJA 4G5GA 1L4YA 1QYVA 3F78A 3O4FA 4B45A 4PC1A 1KAOA 3QKSB 1X1BA 3PPVA 1FDIA 2GXAA 2C5FA 1P77A 2OHIA 1V3QE 1RLJA 2PMFA 2VP6A 2XH8A 3AHEA 4HUJA 3KKZA 2E49A 1RWMA 2H2WA 4WXMA 4Z5XA 3GLFE 3IQXA 3B5IA 1HZZC 3A58B 4MKGA 3N8GA 1G5IA 1ADYA 3CEHA 1SRQA 3AJEA 4ERXA 4QG3A 5MN5A 1Y63A 3KV3O 3ECCA 3EYWA 2V6IA 2X1MA 3CUUA 2FWNA 4KWEA 4F6RB 4PN7A 5JSZA 1EHYA 2F8MA 1Z0DA 2FDRA 1ZNWA 1Y5MA 2C2HA 4GSKA 1H85A 1PD1A 2A9FA 1KZ9A 2K2WA 4OI4A 3OMLA 4X20A 1B0PA 1L4KA 1ORVA 4RKEA 3KD3A 3TR0A 2CFSA 2CNDA 4HQ0A 2ZYDA 4DYHA 4BZZA 2WFLB 1U5AA 4FEGA 1N6RA 3W5IA 2H29A 1G3QA 3OKCA 4N8DA 4YAEA 1CY7A 2EP7A 4MMXB 4U1RA 4J2HA 1VXRA 4G5RA 1LZLA 1CUZA 2Q1TA 1X70A 2IOHA 5FWDA 4B79A 1MABB 4DWJA 2BFWA 4JI4B 1F0KA 3FD8A 1VMAA 1U0FA 1UKCA 1FP4B 1E98A 2XIQA 4YCSA 2XA9A 4G8CA 3T3HA 2YY6A 4ZODA 2I6QA 3QJYA 2YV5A 3GJTA 2OCYC 4XYMA 2O2XA 2O19A 1SK8A 4N18A 4EGJA 5JPIA 3BKXA 3IULA 3WS7A 2IS4A 3OTQA 2CBZA 1UMBB 3NHYA 1K97A 3OQIA 1JEAA 3I53A 2J67A 4GE3A 3VOTA 4U6NA 2IXGA 3PKJA 2AQKA 1ZH4A 3MINA 3LS2A 3DPIA 4BMSA 1FSPA 1T8RA 5CCEA 2RHMA 4FDTA 2NWQA 2EZUA 2G63A 2C5AA 3RO7A 3EF3A 5J4YA 4EW3A 3AGPA 2R62A 3EWIA 4IVRA 3BIXA 1NVGA 5DCWA 3PIDA 3P9PA 3GNTA 4JSRA 2NV0A 3H7AA 1MVNA 3DW3X 3PV0A 2OV6A 2HKIA 3AVOA 5IM5A 3SSAA 1JR6A 5BOSB 4LHXA 4Z4HA 3GZTB 1H66A 3HJRA 1L1EA 2JGRA 3KX2A 4Y2GA 5CB6A 2OBBA 4MAMA 1OX5A 2JFOA 2VH5R 3AF1A 3QRWA 5KJEA 3ZWMA 4EEZA 2B37A 1N0HA 2C61A 4YAIA 3EP9B 2JHCA 2ZJAA 2B3DA 2I8LA 3EGWA 1ZUD1 4R81A 5AKLA 3WK7A 3H6GA 3QVWA 2EZ4A 2QK4A 3PL1A 4ZANA 1U8XX 3ORQA 5D1HA 1RWWA 4BNJA 1NWHA 4HDNA 5E4YA 4W5NA 1JLMA 1XQVA 5BYAA 1XD2A 3DHEA 3ESBA 4FHGA 4HXFB 2AZTA 2J8ZA 4X7PA 3ZV4A 1J7KA 1X3LA 2B2NA 1Z5PA 4NG4A 4RDCA 1BCRB 3KKOA 5LQAA 2RBKA 2BFBB 2D59A 3HBFA 2GPAA 3IQWA 4P58A 