1OBPA

Odorant-binding protein from bovine nasal mucosa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
b'QEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTGLFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ODORANT-BINDING PROTEIN
publication title Domain swapping creates a third putative combining site in bovine odorant binding protein dimer
pubmed doi rcsb
molecule tags Odorant-binding protein
total genus 33
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1obpA00
3I17A 4QGWA 1PMPA 2L67A 3FEPA 1G7NA 1U0XA 1LFOA 1JBHA 1IW2A 2HZQA 4YGGA 2KT4B 2L5PA 2NNEA 3JS1A 2AKQA 4NYRA 4TJZA 1FELA 2R73A 4Y0QA 2NNQA 1BSOA 3BDRA 3NADA 2CM4A 1EXSA 1X8PA 4TKBA 3FA6A 3SAOA 1HMTA 2ALLX 1CJ5A 4EEJA 4QGVA 2JU8A 3P6CA 3TGAA 4OMWA 4XMFA 3FEKA 4ZGUA 1ML7A 3FELA 2OVEA 1FE3A 1SXXA 2LBAA 4Y0SA 3FW4A 1BM5A 3NX1A 1X89A 4QZTA 3WXQA 1YWCA 5F6ZA 4ZCBA 5D8JA 3B2KA 1MVGA 1ZNKA 3U03A 3BX8A 1G74A 4YFPA 2Q9SA 1LIEA 4AZRA 3C77X 1ACDA 1S7DA 3FA9A 3FR5A 2CBSA 1HN2A 4IB8A 1OEEA 4ZH6A 5IO5A 1CBSA 1ALBA 2Q4NA 2WEWA 5H9NA 2NP1A 5DG4A 4XMDA 4GKCA 2W2AA 1SXUA 1JYJA 1QG5A 3FR4A 5EDCA 2LBVA 1FEMA 3QKGA 3VG7A 2MO5A 5IO6A 3IA8A 3STNA 1GKAB 4GH7A 1CBQA 1B0OA 2NNDA 3B2LA 5L8OA 5LJHA 3WJGA 1GX8A 1SXYA 3JSQA 3BU9A 4YH0A 2LKKA 1U17A 1DZMA 2AT3X 3GAQA 4XMEA 1JJXA 1B4MA 1KZXA 4QYNA 1HBPA 3AKNA 3KFFA 4EXZA 5K06A 2CZTA 5D45A 1DZPA 2Q2MA 3FMZA 1SA8A 3AKMA 2JOZA 2G79A 3P6GA 5H9LA 4PSQA 2FS7A 2G7BA 1BJ7A 1I4UA 4TNNA 3KFHA 1CBIA 5CE4A 4ZHDA 1QABE 2F73A 1LKEA 2FTBA 1MX7A 1L6MA 5D4AA 5HCEC 1DF3A 1KGLA 1O1UA 4M7MA 4D6BA 1GX9A 2AT6X 2MM3A 1IKJA 2PY1A 2GC9A 2MJIA 4YFQA 2RCTA 1EW3A 1YWAA 2AL0X 3P6FA 4MVLA 2XSTA 5HTEA 2JU3A 1EIOA 1ERBA 4GNWA 1YWDA 3WVMA 1U18A 2FRSA 4OS3A 2X45A 1LPJA 2OZQA 1BWYA 4K19A 1OPBA 5EDBA 1I04A 4GE1A 2W2FA 1OPAA 1N0SA 1BBPA 1QFTA 3L4RA 5HA1A 1EALA 1A3YA 1QFVA 2ANSA 4ORWA 5LJGA 3UEXA 4IB6A 3I0AA 5EEEA 1X71A 4ORRA 4I3BA 1MUPA 1D3SA 3C78X 1X8NA 4HPDA 5LJKA 3CR6A 3UEUA 1ZNGA 3CQNA 1R0UA 1E06A 1BRQA 3VG5A 3TGCA 1HMSA 3OJYC 1ERXA 4YGZA 2AH7X 1ICMA 5LJBA 3FW5A 4ORSA 1ZNEA 1KQXA 1KT5A 5B27A 3WJEA 3EM0A 3VG3A 1HMRA 3PECA 1KQWA 2WWPA 3U0DA 4R0BA 4TKJA 1DZJA 3MBTA 4AZQA 5FFHA 1TOWA 2DM5A 1OBQA 4I3CA 3WJFA 2AMMX 2ACPX 1ZNLA 4OS8A 5KICA 1A18A 3HWEA 1UZ2X 2O62A 2A13A 3KFIA 4NNTA 2K23A 1NGLA 5DPQA 1OEKA 5AQ6A 4HPAA 3KZAA 1UREA 3BS2A 3PEDA 5C0NA 5HZ6A 5KIDA 3NX2A 2EU7X 2AT5X 3PPTA 3HWFA 2A3FX 4QGXA 1LF7A 3FR2A 4NP1A 4QAEA 3TGBA 2QO6A 4Y0RA 4A1HA 3WJDA 3APVA 1TXLA 1P6PA 5D48A 3STMX 3HWGA 1YWBA 3DTQA 3NR3A 4I3DA 3EMMA 4LZVA 4ZFXA 2HLVA 2WEXA 5HTDA 1ADLA 2X46A 1HBQA 1S2PA 1KT6A 4XMHA 1YIVA 5BVQA 3O2YA 1SXWA 1T8VA 1TOUA 2GTFX 4A1YA 2Q2PA 2QM9A 3U9PC 4BOEA 1KT3A 4HPBA 1ZRYA 1YUPA 3B2JA 3BU1A 2HNXA 2IFBA 1T68X 1VYFA 2AT8X 1FTPA 3KFGA 1IFCA 1JZUA 1YP6A 3WJBA 4HFOA 5HWZA 4UU2A 5F6BA 4D6AA 3ELXA 2R74A 3CMPA 4YDAA 2CBRA 2W2BA 2ASNX 4QYPA 3FA8A 3ELZA 4AW8A 1GM6A 2KTDA 4YMYA 2POAA 4IB7A 4NLIA 5D47A 1EUOA 1GGLA 1H91A 1I06A 3T1DA 3F9DA 1A57A 3D96A 4Y0PA 5KHPA 4WFVA 2OVDA 4IMNA 4ZHGA 4MVIA 4I9SA 5H9KA 3UEWA 4ALBA 1GKAA 3O19A 4TQ2A 3PP6A 4GETA 1BEBA 3BX7A 3APXA 3CQRA 1OBUA 3Q6LA 1BSQA 2A2GA 3HWDA 4BQUA 4I9RA 1KT4A 1BLRA 1VYGA 1X8QA 1QWDA 1ZNHA 3DSZA 3NQ9A 4HPCA 1DV9A 3FIQA 1ICNA 3P6DA 2XKLA 1KZWA 4NLJA 4WFUA 3RZYA 4IMOA 3NPOA 5F7GA 1EPAA 1E02A 1EQDA 4XMGA 1O8VA 5HZ8A 5HZQA 2QO4A 1TVQA 2RA6A 3BSZE 1VPRA 2FR2A 1XKIA 4EFGA 2G78A 2HYSA 3C76X 4IB9A 3PH6A 4IBAA 1LICA 5B29A 2HMBA 1GT5A 2LFOA 3F8AA 4DQ4A 1AB0A 5F1EA 1EIIA 3VG2A 2HZRA 1NP1A 2OFMX 4ODDA 1GT1A 4YGHA 1SY0A 2OFRX 1SY1A 5HZ9A 2JU7A 1LNMA 3B2HA 4ORXA 3APUA 3STKA 5EEDA 3ZQ3A 1SY3A 4NNSA 5FENA 1X8OA 5L8IA 1JJJA 3P6EA 4RUNA 1GXAA 3FA7A 4ARHA 5H9AA 1AQBA 3S26A 4RUUA 1JYDA 4YBPA 4ZHHA 4TLJA 1DFVA 4YCHA 3WBGA 1QQSA 3NQ3A 4YKMA 1FENA 3ZUIA 1AELA 3EBKA 4AZPA 3TZSA 2BLGA 2QO5A 3UEVA 4ZH9A 5IO7A 3CWKA 4UU3A 2GJ5A 1FDQA 1HQPA 3APWA 1PBOA 5HCCC 1LIFA 5BVTA 4A8ZA 4YDBA 4ZHFA 4A60A 2L68A 4MVKA 1QY1A 2R56A 5EPQA 2AT0X 1RLBE 1OEJA 2WSJA 4YKOA 5H8TA 3CBSA 3WJCA 1YP7A 4ZR2A 1IKEA 2Q39A 1Z24A 3O22A 1BSYA 4XMCA 3BY0A 1EPBA 3B2IA 1IFBA 1SY2A 4WBKA 1G5WA 5LKEA 2CZUA 1LIBA 1PEEA 4ORUA 3ZUOA 1MX8A 5F58A 2ACOA 3BLGA 2WQ9A 1T0VA 2FR3A 4GRJA 4LKTA 4NYQA 4LKPA 1GT3A 3CBCA 4QZUA 2K62A 4BVMA 5HAEA 2WR6A 1S44A 2E4JA 1X8UA 4ZHCA 5LJEA 4OMXA 3PH5A 4DQ3A 5LJDA 1D2UA 3D95A 1OBPA 2LB6A 2QOSC 1XCAA 1JV4A 3K3LA 1KOIA 2A0AA 1B56A 2WQAE 4TKHA 1A2DA 1TW4A 4YCEA 5HBSA 3TF6A 4M6SA 2WUTA 1E00A 4OS0A 1MDCA 4ALOA 2FT9A 1G85A 2JN3A 2N93A 3VG6A 1GT4A 4ES7A 4KIIA 4GNYA 4ZJ0A 4LZUA 2L9CA 1DC9A 5FAZA 3BRNA 3RSWA 4ORYA 5HCDC 3FLLA 5BVSA 3IFBA 4O9SA 3VG4A 1PM1X 3G7XA 5L8NA 5HA0A 1IIUA 1NP4A 3FENA 5EZ2A 4YFRA 4AZMA 3MVFA 5JR8A 5LKFA 1E5PA 3NP1A 2FS6A 2A2UA 1AVGI 3P6HA 1KXOA 1RBPA 1CRBA 1QY2A 3D97A 2RD7C 3KQ0A 2FWVA 4CK4A 2CM9A 3HK1A 2RQ0A 2OVAA 2YG2A 1KT7A 1ZNDA 3EBWA 4AYHA 4IAWA 4N7DA 1CBRA 2P8GA 2RCQA 4YBUA 4AZNA 1I05A 1QY0A 1DZKA 4AZOA 1BRPA 1O1VA 3EYCA 4N7CA 1B8EA 2FLJA 4IAXA 1LIDA 4EDEA 5LJCA 5HZ5A
chains in the Genus database with same CATH superfamily
