1OC8A

Tryparedoxin ii from c.fasciculata solved by mr
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
151
Chain Sequence
b'HMSGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNVEAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryparedoxins from Crithidia Fasciculata and Trypanosoma Brucei: Photoreduction of the Redox Disulfide Using Synchrotron Radiation and Evidence for a Conformational Switch Implicated in Function
pubmed doi rcsb
molecule keywords TRYPAREDOXIN II
source organism Crithidia fasciculata
molecule tags Electron transport
total genus 47
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oc8A00
1E2YA 2LQOA 2MBSA 4YAPA 1V98A 1A0RP 2GGTA 4MF5A 1G7EA 3W8JA 4V2LA 2ZCTA 3M8NA 3GKMA 5ID2B 4K2DA 5EL8A 2NBSA 1ZL9A 4BL7A 3GUSA 3TB2A 3EU3A 3P8WA 5ECQB 1B4QA 2LJRA 5J3RA 1R5PA 1A8LA 1TRWA 3HY2A 3TKRA 2YWOA 3IOSA 3TRQA 1PRXA 2R2JA 2O8VB 5KN0A 4ZL9A 1Z6NA 5ECLB 2DJ2A 5A4VA 1FB6A 1VF4A 3PH9A 1K0NA 1GUHA 3IAM2 4EKZA 4IS0A 2DIYA 5FHIA 1H75A 4KDYA 4L0WA 2DJKA 4K1FA 4YH2A 3CTFA 4TVEA 3LGCA 3HDCA 3FR3A 2CVKA 2X99A 1DE2A 2GSSA 3EMXA 2B5XA 1T8EB 2HFDA 2LJAA 1GUMA 5F07A 4DEJA 2MMAA 1YY7A 4EXJA 3D5JA 4MP4A 5CO3A 3MAKA 4JBBA 3WT2A 3PGTA 4IELA 4L5LA 2PBJA 5CP1A 1FAAA 5HR0A 2BMXA 3CRUA 3C1SA 2C3QA 1K0BA 2YWMA 6GSUA 1F3AA 2OACA 2ZUPA 6GSTA 3JCML 4Z7XA 1TK0B 2VD1A 5ID2A 2C0GA 4MABA 6GSVA 4LMWA 3GKNA 1HYUA 2X8GA 3GH6A 2VCWA 4IQAA 2LRTA 1TTZA 4I2UA 3K8NA 2DLXA 1SD9A 2PVQA 2GVPA 3LXTA 2F3MA 2X64A 1O7UA 4MA9A 3HD5A 3UVTA 1BYEA 2EIRA 1ZZYA 4GSSA 5D96A 1UC7A 2AHEA 2B1LA 4P3YB 3F0IA 1EEMA 2HSYA 1J0FA 3F6FA 4IJ3A 3LORA 3FZ5A 4PQHA 2VL2C 4KCEA 2E2GA 3EWLA 2M72A 5A4WA 3EC3A 4HJ2A 4KA0A 1M9BA 2B5YA 1M2AA 3TOUA 2FCHA 1XZOA 2I4AA 3FRCA 3GL3A 1BAYA 1ZYEA 2L4CA 4DSSB 4AF2A 3QDNA 