1OBGA

Saicar-synthase complexed with atp
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
305
structure length
305
Chain Sequence
b'SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGEHDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMIDOIMIDAZOLE- SUCCINOCARBOXAMIDE SYNTHASE
publication title X-Ray Structure of Saicar-Synthase Complexed with ATP
rcsb
molecule tags Ligase
total genus 93
structure length 305
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1obgA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1obgA02
4PTGA 1YVJA 3P79A 3SW7A 3RFCA 5AP2A 3FMLA 5FDPA 3VRZA 4FEXA 4FEUA 3KL8A 4RX5A 4IX6A 1C30A 3WZUA 2WELA 4TN6A 4FIFA 5M07A 3F5UA 4C4GA 1Q3WA 4XX0B 2XRUA 2GS6A 4O7SA 5LWMA 1H1SA 4E6DA 3BU5A 2PY3A 4GRBA 4JDKA 4JR3A 2ZYBA 3PVUA 5KKNB 3W55A 2A19B 1H25A 4RBLA 3W2QA 1WBOA 4QTEA 1OI9A 1OIRA 2GTMA 4QSHA 5FUTA 3ORZA 5CAPA 3BE9A 3HRFA 2YCSA 4EH9A 5CAVA 3HV5A 2UZDA 5FBNC 3EN7A 4JXFA 3UP2A 4YGAA 3FMNA 4RWJA 4IC8A 4R1YA 3ZH8A 2OXXA 2VWIA 2Z8CA 4YMJA 5CALA 4DEAA 3PSCA 2ZJWA 3CBLA 3L9MA 3ZUTA 4C3PA 4AW2A 2IP4A 1WAKA 4EHGA 4AW1A 5M44A 4AN2A 4WSYA 5HGIA 3TM0A 1KJJA 4FVRA 1P5EA 3IO7A 3VOTA 1URCA 4ANMA 4N70A 3R30A 3DQXA 2QR7A 3Q2JA 4FKGA 3MVLA 1Q8YA 4PMPA 2PVFA 4MXCA 2G2HA 3BHYA 2CCIA 5E8TA 4FV3A 5HD7A 3DKOA 3NDMA 4DC2A 4IZ5A 4EH3A 4Y85A 4BCFA 1OL2A 3KC3A 5E92A 4F99A 3DT1A 4RIWB 1J91A 2ESMA 2QHMA 3TKHA 3LLAA 1K3AA 3MPMA 2XNGA 2HOGA 4U79A 4U40A 3EQCA 3KXNA 4IFCA 3O8TA 2BRHA 3CD8A 4LOPA 2PUNA 3SX9A 1BXRA 3ZTXA 3NS9A 5M53A 4U81A 3UPZA 1AGWA 3CQUA 4O0UA 4FKJA 4EONA 2W5HA 5L8KA 3OXTA 1W93A 2YJRA 4O0TA 4M97A 5AUVA 3NNUA 4KD1A 5CA1F 2XK7A 4HJOA 3EQPA 5CEMA 3ATSA 4EBVA 1M0WA 4O2AF 4G31A 1VEBA 3EQGA 3R7VA 4FU0A 4OR5A 4O0XA 2AYPA 5CTPA 2NRYA 3VIDA 4MV1A 4XS2A 4N6YA 4FK6A 1RJBA 4QTBA 2B9JA 3QZIA 4ENXA 2OJJA 1PXIA 4L3JA 5A3XA 4ITIA 2VTHA 3UMWA 3BZ3A 3VS1A 3QU0A 2F49A 4U41A 2V22A 1YOMA 4EZ7A 5CSXA 2OO8X 3QTIA 3NW5A 3ZYAA 2V55A 4IE9A 3BQCA 3IG7A 4C02A 2ZAZA 2R7KA 5DA3A 2GNFA 2BIKB 4TRLA 4U43A 2OIDA 2W99B 1URWA 3ETAA 2QOIA 3A62A 4D2SA 2VWWA 1E4EA 4H58A 1OUYA 5LWNA 3DFAA 3C9WA 4D2RA 4OT5A 3DY7A 4G5PA 4AFJA 3AXWA 1ZY4A 4EHZA 3FLWA 4BHZA 3QALE 4O4IF 3HDNA 3MIAA 4AX8A 3RJCA 2UZOA 3L9NA 5I9WA 1J7UA 5HORA 4E4NA 4EH6A 4EKLA 1Y8GA 2GHMA 4IIRA 3HMPA 2H96A 2PK9A 2QOOA 3NYNA 3RCDA 4IVDA 1ZYDA 5I9VA 1Z2PX 3QD2B 3G6HA 3MJ1A 4TXCA 4FV8A 5FTGA 3MI9A 5CZHA 4PQNA 4QP3A 4RFZA 2QLQA 2ZB0A 5CF8A 2R7LA 3MDYA 4YUQA 3KF4A 1SCUB 5EM7A 4NW5A 3I0OA 1H1PA 4DH7A 4KNBA 2F7ZE 5EHYA 5HG9A 3QTZA 2XIRA 4O38A 4QMMA 2H9VA 2UZTA 2ZV8A 4HNIA 3C50A 3R5HA 3WF8A 3BYUA 3KRRA 4R5YA 4DG0E 3JYAA 3W33A 2R86A 3DS6A 4RVLA 5GNKA 4JBOA 2YHVA 4ZJJA 3AD6A 2VGOA 1JWHA 3E7VA 3TL8A 4EHVA 1Q8ZA 3QD4A 3HNGA 2E9NA 4PMMA 4GSBA 3HVCA 2HAKA 3EFLA 5EG3A 3WNZA 3EZRA 2AC3A 3DBDA 1GSOA 2OJFE 5H9BA 4EK5A 3HA6A 2QG7A 2G15A 2GLTA 1NVSA 2FSLX 1EH4A 5M51A 4EGQA 2Q83A 3FZ1A 3G90X 4BTFA 5AJQA 3V5TA 2R3JA 2NNWB 2JC6A 1YXXA 2OI4X 2QOCA 4HYHA 2HCKA 3GC8A 2BDFA 3KMWA 4GFGA 1OB3A 3FV8A 2X7GA 3GFWA 4L42A 2OZAA 4LI5A 3SDJA 3F7WA 5KBQA 4DGLC 3TNWA 4YLKA 3T3VA 4EOIA 1NXKA 2OLSA 5CF6A 2SRCA 3AGLA 1OIYA 5IDPA 3ZRLA 2X6DA 2WQNA 3FSFA 4MV6A 4EUTA 3R1QA 2OW3A 4BCKA 4CD0A 3DXQA 3FMMA 3MB6A 4AZSA 5BPHA 3FQHA 1ERKA 4DFYA 4FFLA 3KMMA 3FY2A 5CNOA 1W84A 4QYGA 1QPJA 2C30A 2P33A 3DDPA 4LRJA 1OPJA 3OCTA 5EOBA 2QODA 3PA4A 1UU9A 3NR9A 2WMWA 4FFNA 3H0ZA 3I81A 5HIDA 4AA5A 4CKJA 1OKZA 1U5RA 3WZEA 4D5KA 1FOTA 4DBNA 3E8DA 3A2CA 3F61A 2YM8A 1BX6A 3PZEA 5ANKA 1JLUE 4O7WA 4PDYA 3A61A 3AMAA 3L9PA 1XQZA 4NK9A 5EW9A 2PVPA 3A99A 2X7FA 3PVBA 1WVXA 2C6OA 4IB3A 3OEFX 3SXSA 2FPGB 5D11A 5HCYA 3IECA 4LQMA 2P55A 2ITXA 4O86A 1DV1A 4CFMA 3DTWA 3S95A 3P7AA 5FDXA 2OJGA 3G0FA 2R3NA 3EKKA 3MB7A 4I41A 5HKMA 2R84A 4JAJA 4CFVA 4PMSA 4M13A 4GS6A 2NUAB 3V4SA 3VS7A 3LFQA 4JRVA 4RWIA 2R85A 4BDEA 4X7QA 4JI9A 2XM9A 4RRVA 5CS6A 3C4EA 4FEWA 4CV9A 4J71A 5HU3A 5KHWA 1DV2A 4RJ4A 2CGXA 3B2TA 2W71A 4D1SA 3FMKA 1H00A 1IOWA 3QRTA 4NCTA 4I5CA 4AA4A 1XHAA 3CXWA 2X8DA 2W6NA 2YS7A 1R0PA 1YI4A 3E63A 3MVHA 3ZZEA 4WIHA 3DA6A 2UVXA 4IJ9A 4ZSAA 3GC7A 3TV4A 4FODA 4JIAA 4BR3A 5FEDA 3ZLSA 4BCGA 3JRXA 5D10A 3DBCA 3NIZA 3GIDA 2YFXA 5LJJA 3RV4A 1JKKA 3LQ3A 3BHVA 3UZPA 1UV5A 4XBUA 4DT8A 2QC6A 1I09A 3R83A 4WOVA 2HGSA 3L1SA 1M7NA 1PKGA 1ZYCA 5AIKA 3GC9A 4EZ3A 1ZLTA 4GT4A 3IGGA 4O91A 2O64A 3GNIB 4IEBA 4B9DA 4BRXA 3IW6A 3PJ1A 4LRMA 3QTSA 4G5JA 3DZQA 5EYDA 3UE4A 3NUPA 3R00A 3QHRA 4E93A 2WB8A 3FYJX 4QPSA 4ZP5A 5E91A 3W2PA 5KMJA 4YP8A 4FFRA 1GIIA 4BCPA 1XH6A 4H05A 3R8PA 5IA1A 2BDWA 3SLSA 5CI6A 2AUHA 5KX8A 1H8FA 3D94A 2XNMA 1B39A 2XEZA 4XZ3B 1KE6A 4GK3A 4GMYA 3LFBA 2QURA 5AV1A 5CEIA 4ZTHA 4DLIA 3VA7A 3DPKA 3SQQA 1W0XC 1QPCA 2J2IB 4DBXA 4K8AA 2Q0NA 2XIYA 3AOXA 4JQ7A 4QP7A 4TZRA 4Y83A 3DTCA 4MX9A 4C34A 4FTKA 3E7OA 5L6WL 2JD5A 4A9YA 3VS3A 3WYYA 4JNWA 3CTJA 1W82A 3QFFA 1GIJA 3UZRA 3IDBA 4I22A 4ACMA 5FP6A 5GJFA 1HOWA 5EYKA 3VBXA 4DE4A 4G6NA 2X9EA 4C5BA 3NNWA 3KAKA 3IDCA 1CKPA 2R9SA 1SZMA 4G1WA 3CKWA 3HGKA 2WMVA 2PU8A 3FXWA 5CAUA 3I5ZA 4AS0A 2LAVA 3R2YA 4EQUA 3SVVA 4RWKA 2BAQA 3H9OA 4XG7A 1R1WA 