2B9EA 4XIIA 1GZUA 3ZHYA 1CFZA 4X3PA 2D54A 1M9NA 4O4JA 1CWUA 1HQKA 2NZVG 1EVYA 1SHLA 1AKUA 3L7MA 3PL5A 4PZLA 5KU1A 4GF5A 1Q19A 1YQXA 4G07A 2PNFA 3TBKA 2CGEA 3I4FA 1JFRA 4W7IA 1YFLA 1P5FA 1H9CA 3CBQA 4B6JA 2PDAA 1VRVA 3GLHB 4M8LA 1M0WA 3FHJA 3W34A 4WXEA 4H4DA 3DH0A 4KR0A 1P39A 1ZIOA 5G02A 3GFQA 3Q5DA 2WDPA 2QRNA 2CDBA 3FNQA 1YZTA 2HIHA 3HCOA 5BSRA 4EHJA 4HLCA 4O33A 3CX8A 1N33B 2VAPA 2G0AA 1QTNA 3EB9A 1NRIA 3KB2A 3PQFA 4EFDA 1BKDR 4FYHA 2JJ2A 2VRCD 3CUKA 4TXLA 1VJCA 4ICIA 3C7KA 5J63A 2OPBA 4OM8A 5M3BA 3FHOA 3HM2A 2GKSA 1C7QA 1W47A 1JAIA 3IUEA 3ZXUB 1SOAA 2H00A 1Q7CA 4NLLA 1R3UA 3SQDA 4A0HA 3K1ZA 2AJDA 4CG0A 4EATA 2Q5HA 1PL0A 5DLYA 1P7YA 2B7LA 3EVEA 4IILA 2RC5A 2GN4A 3G23A 4AT1A 5HX7A 5BOSA 4Y2JA 3G79A 3H4VA 5DNDA 3TJZA 4EWLA 4DDHA 1E3MA 2R1UA 1QANA 3AR8A 3GGCA 4EW6A 1XFAA 3MOIA 1JQLB 3RC3A 3VPFA 4AYXA 4B3CA 1LLDA 3AJDA 4US2R 3IDZA 5YASA 3FETA 3UKOA 1D1PA 2IX9A 4GYWA 4XVRA 1NBOA 3FDFA 1FVFA 1LV7A 1ZQ1A 3R24A 1Z0FA 3RTCA 3QEMB 1JLHA 2VJPA 2XXAB 4WGFA 3LX8A 4Z0PA 1EA7A 3GNQA 1F8UA 2CCJA 3F6BX 5AVKA 1USVA 4XPIB 3EUEA 4WV3A 1X80A 3K9CA 4H59A 3ZWKA 1QH9A 2ZBUA 3KEOA 4PWZA 2OM6A 3BXXA 3FLMA 3CVXA 2HK6A 3GJRA 1JWAB 3ANLA 5LBTA 2H1VA 3G59A 5HOEA 5DK4A 3REGA 1QRAA 1UXOA 1YRQA 2OCAA 4KE9A 4G97A 4YJGB 1GADO 5HK8A 3RS0A 4QDTA 1EP3B 1GPJA 1QKKA 3E9ZA 1YTUA 5MGBA 3TSWA 1BQEA 5GM1A 2IFTA 1ZOSA 1DINA 4WECA 2PLWA 1N75A 3QVOA 1CDZA 1ONOA 1W30A 1QH1A 1YUBA 2L82A 2MMGA 3DAYA 3EJWA 4OLHA 2UUOA 4WZAB 5KKAA 1JE1A 4RTRA 1YBVA 2VF7A 2YVLA 3ESRA 3JQPA 4J0CA 4KQXA 5HW0A 1RXVA 1Z6XA 2EFGA 1RU3A 3IA2A 3QOWA 5D86A 4BO7A 2J3KA 2CLFB 3EODA 1I36A 2XDQA 1BW9A 3WGTA 1ZUWA 5A4MS 3IMKA 2C2OA 3QMWA 3FHTA 1E1KA 2OZLB 2QAGA 4NL4H 4Y8VA 3TLKA 3C85A 1SXJE 4TUYF 4EHNA 