4XCSA 4GTUA 1X9MB 3L9VA 3G7IA 4EL1A 1EGRA 4OMVA 1G0TA 2L59A 4K6XA 4JRRA 2VOCA 3D22A 3GNJA 3E9JB 5AIXA 1WWJA 1SL2B 1Y6EA 1GLQA 2C3NA 4JEDA 2L5OA 1G7OA 1AW9A 2HT9A 1SL1B 3TRXA 1OE8A 2H1BA 4KSMA 3TJFA 1K3OA 3M9KA 2E0QA 5F8BA 2E2MA 4GSTA 3D4TA 3RAZA 1WPIA 1FVKA 2YANA 3IA1A 3RHCA 2HRFA 1LBKA 4IP1A 1KTEA 3H79A 3QR6A 2LNTA 2K18A 2RM6A 4LLRA 4JE1A 2H66A 3NZNA 5GAND 3UL3A 2H70A 4O7HA 3IV4A 2O85A 4I6XA 2EIQA 2KLXA 4IHUA 3EVIA 5J41A 3HJPA 5ABRA 4L0UA 4BWSA 3KIJA 3ZREA 5A5KA 3QAWA 3APOA 1QFNA 4KNDA 2M80A 4E8HA 4WBJA 3TRPA 4H86A 4WF5A 5IPGA 1XWAA 1XOAA 11GSA 1YKAA 3I43A 1BX9A 1WE0A 4V2MA 2GZZA 2GZYA 1EP7A 1YJ6A 1A2LA 4NWYA 4NXIA 4MPFA 1GSDA 2KUCA 3CXGA 2B3SA 2LKUA 2WFCA 4TKYA 2VL9A 2ZNMA 1EP8A 3VI5A 3RHBA 2RLIA 3UMAA 3TKSA 4JU5A 1O8WA 1MTCA 3UBKA 3UVHA 2AYTA 3FR9A 3HZ4A 3O6TA 1PQNA 4MZWA 3LQ7A 5HQPA 4KB3A 1OC8A 1TP9A 2C3TA 4ZIJA 1WRYA 5CYYA 1Q4JA 5KEJA 2PN8A 2KOKA 4PX1A 4RQRA 5LNKe 2IIYA 5CRDA 5L71A 2GQKA 4AGSA 5KN1A 4ILFA 5DVBA 3ZMLA 4ECJA 1FW1A 1SL0B 2OE1A 2DJ3A 4MJEA 1Q98A 1KBNA 2PERA 3HVXA 2TIRA 5HFKA 1SKRB 2JSYA 2H72A 3DIEA 3ZYWA 1A2MA 1V57A 2OBIA 1HNCA 2L5LA 1J08A 1DUGA 1VGLA 2H6YA 4PUAA 4Q5FA 1AQXA 1KEBA 4X1UA 3HKRA 1T4YA 3M9JA 2O7KA 1B4PA 2C0DA 3IRAA 4HS1A 2A2RA 2XC2A 4PNFA 2H71A 2QKEA 2FWGA 3BCIA 4ACSA 4BWQA 1K3YA 4MJCA 2H6XA 2L57A 4O32A 4V2NA 3UIWA 3M0FA 3ZITA 3EE2A 5F06A 1OVNA 1TK5B 3Q6OA 4RQXA 4ISDA 2NTOA 2VAFA 2I9HA 1IYIA 1HD2A 5GAPD 14GSA 4GWRA 4CW9A 1G6YA 2GLRA 1FHEA 1F2EA 1M9AA 4XTSA 3GSSA 4HZ2A 4WBRD 1LJRA 2LTKA 4KSOA 3CMIA 3CYNA 5JWQB 5IQYA 2GZPA 3NIVA 2DC5A 2H19A 1K0CA 4D73B 2C0FA 1SU9A 3QD9A 1B8XA 2DIZA 4NHWA 3QCPA 4KE3A 1R7HA 5G1LA 4HU9A 3ZMKA 1ACVA 1K3LA 3UAPA 3WYWA 4NMUA 5ECKB 5G2ZA 12GSA 4IN0A 3KGKA 1T1VA 3IPZA 1TRVA 2HXKA 3GRXA 5IMCA 3RDWA 1PSQA 5AISA 3GH9A 