2WTWA 3OOMA 5IA4A 4BB4A 4PTCA 4CG9A 4ZMFA 5J1VA 4OUCA 2B55A 4ASDA 5AA8A 3POOA 4BDJA 3EL7A 1U4DA 4GJ3A 3FZRA 2NU7B 3U9SA 4YPSA 2HJWA 2QOFA 3QFVA 5BVNA 4GT3A 5AX9A 3UO6A 1KJ8A 3QD3A 3RNIA 3QCSA 5LMKA 3BU6A 3QYWA 4EORA 4HNUA 2XYUA 3BCEA 4HCTA 5LOHA 4DEBA 3NUXA 2PN1A 3BU3A 2Z7QA 3IS5A 3PA5A 5D9HA 3IKAA 3W10A 1Q24A 4L8MA 2W6PA 4WRGA 5EI2A 5LVMA 4AT5A 2HWOA 4FSUA 3TT0A 4IANA 4E20A 2W1CA 4QP8A 3BPRA 4O82A 3HUBA 2HZIA 2R3GA 4I6HA 2OJ9A 2B54A 5E8YA 2QNJA 5JVLA 1SNXA 4U0IA 4PX6A 4HVGA 5E90A 4I6QA 3E64A 3PXKA 3Q53A 4IAAA 4RWLA 2BTSA 2DS1A 2R3OA 3KRWA 3GFEA 3NNXA 2VWUA 3C0HA 3KRXA 3WIKA 4CNHA 1JKJB 1WFCA 2VTAA 3BLQA 1CM8A 5HVKA 1VR2A 2O8YA 2VTQA 4BGQA 2VAGA 4P90A 4HNTA 1BL7A 4I94A 3KULB 3F3VA 3N51A 4I23A 5L8JA 4BTKA 1KBLA 2GS2A 2W17A 2YERA 4FKOA 5D41A 4F1MA 3FMEA 4DEDA 2C6LA 3RAHA 3QXPA 3SD0A 2R7IA 3BEAA 4GW8A 3VMMA 3EYGA 5EDPA 2IW9A 5GINE 3OWPA 4BTJA 5AEPA 1OL6A 1A9XA 5J8IA 3UIBA 1QPDA 3P78A 4HW7A 3TN8A 4CSVA 4U3YA 2EUFB 4EOSA 5DT4A 3BGQA 4MNEA 2E9PA 3CY3A 4EQCA 2R64A 1GZOA 3NUYA 5TR6A 4CZTA 4FUYA 4JJRA 2BZHB 2PVYA 1XO2B 3SHEA 5KE0A 5T3QA 4ZMEA 1Q4LA 1W8CA 4KA3A 2E9UA 2VTMA 4E1ZA 4QP9A 1YHWA 5AV2A 1Y6BA 2OLCA 3UDBA 4L45A 2JGZA 5JQ8A 2BIYA 4FFMA 1R3CA 1KJIA 1GZ8A 3O17A 3NYVA 4RIYA 4X3FB 2R87A 3D15A 2R7BA 5M57A 3O0GA 3MVMA 1VYWA 2ZDTA 3QD0A 5FTOA 5F9EA 4WG3A 2J0IA 3COKA 5IQIA 3F82A 4M8TA 2XA4A 4OTDA 1GGOA 5C26A 4CT2A 4ALWA 2ZDGA 2DLNA 1XWSA 2OFVA 2R2PA 2HY81 5ICPA 4FT7A 2JIIA 4CMTA 4YJ3F 5KUPA 2UVZA 3W2SA 2I7QA 4TPTA 3Q9XA 5CYIA 3PG1A 4JIKA 3OY1A 3R7EA 1B38A 2X9FA 2OK1A 3Q4UA 1BMKA 2W05A 3CGOA 3MH0A 1H28A 4U45A 4WA9A 5CU2A 1QL6A 4RC3A 5DG5A 3KY2A 3R9OA 3DK3A 4F1OA 4G3FA 4Y72A 4QMSA 4NSTA 3JPVA 4C61A 5DBXA 3R8VA 4YJPA 3LFEA 4OT6A 2PVNA 1GLVA 4G3EA 1KE7A 1ND4A 1PJKA 2QLUA 2QU5A 4YC6A 5JZNA 3TNQB 4XG9A 2JAVA 4UZHA 1OL1A 3TV6A 2QO7A 3GI3A 4EYJA 4XG6A 4XP3A 3VJNA 1BYGA 2KTYA 4FZAB 1ZOHA 4A06A 5L2IA 4JBPA 3BBWA 4DEHA 5BNJA 3EHAA 2DIKA 4JG8A 5KZ0A 2X2KA 1UU7A 2ZB1A 2HK5A 4L3PA 4YR8A 4EUUA 3UNJA 4YTIA 3Q6UA 2QO9A 2C5OA 2XS0A 3FQSA 4GVJA 5KKRC 3T8OA 5D7VA 1Q97A 4YZCA 2ITNA 2JIUA 1G8SA 4PY1A 3WILA 4A9TA 3MYGA 3ZS5A 4GUEA 4BZDA 4CV8A 3DLSA 5AAEA 3VPCA 3V5LA 3ZZWA 3R2BA 3NLBA 2C6IA 3DB8A 3W2CA 4F7JA 1OL7A 3Q9WA 4DFZE 3AD5A 5M4FA 4I4TF 1K9AA 3U4WA 3L9LA 3ORXA 3SG8A 1LEZA 5LVLA 4M3QA 2GTNA 3QA0A 3QTQA 1LP4A 4TYGA 4CFFA 4I93A 1H1RA 4UXLA 5GIPE 1P14A 4MV8A 2PYWA 4P7EA 4YJUA 3ET7A 1WVWA 4B8MA 4EG0A 2NRUA 4FTNA 4EL9A 5DWRA 4BVUA 3O2MA 3QLGA 2OXYA 3ZM4A 5DPVA 5HBRB 3ENMA 3E88A 3C13A 5CQWA 4CRLA 3GCPA 1JLLB 3FPMA 4IAFA 4O22A 3POZA 3FY0A 5JRSA 2JDTA 4G17A 3OEZA 5A4LA 1BUHA 4D4YA 2JKMA 4M7IA 1KC7A 5F95A 3FZSA 3VUGA 3C5UA 2H6DA 4PDPA 3WO1A 2JITA 3W2RA 5ITAA 2XYNA 2WMQA 3FL5A 2A4LA 4HR7A 3LXLA 3NPCA 1T46A 2X0SA 2BHHA 4BGGA 4DFNA 4A07A 2XNBA 1I44A 2GQRA 2UV2A 2BFYA 3MPTA 4HCVA 3OUZA 3LIJA 4DEIA 3E93A 2IVSA 3I79A 5AUWA 1OL5A 4E7WA 5JQ5A 2XKCA 2XZSA 3PPKA 3U8WA 1CKIA 1UVRA 5H2UA 3L8SA 5E8WA 4BHNA 4HPTE 4F7LA 1ZOEA 5LVNA 2DYLA 3EN6A 3TZ7A 4FV6A 2UW6A 4I4FA 2Y4IB 1FINA 2VWVA 1WBPA 4MQ1A 5EQEA 4RZQA 5KMMA 2PWLA 5LMAA 3K54A 2P2HA 3FI8A 2GFSA 5FLFA 2OF2A 2QI8A 4OTIA 5I5ZA 1JQHA 4TUYF 4GYGA 4IM0A 4A4OA 4QMYA 2UUEA 3RAKA 3CQEA 3FDNA 3VULA 4DH3A 4FSWA 3AMYA 4NL0A 5M4IA 4MA5A 1W7HA 5HG8A 5JGAA 4ITJA 3W8LA 3SW4A 3BQRA 4UBAA 2YYAA 4F9BA 2BZIB 4USFA 3QC4A 3VUDA 3LJ1A 3HEGA 1Z9XA 2BUJA 4Q5HA 5FTQA 2R3FA 3FHIA 2C6MA 4L67A 1UKHA 1M2RA 3E8NA 3QF9A 3PIYA 5M08A 5DR2A 4IIJF 5HQ0A 4ZHQF 4AT4A 3EYHA 4XRLA 4M15A 5F94A 2BAJA 2CKPA 5D8DA 4RT7A 4QMPA 3PVWA 4TYIA 4XEYA 3NCGA 4RFYA 3ORTA 2ITZA 2PUIA 4XNEA 4G34A 2C5NA 4G2FA 1FGIA 2P0CA 4E26A 4RC4A 5LA6F 5I4NA 4FEQA 4XUFA 3F88A 4DG3E 2UW8A 3SC1A 3QAME 3MA3A 1Q61A 3NVMB 4YBJA 4BZOA 5KBRA 1SMHA 4DINA 4FNWA 1A06A 3GB2A 2WO6A 3IW8A 4PP7A 3U6JA 3ORQA 2W4KA 3ATTA 3A4OX 3Q52A 3QTRA 4BCQA 2ONLC 2WXVA 2CGUA 1NY3A 3MFTA 2ITWA 3UOLA 2UZWE 1OECA 2E9VA 4GFMA 1YI6A 4E6AA 4DFUA 5IMXA 4ZAUA 1RQQA 5HX8A 2WMAA 4N57A 3W1FA 3PXZA 2OZOA 3NUNA 4NH1A 4EHEA 3JZFA 4G9CA 4W4VA 5AP1A 4TY1A 5AP6A 4O7VA 4XH6A 3LMGA 4CTBA 4I0TA 4C3FA 4IWOA 2W4JA 4NKSA 1YQJA 2OKRA 5CU6A 4DH5A 2GNIA 3Q04A 4RZWA 3R9DA 5IA5A 2XK3A 4ITHA 4O83A 4GV1A 4DAWA 3BEGA 2YM4A 4DITA 3E8CA 3MFUA 4FKIA 3QQLA 4NFNA 4F64A 3MH3A 1ZMUA 5E9EA 2W9FB 2YIQA 2ZMDA 3EMGA 4IZYA 1Z57A 1UKIA 2GNLA 2XKDA 4KS7A 3HUCA 5DH3A 4ZK5A 3VVHA 3WIGA 2BRBA 5KMNA 4K77A 3BYVA 4IMYA 5B2MA 4FIGA 5AIRA 4Y5QA 2J51A 3U54A 5CXZA 3EKNA 1JKLA 4OTQA 4EC8A 4ZEGA 1MQBA 4R3RA 5AUYA 2A0CX 1REKA 2C1BA 5T6KA 3ROYA 5ANOA 4EH5A 4IAYA 4Z7GA 5CVFA 3GEQA 2R3HA 5LYJF 2Z7LA 5J9ZA 4C4IA 5CX9A 4IZOA 2W1GA 4ZLYA 1PXLA 4EWHA 4YJTA 3VBVA 3QRKA 4CXAA 3UOKA 1M0TA 4ZTNA 4EK3A 2O2UA 2J0MB 4YURA 4WO5A 5AP7A 4CVAA 3VNTA 5IH5A 4C5AA 3H30A 1H1WA 3GU8A 4G6LA 2WTCA 3ODYX 4P5ZA 4U97A 5BYZA 1Q41A 4JDJA 4L7SA 5EM5A 4DT9A 4QMQA 3NRMA 2F9GA 3HYHA 1LEWA 4ZY5A 3AW8A 4ASEA 5ANGA 5E8UA 4EOMA 4I50F 1FMOE 3FKLA 4LUDA 2EB2A 3H3CA 3G0EA 3I1AA 4FC0A 5G6VA 2ZV7A 2O0UA 3NEWA 3KXZA 3ZO2A 1OBGA 4RMZA 2XD4A 3Q4CA 3SXFA 4X6QC 5C8NA 1E1XA 4X0MA 2X1NA 5TT7A 2FP4B 5IA2A 2GDOA 4TYJA 5GJDA 3A8WA 1LUFA 