1T43A 2KHZA 2GPTA 4NVRA 4CCAA 4NENB 2QORA 2MSKA 4AMGA 4QOHA 4BB6A 3DLBA 4GGOA 4RZIA 1JNYA 3QQ5A 3B3JA 4BDTA 1RT9A 1E3JA 5CVUA 4Z9YA 3KB6A 1LK5A 2IY8A 3RC7A 3E58A 1Y6ZA 3TEMA 3D4IA 4IDBA 5AJXA 2OHJA 3TCXB 1D4FA 3UWMA 3I2HA 4Q0MA 1DCMA 1SD5A 1D1SA 2NQ8A 4B4WA 3AHDA 4KZPA 2X8LA 4RVFA 4RXTA 4XLTA 2EJTA 4FFVA 5LQMA 2JHFA 2AHRA 4LHEA 5EIAA 4BO3A 2X9NA 3E9MA 1MB3A 4GX5A 1C2TA 1NOIA 2VJDA 3THXB 1JYFA 4BN0A 2HPZA 1OXTA 3LT1A 4D1YA 4URVR 5KTOA 3RIYA 3CVYA 3F6PA 1W85A 1TYCA 3ONNA 3QBJA 4D9FA 5KVVA 4LW8A 2CNLA 1TJ5A 3TK1A 4ZI5A 3DZ2B 3LK7A 1XLTC 4YGYA 1ZVQA 2WYVA 2I03A 4EHKA 1NW6A 4J1QA 2QBYB 4UTPA 2PE5A 4P3XA 3D81A 4K6HA 3ND5A 1TLFA 1KQGA 3GLQA 3IIIA 4LXYA 5JZ9A 3K72B 2VYVA 5BSTA 2VTBA 3FF1A 3PYMA 3WWZA 3VYWA 5EQFA 3N0RA 5C8ZA 1EU1A 3D64A 4NESA 3QQPA 4QNNA 4QYSA 1M2VA 4BP9A 3VBCA 1GPBA 5B2FA 2WJWA 3ANXA 3DMGA 1SELA 2V96A 4BX2A 5DX8A 4A6PA 4XIGS 4QOEA 1RQ2A 3USZA 1P1IA 4YAUA 5BV8A 4U7GA 2XR1A 2G40A 1H8HD 4YACA 2BEWA 2HY7A 5D3MB 1Q7BA 1NG1A 3I8XA 3MAGA 2BGWA 1RWVA 1RCUA 4S12A 3TYXA 4DCOA 1S8OA 1K86A 3EDYA 3E0XA 4HLQB 1L8LA 1P74A 1HT0A 4WKNA 4I1VA 4JLWA 4M9UA 5C0OE 5HSGA 4NS4A 2E18A 2VJBA 3IKTA 1NFQA 3ZHRA 1PKEA 3LUBA 5DULA 2GZRA 4AZSA 1YA6A 2ZIXB 3LP5A 3A1CA 2QHXA 5CG1A 2DOKA 3IIMA 1UDAA 1VLMA 3Q0IA 4IJMA 4TZ0A 1OTYA 3AF4A 4QIHA 4MMYB 2RB5A 3VR1A 4AP9A 2PBRA 1AUVA 1Y9JA 1GEGA 1V95A 2F48A 2J1LA 3NCHA 2B3TA 4L4XA 4QE3A 4YO7A 5I7WA 4EBFA 2PXHA 1VJ0A 3DVSX 4JP8A 4F7DA 5CITA 2HF7A 2I62A 3KPJA 4LJ5A 1M66A 1SC1A 4IIBA 1HH4A 1KR5A 5SY4A 1HI9A 5B6IA 1KP2A 2DBQA 4Y6LA 1HXHA 4HTAA 4KXUA 2C9CA 1D8AA 3A4YA 1T3HA 4H08A 2H3HA 5CB8A 3ZJXA 1X87A 1Y3DE 2RIPA 1R5JA 1N5DA 2YNMC 1Z26A 3X2EA 1THZA 3IOYA 4DV6B 3TRHA 2GS9A 3RJ5A 5E38A 4FGKA 4D82A 3COJA 4GAEA 