3I17A 4QGWA 1PMPA 5F2BA 2L67A 2RTCB 3FEPA 1G7NA 1U0XA 1SREA 1LFOA 4GU8A 4C5PA 1JBHA 1IW2A 2HZQA 3RKGA 3SZHA 4YGGA 2KT4B 2L5PA 2NNEA 3AEHA 2BSZA 2AKQA 3JS1A 3NQKA 4NYRA 1I78A 4TJZA 1FELA 2IZLB 3VHIA 2R73A 4KC8A 2OY1O 3P02A 4Y0QA 2NNQA 1BSOA 1VWRB 3BDRA 2QMIA 4U9CA 3NADA 1RAVA 2CM4A 1EXSA 4GD9A 1JIWI 1X8PA 2A5CA 4TKBA 3RY2A 3FA6A 3SAOA 2C1SA 1HMTA 2RTNB 2ALLX 1W6FA 1CJ5A 1UYOX 1LDOA 2G8CO 4EEJA 2MF6A 3ZW0A 2JU8A 3P6CA 3TGAA 2GH7A 4QGVA 3PQSA 4OELA 2F09A 4GUZA 4OMWA 4XMFA 3VE1A 3FEKA 4ZGUA 4KT5A 4DCBA 1ML7A 3FELA 2OVEA 1FE3A 1SXXA 2KD2A 2RTEB 2LBAA 2C4IA 4Y0SA 3FW4A 1BM5A 3MG5A 3NX1A 1X89A 4QZTA 4Z28A 3T2WA 3WXQA 1YWCA 5F6ZA 3HOLA 4ZCBA 5D8JA 3B2KA 4BCSA 1MVGA 3UAQA 1ZNKA 2IZEB 1SWNA 3SZJA 3BX8A 1G74A 3U03A 4YFPA 2Q9SA 1LIEA 4AZRA 3C77X 1ACDA 1S7DA 3FA9A 3FR5A 2CBSA 3H3IA 1HN2A 4DNEA 4IB8A 1OEEA 4ZH6A 5IO5A 1CBSA 1ALBA 2Q4NA 2WEWA 5H9NA 3S60A 2NP1A 5DG4A 4XMDA 4GKCA 2W2AA 1SXUA 3SLJA 3ZW1B 4O49A 1JYJA 1QG5A 2RTLA 3FR4A 4OEMA 1HQQA 5EDCA 1VWBB 2LBVA 4BX5B 5AEOA 1FEMA 3QKGA 3VG7A 2VDFA 3RDOA 1SWTA 2MO5A 5IO6A 4MVEA 3IA8A 3STNA 1GKAB 1SWQA 4GH7A 3WZOA 1CBQA 1B0OA 2NNDA 3B2LA 5L8OA 5LJHA 3WJGA 1GX8A 1SXYA 3JSQA 3BU9A 4YH0A 1U17A 1DZMA 2LKKA 2AT3X 3GAQA 4XMEA 1SWJA 1HY2A 1SMPI 3V8UA 2LA7A 4QYNA 1HBPA 1B4MA 1KZXA 3AKNA 3KFFA 4EXZA 2M4LA 3RE5A 5FQ8E 4O3ZA 5K06A 1KL4A 2CZTA 4KH8A 1DZPA 5D45A 2RTKA 3T6LA 2Q2MA 1AVDA 1NQNA 3FMZA 1VWQB 1SA8A 2CAMA 3AKMA 4YVBA 2JOZA 1RSUB 2G79A 3P6GA 2IZGB 4PSQA 5H9LA 1SWFA 1SWOA 2FS7A 1BJ7A 2G7BA 2X32A 3WZNA 4INNA 1I4UA 3E3CA 5AJBA 4TNNA 3KFHA 1CBIA 2AF5A 5CE4A 3VHMA 2GTLM 3HPEA 1QABE 2F73A 4ZHDA 1LKEA 2DJFA 1STSB 2RTFB 2F01A 2FTBA 1MX7A 4HWMA 5K68A 1L6MA 4GGRA 5D4AA 5HCEC 1DF3A 4JNJA 1KGLA 1O1UA 2OFBA 4M7MA 3ZZVA 4D6BA 4Z2PA 5B5GA 1GX9A 2AT6X 2MM3A 1IKJA 2PY1A 1SWEA 2RTJA 2GC9A 2MJIA 2OYBO 4YFQA 2RCTA 1EW3A 1YWAA 2AL0X 2RTIB 3P6FA 2XSTA 4MVLA 4ON1A 2JU3A 5HTEA 1EIOA 1ERBA 4GNWA 1VWCB 1YWDA 3WVMA 1U18A 1W5RA 4EKVA 1MOYA 2FRSA 4OS3A 2X45A 5IRWA 1OSPO 1LPJA 2OZQA 1PTSA 1BWYA 4K19A 1OPBA 5EDBA 1I04A 3OE3A 4GE1A 4PJ2A 2W2FA 1OPAA 1N0SA 1BBPA 1QFTA 1VWJB 1N4JA 1N9YA 3FYFA 3L4RA 5HA1A 2MWHA 1EALA 1A3YA 1QFVA 1SWRA 2ANSA 3EW2A 4ORWA 4U8UM 5LJGA 2IZBA 3UEXA 4IB6A 3I0AA 5EEEA 1X71A 3FIDA 4JO6A 4ORRA 4GDZA 4I3BA 4CPHA 1MUPA 4KC7A 3SLTA 3WJFA 1D3SA 3C78X 1X8NA 4HPDA 4EQAC 3CR6A 5LJKA 3AUMO 3UEUA 1Y9LA 4BGFA 1ZNGA 3CQNA 1R0UA 1E06A 1BRQA 1NDJA 3VG5A 1MM9A 1HMSA 1WBIA 3OJYC 4I95A 1SRIA 3ZW0B 2X55A 1ERXA 1VWLB 4YGZA 2AH7X 4GGZA 1ICMA 4ID2A 3WYPA 5LJBA 3FW5A 2RTMA 3CKFA 3OD9A 4ORSA 1ZNEA 4FQBB 1KQXA 5CHKA 3SOTA 1KT5A 4IRWA 5B27A 3WJEA 1SRJA 3EM0A 3P24A 1HMRA 3PECA 3VG3A 1KQWA 2WWPA 1SWGA 1DF8A 3U0DA 4R0BA 4TKJA 1DZJA 3MM0A 1HXLA 3MBTA 5FFHA 4AZQA 1STPA 1TOWA 2DM5A 2X8TA 3T2XA 1OBQA 2X8SA 1SRHA 1SWPA 2AMMX 2ACPX 1ZNLA 2RTBB 4I3CA 4OS8A 5KICA 1A18A 4O4UA 3WYQA 1WUBA 3HWEA 5CYBA 2RN4A 2A8GA 1K3BA 1UZ2X 2A13A 2O62A 3KFIA 4FBOA 4NNTA 2K23A 4NV7A 4CPEA 1NGLA 2KW1A 3LHNA 5DPQA 1OEKA 4Z6JA 4BX6A 4FGIB 2OL6O 5AQ6A 2BHVA 4HPAA 1RXHA 3KZAA 1UREA 3RDQA 3BS2A 3PEDA 5CSEA 5C0NA 5HZ6A 5KIDA 1SWLA 3HOEA 3EW1A 3NX2A 2EU7X 2AT5X 3PPTA 3HWFA 1Y9TA 1JJUA 2A3FX 1N7YA 4O4OA 1LF7A 1VWPB 3FR2A 4NP1A 4QAEA 4QGXA 5L3YA 2QO6A 4Y0RA 4A1HA 3VE2A 4EDEA 3TGBA 3WJDA 3APVA 1TXLA 1P6PA 5D48A 3STMX 3HWGA 1YWBA 3DTQA 1RSTB 5IRAA 3NR3A 2FKJA 1KFFA 4I3DA 3EMMA 4LZVA 4ZFXA 2HLVA 2WEXA 5HTDA 1ADLA 2X46A 1HBQA 1S2PA 4ZGFA 1KT6A 4O3YA 4XMHA 1YIVA 5B3MO 4Z27A 2RTHB 1FJ1E 3O2YA 2WPUA 3CKGA 4O3XB 5BVQA 1SXWA 1T8VA 1TOUA 2GTFX 4A1YA 2Q2PA 2QM9A 3U9PC 4BOEA 4CV7A 1KT3A 4ML7B 4HPBA 3RBYA 1VWAB 1ZRYA 1KL3A 1YUPA 4U3QA 5FQ6E 3B2JA 1VWNB 2HNXA 3BU1A 2IFBA 2X4MA 1NQMA 1T68X 1VYFA 1I9HA 2AT8X 1FTPA 2BS5A 2MHDA 2OL7A 3KFGA 5IRUA 1IFCA 2RTOB 2OY8A 3N91A 1JZUA 1YP6A 3WJBA 1VWMB 2QOMA 4HFOA 5HWZA 4UU2A 1LELA 2GTLO 5F6BA 4D6AA 1SWHA 4I6SA 2Z4IA 3ELXA 2R74A 3CMPA 4YDAA 2CBRA 4O3WA 2W2BA 1Y52X 2ASNX 4QYPA 1NC9A 3FA8A 3ELZA 4AW8A 1GM6A 2KTDA 4YMYA 2POAA 4IB7A 4NLIA 5D47A 1EUOA 1GGLA 1H91A 3ZW1A 1I06A 3T1DA 3F9DA 2UZ2A 2G5LA 1A57A 2YMSA 3D96A 4Y0PA 5KHPA 4OKAA 4BX5A 4WFVA 2OVDA 2A5BA 4IMNA 2JW1A 4QRLA 4MVIA 4WHIA 3ZI8A 4ZHGA 2RTQB 4KCAA 4I9SA 5H9KA 3UEWA 4Y59A 4ALBA 1GKAA 3O19A 4TQ2A 5FENA 4L3RA 1SWUA 1LCVA 4BX7B 3PP6A 3FDCA 1BEBA 1LCWA 4FBVA 4GETA 4Y5DA 3BX7A 3WZQA 3APXA 3CQRA 3SLOA 4CPFA 2OFAA 2FGSA 1OBUA 3Q6LA 1BSQA 2A2GA 3HWDA 1SRFA 2FHNX 4U8UO 4BQUA 4I9RA 1KT4A 5BYPA 1BLRA 1VYGA 1PBYA 1X8QA 1QWDA 1ZNHA 3DSZA 3NQ9A 1RXKA 4HPCA 1HXZA 1DV9A 3FIQA 1ICNA 3P6DA 1LCZA 2IZJA 2XKLA 1N9MA 3X00A 1KZWA 4NLJA 4WFUA 4Z2VA 3Q34A 3RZYA 4IMOA 3NPOA 5F7GA 1EPAA 4B55A 1E02A 1EQDA 4XMGA 1O8VA 1NBXA 3RWXA 5HZ8A 2KTSA 5HZQA 2QO4A 3RY1A 1TVQA 2RA6A 3BSZE 4IABA 1VPRA 2I5ZO 2FR2A 1XKIA 4EFGA 5AJCA 2IZCB 2G78A 2HYSA 3C76X 4IB9A 3PH6A 4IBAA 1LICA 5B29A 2AVIA 2HMBA 1LDQA 1EI5A 1GT5A 2LFOA 3F8AA 4DQ4A 1AB0A 2ZSCA 5F1EA 1EIIA 3VG2A 2HZRA 1VWKB 2VFBA 1NP1A 3PK2A 2OFMX 4GJVA 4ODDA 1GT1A 1JMZA 4YGHA 2Y32A 1SY0A 2OFRX 1SY1A 4CSBA 2X8FA 1SWSA 3WOVA 5HZ9A 2JU7A 2X34A 1LNMA 3B2HA 4ORXA 3APUA 3STKA 3ZWEA 2GTLN 3NBXX 5EEDA 3ZQ3A 1SY3A 3QQ2A 4NNSA 4QQ1A 3RDXA 1X8OA 1VYOA 1SLDB 5L8IA 3P6EA 4RUNA 1MEPA 3RDMA 3S5XA 1JJJA 1GXAA 3FA7A 4ARHA 5H9AA 1AQBA 3S26A 4RUUA 1JYDA 4YBPA 2FKGA 4ZHHA 3D9WA 4TLJA 1DFVA 4YCHA 1W4TA 4BJ8A 1VWGB 2OY7A 3WBGA 1QQSA 3NQ3A 3LV4A 4CDEA 3VU1A 1UYNX 4CDCA 4YKMA 1FENA 3ZUIA 5K67A 1SWKA 3EBKA 1AELA 4O4XA 4AZPA 3TZSA 2BLGA 2QO5A 3UEVA 4NW4A 1VWOB 4ZH9A 3S5VA 5IO7A 3MX7A 3CWKA 4UU3A 2GJ5A 1FDQA 3OBLA 1HQPA 3APWA 1PBOA 4I60A 1LIFA 5HCCC 1N43A 5BVTA 4A8ZA 4YDBA 4ZHFA 4A60A 2QCBA 2L68A 4MVKA 1QY1A 1SRGA 2R56A 2AT0X 1RLBE 3EC5A 5EPQA 1OEJA 1JQPA 2WSJA 4MISA 4YKOA 1VWHB 2Y3FA 3KVNA 1Y53X 5H8TA 1SWCA 2OVSA 5B10O 3CBSA 3WJCA 1YP7A 3LTWA 2IZDB 4ZR2A 1JJXA 1IKEA 2Q39A 4COTA 4U8UN 1Z24A 2JGSA 3O22A 1BSYA 2I5VO 4GK9A 1Y0GA 4XMCA 3BY0A 1EPBA 3B2IA 1IFBA 1SY2A 4LQZA 4WBKA 3WZPA 4BBOA 5LKEA 2CZUA 1G5WA 