3ACKA 3C4WA 4O7NA 2I0EA 5H8GA 4ARKA 5H80A 3I12A 2XK8A 4DG2E 4BN1A 1I7LA 3EL8A 5L2TA 3GCQA 3MW1A 3MY5A 1XR1A 3SG9A 2NU8B 4GK4A 3ANRA 3RCJA 3EB0A 2G2FA 3O71A 5E4HA 3VBQA 5L6PA 3ORPA 2GHLA 1H26A 4O0RA 3AG9A 3AT3A 4FZFB 4FZ6A 2B1PA 4JS8A 4A4XA 3NVKI 3R8UA 3EFKA 1Q99A 2IO6A 3GOPA 4PV0A 3MVJA 3MA6A 4M0ZA 4FV4A 5EH0A 4CGAA 5DRBA 5CF4A 1EUDB 5BYYA 3LFNA 3R7UA 2YIXA 3AC5A 3V6RA 1WCCA 1GZNA 4JVGA 4MD7E 2RIOA 5B2LA 4IAKA 1SVEA 5BUEA 5GHVA 3ZDIA 4E6CA 4UB7A 5BMSA 1M6VA 5CVGA 5C4LA 3LCDA 4JDIA 3CCNA 3II5A 5HIBA 2BVAA 3ROCA 1M52A 4QQCA 5AM7A 4YHTA 1WR2A 4CKIA 2QHNA 4JX3A 4O81A 3FJQE 4I5PA 1EZ1A 1AUVA 1XH9A 2VGPA 1YHVA 3IGOA 2GU8A 1U54A 2J6MA 3UODA 4FFOA 3QTUA 1NW1A 2UZLA 1Z2NX 2J7TA 3GOKA 4MK0A 4S2ZA 2W70A 5M09A 2VQDA 3QA8A 4ZJVA 2HYYA 4MD8E 2UZEA 5I9YA 5IF1A 3FI2A 4BYJA 4WUNA 4C4JA 4ME6A 1I7NA 4L1KA 4XYLB 3UO5A 2QOLA 1A48A 2BTRA 2JAMA 3OCSA 4D4RA 4MBLA 3SRVA 3VJOA 4OBQA 5ACBC 1WMKA 4RIXA 4S34A 3A7IA 5IQCA 3P0MA 2GPSA 5EI6A 2QU6A 3FWQA 4C33A 2O63A 3CJFA 3GGFA 5HX6A 1U54B 1P2AA 2XNPA 3EQRA 4TNDA 3D5UA 4I0SA 2J5FA 1E1VA 1ZXEA 3KN5A 3SGCA 4QP6A 4AN3A 3DAJA 5B0XA 5C8MA 3V5WA 1KEEA 4FX3A 3EN5A 4TWCA 4ZJIA 4F7NA 3TNHA 5A4CA 2CN5A 5HCZA 1OIQA 3JVRA 3M1SA 1WBTA 1ZZLA 4QNAA 4TT7A 2P2IA 3R28A 4Y46A 3BWFA 2ZM1A 2YAKA 3QCQA 1CMKE 4KUJA 1F5QA 2BFXA 3VQUA 4RJ5A 3PDTA 5TO8A 1CE8A 2Y9QA 4FOCA 2B9IA 1OBDA 1XBAA 4H3BA 5CI7A 3ZBXA 2YZGA 2PE2A 2KULA 4MXYA 2JKQA 3R5FA 3VRYA 4CTCA 1KJ9A 1L8TA 2CLQA 4JAIA 4FL1A 4S32A 3ETJA 2BRGA 2OJIA 1SVGA 3GXLA 4KB8A 4LL5A 2YL2A 3QKKA 4FSQA 5IA0A 3O7LB 4Q5EA 4FV5A 3I60A 3DF7A 4NFMA 2RFNA 4XG8A 3T9IA 2ITQA 4EH7A 4BIEA 4O0SA 3HA8A 3GQIA 1PMNA 4D1XA 4WHZA 4X2FA 3AGMA 4LRKA 2PPQA 3PY1A 3QQHA 2C47A 3C4FA 3L8PA 3K3IA 3NAXA 3DK7A 3ODZX 4NJ3A 4ACHA 4CT1A 5HV6A 4EJ7A 4O6LA 4QRCA 3TZ8A 3D5WA 2QO2A 4I6BA 5BMMA 2PULA 4IM3A 1WZYA 4ALVA 3BIZA 4DGOA 1JDEA 5HBHA 2GMXA 4ERKA 2Y7JA 2CJMA 5CF5A 5IUGA 2X8IA 4MH7A 1PXNA 4IQ6A 3QUPA 1H08A 1NVRA 2I0VA 3Q96A 2F4JA 2GQGA 4MF1A 4E5WA 4FL3A 3CD3A 5CU0A 3QRIA 4IX5A 4XP0A 3FLYA 2BILB 3VBTA 5HG7A 2I6LA 2W5AA 1GOLA 3P5KA 4FKTA 4DFBA 5JQGF 5AUZA 1DI9A 5HI2A 1U5QA 2J0JA 3KXMA 3LZBA 5IH6A 2CPKE 4HYSA 3Q5ZA 2ETMA 3PRIA 5GJGA 3MS9A 3FSKA 3ZHPC 4E4TA 2W1HA 1BL6A 3QUEA 4V04A 3SE7A 4IWQA 1QMZA 3TQTA 4QNYA 4GKHA 5KHXA 3RK9A 2OZAB 2X7OA 3QXOA 3UGCA 4J8MA 2O65A 3LM5A 4II5A 2Y6OA 2YDIA 3DCVA 3NZ0A 4XBRA 3S1HA 1W96A 5JZJA 4AZVA 5H8BA 4YBZB 2QK4A 2CSNA 1XJDA 2J90A 2PZ5A 4CLIA 5EYCA 4ZTRA 4Y95A 3ZSIA 2CZGA 3UZTA 1ZMVA 2NU9B 2A2AA 4GUBA 2Z2WA 4QMWA 4F9WA 3B8RA 5EQPA 3HBLA 3OXZA 5C4KA 4AOTA 4D9TA 4RA5A 3BGZA 4MCVA 4FV7A 1EUCB 3GQLA 2REIA 3ENHA 4ZY4A 3ELJA 2R3MA 4S31A 3OTVA 2RG6A 3LFSA 5M4CA 1Z5MA 5HLPA 3F3UA 4O0VA 4MXXA 3DKCA 4JT3A 3ZRMA 4AN9A 2W6ZA 3UC3A 2UW3A 1UNHA 1GIHA 4H36A 2XCLA 4FTTA 4OBOA 4I6FA 4OLIA 4HCUA 4L00A 3RP9A 4AZWA 5CAEB 4ALUA 4EOKA 4FTRA 4BDGA 2UVYA 2J0LA 2QOQA 2FPPB 1DAYA 2WMTA 3FZTA 3K5UA 2WGJA 4TYHA 3FYKX 4O84A 4F08A 3BV2A 3Q2OA 5IDNA 4AOIA 2Z04A 3DKGA 4TL0A 2R82A 4DH8A 3JY9A 2YDJA 3HL7A 1ZWSA 3KGAA 2VTLA 3ZCLA 4BCJA 3R73A 2VWZA 5K5XA 4YJRA 3DXNA 3FQEA 3ID6C 3R0TA 2XNNA 4J98A 2RFEA 5EM8A 2YIRA 1MP8A 2PHKA 2W4OA 5FRIA 2IW8A 4AW5A 4D55A 5BVOA 3FKOA 4XJ0A 5FG8A 1PRYA 2JBPA 4TYEA 2CGVA 5EFQA 5HTBA 3DXPA 4O2PA 4AGUA 1UU8A 2FUMA 3Q3BA 2DUVA 1SM2A 5AP3A 3AC3A 3DQWA 4J53A 4KBCA 3ZC6A 1WBNA 2EXMA 3RZBA 3R9NA 2QOBA 2HZ4A 4G3DA 4RG0A 4QQ5A 4E5AX 4Z7HA 4JL9A 4YZ9A 2OBJA 2YS6A 2OICA 4DHFA 5CSWA 4LV5A 4IHPA 5IQFA 3PIZA 5DMXA 2W7XA 4KIQA 4QPAA 5B7VA 1NVQA 1W98A 3LXNA 5DN3A 3OT8A 4ZLOA 1YI3A 5I9ZA 4XG2A 2HW7A 4WT6A 2W6QA 2OGVA 4C59A 3KK8A 3PXRA 3TIGA 4YO6A 3R9RA 3RHXA 3R1YA 3JRWA 1PKDA 2X8EA 3RINA 5HZNA 3FLNC 2RF9A 3R7OA 4L01A 5A54A 4LYNA 4U80A 3MFRA 4M69B 4Z9LA 3UQGA 3UMXA 4AWIA 3K5IA 3OC1A 4HPUE 2WTIA 4FIIA 3EQDA 5IU2A 4ZSJA 4D4SA 1KUTA 2W6MA 4EK4A 5A9UA 5KMKA 2WTVA 4RJ8A 2RG5A 2XK6A 5L3AA 2UW5A 1O9UA 1CSNA 2JDOA 4PDSA 4ZY6A 4IB5A 3F5PA 5DEWA 4UYNA 1FMKA 2IG7A 4AUAA 2X4ZA 4ANLA 3UYTA 2V5AA 3IK3A 4RC2A 2YIWA 1YWVA 3EQHA 3P1AA 3T9TA 3G9NA 3R04A 1YOJA 3KFAA 5EW3A 3ZSHA 4BDDA 2XBAA 4FTJA 4S33A 4KKGA 2YWVA 3DOGA 3VBYA 4BCNA 1RDQE 5DEYA 4MWIA 4AFEA 1YXVA 3FBVA 2C3IB 2RFDA 3GU7A 4IAZA 2IVVA 5HE2A 2JEDA 3EFJA 3LCTA 3R7YA 4RX9A 4IVBA 2WIHA 2YCQA 1OGUA 4FGBA 5EI8A 3IW7A 3R1NA 2WTKC 5IG1A 2PTKA 2EXCX 3O8PA 3I5NA 2IZUA 2JKKA 5K4IA 3S3IA 3LPBA 5EYMA 1PW2A 4R3PA 3TWJA 3R21A 5LCJA 3TUDA 1Q62A 3CR0A 3R22A 5AP0A 5HTCA 2GCDA 3MGYA 3D9VA 5AMNA 3WF9A 5IPJA 4A4LA 5KKRB 3TIZA 2PVHA 2PSQA 2J4ZA 4O6EA 5BYLA 4GG5A 4GU6A 3ZLWA 4AA0A 1YW2A 2QKWB 4GU9A 4LOQA 5EW8A 3DJ5A 5IQHA 5C01A 2PBZA 3PJ3A 5AV3A 2BKZA 4MHAA 2UW9A 4YJNA 4BBFA 3TUBA 5BVWA 3I0QA 4FZDB 5HBEA 3ZXTA 3F69A 3TKIA 5KMLA 5BPFA 4FI1A 2JFLA 3PWDA 4EH8A 5IISA 4OW8A 2QCSA 3KXHA 2CNVA 4JRNA 3DBFA 1FVTA 3OP5A 3NX8A 4DEEA 2YAAA 1VJYA 2XJ0A 4I21A 4AZFA 2VWYA 4DTBA 2H34A 4O21A 4DFLA 5DIAA 2X81A 4IX4A 4FYNA 2VWBA 3U6IA 3COIA 4E6QA 4Y73A 3PA3A 1PXKA 2DWBA 3K5VA 2ITVA 3F66A 5AUUA 5JT2A 3FAAA 1YRPA 2IVTA 5AM6A 3RAWA 1YDRE 3OFMA 4QMVA 2ITPA 1GNGA 1ZY5A 4ZIMA 4AF3A 5HLWA 3RPYA 3C1XA 4ZS0A 4DN5A 3QRJA 