1RVV1 2QTVB 1A69A 4MRAA 5FEMA 5HEKA 4WGGA 3ZE6A 2VIIA 4FYXA 4K9OA 4DZRA 2EKDA 3G02A 4AZWA 1CVIA 1DADA 1Y3HA 3T9FA 2FSIA 2CBXA 2B5OA 5GV7A 4I9HA 1T5TA 3WY9A 5CDTA 5T7BA 2MYUA 3JAKB 1KY5A 3SX0A 3O1IC 3SFVA 2R3SA 2JI6A 2QVYX 4M6WB 4HATA 4HN2A 3UJDA 4E6PA 4E5SA 2HFKA 4IUBS 3KUDA 1P60A 3WLNA 1TLLA 3ZXYA 1ODTC 1MQAA 2PKRA 2MSLA 1YFZA 3NIGB 1AHIA 4LZPA 5JO0A 1WR8A 1O4VA 4DV4B 3CV3A 4HZUA 1PN3A 2NZYA 1LPOA 2XTZA 3BCHA 2RKBA 4MX8A 3ZCSA 2ZTSA 2GN2A 1IEQA 4DBZA 1Y48E 2AS0A 2WQZA 1EESA 3D8RA 2IYXA 4CT0A 5F7OA 1F48A 2Y67A 4KMMA 5JYFA 3IILA 2PRJA 2P6NA 3H8SA 3SXUA 1IQUA 2CDRA 2FE1A 5J2TB 1U2GA 2O06A 2OXRA 3Q7IA 3OCZA 2P1ZA 4MUXA 4MLDA 4OU5A 4B3IA 2DFDA 1J5PA 5D51S 1YR7A 4ZI3A 5M29A 2VBGA 5DYTA 1DC7A 4MHOA 1M2HA 1BJKA 5C1BA 1G9XA 1YR9A 3SC6A 3V8PA 2FOLA 1A4XA 1FW8A 3Q1KA 4L3VA 3U4IA 3WO0A 2CHUA 3P26A 5BXYA 1NNI1 1AA9A 4P3KA 2ISCA 1ISIA 1ZD8A 2QX8A 3LP6A 3KDPA 4QFBA 4HI0E 3TQTA 1I0IA 5EUMA 1MG0A 4MROA 1VPTA 1JAZA 1PR9A 2O48X 1HYGA 1R12A 5SZIA 1M1ZA 3AF0A 2C8VA 3BIFA 1NUQA 4HPWA 4TRJA 4YONB 5JD3A 3M6FA 2D5LA 3EXFA 5CB4B 1I0LA 2B1RA 4R9SA 5FQNA 2JG3A 3OPYI 3UO8B 5DI3B 2XKKA 4GBJA 4PG4A 1Q7TA 4ZDJA 4NI5A 2MJLA 1U0JA 1C41A 3WG9A 1WDWB 2DHEA 3EOZA 4QM7A 1OTHA 1I72B 2AJLI 2C4TA 2ZXFA 2IIPA 2Y05A 4MAAA 5AQEA 3WKCA 3EK2A 1QYRA 1J5XA 2AN1A 2IUSA 4Y1EA 2IWRA 3SQLA 3WVNA 2BF4A 4C01A 1YB2A 4OXQA 4TKUB 4KN6A 3ZQKA 2IU0A 1PIWA 3RT9A 1E2HA 3KFVA 4V1CI 1MOSA 4YFVA 2G77B 1WZUA 1Z0KA 1XAJA 2B8NA 3DHVA 1UJNA 3GRCA 4GOXA 4HFRA 4OHWA 4BFYA 2PSSA 1SCJA 1R4NB 2WJZB 5L3QA 3EUFA 4Y0VA 4BNNA 2CW5A 1S5PA 1IZYA 5JSQA 3C5EA 4QELA 5H9VA 5LBIA 2BHNA 1ZAKA 2O5RA 3SSMA 1ZN8A 2ZRQA 1GPYA 2WT8A 1DXYA 3ABSB 5A4DA 3V4RA 1QB7A 4U9IS 1GRRA 1IVNA 1ZCZA 3NM4A 1XTJA 4OI2A 3Q7RA 2RHWA 