2JMBA 3HTYA 2RTAA 2RTDB 1LIBA 1PEEA 4ORUA 1GX3A 2ZAGA 5B11O 3ZUOA 2UYWA 1MX8A 2X56A 5F58A 2ACOA 3BLGA 2WQ9A 3SZIA 2IZIA 5FQ7E 3RDUA 1STRB 1T0VA 2FR3A 2OF8A 4GRJA 4Z2OA 4LKTA 4NYQA 4CDDA 1K24A 1GT3A 3CBCA 4LKPA 4QZUA 1SWDA 2K62A 4BVMA 5HAEA 3PDFA 2WR6A 5IXGA 1S44A 2E4JA 1X8UA 2IZFB 1Y55X 2BC3A 2IZKA 1VWIB 4ZHCA 1IJ8A 3D4RA 4MEEA 1AVEA 5LJEA 4OMXA 3PH5A 4DQ3A 2BS6A 5LJDA 1D2UA 4FBRA 4JGLA 3D95A 1RXJA 1OBPA 2LB6A 2QOSC 2RTPB 1XCAA 2IZAA 1JV4A 3K3LA 4GJSA 1KOIA 2A0AA 1SWBA 4CPHB 2RTRB 2OY5O 1B56A 2WQAE 4TKHA 1A2DA 1TW4A 4YCEA 5HBSA 5JD2A 5B5FA 3TF6A 4GZVA 3VHHA 4M6SA 2WUTA 4NV8A 1E00A 4OS0A 1MDCA 4GDAA 3RE6A 4ALOA 2FT9A 2FHLA 1G85A 2JN3A 2N93A 3VG6A 1JMXA 1GT4A 4ES7A 2DJGA 1VWEB 4GGTA 4KIIA 1VWDB 4GNYA 4ZJ0A 4LZUA 2L9CA 1DC9A 5FAZA 3BRNA 3RSWA 4ORYA 5HCDC 3FLLA 3PQUA 5BVSA 3IFBA 1SLFB 4O9SA 3T6FA 3VG4A 3ZW2A 1PM1X 3G7XA 2C1QA 4CPIA 5L8NA 1KL5A 5HA0A 1IIUA 1NP4A 2Y3EA 3FENA 5EZ2A 4YFRA 4AZMA 3MVFA 2IZHB 5JR8A 2VFCA 1SLGB 1E5PA 5LKFA 3NP1A 3RDSA 1SLEB 2BT9A 2FS6A 2A2UA 2OL8O 2PI3O 1AVGI 3P6HA 1E2TA 3GE2A 2OF9A 1KXOA 3F6ZB 1RBPA 3JQOA 1CRBA 1SWAA 2HKDA 1QY2A 2Z4HA 4L1NA 4MIRA 3D97A 2RD7C 3KQ0A 2FWVA 4O4SA 2RTGB 4CK4A 3TGCA 4U46A 5B2AO 3VGWA 2CM9A 3HK1A 4BX6B 2ZAIA 3VPJE 2RQ0A 2OVAA 4JHQA 2YG2A 1KT7A 4QNIA 1ZNDA 3EBWA 4AYHA 1LUQA 4IAWA 4CDFA 4N7DA 1CBRA 2P8GA 2RCQA 4YBUA 4AZNA 1I05A 1QY0A 1DZKA 1MK5A 4AZOA 1BRPA 1O1VA 3EYCA 1VWFB 1B8EA 2FLJA 4IAXA 4N7CA 1LIDA 4BX7A 5LJCA 5HZ5A
chains in the Genus database with same CATH topology
3I17A 4QGWA 1PMPA 2L67A 3FEPA 1G7NA 1U0XA 1LFOA 4GU8A 1JBHA 1IW2A 2HZQA 3RKGA 4YGGA 2KT4B 2L5PA 2NNEA 3JS1A 2AKQA 3NQKA 4NYRA 4TJZA 1FELA 2R73A 4KC8A 3P02A 4Y0QA 2NNQA 1BSOA 3BDRA 2QMIA 4U9CA 3NADA 2CM4A 1EXSA 1JIWI 1X8PA 4TKBA 3FA6A 3SAOA 1HMTA 2ALLX 1CJ5A 4EEJA 3ZW0A 4QGVA 2JU8A 3P6CA 3TGAA 3PQSA 2F09A 4OMWA 4XMFA 3VE1A 3FEKA 4ZGUA 4KT5A 1ML7A 3FELA 2OVEA 1FE3A 1SXXA 2KD2A 2LBAA 4Y0SA 3FW4A 1BM5A 3NX1A 1X89A 4QZTA 3WXQA 1YWCA 5F6ZA 3HOLA 4ZCBA 5D8JA 3B2KA 1MVGA 3UAQA 1ZNKA 3U03A 3BX8A 1G74A 4YFPA 2Q9SA 1LIEA 4AZRA 3C77X 1ACDA 1S7DA 3FA9A 3FR5A 2CBSA 3H3IA 1HN2A 4IB8A 1OEEA 4ZH6A 5IO5A 1CBSA 1ALBA 2Q4NA 2WEWA 5H9NA 3S60A 2NP1A 5DG4A 4XMDA 4GKCA 2W2AA 1SXUA 3ZW1B 4O49A 1JYJA 1QG5A 3FR4A 5EDCA 2LBVA 5AEOA 1FEMA 3QKGA 3VG7A 2MO5A 5IO6A 4MVEA 3IA8A 3STNA 1GKAB 4GH7A 1CBQA 1B0OA 2NNDA 3B2LA 5L8OA 5LJHA 3WJGA 1GX8A 1SXYA 3JSQA 3BU9A 4YH0A 2LKKA 1U17A 1DZMA 2AT3X 3GAQA 4XMEA 3V8UA 1SMPI 1B4MA 1JJXA 2LA7A 4QYNA 1HBPA 1KZXA 3AKNA 3KFFA 4EXZA 2M4LA 5FQ8E 4O3ZA 5K06A 2CZTA 4KH8A 1DZPA 5D45A 2Q2MA 3FMZA 1SA8A 3AKMA 2JOZA 2G79A 3P6GA 5H9LA 4PSQA 2FS7A 2G7BA 1BJ7A 4INNA 1I4UA 3E3CA 5AJBA 4TNNA 3KFHA 1CBIA 5CE4A 2GTLM 4ZHDA 1QABE 2F73A 1LKEA 2FTBA 1MX7A 4HWMA 1L6MA 5D4AA 5HCEC 1DF3A 1KGLA 1O1UA 4M7MA 3ZZVA 4D6BA 1GX9A 2AT6X 2MM3A 1IKJA 2PY1A 2GC9A 2MJIA 4YFQA 2RCTA 1EW3A 1YWAA 2AL0X 3P6FA 4MVLA 2XSTA 4ON1A 5HTEA 2JU3A 1EIOA 1ERBA 4GNWA 1YWDA 3WVMA 1U18A 2FRSA 4OS3A 2X45A 1LPJA 2OZQA 1BWYA 4K19A 1OPBA 5EDBA 1I04A 3OE3A 4GE1A 4PJ2A 2W2FA 1OPAA 1N0SA 1BBPA 1QFTA 3FYFA 3L4RA 5HA1A 2MWHA 1EALA 1A3YA 1QFVA 2ANSA 4U8UM 4ORWA 5LJGA 3UEXA 4IB6A 3I0AA 5EEEA 1X71A 4ORRA 4GDZA 4I3BA 1MUPA 4KC7A 1D3SA 3C78X 1X8NA 4HPDA 4EQAC 3CR6A 5LJKA 3UEUA 1Y9LA 1ZNGA 3CQNA 1R0UA 1E06A 1BRQA 3VG5A 3ZW0B 3TGCA 1HMSA 3OJYC 4I95A 1ERXA 4YGZA 2AH7X 1ICMA 4ID2A 5LJBA 3FW5A 3OD9A 4ORSA 1ZNEA 4FQBB 1KQXA 3SOTA 1KT5A 5B27A 3WJEA 3P24A 3EM0A 3VG3A 1HMRA 3PECA 1KQWA 2WWPA 3U0DA 4R0BA 4TKJA 1DZJA 3MBTA 4AZQA 5FFHA 1TOWA 2DM5A 2X8TA 1OBQA 2X8SA 4I3CA 3WJFA 2AMMX 2ACPX 1ZNLA 4OS8A 5KICA 1A18A 4O4UA 3HWEA 5CYBA 2RN4A 1UZ2X 2O62A 2A13A 3KFIA 4FBOA 4NNTA 2K23A 1NGLA 2KW1A 3LHNA 5DPQA 1OEKA 4FGIB 5AQ6A 2BHVA 4HPAA 3KZAA 1UREA 3BS2A 3PEDA 5C0NA 5HZ6A 5KIDA 3HOEA 3NX2A 2EU7X 2AT5X 3PPTA 3HWFA 1Y9TA 2A3FX 4O4OA 4QGXA 1LF7A 3FR2A 4NP1A 4QAEA 3TGBA 2QO6A 4Y0RA 4A1HA 3VE2A 3WJDA 3APVA 1TXLA 1P6PA 5D48A 3STMX 3HWGA 1YWBA 3DTQA 3NR3A 4I3DA 3EMMA 4LZVA 4ZFXA 2HLVA 2WEXA 5HTDA 1ADLA 2X46A 1HBQA 1S2PA 4ZGFA 1KT6A 4O3YA 4XMHA 1YIVA 5BVQA 3O2YA 4O3XB 1SXWA 1T8VA 1TOUA 2GTFX 4A1YA 2Q2PA 2QM9A 3U9PC 4BOEA 4CV7A 1KT3A 4ML7B 4HPBA 3RBYA 1ZRYA 1YUPA 4U3QA 5FQ6E 3B2JA 3BU1A 2HNXA 2IFBA 1T68X 1VYFA 2AT8X 2MHDA 1FTPA 2BS5A 3KFGA 1IFCA 3N91A 1JZUA 1YP6A 3WJBA 4HFOA 5HWZA 4UU2A 2GTLO 5F6BA 4D6AA 4I6SA 2Z4IA 3ELXA 2R74A 3CMPA 4YDAA 2CBRA 4O3WA 2W2BA 2ASNX 4QYPA 3FA8A 3ELZA 4AW8A 1GM6A 2KTDA 4YMYA 2POAA 4IB7A 4NLIA 5D47A 1EUOA 1GGLA 1H91A 3ZW1A 1I06A 3T1DA 3F9DA 1A57A 2YMSA 3D96A 4Y0PA 5KHPA 4WFVA 2OVDA 4IMNA 4ZHGA 2JW1A 4QRLA 4MVIA 4WHIA 3ZI8A 4KCAA 4I9SA 5H9KA 3UEWA 4ALBA 1GKAA 3O19A 4TQ2A 4L3RA 3PP6A 4FBVA 1BEBA 4GETA 3BX7A 3APXA 3CQRA 1OBUA 3Q6LA 1BSQA 2A2GA 3HWDA 4U8UO 4BQUA 4I9RA 1KT4A 5BYPA 1BLRA 1VYGA 1X8QA 1QWDA 1ZNHA 3DSZA 3NQ9A 4HPCA 1DV9A 3FIQA 1ICNA 3P6DA 2XKLA 1KZWA 4NLJA 4WFUA 3RZYA 4IMOA 3NPOA 5F7GA 1EPAA 1E02A 1EQDA 4XMGA 1O8VA 5HZ8A 3RWXA 2KTSA 5HZQA 2QO4A 1TVQA 2RA6A 3BSZE 4IABA 1VPRA 2FR2A 1XKIA 4EFGA 5AJCA 2G78A 2HYSA 3C76X 4IB9A 3PH6A 4IBAA 1LICA 5B29A 2HMBA 1EI5A 1GT5A 2LFOA 3F8AA 4DQ4A 1AB0A 5F1EA 1EIIA 3VG2A 2HZRA 1NP1A 2OFMX 4ODDA 1GT1A 4YGHA 1SY0A 2OFRX 1SY1A 4CSBA 2X8FA 3WOVA 5HZ9A 2JU7A 1LNMA 3B2HA 4ORXA 3APUA 3STKA 3ZWEA 2GTLN 3NBXX 5EEDA 3ZQ3A 1SY3A 4NNSA 4QQ1A 5FENA 1X8OA 5L8IA 1JJJA 3P6EA 4RUNA 3S5XA 1GXAA 3FA7A 4ARHA 5H9AA 1AQBA 3S26A 4RUUA 1JYDA 4YBPA 4ZHHA 4TLJA 1DFVA 4YCHA 3WBGA 1QQSA 3NQ3A 3LV4A 3VU1A 4YKMA 1FENA 3ZUIA 1AELA 3EBKA 4O4XA 