4YC3A 2VTJA 4EZ5A 3OUNB 3WZJA 2CHLA 1JSVA 5EKOA 5FXSA 4CLJA 4GEOA 1VBGA 3DAKA 4FFPA 3N4VA 2YZLA 2WNTA 4HGLA 2XM8A 1NT2A 2R3KA 5IYZF 2IPXA 2VNWA 4GCJA 4XLVA 4YJVA 4APPA 1PXOA 1IA8A 3V51A 4IZAA 4YLLA 1U46A 3GVUA 3CPCA 3PP0A 4FKLA 4LGGA 3VWAA 1VKZA 2HY0A 2VO3A 2WTDA 4PDOA 2ETKA 3D0EA 4WBNF 3EJ1A 3NUAA 2XCKA 4FVPA 4YTFA 4EBWA 2XP2A 5JFVA 4XV9A 1WBWA 4F0GA 4MNEB 3ZO4A 4YTCA 3QKLA 4B4LA 3V01A 3EOCA 3PVGA 3PSDA 5HICA 4XOZA 1IAHA 3HZTA 4QO9A 1S9JA 3G8DA 1ZMWA 2Z7RA 4TTHB 3MWUA 1WVYA 4HGSA 3JS2A 2Z60A 3VUKA 2HXQA 3V5PA 5JN2A 4QOXA 4Q9ZA 5FXRA 1VBHA 1PMUA 3VS5A 2H8HA 3C0GA 3QCYA 4MEDA 5K4JA 3D5XA 4UY9A 5DVRA 4RIYB 4IDTA 1LPUA 3QTWA 4R5SA 4YAJB 1FPUA 3G6GA 3FE3A 3OZ6A 4KS8A 4FA2A 5GONF 3GLKA 3MIYA 1L3RE 5EHOA 4EH2A 3Q1KA 3D7ZA 3JUHA 1FVRA 4GKIA 4YZNA 2ONLA 4PL4A 2QOKA 2ZOQA 3PSBA 4K2RA 2VX3A 4P5QA 3AQVA 5DYJA 5ANEA 5BX0A 4F70A 4F7SA 1Y91A 4YSMA 4RX7A 2VTSA 4OTHA 2B7AA 4U3ZA 4B8LA 2OU7A 4HYUA 3AC2A 3LKMA 4YLJA 4PP9A 4PTEA 2VR1A 3AD4A 3RK5A 3N8DA 3BYSA 3KEXA 3GCVA 5FEEA 2QG5A 5K3YA 1O6KA 5CWZA 4NM5A 3RM6A 4DA5A 3PLSA 4JBVA 5CEOA 1MRYA 1PY5A 2WZJA 4WRSA 1PMVA 3R02A 3IDPA 5AX3A 5H3QA 3RPSA 3H10A 3BE2A 4Z3VA 1T36A 2R7MA 4H3QA 1C3OA 2CKEA 4ZZOA 3AC1A 1R39A 3D2IA 3PPJA 3P86A 4ZTLA 3LP8A 4K33A 1DIKA 5BVFA 3GBZA 1Q3DA 3DB6A 3UVPA 3ULIA 4FTIA 4FV9A 3LLTA 4O7LA 2UW7A 4J96A 1KV1A 2ITOA 4I4EA 4IB1A 4W4WA 5HNIX 1IA9A 2XNOA 3QQGA 4RQVA 4V0GA 2RGPA 3VF8A 5LMBA 3NYXA 5HESA 4R1VA 4L68A 2VD5A 2OXDA 4C2VA 1DI8A 2WU6A 3NUSA 4YHFA 4ACDA 2CNQA 2VX1A 3OD6X 3H9FA 4FZ7A 4U9AA 5HE0A 4RJ3A 4BDAA 3NNVA 1P4FA 3C5IA 5FP5A 3BYMA 3LMHA 3DBEA 4PL5A 4M9UA 3FEGA 2X2LA 3M42A 4FTLA 5E8ZA 3QHWA 3VO3A 3WI6A 3D83A 2VTIA 2C6DA 5CY3A 2ITYA 4O2ZA 3OBJA 4RX8A 2PMNX 1PMEA 2YN8A 4Y5HA 5H8EA 3PFQA 1YHSA 3BWJA 4AGWA 2JIVA 3WBLA 1Y8YA 2C3JA 1UNGA 4FUXA 5HVJA 4U44A 5BUJA 4C36A 4K9YA 1GY3A 1OIUA 4NZWB 3G33A 2R7NA 4M68A 4OTRA 3TCPA 5CU3A 4DH1A 3CP9A 3ZOSA 2QF7A 2FYSA 2R0IA 3A7GA 4O7ZA 3RPVA 3P9JA 3HKOA 4M12A 3TJDA 4FKQA 3S00A 1PK8A 2JLDA 2OIQA 4XMOA 4Y8DA 2I8CA 4BGHA 4BIBA 2YM5A 2VTPA 3D14A 4CRSA 2EB3A 4HYIA 3LFDA 4GIIA 4XP2A 2WFYA 1S9IA 2VUWA 4UXQA 5ETFA 3FHRA 1WBVA 2HZNA 4EQMA 4C4FA 1YOLA 1V0PA 3MWDA 2IZRA 4L3LA 4K6ZA 5CAOA 2BRMA 2JDRA 1VYZA 4PRJA 3ZFXA 4AE6A 2WMXA 4HVDA 5A14A 4BICA 3ZU7A 3HDMA 4F6UA 3IW5A 5D1JA 1KOAA 4FKPA 4ENYA 1J1CA 5M4UA 3EQFA 4QQTA 4NU1A 4WUAA 2GS7A 5J2TF 1JAMA 3KA0A 4MBIA 3PRFA 5C03A 4XX9A 2PVKA 3RAIA 2Z02A 2VPQA 1REJA 3R23A 2XIZA 3NIEA 5KCVA 4PF4A 4ERWA 2G9XA 4U6RA 3PLAE 3JY0A 2PVJA 3R01A 4X6RA 2X2MA 1R78A 3UPXA 4ZOGA 2F2UA 1IR3A 2EU9A 3KRJA 4IAIA 1MRUA 1EHIA 2OWBA 4QYYA 3R9HA 3TKUA 3K5HA 1IASA 2W96B 4QQJA 3PYYA 4TW9A 1V0BA 3VC4A 2VWXA 4MAMA 4FSTA 1XH8A 4TWNA 3ZLYA 4C2WA 5HE1A 2ZV2A 4C37A 2E2BA 1TVOA 2WTJA 4PNKA 4BY9E 3BELA 3OWKA 3VHEA 5K5NA 3CPBA 4IHJF 3PZHA 3PIXA 3ZMMA 2WU7A 4GL9A 5HEZA 3RWQA 3FXXA 2WQMA 3D7TA 3BYOA 4TWOA 1H01A 2IN6A 3S0OA 4O7YA 1BLXA 4JR7A 2CNUA 2UW0A 3WE8A 3Q9ZA 5FM3A 3OWJA 4FICA 4O27B 2Z7SA 5J9LA 1JOWB 4KSQA 4OTWA 4RSSA 5CASA 4IH8A 1IG1A 1NA7A 4BZNA 3TTIA 3DGKA 5HU9A 2FB9A 4LGHA 3BKBA 4XLIA 2RFSA 4DF3A 4F9CA 5AV4A 2DWCA 3BV3A 1M14A 3EQBA 4QP2A 2I1MA 3BBTB 4MQ2A 3A7JA 3LXPA 4UV0A 5T68A 2FA2A 4F0FA 3F2NA 4EGJA 4H1MA 4AOJA 2IZTA 3V8SA 3AC8A 4QT1A 1OZ1A 5AWMA 2X4FA 2VO7A 4KKEA 5FM2A 5J95A 5AAFA 2VO0A 4TNBA 2C6TA 4UWYA 4FEVA 4X2GA 3FC2A 5CLPA 4IB0A 5DGZA 1Q8WA 3LCOA 4DTKA 3Q6WA 4O2BF 5LVPA 3QLFA 4JX7A 4ZSLA 2VNYA 3A7HA 4HNFA 1XBBA 4BDBA 5CSVA 5KZIA 4I5MA 2WQEA 1H24A 2A1AB 3GU4A 3UJGA 1E4EB 1ULZA 2YW2A 1J3HA 5JVDF 3F9NA 5HE3A 2IVUA 5TOZA 4FV1A 3NMUF 1YDSE 4GT5A 3ZRKA 5A6OA 4B7TA 3I7BA 1XBCA 4H39A 3COHA 4FMQA 3NAYA 3PXQA 5IA3A 3OXIA 4W8EA 3Q5IA 5DLSA 4BCMA 5A6NA 3O50A 4FG8A 4CG8A 3WF5A 2C1AA 3UOHA 3E62A 1TQIA 1W83A 1BNCA 2R0UA 3UFXB 4JOAA 3CLYA 5IQEA 3UO4A 5C1OA 4C38A 2DQ7X 1ATPE 3TIIA 2GNJA 3BHTA 4J95A 3FMDA 2E9OA 2Y0AA 4GG7A 4N4SA 4O7TA 3WYXA 3S2PA 5EQYA 1JDBB 2J5EA 5LVOA 4RZVA 2C6KA 3LJ2A 4FT3A 2WHBA 4QMTA 3ETHA 4R6VA 3LW0A 5CANA 3W16A 4AZTA 2YM3A 3P23A 3C4XA 4Q2AA 4WBOA 5ETAA 2HELA 4IDVA 5C1QB 1PYXA 2ACXA 4O0YA 2YEXA 3RUPA 4ASXA 3C0IA 5JSMA 2ITUA 2PE1A 2YZAA 5L8LA 4J7BA 4O96A 2P3GX 4IWPA 3TZMA 2R3PA 4QMZA 4ZSGA 3ZSGA 5CZIA 5HNGA 2XJ2A 1IRKA 3U51A 2V58A 1Y6AA 4ZZMA 5KMIA 4RIWA 3R71A 4BC6A 5HVYA 3WARA 4AZEA 2BALA 5IEVA 2Y4IC 2ERKA 3O51A 1KJQA 4YPDA 2UZBA 5KMOA 3ITZA 4FTOA 2FSMX 5A4TA 4CFNA 4WG5A 3E5NA 3OROA 4F1TA 5CENA 5F1ZA 3REPA 2Y4PA 3OY3A 4M0YA 4ZQIA 2W06A 5F4NA 5LP6F 3V5QA 3E92A 1MRVA 2ZMCA 2I87A 3GT8A 2WIPA 5IQAA 4RQKA 5HNBA 4UN0C 3MV5A 1P4OA 4A7CA 3VPBA 3FMJA 5ANDA 4D58A 4DLJA 4C5CA 3DDQA 4F9YA 1ZYSA 4RIOA 3Q4ZA 3G2FA 4XV1A 2JFMA 2W1IA 3OBGA 2YISA 4FK3A 2PZYA 4PUZA 5TKDA 3ALNA 3QZHA 3TNIA 4B99A 2OH4A 3COMA 2C0IA 3GUBA 4YB8B 3TW6A 2WQBA 5CXHA 4CFUA 2G01A 2BPMA 2YM6A 5E8XA 4M14A 2G1TA 2Q0BA 2R3QA 4A9SA 2GHGA 3MJ2A 4BI2A 2WKMA 3PJ2A 3UNZA 4CEGA 1M2QA 4NUSA 3FUPA 3TI1A 2HZ0A 4HGTA 4LMUA 4AGCA 1UWHA 1UNLA 3MBLA 1OM1A 3HV3A 3QKMA 4X2KA 3ZO1A 4W4YA 4YBKA 1CS0A 1CKJA 4Z55A 1O6LA 3OF0A 2J9GA 1KE8A 1OKVA 1G8AA 1Q8UA 3Q32A 3VUHA 5AA9A 3HB9A 3KF7A 5E8VA 