1GSSA 4V1Ag 1JFUA 2CT6A 17GSA 3CSJA 2TRXA 4OO5A 1W4VA 2H8LA 4X0XA 4EF0A 4YQMA 1WOUA 4PQ1A 2AB6A 3KH9A 1YQ1A 2H0GA 1B48A 3UEMA 2L6CA 2JZRA 1PX6A 4POLA 4KX4A 4MZBA 1TU7A 1G6WA 1WMJA 2L4QA 4HQSA 1HQOA 2YV7A 4MPGA 3VLNA 4TR3A 4YQVA 3TKQA 19GSA 2C4JA 2YCDA 2YV9A 4GF0A 4K8MA 1U3IA 1XW6A 3WT1A 2V6KA 1AQWA 3FHKA 5G1KA 1OC3A 5FWGA 2GDRA 4OCEA 1NM3A 2K9FA 3BD2A 2CA8A 3QOUA 1PKZA 2VCTA 1X5CA 1ERWA 4D73A 3ZFLA 3QMXA 4ZXGA 4ZL7A 1XFLA 1TJDA 3IE3A 3MNGA 3HXSA 4AJ8A 4N30A 2ON7A 1K0OA 2LQQA 2JACA 4WF4A 2GQLA 3L9SA 2I1UA 2YP6A 4KGIA 5F05A 2CV4A 3ZRDA 2P31A 1S3DA 1EOGA 2PU9C 4IQ1A 3MSZA 4WEYA 4ECIA 1UN2A 4GQFA 1A24A 4NV2A 1YF1A 3ZTLA 1OAZA 2IMDA 3MDKA 1Y25A 3TUEA 3HHVA 2K8SA 4GQCA 2A4VA 1TI1A 2ES7A 2FA4A 1V2AA 5HR3A 4MK3A 5COHA 2AAWA 4BA7A 5ECNB 1TRSA 3PINA 1SKSB 1CQHA 2OADA 1ZCPA 1GTUA 3N5OA 4O5RA 2QC7A 3PR8A 3VFIA 2H6ZA 1XVWA 5ELGA 1K0AA 2A2SA 4WETA 3AY8A 2WS2A 1GNWA 5ECOB 2RUEA 2X8CA 4XRAA 4RI6A 2YZHA 4JZQA 2REMA 3LWAA 2KP1A 3IC4A 2HSHA 3D0ZA 4YAVA 3C1RA 1I9DA 2WDUA 2PPTA 3Q74A 2CVDA 3GSTA 2I3YA 5HR2A 2VCVA 4IKHA 3F9UA 2HZEB 4XHMA 3D21A 4KDXA 1RW1A 4L8EA 1GWCA 3F3RA 1JZRA 1USBA 3LJRA 3IR4A 2GQMA 1A8YA 4PGTA 2VLUA 4FO5A 3KJYA 1NHOA 5IPHA 2LSTA 5IMAA 1YKCA 3CSHA 3U5RE 1W89A 2MBTA 4G19A 1ML6A 3HZ8A 4N0VA 2GSTA 4HDEA 4WKWA 2IFQB 4EDYA 1PMTA 4MH2A 1QUWA 3ZL5A 2IN3A 1EV4A 5GZZB 5EVOA 3GKKA 1SK2A 2F51A 1QXHA 2B5EA 1T00A 3F63A 1PA3A 5GSTA 4ZB9A 1ST9A 3TKSE 3UBLA 2V2GA 4ZBBA 1V40A 3DRNA 4HZ4A 3O3TA 5CRGA 2VCQA 4KCAA 1TOFA 1OKTA 3KZQA 4N0ZA 4KDUA 1T7PB 2IMEA 4OO4A 2LEGA 2FNOA 4AJ7A 3KD0A 3GA4A 4LL4B 3GMFA 4PXOA 4TR1B 3IK9A 2HZEA 2LRCA 5IO2A 2WZ9A 5D93A 3BBYA 1TXXA 2HE3A 2JSZA 2OE0A 2VL2A 4I2TA 3J7Yb 3GV1A 4V1Ap 5IM9A 3ERWA 4OWYA 1GTIA 4HUAA 3IK7A 3TGZA 2PUKC 5HFIA 5JCUA 5G5FA 3KEBA 5DBQA 4ZB8A 