4AZPA 3TZSA 2BLGA 2QO5A 3UEVA 4NW4A 3S5VA 4ZH9A 5IO7A 3MX7A 3CWKA 4UU3A 2GJ5A 1FDQA 3OBLA 1HQPA 3APWA 1PBOA 5HCCC 1LIFA 5BVTA 4A8ZA 4YDBA 4ZHFA 4A60A 2L68A 4MVKA 1QY1A 2R56A 5EPQA 2AT0X 1RLBE 1OEJA 2WSJA 4MISA 4YKOA 5H8TA 2OVSA 3CBSA 3WJCA 1YP7A 4ZR2A 1IKEA 2Q39A 4COTA 4U8UN 1Z24A 3O22A 1BSYA 4GK9A 4XMCA 3BY0A 1EPBA 3B2IA 1IFBA 1SY2A 4LQZA 4WBKA 5LKEA 1G5WA 2CZUA 2JMBA 3HTYA 1LIBA 1PEEA 4ORUA 2ZAGA 3ZUOA 1MX8A 5F58A 2ACOA 3BLGA 2WQ9A 5FQ7E 1T0VA 2FR3A 4GRJA 4LKTA 4NYQA 4LKPA 1GT3A 3CBCA 4QZUA 2K62A 4BVMA 5HAEA 2WR6A 1S44A 2E4JA 1X8UA 4ZHCA 3D4RA 5LJEA 4OMXA 3PH5A 4DQ3A 2BS6A 5LJDA 1D2UA 4FBRA 4JGLA 3D95A 1OBPA 2LB6A 2QOSC 1XCAA 1JV4A 3K3LA 1KOIA 2A0AA 1B56A 2WQAE 4TKHA 1A2DA 1TW4A 4YCEA 5HBSA 3TF6A 4GZVA 4M6SA 2WUTA 1E00A 4OS0A 1MDCA 4ALOA 2FT9A 1G85A 2JN3A 2N93A 3VG6A 1GT4A 4ES7A 4KIIA 4GNYA 4ZJ0A 4LZUA 2L9CA 1DC9A 5FAZA 3BRNA 3RSWA 4ORYA 5HCDC 3FLLA 3PQUA 5BVSA 3IFBA 4O9SA 3VG4A 3ZW2A 1PM1X 3G7XA 5L8NA 5HA0A 1IIUA 1NP4A 3FENA 5EZ2A 4YFRA 4AZMA 3MVFA 5JR8A 5LKFA 1E5PA 3NP1A 2FS6A 2BT9A 2A2UA 1AVGI 3P6HA 3GE2A 1KXOA 3F6ZB 1RBPA 3JQOA 1CRBA 1QY2A 2Z4HA 4L1NA 4MIRA 3D97A 2RD7C 3KQ0A 2FWVA 4O4SA 4CK4A 2CM9A 3HK1A 2ZAIA 3VPJE 2RQ0A 2OVAA 2YG2A 1KT7A 4QNIA 1ZNDA 3EBWA 4AYHA 4IAWA 4N7DA 1CBRA 2P8GA 2RCQA 4YBUA 4AZNA 1I05A 1QY0A 1DZKA 4AZOA 1BRPA 1O1VA 3EYCA 4N7CA 1B8EA 2FLJA 4IAXA 1LIDA 4EDEA 5LJCA 5HZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I17 A;  4QGW A;  1PMP A;  2L67 A;  3FEP A;  1G7N A;  1U0X A;  1LFO A;  1JBH A;  1IW2 A;  2HZQ A;  4YGG A;  2KT4 B;  2L5P A;  2NNE A;  3JS1 A;  2AKQ A;  4NYR A;  4TJZ A;  1FEL A;  2R73 A;  4Y0Q A;  2NNQ A;  1BSO A;  3BDR A;  3NAD A;  2CM4 A;  1EXS A;  1X8P A;  4TKB A;  3FA6 A;  3SAO A;  1HMT A;  2ALL X;  1CJ5 A;  4EEJ A;  4QGV A;  2JU8 A;  3P6C A;  3TGA A;  4OMW A;  4XMF A;  3FEK A;  4ZGU A;  1ML7 A;  3FEL A;  2OVE A;  1FE3 A;  1SXX A;  2LBA A;  4Y0S A;  3FW4 A;  1BM5 A;  3NX1 A;  1X89 A;  4QZT A;  3WXQ A;  1YWC A;  5F6Z A;  4ZCB A;  5D8J A;  3B2K A;  1MVG A;  1ZNK A;  3U03 A;  3BX8 A;  1G74 A;  4YFP A;  2Q9S A;  1LIE A;  4AZR A;  3C77 X;  1ACD A;  1S7D A;  3FA9 A;  3FR5 A;  2CBS A;  1HN2 A;  4IB8 A;  1OEE A;  4ZH6 A;  5IO5 A;  1CBS A;  1ALB A;  2Q4N A;  2WEW A;  5H9N A;  2NP1 A;  5DG4 A;  4XMD A;  4GKC A;  2W2A A;  1SXU A;  1JYJ A;  1QG5 A;  3FR4 A;  5EDC A;  2LBV A;  1FEM A;  3QKG A;  3VG7 A;  2MO5 A;  5IO6 A;  3IA8 A;  3STN A;  1GKA B;  4GH7 A;  1CBQ A;  1B0O A;  2NND A;  3B2L A;  5L8O A;  5LJH A;  3WJG A;  1GX8 A;  1SXY A;  3JSQ A;  3BU9 A;  4YH0 A;  2LKK A;  1U17 A;  1DZM A;  2AT3 X;  3GAQ A;  4XME A;  1JJX A;  1B4M A;  1KZX A;  4QYN A;  1HBP A;  3AKN A;  3KFF A;  4EXZ A;  5K06 A;  2CZT A;  5D45 A;  1DZP A;  2Q2M A;  3FMZ A;  1SA8 A;  3AKM A;  2JOZ A;  2G79 A;  3P6G A;  5H9L A;  4PSQ A;  2FS7 A;  2G7B A;  1BJ7 A;  1I4U A;  4TNN A;  3KFH A;  1CBI A;  5CE4 A;  4ZHD A;  1QAB E;  2F73 A;  1LKE A;  2FTB A;  1MX7 A;  1L6M A;  5D4A A;  5HCE C;  1DF3 A;  1KGL A;  1O1U A;  4M7M A;  4D6B A;  1GX9 A;  2AT6 X;  2MM3 A;  1IKJ A;  2PY1 A;  2GC9 A;  2MJI A;  4YFQ A;  2RCT A;  1EW3 A;  1YWA A;  2AL0 X;  3P6F A;  4MVL A;  2XST A;  5HTE A;  2JU3 A;  1EIO A;  1ERB A;  4GNW A;  1YWD A;  3WVM A;  1U18 A;  2FRS A;  4OS3 A;  2X45 A;  1LPJ A;  2OZQ A;  1BWY A;  4K19 A;  1OPB A;  5EDB A;  1I04 A;  4GE1 A;  2W2F A;  1OPA A;  1N0S A;  1BBP A;  1QFT A;  3L4R A;  5HA1 A;  1EAL A;  1A3Y A;  1QFV A;  2ANS A;  4ORW A;  5LJG A;  3UEX A;  4IB6 A;  3I0A A;  5EEE A;  1X71 A;  4ORR A;  4I3B A;  1MUP A;  1D3S A;  3C78 X;  1X8N A;  4HPD A;  5LJK A;  3CR6 A;  3UEU A;  1ZNG A;  3CQN A;  1R0U A;  1E06 A;  1BRQ A;  3VG5 A;  3TGC A;  1HMS A;  3OJY C;  1ERX A;  4YGZ A;  2AH7 X;  1ICM A;  5LJB A;  3FW5 A;  4ORS A;  1ZNE A;  1KQX A;  1KT5 A;  5B27 A;  3WJE A;  3EM0 A;  3VG3 A;  1HMR A;  3PEC A;  1KQW A;  2WWP A;  3U0D A;  4R0B A;  4TKJ A;  1DZJ A;  3MBT A;  4AZQ A;  5FFH A;  1TOW A;  2DM5 A;  1OBQ A;  4I3C A;  3WJF A;  2AMM X;  2ACP X;  1ZNL A;  4OS8 A;  5KIC A;  1A18 A;  3HWE A;  1UZ2 X;  2O62 A;  2A13 A;  3KFI A;  4NNT A;  2K23 A;  1NGL A;  5DPQ A;  1OEK A;  5AQ6 A;  4HPA A;  3KZA A;  1URE A;  3BS2 A;  3PED A;  5C0N A;  5HZ6 A;  5KID A;  3NX2 A;  2EU7 X;  2AT5 X;  3PPT A;  3HWF A;  2A3F X;  4QGX A;  1LF7 A;  3FR2 A;  4NP1 A;  4QAE A;  3TGB A;  2QO6 A;  4Y0R A;  4A1H A;  3WJD A;  3APV A;  1TXL A;  1P6P A;  5D48 A;  3STM X;  3HWG A;  1YWB A;  3DTQ A;  3NR3 A;  4I3D A;  3EMM A;  4LZV A;  4ZFX A;  2HLV A;  2WEX A;  5HTD A;  1ADL A;  2X46 A;  1HBQ A;  1S2P A;  1KT6 A;  4XMH A;  1YIV A;  5BVQ A;  3O2Y A;  1SXW A;  1T8V A;  1TOU A;  2GTF X;  4A1Y A;  2Q2P A;  2QM9 A;  3U9P C;  4BOE A;  1KT3 A;  4HPB A;  1ZRY A;  1YUP A;  3B2J A;  3BU1 A;  2HNX A;  2IFB A;  1T68 X;  1VYF A;  2AT8 X;  1FTP A;  3KFG A;  1IFC A;  1JZU A;  1YP6 A;  3WJB A;  4HFO A;  5HWZ A;  4UU2 A;  5F6B A;  4D6A A;  3ELX A;  2R74 A;  3CMP A;  4YDA A;  2CBR A;  2W2B A;  2ASN X;  4QYP A;  3FA8 A;  3ELZ A;  4AW8 A;  1GM6 A;  2KTD A;  4YMY A;  2POA A;  4IB7 A;  4NLI A;  5D47 A;  1EUO A;  1GGL A;  1H91 A;  1I06 A;  3T1D A;  3F9D A;  1A57 A;  3D96 A;  4Y0P A;  5KHP A;  4WFV A;  2OVD A;  4IMN A;  4ZHG A;  4MVI A;  4I9S A;  5H9K A;  3UEW A;  4ALB A;  1GKA A;  3O19 A;  4TQ2 A;  3PP6 A;  4GET A;  1BEB A;  3BX7 A;  3APX A;  3CQR A;  1OBU A;  3Q6L A;  1BSQ A;  2A2G A;  3HWD A;  4BQU A;  4I9R A;  1KT4 A;  1BLR A;  1VYG A;  1X8Q A;  1QWD A;  1ZNH A;  3DSZ A;  3NQ9 