3CCFA 4NCIA 2ZATA 1JYEA 4C4YA 2WWHA 4N3BA 4ERNA 2RBGA 2CLCX 2D1YA 1R8XA 5HZKA 4G0VA 1PNOA 4PZ9A 3I52A 1IQ0A 1UWKA 4BFSA 1NJ5A 2CK3D 3HYLA 5DNEA 2WEKA 3EH1A 4HZGA 5AJWA 4AY4A 1QH8A 3QFHA 4GBMA 1A0OA 4P35A 2C0PA 3KTAA 2FZCA 2OFWA 4O2BA 5ADHA 3CNHA 3K70B 3RW9A 4KREA 1L4HA 3IJ5A 1H4TA 3QVVA 3VHRA 5LWHA 2GYYA 1G5QA 2P62A 4BZXA 1EX7A 1A9OA 4DLVA 1K5PA 4UPEA 5EP3A 5H4HA 5EERA 2OOKA 1XNQB 1DEHA 3FWYA 5FULA 3V32A 3WWOA 5JH7A 1N57A 2CB9A 2G1PA 1NKTA 3MTJA 1T8TA 2FMHA 2H5EA 3BKWA 3IESA 4N8EA 4QPDA 5HCUA 4C43A 5KJCA 5GZ3A 4PRLA 4ZQIA 4XCXA 3IWBB 1UP7A 2FPSA 1C0LA 2P9TA 4G4IA 5AVWA 1R0LA 4N7BA 4P32A 3OTWA 1CRPA 1P73A 5LQRA 4R31A 5FORA 3B7WA 1Z0UA 3RYTC 7MHTA 3BAFA 5FBQB 1D6NA 1O03A 1A88A 3U4AA 2VT3A 1EVZA 1DC8A 2ID8A 1CC1S 2Q3LA 3AHIA 3G85A 3COZA 3K9LA 1KKLA 4B4UA 1OU0A 2RD2A 3RASA 1MA0A 1ECBA 2I4IA 3A2LA 3TD6A 3OPQA 1ISFA 1JDSA 1MNQA 2B1IA 1ID1A 2GHTA 4NKRA 4A0QA 3B38A 3KUCA 3RS3A 2RGRA 2CFOA 1QUFA 2YIMA 2ZJ8A 3D0OA 2W5UA 1NXSA 1G20E 4QJIA 1H2ZA 4UUBA 4F6LA 1I01A 3S2IA 3IP7A 1B00A 4M1WA 1IK4A 5TVOB 5EINA 2JHAA 2RGAA 3DWIA 2JVKA 1PX2A 2ZIWB 3BD6A 2HCJB 2WOOA 3FNRA 3PUHA 4OYHA 4YECA 3CJTA 3ST7A 1QP4A 1V47A 3NXKA 1RAGA 1CJBA 1JWBB 1V2HE 4HQ6A 1H0HA 4CDRA 1E60A 4H7FA 5GIPE 1WHTA 1EFRA 1BHSA 1GA1A 1OI4A 4L73A 5FF9A 3T9DA 1PWXA 1L9XA 2P4EA 3OE5A 3Q6MA 4L74A 4ABTA 3VKHA 2EKBA 3HI4A 5FPHA 5KSPA 5AW5A 3O3MB 4EKGA 5CDUA 4ZYZA 3KOWA 4AO6A 1BE6A 3GUCA 3SJCA 1HRDA 5FUYA 3FZEA 2C1ZA 3V8MA 3BXPA 4YBRA 2OQIA 3LBNA 3NIBA 1ZJZA 3RBZA 4ND3A 1GQQA 1Q21A 4GVPA 2BCGY 3VZDA 4RA9A 4EG3A 4L9WA 4GXRA 4E46A 1HTBA 1QZXA 2HJWA 2VXBA 4CQMA 3ELDA 2BR4A 1HT3A 2XDQB 2CXSA 3BXHA 4YJ2B 5BW6B 3B3QA 3RLIA 3TRKA 4DARA 3U39A 1FMFA 5BQPA 4ENSA 2QNBA 2FSGA 1M83A 3MD0A 4LYHA 