4MVFA 3ANQA 3R1SA 3BG5A 1RE8A 4HZRA 3FKNA 3EIDA 4W8DA 1BKXA 1M7QA 1Z2OX 4EJNA 5LXMA 4V05A 3ACJA 3TINA 5EK7A 4FTAA 1OPKA 3QGYA 5AP4A 2YITA 1B6CB 2GFCA 2VZ6A 3G51A 3F5XA 4G3CA 5HO8A 2BHEA 3DK6A 5F20A 3U87A 1XH7A 4C7TA 1OITA 4R7BA 3SRVB 4E5BA 1VZOA 4RIXB 3TJCA 5JFSA 1H27A 4I3ZA 3W2OA 4OTFA 4APCA 2VU3A 1QCFA 3R8ZA 4E4MA 4FV0A 2FO0A 3GU6A 4EC9A 2VTRA 4ZZNA 3D4QA 1ZAOA 2XIXA 2BR1A 3QTXA 4O4HF 4JQEA 5ANJA 3LJ0A 3WF7A 3VUIA 2IJMA 4E4XA 4IX3A 5JGDA 3CE3A 4XCUA 1F0QA 3CQWA 4R7IA 3U6HA 2B9FA 5D7AA 3VF9A 4MBJA 4MTAA 5JK3A 5D12A 1R0EA 4BBEA 4AXAA 2YRXA 1UA2A 3QYZA 4CMUA 4FBXA 1B6RA 3PY0A 4G6OA 2XK4A 4U7ZA 2ZM4A 1IOVA 3ORMA 4FV2A 4Y8VB 3ZONA 3UP7A 4ZLZA 3JZIA 2B53A 3CSVA 3HP5A 3UOJA 4AG8A 1PX2A 3R5XA 4CCBA 1O6YA 3G15A 2UW4A 5L2WA 3PE1A 3R8LA 3F3TA 3SV0A 2YCRA 3RGFA 4HQ6A 3U9NA 4D9UA 3VN9A 4IACA 5C8YF 3BGPA 2QONA 4C35A 5CEPA 3AX6A 3KQ7A 3CTQA 1TQPA 2ZV9A 2YM7A 3B2WA 3LMIA 4ZTQA 4AAAA 4AQCA 3BLRA 4FT9A 3QC9A 4UX9A 4Z16A 4RJ6A 5ACKA 5GIOE 4ONAA 4IJPA 4LG4A 5IQDA 4BDHA 3N4TA 3PG3A 2ZDUA 1MUOA 3IONA 1CQIB 4YNEA 4YZMA 3WE4A 5LARA 2G2IA 2BAKA 3NYOA 5EM6A 4QMOA 2R3IA 3OOGA 5CEKA 3AMBA 2F57A 3LFAA 2XK9A 3BI6A 5M06A 3BX5A 5CEQA 4BDFA 5JGBA 3OUKA 3GCUA 1F3MC 3H0YA 4AE9A 3TZ9A 3HO8A 3MH1A 5DFPA 4FKRA 4U5JA 5M55A 3KRLA 3LOKA 4KRDA 3KXGA 4USEA 3RM7A 3A4PA 2JDVA 3KXXA 1J7LA 3ZUVA 4MWHA 4NM0A 3FC1X 4RLLA 4MYGA 4QTDA 4BF2A 2PVRA 2PUPA 3LHJA 3CY2A 4K11A 3PXYA 4L52A 4O7RA 3K3PA 3OVVA 3RPRA 3O7LD 3FZPA 4C3RA 3LFFA 3M11A 3R6XA 3SAYA 3UIXA 2WTKB 3VS4A 3A60A 4QMLA 4XOYA 3WF6A 1UU3A 5CNNA 4YZDA 5AV0A 2BZKB 3N4UA 2PMOX 5HBJA 3C51A 2C68A 2C0OA 5ETIA 2YACA 3BRBA 4TWPA 4USDA 4KSPA 2CKQA 4YU2A 4R77A 3UQFA 4YO4A 3U9CA 3V5JA 3EN4A 4L53A 2J50A 5E7RA 2C5YA 5J5SA 4KRCA 3UG2A 5DNRA 4ZI7F 5AUXA 4E8AA 1UWJA 3VAPA 4KABA 3SXRA 4AP7A 3QQUA 4FTCA 3CC6A 3I4BA 2XBJA 3EH9A 3F3ZA 3LM0A 3M2WA 1KE5A 5FNVF 2YABA 4GYIA 3GCSA 2FSTX 5DT0A 4IM2A 1KE9A 3LWBA 4EOQA 2PE0A 4FT0A 1X8BA 1SNUA 4GJ2A 2W5BA 2C00A 2ZDHA 2B52A 2I0YA 1Q8TA 1J1BA 4DCEA 3SA0A 3LCKA 2CDZA 3E5AA 2O5KA 1FBNA 4KKHA 3RWPA 4DFXE 4EK8A 5DE2A 2NP8A 3A8XA 2YRWA 1TQMA 4JG6A 4F6SA 3BHUA 4CCUA 1DS5A 2V7OA 2CGWA 2XF0A 1H0VA 4ASZA 4HVHA 3TIYA 2JBOA 4C58A 5I0BA 1BI7A 4CMOA 4FKSA 5EKNA 1HCKA 5CVHA 5K9IA 4EOJA 2XB7A 1B6SA 4DLKA 4TYHB 3QWJA 3HLLA 3ORNA 1PXPA 2VRXA 3OW4A 2UZUE 4F9AA 5J87A 4MXOA 4H1JA 5C8KA 3RMFA 5E1EA 5AADA 3B8QA 1GJOA 2OSCA 2XKEA 2GPWA 1FGKA 4R7HA 1BI8A 4XHKB 5B2KA 5TF9A 5KX5F 2Y8OA 3PE2A 3ZEWA 5AUTA 3S4QA 4M84A 3TUCA 4ACCA 5M56A 3VS0A 2IWIA 2WPAA 3NSZA 4BI1A 2LGCA 1GAGA 3NWWA 3QQJA 4RVMA 4A9UA 4M67A 5ETCA 1TKIA 3KVWA 4MV4A 4F63A 4AGDA 3P4KA 4X3JA 2QKRA 1JVPP 3FL4A 1H07A 3KREA 2QOHA 5AP5A 3THBA 3WZKA 4BKJA 4QTAA 2I0HA 3DNEA 3ERKA 3ZM9A 3T3UA 2PVLA 3PJCA 4LV8A 2NU6B 3PTGA 3OMVA 4L9IA 4C62A 2XRWA 1PYEA 3HAVA 3IOPA 3KB7A 3L8XA 1A9UA 3FLSA 4XG3A 5CU4A 3KK9A 3FXZA 1QPEA 4AW0A 2OIBA 4WNKA 1H4LA 4DIMA 2YIYA 4F65A 3HMIA 5CA0F 1JKSA 2C4GA 4L43A 3FPQA 5DT3A 3VBWA 3TDVA 1OUKA 2FVDA 2UZVA 2WQOA 3CIKA 2AC5A 4ANBA 2IZSA 3ORKA 3RALA 3MJFA 1OKWA 4UYAA 2W1FA 4GFOA 4DGNA 3GP0A 4I92A 5JH7F 3R8MA 4I0RA 4ACGA 1WBSA 3DJ6A 3MSSA 4KAOA 4FIHA 2XEYA 4L46A 4BYIA 3TXOA 4F0IA 1XH4A 4CFXA 5I9UA 3N6RA 3I7CA 4NM7A 3DJ7A 2GQSA 5DR9A 3O23A 4AT3A 2WOUA 3AT2A 3KCKA 4RFMA 1JNKA 2BDJA 2FGIA 3HMOA 2ITTA 1YXTA 2X39A 3DLZA 4GH2A 2OG8A 3OT3A 4PMTA 4PNIA 3EWHA 2YDKA 2B0QA 5JFXA 4EK6A 2FB8A 2X6EA 4NIFB 5FEQA 4A9RA 4CQEA 4YJ2F 3GU5A 1YXUA 3HP2A 4QYFA 4YJOA 3MTLA 2QQ7A 2VV9A 4JBQA 4IW0A 4BCHA 2F7EE 3QX4A 4FNXA 3PWYA 4FNYA 5A4EA 4J8NA 2FSOX 4YNOA 2HW6A 2HWPA 2I40A 2WEVA 1RW8A 4FG9A 5FQDC 3L8VA 3V6SA 3IOKA 1H1QA 2GSFA 4FKVA 4ID7A 4KIOA 4JLCA 3KN6A 3OWLA 4HVIA 2VO6A 4FSYA 4NYEA 4R3CA 3ORIA 4E4LA 5JMSA 3A7FA 3PY3A 3CKXA 4TV8F 2C3LA 1EYZA 2W0JA 2BROA 3DU8A 5J2UF 4N0SA 3JXWA 4HGEA 3JR1A 3ULZA 3UVRA 5L6OA 3V04A 4EEVA 3G8CA 3JVSA 2UZNA 3CEKA 3LAUA 1YWNA 4FKWA 4XRJA 2R3LA 4IVAA 4P4CA 4XG4A 4ZTSA 3RHKA 1IEPA 4BBMA 3NUUA 4EKKA 4F09A 3LE6A 4FNZA 5IEXA 4GK2A 1STCE 2WMBA 3FZOA 4RVTA 3C4ZA 3UIUA 1CDKA 2C3KA 3E8EA 4CFWA 3MTFA 2DZDA 1IAJA 4I20A 4X2NA 1AD5A 2JDSA 3F6XA 5BQ0A 1JKTA 1YXSA 1XKKA 4XV2A 3KULA 1ZARA 3WOWA 1PXJA 1YDTE 3V8WA 2EVAA 4FTMA 4MXAA 5HD4A 3MY1A 4HOKA 4UEUA 1U59A 4BCIA 2WMSA 3GENA 4ZXTA 4FSRA 3R7IA 4BDIA 3ZC5A 4D1ZA 3BLHA 2IW6A 5E8SA 4FOBA 2GNHA 4DEGA 5HLNA 3ZO3A 3TACA 3P08A 4WNPA 4KIPA 2C6EA 4RGJA 5J1WA 4B6LA 4QP4A 4I1ZA 3TNPC 5IMEA 2BMCA 1AQ1A 3O96A 4U8ZA 2XMYA 4UZDA 4WNMA 1GZKA 3HECA 5L2SA 5AAGA 4MD9E 4O0WA 1PXMA 4X2JA 3EQIA 3Q9YA 3C4CA 4OBPA 3FLQA 3DBQA 4RPVA 2XH5A 3I6UA 3LCSA 4QYHA 2BKKA 2CN8A 3RKBA 4G3GA 2GNGA 3MESA 5G1XA 4NCTC 5C27A 4AACA 3KAJA 3HX4A 3NW7A 1YWRA 4X3FA 3QZFA 4OTGA 5HG5A 3RK7A 3HMMA 5FBOA 2PZRA 2RKUA 2YWPA 4IFGA 2B9HA 1GSAA 3QX2A 4DYMA 5JFWA 1Q5KA 1H0WA 5JRQA 4ZOLF 3QQKA 2C0TA 4ZSEA 1T45A 5ANIA 5EOLA 3HAMA 5IZFA 1OMWA 3N9XA 3P7BA 2YZNA 3H9RA 4BI0A 5A46A 3RTPA 2BZJA 4I24A 4ZTMA 4XYMB 2PMLX 2HENA 4MKCA 2GPHA 4BDKA 1KWPA 3WO0A 3EFWA 4D28A 1JBPE 2PMIA 3G9LX 3V4ZA 2B4SB 2R5TA 3OW3A 4I5HA 4LL0A 4W4XA 3BHHA 4YC8A 1PF8A 1MQ4A 4LM5A 4PWNA 3O8UA 4QMUA 2V59A 