2CAQA 5J5NA 4IBPA 3DMLA 1F37A 1TDIA 2WGRA 4K7NA 3HJMA 1NW2A 2V32A 4DSSA 2CX3A 3F3QA 1SENA 3H1NA 3TKSC 2AV4A 3VPTA 3KMOA 3F8UA 3TOTA 1MEKA 2FY6A 4MDCA 4ZL8A 1OE7A 4AJ6A 1GNEA 5ECPB 2AUVA 2VLTA 1BQ7A 4KW6A 3GX0A 3BOAA 3J7Yk 1WJKA 2K6VA 1WP0A 3VWVA 2LJKA 3BJ5A 3A5WA 5E59A 4ID0A 3CBUA 3C8EA 3KXOA 4XS4B 3LG6A 2CZ2A 3R2QA 1SK0A 1Z3EA 2NPBA 4ECBA 3ISOA 1U87A 4OCFA 3RPNA 2YJ7A 4E8EA 3ZIVA 4F2IA 3IDVA 1BG5A 5JWRB 3KMNA 1O81A 2GT6A 3SWLA 3I9V2 5LCZA 2HYXA 16GSA 4PUFC 3GL5A 2ON5A 4BPYA 3TDGA 3A2WA 3KP9A 2NVLA 4IGJA 1SKWB 3F4SA 3WGEA 3DWVA 5GSSA 1QK8A 2DJ0A 3KTLA 4TRXA 4CHSA 3QAGA 1EWXA 4I8BA 4ML1A 3CSIA 1TI3A 4MF7A 4WR5A 3W8SA 2PVOC 5JWOB 4IP6A 3HVVA 2B1KA 1KNGA 2VO4A 2YNXA 4FYCA 1B9YC 3D6IA 1YF0A 5C00A 4IJIA 1GTAA 4MMMA 3RPPA 1XBSA 2VCZA 5ECIB 4EVMA 1DBYA 2J9HA 3RBTA 4F82A 2B7KA 5C04A 1S3CA 5ECSA 3IAS2 4XS4A 4TOPA 5F0GA 1X0RA 1U6TA 5EY6A 3CTGA 4L5OA 1MDKA 4HJMA 1K0DA 1A23A 3IXRA 1XIYA 4FYBA 2DSAA 1SYRA 1EEJA 5IIZA 3ZFBA 2WULA 1ILOA 2BJXA 5D9TA 3L9UA 1EOHA 5DAKB 2FUG2 2H73A 2CVBA 2H1DA 2IWTA 1SK1A 2WRTA 3WD6A 2YOIA 3QFBC 2CX4A 1XWGA 1M0UA 2O89A 3C73A 4ECCA 1XVQA 2JZTA 3VPQA 4QL7A 3LXZA 3IHQA 5IMZA 2IMIA 1XW9A 2GSRA 2VLVA 2R6KA 3ME7A 3FW2A 3GURA 5ECRB 2YPMA 5HFGA 3M1GA 4XS1A 4Q5QA 1PKWA 1IYHA 4O92A 2IPAA 3EURA 3SBCA 4ZILA 3E3EA 2FHEA 2FWHA 2H0HA 4MJAA 1ZYQB 5IO0A 1V9WA 3GKXA 3HYPA 4J57E 3N9JA 3OR5A 5D8IA 3ED3A 3LSZA 3F6DA 1SD8A 3ZLPA 3GFKA 3GHAA 1GSUA 3Q18A 1VF3A 1ZGNA 5H5QA 5H5RA 3HCZA 3TJBA 3EU4A 2YWNA 1TK8B 4F0CA 4KUNA 3WGDA 1E6BA 1PL1A 2VIMA 2IJYA 3VWWA 4OFTA 2LV3A 1AQVA 2H0IA 3G9BA 2H74A 4G2EA 3CRTA 3WGXA 5B7CA 2H01A 5LD0A 1I5GA 5DALB 3UARA 2N5AA 1U88A 5INYA 2DJ1A 3C71A 5FT3A 2PGTA 3DXBA 3APQA 3IBHA 3ZVJA 4MJBA 3L0HA 3KTBA 5JCGA 3HA9A 1TU8A 3P7XA 1PX7A 4ZBDA 1TW9A 2JL4A 