3T5GA 5IVKA 1DO8A 2YHUA 2B4KA 3LPDA 4KXWA 4AS1A 1PEDA 1POWA 1LJUA 5DBIA 1XF9A 2O57A 1CULC 3QUQA 1A72A 1XTRA 3KB1A 5C3MA 1Y8CA 1SK9A 1SULA 2A9OA 2XOKA 3BTOA 3RRBA 1OFIA 1A2BA 2VSFA 4Y6QA 1PJRA 1XZQA 2CVFA 2JGMA 4FFMA 4MR8A 3BRSA 5B53A 4UQLA 3IHWA 5FADA 4BO6A 2CLSA 5JWOA 1IOLA 3WGHA 5FBZA 5JH7B 2BFDB 4BFWA 4TOIA 5BR7A 3TSYA 3TM4A 3TQSA 5BN3B 3JYHA 1I5EA 1RWXA 4MUAA 1SHZA 2C3YA 4CL3A 3BSWA 2PK3A 3DLHA 1A97A 3BX1A 1AMUA 2LUOA 3VMMA 3KKEA 3IA7A 1ECCA 2HLDD 3R9KA 3TN7A 1MF7A 4J3JA 3UW3A 5D84A 3VNRA 5BR1A 1FNMA 3D2BA 4FDMA 1OHHD 2FP4A 2XGJA 3PYXA 3NWEA 4CMJA 5AHRA 4PRZA 4DGSA 1RBZA 3OZEA 2FPKA 2Y1XA 4IQ0A 3P9KA 3KWJA 3Q3EA 4S0ZA 5CXXA 5AKKA 2L18A 4YV0A 1PJ3A 3LVRE 4IBOA 3VGPA 1SA0B 2YS6A 1Z33A 3QENA 4DA4A 2FWBA 4J0DA 4M0DA 4NENA 4B09A 4EECA 5E9JA 1KSGA 4V0QA 5FBRB 1V6AA 2JAXA 4B6GA 4EA6A 5ARBA 2CHFA 3LFUA 3TNJA 4B3SB 4MP8A 2D5AA 3RSOA 1I3MA 5IT4A 3ZWXA 2QN2A 4W63A 4MVJH 3MWYW 5EIBC 4YLEA 4CM8A 1QDUA 1ZCBA 3HXMA 2FW6A 1AB5A 2KM1A 3OECA 5TQ2A 1R4MA 1HE3A 4B76A 5CDGA 2B35A 2XSZA 3ZVMA 2B4AA 3QVJA 4R6XA 2OQ2A 4XSGA 3VH2A 3PDJA 2QAJA 2GLUA 3L1JA 3EP6B 5JRJA 3FM9A 4UBLA 1NJ8A 1MA3A 1WCWA 2AMYA 2OCXA 3V4PB 1JIVA 3GUVA 3KP1A 3LECA 4ZO6A 2Q1UA 5IVDA 3AB3A 3V2HA 1G9TA 2QRZA 2QB5A 1ZN9A 3C6KA 5BW8A 2VZ0A 4J43A 1AQ6A 4FDAA 1D0SA 4OA8A 4O4HB 4ZCSA 4CV1A 3JZMA 3H99A 5E7JA 2V7WA 5KYWB 4BGDA 3NP9A 2BTQB 1V1JA 1M0TA 2EZTA 2GN9A 5HIKA 4Y2QA 4YJFB 5K01A 3T94A 2RARA 1MZPA 3LG2A 3PC7A 1I6WA 2JIBA 3FMOB 3TRFA 3VZRA 2ZIFA 2PD6A 1ZGHA 2QWXA 1M34A 4C4RA 3K0HA 2ECFA 3KJIA 4NS1A 1K6JA 2GA8A 1TQ8A 5LLDA 4OYLA 5ESRA 4OCZA 4WKOA 4F8JA 5J3JA 1TYAE 1MQSA 2C4WA 4OTZA 4MHSA 4XDGA 4YDHB 3WICA 4G0OA 2FUNB 3QEOA 4GX1A 5LLTA 3GIWA 3NBFA 1OWOA 2PQ0A 2PVSA 4KODA 5F4ZA 