A;  4HPC A;  1DV9 A;  3FIQ A;  1ICN A;  3P6D A;  2XKL A;  1KZW A;  4NLJ A;  4WFU A;  3RZY A;  4IMO A;  3NPO A;  5F7G A;  1EPA A;  1E02 A;  1EQD A;  4XMG A;  1O8V A;  5HZ8 A;  5HZQ A;  2QO4 A;  1TVQ A;  2RA6 A;  3BSZ E;  1VPR A;  2FR2 A;  1XKI A;  4EFG A;  2G78 A;  2HYS A;  3C76 X;  4IB9 A;  3PH6 A;  4IBA A;  1LIC A;  5B29 A;  2HMB A;  1GT5 A;  2LFO A;  3F8A A;  4DQ4 A;  1AB0 A;  5F1E A;  1EII A;  3VG2 A;  2HZR A;  1NP1 A;  2OFM X;  4ODD A;  1GT1 A;  4YGH A;  1SY0 A;  2OFR X;  1SY1 A;  5HZ9 A;  2JU7 A;  1LNM A;  3B2H A;  4ORX A;  3APU A;  3STK A;  5EED A;  3ZQ3 A;  1SY3 A;  4NNS A;  5FEN A;  1X8O A;  5L8I A;  1JJJ A;  3P6E A;  4RUN A;  1GXA A;  3FA7 A;  4ARH A;  5H9A A;  1AQB A;  3S26 A;  4RUU A;  1JYD A;  4YBP A;  4ZHH A;  4TLJ A;  1DFV A;  4YCH A;  3WBG A;  1QQS A;  3NQ3 A;  4YKM A;  1FEN A;  3ZUI A;  1AEL A;  3EBK A;  4AZP A;  3TZS A;  2BLG A;  2QO5 A;  3UEV A;  4ZH9 A;  5IO7 A;  3CWK A;  4UU3 A;  2GJ5 A;  1FDQ A;  1HQP A;  3APW A;  1PBO A;  5HCC C;  1LIF A;  5BVT A;  4A8Z A;  4YDB A;  4ZHF A;  4A60 A;  2L68 A;  4MVK A;  1QY1 A;  2R56 A;  5EPQ A;  2AT0 X;  1RLB E;  1OEJ A;  2WSJ A;  4YKO A;  5H8T A;  3CBS A;  3WJC A;  1YP7 A;  4ZR2 A;  1IKE A;  2Q39 A;  1Z24 A;  3O22 A;  1BSY A;  4XMC A;  3BY0 A;  1EPB A;  3B2I A;  1IFB A;  1SY2 A;  4WBK A;  1G5W A;  5LKE A;  2CZU A;  1LIB A;  1PEE A;  4ORU A;  3ZUO A;  1MX8 A;  5F58 A;  2ACO A;  3BLG A;  2WQ9 A;  1T0V A;  2FR3 A;  4GRJ A;  4LKT A;  4NYQ A;  4LKP A;  1GT3 A;  3CBC A;  4QZU A;  2K62 A;  4BVM A;  5HAE A;  2WR6 A;  1S44 A;  2E4J A;  1X8U A;  4ZHC A;  5LJE A;  4OMX A;  3PH5 A;  4DQ3 A;  5LJD A;  1D2U A;  3D95 A;  1OBP A;  2LB6 A;  2QOS C;  1XCA A;  1JV4 A;  3K3L A;  1KOI A;  2A0A A;  1B56 A;  2WQA E;  4TKH A;  1A2D A;  1TW4 A;  4YCE A;  5HBS A;  3TF6 A;  4M6S A;  2WUT A;  1E00 A;  4OS0 A;  1MDC A;  4ALO A;  2FT9 A;  1G85 A;  2JN3 A;  2N93 A;  3VG6 A;  1GT4 A;  4ES7 A;  4KII A;  4GNY A;  4ZJ0 A;  4LZU A;  2L9C A;  1DC9 A;  5FAZ A;  3BRN A;  3RSW A;  4ORY A;  5HCD C;  3FLL A;  5BVS A;  3IFB A;  4O9S A;  3VG4 A;  1PM1 X;  3G7X A;  5L8N A;  5HA0 A;  1IIU A;  1NP4 A;  3FEN A;  5EZ2 A;  4YFR A;  4AZM A;  3MVF A;  5JR8 A;  5LKF A;  1E5P A;  3NP1 A;  2FS6 A;  2A2U A;  1AVG I;  3P6H A;  1KXO A;  1RBP A;  1CRB A;  1QY2 A;  3D97 A;  2RD7 C;  3KQ0 A;  2FWV A;  4CK4 A;  2CM9 A;  3HK1 A;  2RQ0 A;  2OVA A;  2YG2 A;  1KT7 A;  1ZND A;  3EBW A;  4AYH A;  4IAW A;  4N7D A;  1CBR A;  2P8G A;  2RCQ A;  4YBU A;  4AZN A;  1I05 A;  1QY0 A;  1DZK A;  4AZO A;  1BRP A;  1O1V A;  3EYC A;  4N7C A;  1B8E A;  2FLJ A;  4IAX A;  1LID A;  4EDE A;  5LJC A;  5HZ5 A; 
#chains in the Genus database with same CATH topology
 3I17 A;  4QGW A;  1PMP A;  5F2B A;  2L67 A;  2RTC B;  3FEP A;  1G7N A;  1U0X A;  1SRE A;  1LFO A;  4GU8 A;  4C5P A;  1JBH A;  1IW2 A;  2HZQ A;  3RKG A;  3SZH A;  4YGG A;  2KT4 B;  2L5P A;  2NNE A;  3AEH A;  2BSZ A;  2AKQ A;  3JS1 A;  3NQK A;  4NYR A;  1I78 A;  4TJZ A;  1FEL A;  2IZL B;  3VHI A;  2R73 A;  4KC8 A;  2OY1 O;  3P02 A;  4Y0Q A;  2NNQ A;  1BSO A;  1VWR B;  3BDR A;  2QMI A;  4U9C A;  3NAD A;  1RAV A;  2CM4 A;  1EXS A;  4GD9 A;  1JIW I;  1X8P A;  2A5C A;  4TKB A;  3RY2 A;  3FA6 A;  3SAO A;  2C1S A;  1HMT A;  2RTN B;  2ALL X;  1W6F A;  1CJ5 A;  1UYO X;  1LDO A;  2G8C O;  4EEJ A;  2MF6 A;  3ZW0 A;  2JU8 A;  3P6C A;  3TGA A;  2GH7 A;  4QGV A;  3PQS A;  4OEL A;  2F09 A;  4GUZ A;  4OMW A;  4XMF A;  3VE1 A;  3FEK A;  4ZGU A;  4KT5 A;  4DCB A;  1ML7 A;  3FEL A;  2OVE A;  1FE3 A;  1SXX A;  2KD2 A;  2RTE B;  2LBA A;  2C4I A;  4Y0S A;  3FW4 A;  1BM5 A;  3MG5 A;  3NX1 A;  1X89 A;  4QZT A;  4Z28 A;  3T2W A;  3WXQ A;  1YWC A;  5F6Z A;  3HOL A;  4ZCB A;  5D8J A;  3B2K A;  4BCS A;  1MVG A;  3UAQ A;  1ZNK A;  2IZE B;  1SWN A;  3SZJ A;  3BX8 A;  1G74 A;  3U03 A;  4YFP A;  2Q9S A;  1LIE A;  4AZR A;  3C77 X;  1ACD A;  1S7D A;  3FA9 A;  3FR5 A;  2CBS A;  3H3I A;  1HN2 A;  4DNE A;  4IB8 A;  1OEE A;  4ZH6 A;  5IO5 A;  1CBS A;  1ALB A;  2Q4N A;  2WEW A;  5H9N A;  3S60 A;  2NP1 A;  5DG4 A;  4XMD A;  4GKC A;  2W2A A;  1SXU A;  3SLJ A;  3ZW1 B;  4O49 A;  1JYJ A;  1QG5 A;  2RTL A;  3FR4 A;  4OEM A;  1HQQ A;  5EDC A;  1VWB B;  2LBV A;  4BX5 B;  5AEO A;  1FEM A;  3QKG A;  3VG7 A;  2VDF A;  3RDO A;  1SWT A;  2MO5 A;  5IO6 A;  4MVE A;  3IA8 A;  3STN A;  1GKA B;  1SWQ A;  4GH7 A;  3WZO A;  1CBQ A;  1B0O A;  2NND A;  3B2L A;  5L8O A;  5LJH A;  3WJG A;  1GX8 A;  1SXY A;  3JSQ A;  3BU9 A;  4YH0 A;  1U17 A;  1DZM A;  2LKK A;  2AT3 X;  3GAQ A;  4XME A;  1SWJ A;  1HY2 A;  1SMP I;  3V8U A;  2LA7 A;  4QYN A;  1HBP A;  1B4M A;  1KZX A;  3AKN A;  3KFF A;  4EXZ A;  2M4L A;  3RE5 A;  5FQ8 E;  4O3Z A;  5K06 A;  1KL4 A;  2CZT A;  4KH8 A;  1DZP A;  5D45 A;  2RTK A;  3T6L A;  2Q2M A;  1AVD A;  1NQN A;  3FMZ A;  1VWQ B;  1SA8 A;  2CAM A;  3AKM A;  4YVB A;  2JOZ A;  1RSU B;  2G79 A;  3P6G A;  2IZG B;  4PSQ A;  5H9L A;  1SWF A;  1SWO A;  2FS7 A;  1BJ7 A;  2G7B A;  2X32 A;  3WZN A;  4INN A;  1I4U A;  3E3C A;  5AJB A;  4TNN A;  3KFH A;  1CBI A;  2AF5 A;  5CE4 A;  3VHM A;  2GTL M;  3HPE A;  1QAB E;  2F73 A;  4ZHD A;  1LKE A;  2DJF A;  1STS B;  2RTF B;  2F01 A;  2FTB A;  1MX7 A;  4HWM A;  5K68 A;  1L6M A;  4GGR A;  5D4A A;  5HCE C;  1DF3 A;  4JNJ A;  1KGL A;  1O1U A;  2OFB A;  4M7M A;  3ZZV A;  4D6B A;  4Z2P A;  5B5G A;  1GX9 A;  2AT6 X;  2MM3 A;  1IKJ A;  2PY1 A;  1SWE A;  2RTJ A;  2GC9 A;  2MJI A;  2OYB O;  4YFQ A;  2RCT A;  