5LOVF 1K2PA 3C7QA 4F6WA 2XUUA 3Q4TA 4FL2A 2VTTA 4FG7A 3FMHA 2J9MA 4TKSA 3GC0A 4FT5A 5CSHA 2W9ZB 5FGKA 1ZRZA 4YSJA 3HV4A 2PL0A 1KSWA 3HRBA 2XKFA 3EN9A 3EZVA 4RVKA 2A27A 5LQFA 3RI1A 3VUMA 3MPAA 3SOCA 4L6QA 2CCHA 3LXKA 5JQWA 3MH2A 4RA4A 4EOLA 2O3PA 2XVDA 2VX0A 3NCZA 2ZDQA 4RJ7A 4MV7A 2ZVAA 3UG1A 4MAOA 4DCAA 4EOOA 3VS6A 5IH4A 5LXTF 1G5SA 1V0OA 3OUUA 3NW6A 3CJGA 4C0TA 4HNVA 3DNDA 4LOOA 3PJ8A 3K3JA 2W1DA 1CQJB 3QWKA 4FSNA 4D0XA 4EWQA 4O4JF 5KO1A 3HMNA 3VW6A 3SKCA 1E9HA 4FE2A 5BMVF 3ORLA 3QL8A 4ORKA 4V01A 1GSHA 5EHLA 3MY0A 3V8TA 2WYOA 3TDWA 4EOPA 2R4BA 3QRUA 4X21A 3KKVA 4IBMA 5IQBA 5DRDA 3AT4A 2WMRA 1DAWA 2VN9A 2V7AA 5I9XA 3TG1A 4WD5A 2VTOA 3KMUA 3OCBA 3UQCA 4BTMA 5LMKC 3U55A 2W1EA 3DAEA 3DZOA 3LFCA 4JG7A 2OFUA 4YJSA 5BVEA 3UTOA 4DGMA 4MNFA 4QP1A 4EI4A 3MN3A 4YZBA 4QMNA 4WG4A 3RVGA 3FLZA 3PPZA 5AFVA 4D5HA 5DR6A 3U4UA 4ANQA 5J7HA 3UBDA 2XJ1A 2X0GA 3IW4A 4V0GB 3ZEPA 2WEIA 5JH6A 4ANSA 4FSMA 2P4IA 4LMNA 3DFCB 4UALA 4FIEA 4YJQA 5C9CA 4IZ7A 4G16A 2CKOA 3AC4A 4H3PA 4N6ZA 4QMXA 4DGGA 4DTAA 4FKUA 3LVPA 4IVCA 4MXZA 3W8QA 3ZUUA 2BCJA 5IUIA 3HV6A 3QGWA 3DKFA 3F7ZA 4NTSA 5CSPA 3I6WA 2W1ZA 4K1BA 4LFIA 4D4VA 3CS9A 1Y57A 5IQGA 5A4QA 4XYFA 3D2KA 3VHKA 1HCLA 2HIWA 4NKAA 2YJSA 3UIMA 2YZMA 4C4HA 3RV3A 4WNOA 1OVEA 3G5DA 4MV3A 5HIEA 4TV9F 1JPAA 3HRCA 4AU8A 2CLXA 3FI4A 5J9YA 4FIJA 5HO7A 5C1PA 5BPYA 2CMWA 5EDRA 3K2LA 4QYEA 2OH0E 5EZYF 2BRNA 5BVKA 1OPLA 4FR4A 4L7FA 4E73A 4JQ8A 4FTQA 4X3FC 3W18A 5CT0A 5IUHA 3F2RA 1DM2A 3OCGA 4KBAA 3UYSA 4GVAA 5BVDA 3ZFMA 2QD9A 3UC4A 3KCFA 4NT4A 3OS3A 4YAKB 4EYMA 2V62A 4NJDA 2VTNA 3OTUA 3F5GA 1J7IA 3VQHA 1KV2A 1SVHA 2C5VA 4PL3A 4S30A 5DI1A 5JEBA 3KALA 3PUPA 1LR4A 3TEIA 4FYOA 2OF4A 3IPHA 2W6OA 4F4PA 4BCOA 4FVQA 3V3VA 2XCHA 5JKGA 4HVSA 2PUUA 1JSUA 1YKRA 2R3RA 2ZM3A 3W32A 3CGFA 5CT7A 2NPQA 4J52A 3Q2MA 5DOSA 5LCKA 4U42A 1APME 4L44A 3KU2A 2QR8A 4JDHA 4NW6A 1FVVA 3ZDUA 4FTUA 3ZFYA 4OGRA 2RL5A 4K0YA 2JKOA 2YCFA 4R78A 4RLKA 2V0DA 2YA9A 3LQ8A 3E3BX 3F2AA 4IC7A 5IEYA 3FI3A 4KBKA 4CKRA 1SYKA 4J1RA 2WOTA 1JSTA 3MFSA 4LUEA 3TV7A 5DHJA 2WAJA 4B0GA 2WD1A 3PP1A 4IADA 4WKQA 5FD2A 4BDCA 5CB4F 4NTTA 4D0WA 3OHTA 3CTHA 1V1KA 4GIHA 3P7CA 2EWAA 2HXLA 2QVSE 2XNEA 3DV3A 3KVXA 3QZGA 5HHWA 5HCXA 3IQ7A 3ZBFA 4HZSA 5E1SA 4MV9A 2PZIA 2F2CB 3E87A 3OG7A 4FSZA 1M2PA 1OKYA 3QCXA 3QBNA 3VW8A 4NWMA 4CZUA 1FQ1B 1CTPE 1KOBA 4EH4A 4O4LF 3TTJA 2C5XA 2P0AA 1M17A 3F3WA 2FH9A 3E3PA 3ORRA 3D7TB 3LQ5A 2ERZE 3PXFA 3VS2A 5CAQA 2ETRA 4MA0A 2PVMA 5EDQA 2NO3A 4ZS4A 4I55F 4NM3A 2XIKA 3R63A 5CQUA 3D5VA 3NGAA 4BIDA 4YHJA 5KNJA 1ZZ2A 4WBBB 4IWDA 1G3NA 1AUXA 4UWBA 5FXQA 3WZDA 2I80A 2FPIB 3MWEA 4J97A 1XH5A 3H4JA 3UVQA 3HV7A 1PHKA 4QTCA 4P2KA 4XV3A 1ZYJA 3QUDA 1ZOGA 2J0KA 2SCUB 3Q60A 4G9RA 4Q9SA 4UWCA 3RPOA 2V5QA 4YTHA 5BUIA 4J99A 3UNKA 2PZPA 3QQFA 4KINA 4K18A 3ZXZA 2C69A 2Y6MA 4KWPA 3SOAA 4C4EA 3U9TA 2WMUA 3ZLXA 3ALOA 2F7XE 4FGRA
chains in the Genus database with same CATH superfamily
4PTGA 1YVJA 3P79A 3SW7A 5D1PA 3RFCA 5AP2A 3FMLA 5FDPA 2EJ0A 3VRZA 4FEXA 4FEUA 3KL8A 4RX5A 4IX6A 1C30A 3WZUA 2HG8A 2WELA 4TN6A 4FIFA 5M07A 3F5UA 4C4GA 1Q3WA 4XX0B 2XRUA 2GS6A 4O7SA 5LWMA 1H1SA 4E6DA 3BU5A 2PY3A 4GRBA 4JDKA 4JR3A 2ZYBA 3PVUA 5KKNB 3W55A 2A19B 1H25A 4RBLA 3W2QA 1WBOA 4QTEA 1OI9A 1OIRA 2GTMA 4QSHA 5FUTA 3ORZA 5CAPA 3BE9A 3HRFA 2YCSA 4EH9A 5CAVA 3HV5A 2UZDA 5FBNC 3EN7A 4JXFA 3UP2A 4YGAA 3FMNA 4RWJA 4IC8A 4R1YA 3ZH8A 2OXXA 2VWIA 2Z8CA 4YMJA 5CALA 4DEAA 3PSCA 2ZJWA 3CBLA 3L9MA 3ZUTA 4C3PA 4AW2A 2IP4A 1WAKA 5FPRA 4EHGA 4AW1A 3UDTA 5M44A 4AN2A 2Q2TA 4WSYA 5HGIA 3TM0A 1KJJA 4FVRA 1P5EA 3IO7A 3VOTA 1URCA 4ANMA 4N70A 3R30A 3DQXA 2QR7A 3Q2JA 4FKGA 3MVLA 1Q8YA 4PMPA 2PVFA 4MXCA 2G2HA 3BHYA 2CCIA 5E8TA 4FV3A 5HD7A 3DKOA 3NDMA 4DC2A 4IZ5A 2XALA 4EH3A 4Y85A 4BCFA 1OL2A 3KC3A 5E92A 4F99A 3DT1A 4RIWB 1J91A 2ESMA 2QHMA 3TKHA 3LLAA 1K3AA 3MPMA 2XNGA 2HOGA 4U79A 4U40A 3EQCA 1ET0A 3KXNA 4IFCA 3O8TA 2BRHA 3CD8A 4LOPA 2PUNA 3SX9A 1BXRA 3ZTXA 3NS9A 5M53A 4U81A 3UPZA 3GJXB 1AGWA 3CQUA 4O0UA 4FKJA 4EONA 2W5HA 5L8KA 3OXTA 1W93A 4WHXA 2YJRA 4O0TA 4M97A 5AUVA 3NNUA 4KD1A 5CA1F 2XK7A 4HJOA 3EQPA 5CEMA 3ATSA 4EBVA 1M0WA 4O2AF 4G31A 1VEBA 3EQGA 3R7VA 4FU0A 4OR5A 4O0XA 2AYPA 5CTPA 2NRYA 3VIDA 4MV1A 4XS2A 4N6YA 4FK6A 1RJBA 4QTBA 2B9JA 3QZIA 4ENXA 2OJJA 1PXIA 4L3JA 5A3XA 4ITIA 2VTHA 3UMWA 3BZ3A 3VS1A 3QU0A 2F49A 4U41A 2V22A 1YOMA 4EZ7A 5CSXA 2OO8X 3QTIA 3NW5A 3ZYAA 2V55A 4IE9A 3BQCA 3IG7A 4C02A 2ZAZA 2R7KA 5DA3A 2GNFA 2BIKB 4TRLA 4U43A 2OIDA 2W99B 1URWA 3ETAA 2QOIA 3A62A 4D2SA 2VWWA 1E4EA 4H58A 1OUYA 5LWNA 3DFAA 3UQ8A 3C9WA 4D2RA 4OT5A 3DY7A 4G5PA 4AFJA 3AXWA 1ZY4A 4EHZA 3FLWA 4BHZA 3QALE 4O4IF 3HDNA 3MIAA 4AX8A 3RJCA 2UZOA 3L9NA 5I9WA 1J7UA 5HORA 4E4NA 4EH6A 4EKLA 1Y8GA 2GHMA 4IIRA 3HMPA 2H96A 2PK9A 2QOOA 3NYNA 3RCDA 4IVDA 1ZYDA 5I9VA 1Z2PX 3QD2B 3G6HA 3MJ1A 3PN1A 4TXCA 4FV8A 5FTGA 3MI9A 5CZHA 4PQNA 4QP3A 4RFZA 2QLQA 2ZB0A 5CF8A 2R7LA 3MDYA 4YUQA 3KF4A 1SCUB 5EM7A 4NW5A 3I0OA 1H1PA 4DH7A 4KNBA 2F7ZE 5EHYA 5HG9A 3QTZA 2XIRA 4O38A 4QMMA 2H9VA 2UZTA 2ZV8A 4HNIA 3C50A 3R5HA 3WF8A 4IWXA 4PBCA 3BYUA 3KRRA 4R5YA 4BJJA 4DG0E 3JYAA 