4OD7A 2VUPA 4TXOB 2YWIA 1VRSD 4XIHA 1SJ6A 3DVXA 5G30A 2FWEA 1URMA 3NOFA 2FGXA 4HI7A 3VURA 2B7JA 4EO3A 3Q19A 1FO5A 3EYTA 1GULA 4F0BA 1LU4A 4CDOA 1WIKA 3TJJA 4XS6A 4QL9A 2F8AA 1NHYA 2QGVA 5AGYA 2FA8A 1GP1A 5AIVA 1PN9A 4MZCA 2JU5A 2YJHA 4YQUA 2C0EA 3ZZXA 3A2VA 4EDZA 5CREA 1PD21 1JLVA 1Z5YE 1J9BA 2DMLA 4F9ZA 5DALA 3TJGA 2P0GA 1TRUA 3H4KA 1K0MA 5B6NA 5IMVA 1MDJA 1VF2A 1GSQA 1V58A 5B8BA 5D73A 5IOWA 2C8UA 20GSA 4TXOA 3GTUB 3KH7A 1N8JA 4POMA 2H1AA 4GSNA 4N11A 1FOVA 4POKA 1OYJA 2R37A 3H8QA 4PURA 3DGQA 22GSA 1X9SB 1ERUA 3M3MA 1M2DA 2MMNA 3GN3A 4FH8A 9GSSA 3QAVA 2XBIA 1ZMAA 2V6OA 2QSIA 1THXA 2OE3A 1XOBA 2MZCA 2WB9A 5JCWA 2V1MA 1O8XA 2H76A 4DVCA 5D9WA 5DQYA 1YZXA 1RQMA 4NV5A 13GSA 4OFNA 4HEA2 4MH3A 2VM1A 2AJQB 2YZUA 2P5RA 5IMFA 3LYKA 1GUKA 1YDKA 3KP8A 4TR0A 3LYPA 1RK4A 1A0FA 2V41A 3L78A 2VD0A 4GRFA 3F4RA 1JZDA 1R4WA 4NAXA 3UJ1A 3GTUA 1SYXA 3ZVJD 1QQ2A 2WJUA 5E4WA 5B6MA 3DD3A 2LUSA 2H1GA 1A2JA 4GCIA 2H75A 1SJIA 5AN1A 3S9FA 1M99A 2OBKA 2C1YA 1AC1A 1Z9HA 2M46A 2N5BA 3ERGA 1YEXA 2YN1A 4DSQA 5CRHA 1Z6MA 4GLTA 4I97A 3LFLA 1XW5A 4WXTA 1H4OA 1ERTA 5ELAA 2R5GA 2IFQA 2LS5A 4WR4A 4FIWA 1XWKA 5KN3A 5G5EA 2CQ9A 2O87A 3HJOA 3W6GA 2XBQA 2F9SA 3U6VA 1EGOA 3A2XA 5ENUA 3KCMA 3GX8A 3QPMA 4MLYA 5D9XA 2BTOT 5ECHB 2CZ3A 5DQSA 1QGVA 3GYKA 1CQGA 1MD3A 4BVXA 1GSYA 6GSWA 1PGTA 3G7YA 4XRDA 5J9CA 1JLWA 1EZKA 2P5QA 1DE1A 3MWHA 4J2FA 5J4UA 3DKSA 2NDOA 2HZFA 4JR6A 4POBA 2IMFA 1XWBA 2MMOA 3E0UA 1HNAA 2IMKA 1GSEA 4K7IA 1F6MC 3ME8A 3FK8A 2HRNA 5G31A 3VK9A 4TR1A 2RUFA 1M2BA 1S3AA 5H5SA 1QMVA 4J56E 2DMMA 1AAZA 1GSFA 4OFMA 1XPVA 3FZ9A 1BJXA 4NHZA 4MF6A 4EE0A 4ULXA 2JZSA 1VF1A 1OKDA 1R26A 2FLSA 4ZBAA 4GXZA 3FKFA 3FZ4A 1X5DA 1JZWA 2D2ZA 5IMDA 1BEDA 5IOXA 1T3BA 1OC9B 18GSA 5EPFA 1AIUA 1O85A 1HNBA 1XCCA 3FR6A 5KN2A 3BCKA 