1EW3 A;  1YWA A;  2AL0 X;  2RTI B;  3P6F A;  2XST A;  4MVL A;  4ON1 A;  2JU3 A;  5HTE A;  1EIO A;  1ERB A;  4GNW A;  1VWC B;  1YWD A;  3WVM A;  1U18 A;  1W5R A;  4EKV A;  1MOY A;  2FRS A;  4OS3 A;  2X45 A;  5IRW A;  1OSP O;  1LPJ A;  2OZQ A;  1PTS A;  1BWY A;  4K19 A;  1OPB A;  5EDB A;  1I04 A;  3OE3 A;  4GE1 A;  4PJ2 A;  2W2F A;  1OPA A;  1N0S A;  1BBP A;  1QFT A;  1VWJ B;  1N4J A;  1N9Y A;  3FYF A;  3L4R A;  5HA1 A;  2MWH A;  1EAL A;  1A3Y A;  1QFV A;  1SWR A;  2ANS A;  3EW2 A;  4ORW A;  4U8U M;  5LJG A;  2IZB A;  3UEX A;  4IB6 A;  3I0A A;  5EEE A;  1X71 A;  3FID A;  4JO6 A;  4ORR A;  4GDZ A;  4I3B A;  4CPH A;  1MUP A;  4KC7 A;  3SLT A;  3WJF A;  1D3S A;  3C78 X;  1X8N A;  4HPD A;  4EQA C;  3CR6 A;  5LJK A;  3AUM O;  3UEU A;  1Y9L A;  4BGF A;  1ZNG A;  3CQN A;  1R0U A;  1E06 A;  1BRQ A;  1NDJ A;  3VG5 A;  1MM9 A;  1HMS A;  1WBI A;  3OJY C;  4I95 A;  1SRI A;  3ZW0 B;  2X55 A;  1ERX A;  1VWL B;  4YGZ A;  2AH7 X;  4GGZ A;  1ICM A;  4ID2 A;  3WYP A;  5LJB A;  3FW5 A;  2RTM A;  3CKF A;  3OD9 A;  4ORS A;  1ZNE A;  4FQB B;  1KQX A;  5CHK A;  3SOT A;  1KT5 A;  4IRW A;  5B27 A;  3WJE A;  1SRJ A;  3EM0 A;  3P24 A;  1HMR A;  3PEC A;  3VG3 A;  1KQW A;  2WWP A;  1SWG A;  1DF8 A;  3U0D A;  4R0B A;  4TKJ A;  1DZJ A;  3MM0 A;  1HXL A;  3MBT A;  5FFH A;  4AZQ A;  1STP A;  1TOW A;  2DM5 A;  2X8T A;  3T2X A;  1OBQ A;  2X8S A;  1SRH A;  1SWP A;  2AMM X;  2ACP X;  1ZNL A;  2RTB B;  4I3C A;  4OS8 A;  5KIC A;  1A18 A;  4O4U A;  3WYQ A;  1WUB A;  3HWE A;  5CYB A;  2RN4 A;  2A8G A;  1K3B A;  1UZ2 X;  2A13 A;  2O62 A;  3KFI A;  4FBO A;  4NNT A;  2K23 A;  4NV7 A;  4CPE A;  1NGL A;  2KW1 A;  3LHN A;  5DPQ A;  1OEK A;  4Z6J A;  4BX6 A;  4FGI B;  2OL6 O;  5AQ6 A;  2BHV A;  4HPA A;  1RXH A;  3KZA A;  1URE A;  3RDQ A;  3BS2 A;  3PED A;  5CSE A;  5C0N A;  5HZ6 A;  5KID A;  1SWL A;  3HOE A;  3EW1 A;  3NX2 A;  2EU7 X;  2AT5 X;  3PPT A;  3HWF A;  1Y9T A;  1JJU A;  2A3F X;  1N7Y A;  4O4O A;  1LF7 A;  1VWP B;  3FR2 A;  4NP1 A;  4QAE A;  4QGX A;  5L3Y A;  2QO6 A;  4Y0R A;  4A1H A;  3VE2 A;  4EDE A;  3TGB A;  3WJD A;  3APV A;  1TXL A;  1P6P A;  5D48 A;  3STM X;  3HWG A;  1YWB A;  3DTQ A;  1RST B;  5IRA A;  3NR3 A;  2FKJ A;  1KFF A;  4I3D A;  3EMM A;  4LZV A;  4ZFX A;  2HLV A;  2WEX A;  5HTD A;  1ADL A;  2X46 A;  1HBQ A;  1S2P A;  4ZGF A;  1KT6 A;  4O3Y A;  4XMH A;  1YIV A;  5B3M O;  4Z27 A;  2RTH B;  1FJ1 E;  3O2Y A;  2WPU A;  3CKG A;  4O3X B;  5BVQ A;  1SXW A;  1T8V A;  1TOU A;  2GTF X;  4A1Y A;  2Q2P A;  2QM9 A;  3U9P C;  4BOE A;  4CV7 A;  1KT3 A;  4ML7 B;  4HPB A;  3RBY A;  1VWA B;  1ZRY A;  1KL3 A;  1YUP A;  4U3Q A;  5FQ6 E;  3B2J A;  1VWN B;  2HNX A;  3BU1 A;  2IFB A;  2X4M A;  1NQM A;  1T68 X;  1VYF A;  1I9H A;  2AT8 X;  1FTP A;  2BS5 A;  2MHD A;  2OL7 A;  3KFG A;  5IRU A;  1IFC A;  2RTO B;  2OY8 A;  3N91 A;  1JZU A;  1YP6 A;  3WJB A;  1VWM B;  2QOM A;  4HFO A;  5HWZ A;  4UU2 A;  1LEL A;  2GTL O;  5F6B A;  4D6A A;  1SWH A;  4I6S A;  2Z4I A;  3ELX A;  2R74 A;  3CMP A;  4YDA A;  2CBR A;  4O3W A;  2W2B A;  1Y52 X;  2ASN X;  4QYP A;  1NC9 A;  3FA8 A;  3ELZ A;  4AW8 A;  1GM6 A;  2KTD A;  4YMY A;  2POA A;  4IB7 A;  4NLI A;  5D47 A;  1EUO A;  1GGL A;  1H91 A;  3ZW1 A;  1I06 A;  3T1D A;  3F9D A;  2UZ2 A;  2G5L A;  1A57 A;  2YMS A;  3D96 A;  4Y0P A;  5KHP A;  4OKA A;  4BX5 A;  4WFV A;  2OVD A;  2A5B A;  4IMN A;  2JW1 A;  4QRL A;  4MVI A;  4WHI A;  3ZI8 A;  4ZHG A;  2RTQ B;  4KCA A;  4I9S A;  5H9K A;  3UEW A;  4Y59 A;  4ALB A;  1GKA A;  3O19 A;  4TQ2 A;  5FEN A;  4L3R A;  1SWU A;  1LCV A;  4BX7 B;  3PP6 A;  3FDC A;  1BEB A;  1LCW A;  4FBV A;  4GET A;  4Y5D A;  3BX7 A;  3WZQ A;  3APX A;  3CQR A;  3SLO A;  4CPF A;  2OFA A;  2FGS A;  1OBU A;  3Q6L A;  1BSQ A;  2A2G A;  3HWD A;  1SRF A;  2FHN X;  4U8U O;  4BQU A;  4I9R A;  1KT4 A;  5BYP A;  1BLR A;  1VYG A;  1PBY A;  1X8Q A;  1QWD A;  1ZNH A;  3DSZ A;  3NQ9 A;  1RXK A;  4HPC A;  1HXZ A;  1DV9 A;  3FIQ A;  1ICN A;  3P6D A;  1LCZ A;  2IZJ A;  2XKL A;  1N9M A;  3X00 A;  1KZW A;  4NLJ A;  4WFU A;  4Z2V A;  3Q34 A;  3RZY A;  4IMO A;  3NPO A;  5F7G A;  1EPA A;  4B55 A;  1E02 A;  1EQD A;  4XMG A;  1O8V A;  1NBX A;  3RWX A;  5HZ8 A;  2KTS A;  5HZQ A;  2QO4 A;  3RY1 A;  1TVQ A;  2RA6 A;  3BSZ E;  4IAB A;  1VPR A;  2I5Z O;  2FR2 A;  1XKI A;  4EFG A;  5AJC A;  2IZC B;  2G78 A;  2HYS A;  3C76 X;  4IB9 A;  3PH6 A;  4IBA A;  1LIC A;  5B29 A;  2AVI A;  2HMB A;  1LDQ A;  1EI5 A;  1GT5 A;  2LFO A;  3F8A A;  4DQ4 A;  1AB0 A;  2ZSC A;  5F1E A;  1EII A;  3VG2 A;  2HZR A;  1VWK B;  2VFB A;  1NP1 A;  3PK2 A;  2OFM X;  4GJV A;  4ODD A;  1GT1 A;  1JMZ A;  4YGH A;  2Y32 A;  1SY0 A;  2OFR X;  1SY1 A;  4CSB A;  2X8F A;  1SWS A;  3WOV A;  5HZ9 A;  2JU7 A;  2X34 A;  1LNM A;  3B2H A;  4ORX A;  3APU A;  3STK A;  3ZWE A;  2GTL N;  3NBX X;  5EED A;  3ZQ3 A;  1SY3 A;  3QQ2 A;  4NNS A;  4QQ1 A;  3RDX A;  1X8O A;  1VYO A;  1SLD B;  5L8I A;  3P6E A;  4RUN A;  1MEP A;  3RDM A;  3S5X A;  1JJJ A;  1GXA A;  3FA7 A;  4ARH A;  5H9A A;  1AQB A;  3S26 A;  4RUU A;  1JYD A;  4YBP A;  2FKG A;  4ZHH A;  3D9W A;  4TLJ A;  1DFV A;  4YCH A;  1W4T A;  4BJ8 A;  1VWG B;  2OY7 A;  3WBG A;  1QQS A;  3NQ3 A;  3LV4 A;  4CDE A;  3VU1 A;  1UYN X;  4CDC A;  4YKM A;  1FEN A;  3ZUI A;  5K67 A;  1SWK A;  3EBK A;  1AEL A;  4O4X A;  4AZP A;  3TZS A;  2BLG A;  2QO5 A;  3UEV A;  4NW4 A;  1VWO B;  4ZH9 A;  3S5V A;  5IO7 A;  3MX7 A;  3CWK A;  4UU3 A;  2GJ5 A;  1FDQ A;  3OBL