3W33A 2R86A 3DS6A 4LV7A 4RVLA 5GNKA 4JBOA 2YHVA 4ZJJA 3AD6A 2VGOA 1JWHA 3E7VA 3TL8A 4EHVA 1Q8ZA 3QD4A 4UCUA 3HNGA 2E9NA 4PMMA 4GSBA 3HVCA 3W0MA 2HAKA 3EFLA 3UZBA 5EG3A 3W1GA 3WNZA 3EZRA 2AC3A 3DBDA 4DHIB 1GSOA 2OJFE 5H9BA 4EK5A 3HA6A 2QG7A 2G15A 2GLTA 1NVSA 2FSLX 1EH4A 5M51A 4EGQA 2Q83A 3FZ1A 3G90X 4BTFA 5AJQA 3V5TA 2R3JA 2NNWB 2JC6A 1YXXA 2OI4X 2QOCA 4HYHA 2HCKA 3GC8A 2BDFA 3KMWA 4GFGA 1OB3A 3FV8A 2X7GA 3GFWA 4L42A 2OZAA 4LI5A 3SDJA 3F7WA 5KBQA 4DGLC 3TNWA 4YLKA 3T3VA 4EOIA 1NXKA 2OLSA 5CF6A 2SRCA 3AGLA 1OIYA 5IDPA 3ZRLA 2X6DA 2WQNA 3FSFA 4MV6A 4EUTA 3R1QA 4CE5A 2OW3A 4BCKA 4CD0A 3TY8A 3DXQA 3FMMA 3MB6A 4AZSA 5BPHA 3FQHA 1ERKA 4DFYA 4FFLA 3KMMA 3FY2A 5CNOA 1W84A 4QYGA 1QPJA 2C30A 2P33A 3DDPA 4LRJA 4RCNA 1OPJA 3OCTA 5EOBA 2QODA 3PA4A 1UU9A 3NR9A 2WMWA 4FFNA 3H0ZA 3I81A 5HIDA 4AA5A 4CKJA 1ZAUA 1OKZA 2Q7DA 1U5RA 3WZEA 4D5KA 1FOTA 4DBNA 3E8DA 3A2CA 3F61A 2YM8A 1BX6A 3PZEA 5ANKA 1JLUE 4O7WA 4PDYA 3A61A 3AMAA 3L9PA 1XQZA 4NK9A 5EW9A 2PVPA 3A99A 2X7FA 3PVBA 1WVXA 2C6OA 4IB3A 3OEFX 3SXSA 2FPGB 5D11A 5HCYA 3IECA 4LQMA 2P55A 2ITXA 4O86A 1DV1A 4CFMA 3DTWA 3S95A 3P7AA 5FDXA 3UZOA 5E25A 2OJGA 3G0FA 2R3NA 3EKKA 3MB7A 4I41A 5HKMA 2R84A 4JAJA 4CFVA 4PMSA 4M13A 4GS6A 2NUAB 3V4SA 3VS7A 3LFQA 4JRVA 4RWIA 2R85A 2XAOA 4BDEA 4X7QA 4DDGA 5KS8A 4JI9A 2XM9A 4RRVA 5CS6A 3C4EA 4FEWA 4CV9A 4J71A 5HU3A 5KHWA 1DV2A 4RJ4A 2CGXA 3B2TA 2W71A 4D1SA 3FMKA 5CE8A 5BWXA 1H00A 1IOWA 3QRTA 4NCTA 4I5CA 3VONA 4AA4A 1XHAA 3CXWA 2X8DA 2W6NA 2YS7A 1R0PA 1YI4A 3E63A 3MVHA 3ZZEA 4WIHA 3DA6A 2UVXA 4IJ9A 4ZSAA 3GC7A 3TV4A 4FODA 4JIAA 4BR3A 5FEDA 3ZLSA 4BCGA 3JRXA 5D10A 3DBCA 3NIZA 3GIDA 2YFXA 5LJJA 3RV4A 1JKKA 3LQ3A 3BHVA 3UZPA 1UV5A 4XBUA 4DT8A 2QC6A 1I09A 3R83A 4WOVA 2HGSA 3L1SA 1M7NA 1PKGA 1ZYCA 5AIKA 3GC9A 4EZ3A 1ZLTA 4GT4A 3IGGA 4O91A 2O64A 3GNIB 4IEBA 4B9DA 4BRXA 3IW6A 3PJ1A 4LRMA 3QTSA 4G5JA 3DZQA 4CC5A 5EYDA 3UE4A 3NUPA 3R00A 3QHRA 4E93A 2WB8A 3FYJX 4QPSA 4ZP5A 5E91A 3W2PA 5KMJA 4YP8A 4FFRA 1GIIA 4AXCA 1XH6A 4H05A 3R8PA 4BCPA 5IA1A 2BDWA 3SLSA 5CI6A 2AUHA 5KX8A 4DAAA 1H8FA 3D94A 2XNMA 1B39A 2XEZA 4XZ3B 1KE6A 4GK3A 4GMYA 3LFBA 2QURA 5AV1A 5CEIA 4ZTHA 5DGHA 4DLIA 3VA7A 3DPKA 3SQQA 4DRFA 1W0XC 1QPCA 2J2IB 4DBXA 4K8AA 2Q0NA 2XIYA 3AOXA 4JQ7A 4QP7A 4TZRA 4Y83A 3DTCA 4MX9A 4C34A 4FTKA 3E7OA 5L6WL 2JD5A 4A9YA 4GLWA 3VS3A 3UYYA 3WYYA 1I2KA 4JNWA 3CTJA 1W82A 3QFFA 1GIJA 3UZRA 3IDBA 4I22A 4ACMA 5FP6A 5GJFA 3O5AA 1HOWA 5EYKA 3VBXA 4DE4A 4G6NA 2X9EA 4C5BA 3NNWA 3KAKA 3IDCA 1CKPA 2R9SA 1SZMA 4EQ5A 4G1WA 3CKWA 3HGKA 2WMVA 2PU8A 3FXWA 5CAUA 3I5ZA 4AS0A 3GB8B 2LAVA 3R2YA 4EQUA 3SVVA 4RWKA 1CKNB 2BAQA 3H9OA 4XG7A 1R1WA 2WTWA 3OOMA 5IA4A 4EEQA 4BB4A 4PTCA 4CG9A 5BV3A 4ZMFA 5J1VA 4OUCA 2B55A 4ASDA 5AA8A 3POOA 4BDJA 3KIOC 3EL7A 1U4DA 4GJ3A 3FZRA 2NU7B 3U9SA 4YPSA 2HJWA 2QOFA 3QFVA 5BVNA 4GT3A 5AX9A 3UO6A 1KJ8A 3QD3A 3RNIA 3QCSA 4FJVA 5LMKA 3BU6A 3QYWA 4EORA 4HNUA 2XYUA 3BCEA 4HCTA 5LOHA 4DEBA 3NUXA 2PN1A 3BU3A 2Z7QA 3IS5A 3PA5A 5D9HA 3IKAA 3W10A 1Q24A 4L8MA 2W6PA 4WRGA 5EI2A 5LVMA 4AT5A 3DTFA 2HWOA 4FSUA 3TT0A 2XAMA 4IANA 4E20A 2W1CA 4QP8A 3BPRA 4O82A 3HUBA 2HZIA 2R3GA 4I6HA 2OJ9A 2B54A 5E8YA 2QNJA 5JVLA 1SNXA 4U0IA 4PX6A 4HVGA 5E90A 4I6QA 3E64A 3PXKA 3Q53A 4IAAA 4RWLA 2BTSA 2DS1A 2R3OA 3KRWA 3GFEA 3NNXA 1A3GA 2VWUA 3C0HA 3KRXA 3WIKA 4CNHA 1JKJB 1WFCA 2VTAA 3BLQA 1CM8A 5HVKA 1VR2A 2O8YA 2VTQA 4BGQA 2VAGA 4P90A 4HNTA 1BL7A 4I94A 3KULB 3F3VA 3N51A 4I23A 5L8JA 4BTKA 1KBLA 2GS2A 2W17A 2YERA 4FKOA 5D41A 4F1MA 3FMEA 4DEDA 2C6LA 3RAHA 3QXPA 3SD0A 1P16A 2R7IA 3BEAA 4GW8A 3VMMA 3EYGA 5EDPA 2IW9A 5GINE 3OWPA 4BTJA 5AEPA 1OL6A 1A9XA 5J8IA 3UIBA 1QPDA 3P78A 4HW7A 3TN8A 4CSVA 4U3YA 2EUFB 4EOSA 5DT4A 3BGQA 4MNEA 2E9PA 3CY3A 4EQCA 2R64A 1GZOA 3NUYA 5TR6A 4CZTA 4FUYA 4JJRA 2BZHB 2PVYA 1XO2B 3SHEA 5KE0A 5T3QA 4ZMEA 1Q4LA 1W8CA 4KA3A 2E9UA 2VTMA 4E1ZA 4QP9A 1YHWA 5AV2A 1Y6BA 2OLCA 3UDBA 4L45A 2JGZA 5JQ8A 2BIYA 4FFMA 1R3CA 1KJIA 1GZ8A 3O17A 3NYVA 4RIYA 4X3FB 2R87A 3D15A 2R7BA 5M57A 3O0GA 3MVMA 1VYWA 2ZDTA 3QD0A 5FTOA 5F9EA 4WG3A 5I5WA 2J0IA 3COKA 5IQIA 3F82A 4M8TA 2XA4A 4OTDA 1GGOA 5C26A 4CT2A 4ALWA 2ZDGA 2DLNA 1XWSA 2OFVA 2R2PA 2HY81 5ICPA 4FT7A 2JIIA 4CMTA 4YJ3F 5KUPA 2UVZA 3W2SA 2I7QA 4TPTA 3Q9XA 5CYIA 3PG1A 4JIKA 3OY1A 2HGWA 3R7EA 1B38A 2X9FA 2OK1A 3Q4UA 1BMKA 2W05A 3CGOA 3MH0A 1H28A 4U45A 4WA9A 5CU2A 1QL6A 4RC3A 5DG5A 3KY2A 3R9OA 4NZOA 3DK3A 4F1OA 4G3FA 4Y72A 4QMSA 4NSTA 3JPVA 4C61A 5DBXA 3R8VA 4YJPA 3LFEA 4OT6A 2PVNA 1GLVA 4G3EA 1KE7A 1ND4A 1PJKA 2QLUA 2QU5A 4YC6A 5JZNA 3TNQB 4XG9A 2JAVA 4UZHA 1OL1A 3TV6A 2QO7A 3GI3A 4EYJA 4XG6A 4XP3A 3VJNA 3UDZA 1BYGA 2KTYA 4QDVA 4FZAB 1ZOHA 4A06A 3W0SA 5L2IA 4JBPA 3BBWA 4DEHA 5BNJA 3EHAA 2DIKA 4JG8A 5KZ0A 2X2KA 1UU7A 2ZB1A 2HK5A 4L3PA 4YR8A 4EUUA 3UNJA 4YTIA 3Q6UA 2QO9A 2C5OA 2XS0A 3FQSA 4GVJA 5KKRC 3T8OA 5D7VA 1Q97A 4YZCA 2ITNA 2JIUA 1G8SA 4PY1A 3WILA 4A9TA 3MYGA 3ZS5A 4GUEA 4BZDA 4CV8A 3DLSA 5AAEA 3VPCA 3V5LA 3ZZWA 3R2BA 3NLBA 1UC9A 4GLXA 2C6IA 3DB8A 3W2CA 4F7JA 1OL7A 3Q9WA 4DFZE 3AD5A 5M4FA 4I4TF 1K9AA 3U4WA 3L9LA 3ORXA 3SG8A 1LEZA 5LVLA 4M3QA 2GTNA 3QA0A 3QTQA 1LP4A 