3D4MA 3FYGA 3P2AA 1O6JA 3VWXA 1X5EA 5DJLA 2G0FA 1N2AA 4PNGA 2VM2A 4K7OA 2FWFA 2F8FA 2ALBA 4NPBA 5D9VA 3VI7A 2XPEA 2K8VA 5B8AA 1GRXA 3APSA 1FB0A 4HOJA 3GIXA 4N10A 2RM5A 5DDLA 8GSSA 4QQ7A 2B6MA 2MMZA 3ERFA 2WCIA 1U3AA 5A4UA 2X8HA 1ERVA 1ZOFA 10GSA 3FY7A 3L4NA 3QFAC 2LRNA 4TN8A 1EV9A 1GL8A 4IVFA 7GSSA 2OA7A 5HR1A 2FD3A 2OKAA 4Q5NA 3TJKA 5DJMA 4LL1B 2J23A 3I6AA 3VWUA 4RUVA 2R4VA 3ZIJA 4X43A 2JADA 1FVJA 2N5FA 5DCGA 1OC9A 2I81A 4PQIA 6GSSA 1Z7RA 1B9XC 2GSQA 1O73A 2PMTA 4EC0A 5CNWA 1DSBA 4IW9A 4EUYA 4ML6A 2H30A 1GH2A 3V1WA 2RIIA 4K0NA 1JZOA 1THOA 1YEPA 6GSYA 5CAXA 4FYUA 3F4TA 5J9BA 4TW5A 2OJLA 3O76A 4TXVA 1F9MA 4KAEA 1XWCA 3KM6A 3FZAA 3EMPA 1SJZA 5ECMB 1AXDA 1UA5A 1MDIA 1ON4A 4G9HA 1GLPA 2L6DA 4HU7A 3A3TA 2DBCA 3UOMA 2GTUA 4I5QA 3DVWA 1X9WB 1UVZA 3EINA 2TRCP 2HNLA 1T4ZA 3US3A 2HI7A 1PL2A 1R5AA 3LEFA 3P90A 2PWJA 3G7JA 2IL3A 2VL3A 2CAIA 4LMVA 1XXUA 1ABAA 4TR4A 1AUCA 2XPDA 4KH7A 2MYGA 3I69A 2HLSA 1NSWA 3DEXA 4LA1A 5CRWA 4F03A 4K0GA 5DAKA 1F3BA 2KP2A 2KHPA 2GS3A 4DSRA 1M7TA 4G10A 2VCXA 3TCOA 4HQZA 2GT5A 2EIOA 1MD4A 2XHFA 3HVSA 5DCHA 2G2QA 3H93A 3DYRA 4K9ZA 2LNSA 2Z9SA 4MCUA 2EC4A 1Z7PA 6GSXA 1GTBA 2C80A 2DJJA 3FEUA 2E7PA 1JHBA 4BVYA 3C7MA 4ZB6A 4Q5RA 1FG4A 2R3XA 3TKPA 1TKDB 1C72A 4JR4A 4RI7A
chains in the Genus database with same CATH superfamily
1E2YA 2LQOA 2MBSA 4YAPA 1V98A 1A0RP 2GGTA 4MF5A 1G7EA 3W8JA 4V2LA 2ZCTA 3M8NA 3GKMA 5ID2B 4K2DA 5EL8A 2NBSA 1ZL9A 4BL7A 3GUSA 3TB2A 3LW9A 3EU3A 3P8WA 5ECQB 1B4QA 2LJRA 5J3RA 1R5PA 1A8LA 1TRWA 3HY2A 3TKRA 2YWOA 3IOSA 3TRQA 1PRXA 2R2JA 2QA1A 2O8VB 5KN0A 4ZL9A 2R0CA 1Z6NA 5ECLB 2DJ2A 5A4VA 1FB6A 1VF4A 3IHGA 3PH9A 1K0NA 1GUHA 3IAM2 4EKZA 4IS0A 2DIYA 5FHIA 1H75A 4KDYA 4L0WA 2DJKA 4K1FA 4YH2A 3CTFA 4TVEA 3LGCA 3HDCA 3FR3A 2CVKA 2X99A 1DE2A 