A;  1HQP A;  3APW A;  1PBO A;  4I60 A;  1LIF A;  5HCC C;  1N43 A;  5BVT A;  4A8Z A;  4YDB A;  4ZHF A;  4A60 A;  2QCB A;  2L68 A;  4MVK A;  1QY1 A;  1SRG A;  2R56 A;  2AT0 X;  1RLB E;  3EC5 A;  5EPQ A;  1OEJ A;  1JQP A;  2WSJ A;  4MIS A;  4YKO A;  1VWH B;  2Y3F A;  3KVN A;  1Y53 X;  5H8T A;  1SWC A;  2OVS A;  5B10 O;  3CBS A;  3WJC A;  1YP7 A;  3LTW A;  2IZD B;  4ZR2 A;  1JJX A;  1IKE A;  2Q39 A;  4COT A;  4U8U N;  1Z24 A;  2JGS A;  3O22 A;  1BSY A;  2I5V O;  4GK9 A;  1Y0G A;  4XMC A;  3BY0 A;  1EPB A;  3B2I A;  1IFB A;  1SY2 A;  4LQZ A;  4WBK A;  3WZP A;  4BBO A;  5LKE A;  2CZU A;  1G5W A;  2JMB A;  3HTY A;  2RTA A;  2RTD B;  1LIB A;  1PEE A;  4ORU A;  1GX3 A;  2ZAG A;  5B11 O;  3ZUO A;  2UYW A;  1MX8 A;  2X56 A;  5F58 A;  2ACO A;  3BLG A;  2WQ9 A;  3SZI A;  2IZI A;  5FQ7 E;  3RDU A;  1STR B;  1T0V A;  2FR3 A;  2OF8 A;  4GRJ A;  4Z2O A;  4LKT A;  4NYQ A;  4CDD A;  1K24 A;  1GT3 A;  3CBC A;  4LKP A;  4QZU A;  1SWD A;  2K62 A;  4BVM A;  5HAE A;  3PDF A;  2WR6 A;  5IXG A;  1S44 A;  2E4J A;  1X8U A;  2IZF B;  1Y55 X;  2BC3 A;  2IZK A;  1VWI B;  4ZHC A;  1IJ8 A;  3D4R A;  4MEE A;  1AVE A;  5LJE A;  4OMX A;  3PH5 A;  4DQ3 A;  2BS6 A;  5LJD A;  1D2U A;  4FBR A;  4JGL A;  3D95 A;  1RXJ A;  1OBP A;  2LB6 A;  2QOS C;  2RTP B;  1XCA A;  2IZA A;  1JV4 A;  3K3L A;  4GJS A;  1KOI A;  2A0A A;  1SWB A;  4CPH B;  2RTR B;  2OY5 O;  1B56 A;  2WQA E;  4TKH A;  1A2D A;  1TW4 A;  4YCE A;  5HBS A;  5JD2 A;  5B5F A;  3TF6 A;  4GZV A;  3VHH A;  4M6S A;  2WUT A;  4NV8 A;  1E00 A;  4OS0 A;  1MDC A;  4GDA A;  3RE6 A;  4ALO A;  2FT9 A;  2FHL A;  1G85 A;  2JN3 A;  2N93 A;  3VG6 A;  1JMX A;  1GT4 A;  4ES7 A;  2DJG A;  1VWE B;  4GGT A;  4KII A;  1VWD B;  4GNY A;  4ZJ0 A;  4LZU A;  2L9C A;  1DC9 A;  5FAZ A;  3BRN A;  3RSW A;  4ORY A;  5HCD C;  3FLL A;  3PQU A;  5BVS A;  3IFB A;  1SLF B;  4O9S A;  3T6F A;  3VG4 A;  3ZW2 A;  1PM1 X;  3G7X A;  2C1Q A;  4CPI A;  5L8N A;  1KL5 A;  5HA0 A;  1IIU A;  1NP4 A;  2Y3E A;  3FEN A;  5EZ2 A;  4YFR A;  4AZM A;  3MVF A;  2IZH B;  5JR8 A;  2VFC A;  1SLG B;  1E5P A;  5LKF A;  3NP1 A;  3RDS A;  1SLE B;  2BT9 A;  2FS6 A;  2A2U A;  2OL8 O;  2PI3 O;  1AVG I;  3P6H A;  1E2T A;  3GE2 A;  2OF9 A;  1KXO A;  3F6Z B;  1RBP A;  3JQO A;  1CRB A;  1SWA A;  2HKD A;  1QY2 A;  2Z4H A;  4L1N A;  4MIR A;  3D97 A;  2RD7 C;  3KQ0 A;  2FWV A;  4O4S A;  2RTG B;  4CK4 A;  3TGC A;  4U46 A;  5B2A O;  3VGW A;  2CM9 A;  3HK1 A;  4BX6 B;  2ZAI A;  3VPJ E;  2RQ0 A;  2OVA A;  4JHQ A;  2YG2 A;  1KT7 A;  4QNI A;  1ZND A;  3EBW A;  4AYH A;  1LUQ A;  4IAW A;  4CDF A;  4N7D A;  1CBR A;  2P8G A;  2RCQ A;  4YBU A;  4AZN A;  1I05 A;  1QY0 A;  1DZK A;  1MK5 A;  4AZO A;  1BRP A;  1O1V A;  3EYC A;  1VWF B;  1B8E A;  2FLJ A;  4IAX A;  4N7C A;  1LID A;  4BX7 A;  5LJC A;  5HZ5 A; 
#chains in the Genus database with same CATH homology
 3I17 A;  4QGW A;  1PMP A;  2L67 A;  3FEP A;  1G7N A;  1U0X A;  1LFO A;  4GU8 A;  1JBH A;  1IW2 A;  2HZQ A;  3RKG A;  4YGG A;  2KT4 B;  2L5P A;  2NNE A;  3JS1 A;  2AKQ A;  3NQK A;  4NYR A;  4TJZ A;  1FEL A;  2R73 A;  4KC8 A;  3P02 A;  4Y0Q A;  2NNQ A;  1BSO A;  3BDR A;  2QMI A;  4U9C A;  3NAD A;  2CM4 A;  1EXS A;  1JIW I;  1X8P A;  4TKB A;  3FA6 A;  3SAO A;  1HMT A;  2ALL X;  1CJ5 A;  4EEJ A;  3ZW0 A;  4QGV A;  2JU8 A;  3P6C A;  3TGA A;  3PQS A;  2F09 A;  4OMW A;  4XMF A;  3VE1 A;  3FEK A;  4ZGU A;  4KT5 A;  1ML7 A;  3FEL A;  2OVE A;  1FE3 A;  1SXX A;  2KD2 A;  2LBA A;  4Y0S A;  3FW4 A;  1BM5 A;  3NX1 A;  1X89 A;  4QZT A;  3WXQ A;  1YWC A;  5F6Z A;  3HOL A;  4ZCB A;  5D8J A;  3B2K A;  1MVG A;  3UAQ A;  1ZNK A;  3U03 A;  3BX8 A;  1G74 A;  4YFP A;  2Q9S A;  1LIE A;  4AZR A;  3C77 X;  1ACD A;  1S7D A;  3FA9 A;  3FR5 A;  2CBS A;  3H3I A;  1HN2 A;  4IB8 A;  1OEE A;  4ZH6 A;  5IO5 A;  1CBS A;  1ALB A;  2Q4N A;  2WEW A;  5H9N A;  3S60 A;  2NP1 A;  5DG4 A;  4XMD A;  4GKC A;  2W2A A;  1SXU A;  3ZW1 B;  4O49 A;  1JYJ A;  1QG5 A;  3FR4 A;  5EDC A;  2LBV A;  5AEO A;  1FEM A;  3QKG A;  3VG7 A;  2MO5 A;  5IO6 A;  4MVE A;  3IA8 A;  3STN A;  1GKA B;  4GH7 A;  1CBQ A;  1B0O A;  2NND A;  3B2L A;  5L8O A;  5LJH A;  3WJG A;  1GX8 A;  1SXY A;  3JSQ A;  3BU9 A;  4YH0 A;  2LKK A;  1U17 A;  1DZM A;  2AT3 X;  3GAQ A;  4XME A;  3V8U A;  1SMP I;  1B4M A;  1JJX A;  2LA7 A;  4QYN A;  1HBP A;  1KZX A;  3AKN A;  3KFF A;  4EXZ A;  2M4L A;  5FQ8 E;  4O3Z A;  5K06 A;  2CZT A;  4KH8 A;  1DZP A;  5D45 A;  2Q2M A;  3FMZ A;  1SA8 A;  3AKM A;  2JOZ A;  2G79 A;  3P6G A;  5H9L A;  4PSQ A;  2FS7 A;  2G7B A;  1BJ7 A;  4INN A;  1I4U A;  3E3C A;  5AJB A;  4TNN A;  3KFH A;  1CBI A;  5CE4 A;  2GTL M;  4ZHD A;  1QAB E;  2F73 A;  1LKE A;  2FTB A;  1MX7 A;  4HWM A;  1L6M A;  5D4A A;  5HCE C;  1DF3 A;  1KGL A;  1O1U A;  4M7M A;  3ZZV A;  4D6B A;  1GX9 A;  2AT6 X;  2MM3 A;  1IKJ A;  2PY1 A;  2GC9 A;  2MJI A;  4YFQ A;  2RCT A;  1EW3 A;  1YWA A;  2AL0 X;  3P6F A;  4MVL A;  2XST A;  4ON1 A;  5HTE A;  2JU3 A;  1EIO A;  1ERB A;  4GNW A;  1YWD A;  3WVM A;  1U18 A;  2FRS A;  4OS3 A;  2X45 A;  1LPJ A;  2OZQ A;  1BWY A;  4K19 A;  1OPB A;  5EDB A;  1I04 A;  3OE3 A;  4GE1 A;  4PJ2 A;  2W2F A;  1OPA A;  1N0S A;  1BBP A;  1QFT A;  3FYF A;  3L4R A;  5HA1 A;  2MWH A;  1EAL A;  1A3Y A;  1QFV A;  2ANS A;  4U8U M;  4ORW A;  5LJG A;  3UEX A;  4IB6 A;  3I0A A;  5EEE A;  1X71 A;  4ORR A;  4GDZ A;  4I3B A;  1MUP A;  4KC7 A;  1D3S A;  3C78 X;  1X8N A;  4HPD A;  4EQA C;  3CR6 A;  5LJK A;  3UEU A;  