4I9FA 4DBLC 1FFBA 5F51A 4WKBA 2K6GA 1YA8A 2IL1A 3IPRA 3TS1A 3R5TA 4UUPA 4FOLA 2WKRA 4FC7A 4DV7B 4BLTA 5HWSA 3IIKA 3MXOA 3FYHA 1CZKA 3PCXA 1Y7HA 5LL6P 5GONF 4Z7OB 1PV2A 4X85A 2HD4A 3FAKA 4XR9A 4R3WA 1U3DA 3FBWA 3WNVA 4L8GA 1SCQA 1KTIA 3GJ3A 4DL9A 4RF4A 1RC8A 3SY8A 1N5MA 5H80A 1W0JD 3TL3A 2E6UX 3ZE7A 3AUSA 3G9XA 4I8DA 4HADA 3V1MA 1JBKA 1R0KA 1V48A 3I5UA 2MINA 4IY1A 4OGKA 3C4QA 3OKPA 4W1PA 5CA1A 1N0UA 1K0FA 1VA5A 2Y0DA 4M76B 5EJ4A 4JBNA 5FWXA 5H3LA 4PZCA 1UWVA 2XUHA 4H7EA 1H2YA 2VWQA 2XV1A 2YQ5A 4IHJB 4DMLA 1UOQA 3EE6A 2PH5A 3V5NA 2Q41A 2QI9C 4PQGA 1PLLA 1PJLA 4HNQA 3EQ8A 3I4LA 4V0LA 5FB3A 3UH1A 1M1YA 2VNIA 1KP9A 1YJQA 4QYMA 4ZOLA 5FHQA 2EZ9A 1FIUA 4J7AA 4OUDB 1M72A 4R3UC 4EJ6A 2HRCA 3EIXA 3O2SB 4BE7B 1JLLB 2PBZA 3MIIA 1E6CA 3IMCA 3EQZA 3KQPA 5DT9A 1I7LA 1WKBA 3RUAA 5JAHA 2QTLA 5IYZF 4PQYA 3GJ5A 2BMJA 4YJ2A 2B6HA 2V5VA 4BEVA 2X9VA 3P45A 2HSDA 2ZRHA 3BXZA 5LZ2A 2UU9B 1P8JA 4Z9FA 2HPHA 2W8BB 3OQIB 4C6TA 3Q6NA 3AVVA 4C7OA 4R0MA 3WLIA 3QVSA 5CT4A 3E70C 3K9HA 4K8RB 3O93A 2HI0A 3DYVA 2JI8A 5EI5A 5JQGF 4TKMA 2HWUA 1R3DA 1WX1A 4NOMA 1UJ6A 3MYRA 4O4HA 2Y1OA 1EE1A 1YVDA 3HEMA 3D4BA 5T67A 1E63A 2WPNA 2ZSEA 3TI7A 1SBIA 2C2ZA 1Y81A 4HZUB 4V3BA 4ZVOA 4EUSA 2UV8A 3IAUA 4QL3A 5SZHB 1C8LA 1JU4A 3EFEA 3C8MA 3HWSA 2XTNA 3U61B 2IHKA 3CCBA 1CNEA 3GDOA 2DGDA 4RC9A 1V2GA 4XOIA 4BTEA 2XA1A 3WLMA 1J9ZA 1UPUA 1N5KA 1X7ZA 4ZCQA 3ADCA 4F2DA 3GFRA 3FSGA 3QYPA 4JS0A 5B1YA 1MIOB 2G9UA 4L0DA 3P7MA 1K5GA 3ZCXA 4DXDA 5DNUA 2IF2A 2PM8A 4XWTA 3W8DA 1REQA 2Z3WA 4C0QC 4AI6A 2XX3A 2J5RA 3HKBB 5KMGB 3HSSA 3ZQUA 2KB0A 5LIRA 4CCSA 1T36A 1RAEA 3ROKA 2ZRAA 4D92A 2IHJA 4MV1A 2ZWIA 2V3CC 3O47A 4IMPA 1TQ2A 3UKDA 3QBVA 1RQLA 3H65A 2YICA 1EA5A 3EXAA 1VHQA 4QDXA 4MNTA 1Z62A 3RG2A 