4TYGA 4CFFA 4I93A 1H1RA 4UXLA 5GIPE 1P14A 4MV8A 2PYWA 4P7EA 4YJUA 3ET7A 1WVWA 4B8MA 4EG0A 2NRUA 4FTNA 4QEBA 4EL9A 5DWRA 4BVUA 3O2MA 3QLGA 2OXYA 3ZM4A 5DPVA 5HBRB 3ENMA 3E88A 3C13A 5CQWA 4CRLA 3GCPA 1JLLB 3FPMA 4IAFA 4UCOA 4O22A 3POZA 3FY0A 5JRSA 2JDTA 4G17A 3OEZA 5A4LA 1BUHA 4D4YA 2JKMA 4M7IA 2Y4RA 1KC7A 5F95A 3FZSA 3VUGA 3ML1A 3RTXA 3C5UA 2H6DA 4PDPA 3WO1A 2JITA 3W2RA 5ITAA 2XYNA 2WMQA 3FL5A 2A4LA 1I1LA 3LXLA 3NPCA 1T46A 2X0SA 2BHHA 4HR7A 4BGGA 4DFNA 4A07A 2XNBA 1I44A 2GQRA 2UV2A 2BFYA 2A1HA 3MPTA 4HCVA 3OUZA 4EFEA 3LIJA 4DEIA 3E93A 2IVSA 3I79A 5AUWA 1OL5A 4E7WA 5JQ5A 2XKCA 2XZSA 3PPKA 3U8WA 1CKIA 2HVQA 1UVRA 5H2UA 3L8SA 5E8WA 4BHNA 4HPTE 4F7LA 1ZOEA 5LVNA 2DYLA 3EN6A 3TZ7A 4FV6A 2UW6A 4I4FA 2Y4IB 1FINA 2VWVA 1WBPA 4MQ1A 5EQEA 1DGSA 5KMMA 4RZQA 4TVIA 2PWLA 5LMAA 3K54A 2P2HA 3FI8A 2GFSA 5FLFA 2OF2A 2QI8A 4OTIA 5I5ZA 1JQHA 4TUYF 4GYGA 4IM0A 4A4OA 4QMYA 2UUEA 3RAKA 3CQEA 3FDNA 3VULA 4DH3A 4FSWA 3AMYA 4NL0A 5M4IA 4MA5A 1W7HA 5HG8A 5JGAA 4ITJA 3W8LA 3SW4A 3BQRA 4UBAA 2YYAA 4F9BA 2BZIB 4USFA 3QC4A 3VUDA 3LJ1A 3HEGA 3NBZB 1Z9XA 2BUJA 4Q5HA 5FTQA 2R3FA 3FHIA 2C6MA 4L67A 1UKHA 1M2RA 3E8NA 3QF9A 3PIYA 5M08A 5DR2A 4IIJF 5HQ0A 4ZHQF 4AT4A 3EYHA 4XRLA 4M15A 5F94A 2BAJA 2CKPA 5D8DA 4RT7A 4QMPA 3PVWA 4TYIA 4XEYA 3NCGA 4RFYA 3ORTA 2ITZA 2PUIA 4XNEA 4G34A 2C5NA 4G2FA 1FGIA 2P0CA 4E26A 4RC4A 5LA6F 5I4NA 4FEQA 4XUFA 1ST4A 3F88A 4DG3E 2UW8A 3SC1A 3QAME 3MA3A 1Q61A 3NVMB 4YBJA 4BZOA 5KBRA 1SMHA 4DINA 4FNWA 4CKCA 1A06A 3GB2A 2WO6A 3IW8A 4PP7A 3U6JA 3ORQA 2W4KA 3ATTA 3A4OX 3Q52A 3QTRA 4BCQA 3CEBA 2ONLC 2WXVA 2CGUA 1NY3A 3MFTA 2ITWA 3UOLA 2UZWE 1OECA 2E9VA 4GFMA 1XMMA 4AXDA 1YI6A 4E6AA 4DFUA 5IMXA 4ZAUA 1RQQA 5HX8A 2WMAA 4N57A 3W1FA 3PXZA 5K2MA 2OZOA 3NUNA 4NH1A 4EHEA 3JZFA 4G9CA 4W4VA 5AP1A 4TY1A 5AP6A 4O7VA 4XH6A 3LMGA 4CTBA 4I0TA 4C3FA 4IWOA 2W4JA 4NKSA 1YQJA 1V9PA 2OKRA 5CU6A 4DH5A 2GNIA 3Q04A 4RZWA 3R9DA 5IA5A 2CFMA 2XK3A 4ITHA 4O83A 4GV1A 4DAWA 3BEGA 2YM4A 4DITA 3E8CA 3MFUA 4FKIA 3QQLA 4NFNA 4F64A 3MH3A 1ZMUA 5E9EA 2W9FB 2YIQA 2ZMDA 3EMGA 4IZYA 1Z57A 1UKIA 2GNLA 2XKDA 4KS7A 3HUCA 5DH3A 4ZK5A 3VVHA 3WIGA 2BRBA 5KMNA 3TUBA 4K77A 3BYVA 4IMYA 5B2MA 4FIGA 5AIRA 1I1MA 4Y5QA 2J51A 3U54A 2QB5A 5CXZA 3EKNA 1JKLA 4OTQA 4EC8A 4ZEGA 1MQBA 4R3RA 5AUYA 2A0CX 1REKA 2C1BA 3T9FA 5T6KA 3ROYA 5ANOA 4EH5A 4IAYA 4Z7GA 5CVFA 3GEQA 2R3HA 5LYJF 2Z7LA 5J9ZA 4C4IA 5CX9A 4IZOA 2W1GA 4ZLYA 1PXLA 4EWHA 4YJTA 3VBVA 5BYBA 3QRKA 1EKFA 4CXAA 3UOKA 1M0TA 4ZTNA 3T9BA 4EK3A 2O2UA 2J0MB 4YURA 4WO5A 5AP7A 4CVAA 3VNTA 5IH5A 2ABJA 4C5AA 4PZ7A 3H30A 1H1WA 3GU8A 4G6LA 2WTCA 3ODYX 4P5ZA 4U97A 5BYZA 1Q41A 4JDJA 4L7SA 5EM5A 4DT9A 4QMQA 3NRMA 2F9GA 3HYHA 1LEWA 4ZY5A 3AW8A 4ASEA 5ANGA 5E8UA 4EOMA 4I50F 1FMOE 3FKLA 3P5JC 2EB2A 3H3CA 4LUDA 3G0EA 3I1AA 4FC0A 5G6VA 3W0NA 4DHJA 2ZV7A 2O0UA 3NEWA 3KXZA 3ZO2A 1OBGA 4RMZA 2XD4A 3Q4CA 3SXFA 4X6QC 5C8NA 3KYHC 1E1XA 4X0MA 2X1NA 3DTGA 5TT7A 2FP4B 5IA2A 2GDOA 4TYJA 5GJDA 3A8WA 1LUFA 3ACKA 3C4WA 4O7NA 2I0EA 5H8GA 4ARKA 2HHFA 5H80A 3I12A 2XK8A 4DG2E 4BN1A 1I7LA 3EL8A 5L2TA 4CMDA 3GCQA 3MW1A 3MY5A 1XR1A 3SG9A 2NU8B 4GK4A 3ANRA 3RCJA 3EB0A 2HDKA 2G2FA 3O71A 5E4HA 3VBQA 5L6PA 3ORPA 2GHLA 1H26A 4O0RA 3AG9A 3AT3A 4FZFB 4FZ6A 2B1PA 4JS8A 4A4XA 3NVKI 3R8UA 3EFKA 1Q99A 2IO6A 3GOPA 4PV0A 3MVJA 5HNEA 3MA6A 4M0ZA 4FV4A 5EH0A 4CGAA 5DRBA 5CF4A 1EUDB 5BYYA 3LFNA 3R7UA 2YIXA 3AC5A 3V6RA 1WCCA 1G8KA 1GZNA 4JVGA 4MD7E 2RIOA 5B2LA 4IAKA 5DISC 1SVEA 5BUEA 5GHVA 2NYAA 3ZDIA 4E6CA 4UB7A 5BMSA 1M6VA 5CVGA 5C4LA 3LCDA 4JDIA 3CCNA 4M0JA 3II5A 5HIBA 2BVAA 3ROCA 1M52A 4QQCA 5AM7A 4YHTA 1B04A 4CKIA 1WR2A 2QHNA 4JX3A 4O81A 3FJQE 4I5PA 1EZ1A 1AUVA 1XH9A 2VGPA 1YHVA 3IGOA 2GU8A 1U54A 2J6MA 3UODA 4FFOA 3QTUA 1NW1A 2UZLA 1Z2NX 2J7TA 3GOKA 4MK0A 4S2ZA 2W70A 4CHIA 5M09A 2VQDA 3QA8A 4ZJVA 2HYYA 4MD8E 2UZEA 5I9YA 5IF1A 3FI2A 4BYJA 4WUNA 4C4JA 4ME6A 1I7NA 4L1KA 4XYLB 3UO5A 2QOLA 1A48A 2BTRA 2JAMA 3OCSA 4D4RA 4MBLA 3SRVA 3VJOA 4OBQA 5ACBC 1WMKA 4RIXA 3T99A 4S34A 3A7IA 5IQCA 3P0MA 2GPSA 5EI6A 2QU6A 3FWQA 4C33A 2O63A 3CJFA 3GGFA 5HX6A 1U54B 1P2AA 2XNPA 3EQRA 4TNDA 3D5UA 4I0SA 2J5FA 1E1VA 1ZXEA 3KN5A 3SGCA 4QP6A 4AN3A 3DAJA 5B0XA 5C8MA 3V5WA 1XK5A 1KEEA 4FX3A 3EN5A 4TWCA 4ZJIA 4F7NA 3TNHA 5A4CA 5I60A 2CN5A 5HCZA 1OIQA 3JVRA 3M1SA 1WBTA 1ZZLA 4QNAA 4TT7A 2P2IA 3R28A 4Y46A 3BWFA 2ZM1A 2YAKA 3QCQA 1CMKE 4KUJA 1F5QA 2BFXA 3VQUA 4RJ5A 3PDTA 5TO8A 1CE8A 2Y9QA 4FOCA 2B9IA 1OBDA 1XBAA 4H3BA 5CI7A 3ZBXA 2YZGA 2PE2A 2KULA 4MXYA 2JKQA 3LQSA 3VRYA 3R5FA 4CTCA 1KJ9A 1L8TA 2CLQA 4JAIA 4FL1A 4S32A 3ETJA 2BRGA 2OJIA 1SVGA 3GXLA 4KB8A 4LL5A 2YL2A 3NC0B 3QKKA 3W5OA 4FSQA 5IA0A 3O7LB 4Q5EA 4FV5A 3I60A 3DF7A 4NFMA 2RFNA 4XG8A 3T9IA 2ITQA 4EH7A 4BIEA 4O0SA 3HA8A 3GQIA 1TAEA 1PMNA 4D1XA 4WHZA 4X2FA 3AGMA 4LRKA 2PPQA 3PY1A 3QQHA 2C47A 3C4FA 3L8PA 3K3IA 3NAXA 3DK7A 3ODZX 4NJ3A 4ACHA 4CT1A 5HV6A 4EJ7A 4O6LA 4QRCA 4BJJB 3TZ8A 3D5WA 2QO2A 4I6BA 5BMMA 2PULA 4IM3A 1WZYA 4ALVA 3BIZA 4DGOA 1JDEA 5HBHA 2GMXA 4ERKA 2Y7JA 2CJMA 3NFFB 5CF5A 5IUGA 2X8IA 4MH7A 1PXNA 4IQ6A 3QUPA 1H08A 1NVRA 2I0VA 3Q96A 2F4JA 2GQGA 4MF1A 4E5WA 4FL3A