1Y9L A;  1ZNG A;  3CQN A;  1R0U A;  1E06 A;  1BRQ A;  3VG5 A;  3ZW0 B;  3TGC A;  1HMS A;  3OJY C;  4I95 A;  1ERX A;  4YGZ A;  2AH7 X;  1ICM A;  4ID2 A;  5LJB A;  3FW5 A;  3OD9 A;  4ORS A;  1ZNE A;  4FQB B;  1KQX A;  3SOT A;  1KT5 A;  5B27 A;  3WJE A;  3P24 A;  3EM0 A;  3VG3 A;  1HMR A;  3PEC A;  1KQW A;  2WWP A;  3U0D A;  4R0B A;  4TKJ A;  1DZJ A;  3MBT A;  4AZQ A;  5FFH A;  1TOW A;  2DM5 A;  2X8T A;  1OBQ A;  2X8S A;  4I3C A;  3WJF A;  2AMM X;  2ACP X;  1ZNL A;  4OS8 A;  5KIC A;  1A18 A;  4O4U A;  3HWE A;  5CYB A;  2RN4 A;  1UZ2 X;  2O62 A;  2A13 A;  3KFI A;  4FBO A;  4NNT A;  2K23 A;  1NGL A;  2KW1 A;  3LHN A;  5DPQ A;  1OEK A;  4FGI B;  5AQ6 A;  2BHV A;  4HPA A;  3KZA A;  1URE A;  3BS2 A;  3PED A;  5C0N A;  5HZ6 A;  5KID A;  3HOE A;  3NX2 A;  2EU7 X;  2AT5 X;  3PPT A;  3HWF A;  1Y9T A;  2A3F X;  4O4O A;  4QGX A;  1LF7 A;  3FR2 A;  4NP1 A;  4QAE A;  3TGB A;  2QO6 A;  4Y0R A;  4A1H A;  3VE2 A;  3WJD A;  3APV A;  1TXL A;  1P6P A;  5D48 A;  3STM X;  3HWG A;  1YWB A;  3DTQ A;  3NR3 A;  4I3D A;  3EMM A;  4LZV A;  4ZFX A;  2HLV A;  2WEX A;  5HTD A;  1ADL A;  2X46 A;  1HBQ A;  1S2P A;  4ZGF A;  1KT6 A;  4O3Y A;  4XMH A;  1YIV A;  5BVQ A;  3O2Y A;  4O3X B;  1SXW A;  1T8V A;  1TOU A;  2GTF X;  4A1Y A;  2Q2P A;  2QM9 A;  3U9P C;  4BOE A;  4CV7 A;  1KT3 A;  4ML7 B;  4HPB A;  3RBY A;  1ZRY A;  1YUP A;  4U3Q A;  5FQ6 E;  3B2J A;  3BU1 A;  2HNX A;  2IFB A;  1T68 X;  1VYF A;  2AT8 X;  2MHD A;  1FTP A;  2BS5 A;  3KFG A;  1IFC A;  3N91 A;  1JZU A;  1YP6 A;  3WJB A;  4HFO A;  5HWZ A;  4UU2 A;  2GTL O;  5F6B A;  4D6A A;  4I6S A;  2Z4I A;  3ELX A;  2R74 A;  3CMP A;  4YDA A;  2CBR A;  4O3W A;  2W2B A;  2ASN X;  4QYP A;  3FA8 A;  3ELZ A;  4AW8 A;  1GM6 A;  2KTD A;  4YMY A;  2POA A;  4IB7 A;  4NLI A;  5D47 A;  1EUO A;  1GGL A;  1H91 A;  3ZW1 A;  1I06 A;  3T1D A;  3F9D A;  1A57 A;  2YMS A;  3D96 A;  4Y0P A;  5KHP A;  4WFV A;  2OVD A;  4IMN A;  4ZHG A;  2JW1 A;  4QRL A;  4MVI A;  4WHI A;  3ZI8 A;  4KCA A;  4I9S A;  5H9K A;  3UEW A;  4ALB A;  1GKA A;  3O19 A;  4TQ2 A;  4L3R A;  3PP6 A;  4FBV A;  1BEB A;  4GET A;  3BX7 A;  3APX A;  3CQR A;  1OBU A;  3Q6L A;  1BSQ A;  2A2G A;  3HWD A;  4U8U O;  4BQU A;  4I9R A;  1KT4 A;  5BYP A;  1BLR A;  1VYG A;  1X8Q A;  1QWD A;  1ZNH A;  3DSZ A;  3NQ9 A;  4HPC A;  1DV9 A;  3FIQ A;  1ICN A;  3P6D A;  2XKL A;  1KZW A;  4NLJ A;  4WFU A;  3RZY A;  4IMO A;  3NPO A;  5F7G A;  1EPA A;  1E02 A;  1EQD A;  4XMG A;  1O8V A;  5HZ8 A;  3RWX A;  2KTS A;  5HZQ A;  2QO4 A;  1TVQ A;  2RA6 A;  3BSZ E;  4IAB A;  1VPR A;  2FR2 A;  1XKI A;  4EFG A;  5AJC A;  2G78 A;  2HYS A;  3C76 X;  4IB9 A;  3PH6 A;  4IBA A;  1LIC A;  5B29 A;  2HMB A;  1EI5 A;  1GT5 A;  2LFO A;  3F8A A;  4DQ4 A;  1AB0 A;  5F1E A;  1EII A;  3VG2 A;  2HZR A;  1NP1 A;  2OFM X;  4ODD A;  1GT1 A;  4YGH A;  1SY0 A;  2OFR X;  1SY1 A;  4CSB A;  2X8F A;  3WOV A;  5HZ9 A;  2JU7 A;  1LNM A;  3B2H A;  4ORX A;  3APU A;  3STK A;  3ZWE A;  2GTL N;  3NBX X;  5EED A;  3ZQ3 A;  1SY3 A;  4NNS A;  4QQ1 A;  5FEN A;  1X8O A;  5L8I A;  1JJJ A;  3P6E A;  4RUN A;  3S5X A;  1GXA A;  3FA7 A;  4ARH A;  5H9A A;  1AQB A;  3S26 A;  4RUU A;  1JYD A;  4YBP A;  4ZHH A;  4TLJ A;  1DFV A;  4YCH A;  3WBG A;  1QQS A;  3NQ3 A;  3LV4 A;  3VU1 A;  4YKM A;  1FEN A;  3ZUI A;  1AEL A;  3EBK A;  4O4X A;  4AZP A;  3TZS A;  2BLG A;  2QO5 A;  3UEV A;  4NW4 A;  3S5V A;  4ZH9 A;  5IO7 A;  3MX7 A;  3CWK A;  4UU3 A;  2GJ5 A;  1FDQ A;  3OBL A;  1HQP A;  3APW A;  1PBO A;  5HCC C;  1LIF A;  5BVT A;  4A8Z A;  4YDB A;  4ZHF A;  4A60 A;  2L68 A;  4MVK A;  1QY1 A;  2R56 A;  5EPQ A;  2AT0 X;  1RLB E;  1OEJ A;  2WSJ A;  4MIS A;  4YKO A;  5H8T A;  2OVS A;  3CBS A;  3WJC A;  1YP7 A;  4ZR2 A;  1IKE A;  2Q39 A;  4COT A;  4U8U N;  1Z24 A;  3O22 A;  1BSY A;  4GK9 A;  4XMC A;  3BY0 A;  1EPB A;  3B2I A;  1IFB A;  1SY2 A;  4LQZ A;  4WBK A;  5LKE A;  1G5W A;  2CZU A;  2JMB A;  3HTY A;  1LIB A;  1PEE A;  4ORU A;  2ZAG A;  3ZUO A;  1MX8 A;  5F58 A;  2ACO A;  3BLG A;  2WQ9 A;  5FQ7 E;  1T0V A;  2FR3 A;  4GRJ A;  4LKT A;  4NYQ A;  4LKP A;  1GT3 A;  3CBC A;  4QZU A;  2K62 A;  4BVM A;  5HAE A;  2WR6 A;  1S44 A;  2E4J A;  1X8U A;  4ZHC A;  3D4R A;  5LJE A;  4OMX A;  3PH5 A;  4DQ3 A;  2BS6 A;  5LJD A;  1D2U A;  4FBR A;  4JGL A;  3D95 A;  1OBP A;  2LB6 A;  2QOS C;  1XCA A;  1JV4 A;  3K3L A;  1KOI A;  2A0A A;  1B56 A;  2WQA E;  4TKH A;  1A2D A;  1TW4 A;  4YCE A;  5HBS A;  3TF6 A;  4GZV A;  4M6S A;  2WUT A;  1E00 A;  4OS0 A;  1MDC A;  4ALO A;  2FT9 A;  1G85 A;  2JN3 A;  2N93 A;  3VG6 A;  1GT4 A;  4ES7 A;  4KII A;  4GNY A;  4ZJ0 A;  4LZU A;  2L9C A;  1DC9 A;  5FAZ A;  3BRN A;  3RSW A;  4ORY A;  5HCD C;  3FLL A;  3PQU A;  5BVS A;  3IFB A;  4O9S A;  3VG4 A;  3ZW2 A;  1PM1 X;  3G7X A;  5L8N A;  5HA0 A;  1IIU A;  1NP4 A;  3FEN A;  5EZ2 A;  4YFR A;  4AZM A;  3MVF A;  5JR8 A;  5LKF A;  1E5P A;  3NP1 A;  2FS6 A;  2BT9 A;  2A2U A;  1AVG I;  3P6H A;  3GE2 A;  1KXO A;  3F6Z B;  1RBP A;  3JQO A;  1CRB A;  1QY2 A;  2Z4H A;  4L1N A;  4MIR A;  3D97 A;  2RD7 C;  3KQ0 A;  2FWV A;  4O4S A;  4CK4 A;  2CM9 A;  3HK1 A;  2ZAI A;  3VPJ E;  2RQ0 A;  2OVA A;  2YG2 A;  1KT7 A;  4QNI A;  1ZND A;  3EBW A;  4AYH A;  4IAW A;  4N7D A;  1CBR A;  2P8G A;  2RCQ A;  4YBU A;  4AZN A;  1I05 A;  1QY0 A;  1DZK A;  4AZO A;  1BRP A;  1O1V A;  3EYC A;  4N7C A;  1B8E A;  2FLJ A;  4IAX A;  1LID A;  4EDE A;  5LJC A;  5HZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...