3QVUA 1GCGA 5LP6A 2VUSA 2ZSFA 3VC2A 4KN9S 1G8MA 1Y1TA 4X7RA 3WRXA 2JFHA 4FYWA 4BLWA 4CRWB 1W19A 3JQCA 4IJ5A 4CEHA 3EPKA 4BE9A 4YRPA 1PZMA 3NU1A 2PWAA 2XA2A 3O8OA 2GI4A 3VVBA 1Z7EA 4S2UA 2HK8A 3II6X 3W1VA 3KXKA 1IN8A 1EAYA 3IHLA 4HFNA 2FEOA 1USWA 5DCLA 3ORSA 1XU9A 1X1TA 2KBEA 2XKAA 3PRJA 3NT4A 1R0CA 2G72A 1ZRSA 3CB4A 3UHFA 5IJ9A 1E2KA 3OZTA 1RDFA 5CBPB 1X94A 3AVQA 3KOYA 2FLVA 3OZWA 2IHNA 4MW6A 3GQVA 1NURA 2C07A 2WM9B 4IZIA 4K05A 4XFJA 4OFBA 5HM6A 4PPFA 3UK7A 1P80A 5JC1A 3LSYA 4DDMA 2LR0A 3BN3A 4L75A 1CQPA 1D4ZA 2PR2A 3W5AA 2I1QA 1O3YA 5CDFE 3PFCA 4HH3C 4XWGA 1U2RA 2F9FA 3KDSE 3T0GA 4X64B 2ZJ7A 1JG6A 2R9VA 4MDYA 1XZMA 2QTRA 2VCHA 1KFKB 1QU3A 5EKSA 3U3XA 2YXLA 4ACBA 3EGXB 1ZHFA 3IXLA 1Z29A 4HQNA 1XDWA 1H2HA 2CXRA 3B9BA 1KO1A 5TY0A 2NVUB 4V0SA 1ZD5A 3IVRA 2VDMB 1DG9A 4MQLA 3W2IA 1ZRMA 3OIYA 4YRZA 4FWTA 5G40A 5KNCA 4IQ8A 3LUPA 4KW7A 4F2HA 2NN3C 1GNVA 3R3WA 1I2BA 2AG1A 1T2CA 3GEMA 4JASB 1C1DA 1XOIA 4NMHA 2TMYA 3RVQA 3WWPA 4F1WA 1A7UA 3CRW1 3GD7A 4HHEA 1ZM9A 2IYVA 3CZRA 4DEVA 3W79A 1AKNA 3KVYA 2DY1A 2P2NA 1YCDA 3BF7A 3PJEA 4LJ8A 2PZAA 5B4TA 4A8TA 4G26A 5DBHX 1GAEO 3KCQA 3TOXA 1NE2A 3CE9A 3ZQJA 5A5DA 1YB5A 4MVJI 1UBUS 4TLLB 2EP8A 1NP7A 3OLQA 2IYAA 4PO9A 1RM0A 2GUGA 4KG7A 4U2EA 3RWMB 5CT9A 2COEA 2BFFA 3H8WA 1C81A 2BBSA 3E8XA 1J49A 1PKXA 2XVZA 3GHHA 1VPLA 4I1SA 4IKEA 2HPVA 4OKSA 4YCBA 1HDCA 3TFWA 3ZBUA 1CSEE 2OBNA 4RFSB 2VPQA 4RGYA 1SCUA 1UDWA 2ZAOA 4P86A 5ALNA 3P5SA 1WP4A 3AESB 4OFWA 4ATNA 2HXSA 1JMVA 2OD2A 3ZWWA 5IANA 3PHGA 4JU8A 4YO8A 2EFYA 1U7HA 3RTDA 1JHOA 5FPKA 4W5TA 3TZHA 3MCWA 4NZYA 4OJQA 5EWJA 2QLTA 3VISA 3AW9A 1ZUNB 1KSFX 5ILQA 2QE7A 4OHCA 1G64A 3R2JA 4LWOA 1SC6A 2JCYA 5F12A 5GGXA 3SYNA 5JXJA 1VE6A 2ZS9A 3LCMA 5LDGA 4JH0A