2GSSA 3EMXA 2B5XA 1T8EB 2HFDA 2LJAA 1GUMA 5F07A 4DEJA 2MMAA 1YY7A 4EXJA 3D5JA 4MP4A 5CO3A 3MAKA 4JBBA 3WT2A 3PGTA 4IELA 4L5LA 2PBJA 5CP1A 1FAAA 5HR0A 2BMXA 3CRUA 3C1SA 5BRTA 2C3QA 1K0BA 2YWMA 6GSUA 2R0GA 1F3AA 2OACA 2ZUPA 6GSTA 3JCML 4Z7XA 1TK0B 2VD1A 5ID2A 2C0GA 4MABA 6GSVA 4LMWA 3MYDA 3GKNA 1HYUA 2X8GA 3GH6A 2VCWA 4IQAA 2LRTA 1TTZA 4I2UA 3K8NA 2DLXA 1SD9A 2PVQA 2GVPA 3LXTA 2F3MA 2X64A 1O7UA 4MA9A 3HD5A 3UVTA 1BYEA 2EIRA 1ZZYA 4GSSA 5D96A 1UC7A 2AHEA 2B1LA 4P3YB 3F0IA 1EEMA 2HSYA 1J0FA 2UZ8A 3F6FA 4IJ3A 3LORA 3FZ5A 4PQHA 2VL2C 4KCEA 2E2GA 3EWLA 2M72A 5A4WA 3EC3A 4HJ2A 4KA0A 1M9BA 2B5YA 1M2AA 3TOUA 2FCHA 1XZOA 2I4AA 3FRCA 3GL3A 1BAYA 1ZYEA 2L4CA 4DSSB 4AF2A 3QDNA 4XCSA 4GTUA 1X9MB 2A4HA 4YKFA 3L9VA 3G7IA 3IC8A 4EL1A 1EGRA 4OMVA 1G0TA 2L59A 4K6XA 4JRRA 2VOCA 3D22A 3GNJA 3E9JB 5AIXA 1WWJA 1SL2B 1Y6EA 1GLQA 2HSMA 2C3NA 4JEDA 2L5OA 1G7OA 1AW9A 2HT9A 1SL1B 3TRXA 1OE8A 2H1BA 4KSMA 3TJFA 1K3OA 3M9KA 2E0QA 5F8BA 2E2MA 4GSTA 3D4TA 3RAZA 1WPIA 1FVKA 2YANA 3IA1A 3RHCA 2HRFA 1LBKA 4IP1A 3EPTA 1KTEA 3H79A 3QR6A 2LNTA 2K18A 2RM6A 4LLRA 4JE1A 2H66A 3NZNA 5GAND 3UL3A 2H70A 4O7HA 3IV4A 2O85A 4I6XA 2EIQA 2KLXA 4IHUA 3EVIA 5J41A 3HJPA 5ABRA 4L0UA 4BWSA 3KIJA 3ZREA 5A5KA 3QAWA 3APOA 1QFNA 4KNDA 2M80A 4E8HA 4WBJA 3TRPA 4H86A 3PPUA 4WF5A 5IPGA 1XWAA 1XOAA 11GSA 1YKAA 3I43A 1BX9A 1WE0A 4V2MA 2GZZA 2GZYA 1EP7A 1YJ6A 1A2LA 4NWYA 4NXIA 4MPFA 1GSDA 2KUCA 3CXGA 2B3SA 2LKUA 2WFCA 4TKYA 2VL9A 2ZNMA 1EP8A 3VI5A 3RHBA 2RLIA 3UMAA 3TKSA 4JU5A 1O8WA 1MTCA 3UBKA 3UVHA 2AYTA 3FR9A 4G0IA 3HZ4A 3O6TA 1PQNA 4MZWA 3LQ7A 5HQPA 4KB3A 1OC8A 1TP9A 2C3TA 4ZIJA 1WRYA 5CYYA 4K2XA 1Q4JA 5KEJA 2PN8A 2KOKA 4PX1A 4RQRA 5LNKe 2IIYA 5CRDA 5L71A 4CY6A 2GQKA 4AGSA 1S3RA 5KN1A 4ILFA 5DVBA 3ZMLA 4ECJA 1FW1A 1SL0B 2OE1A 2DJ3A 4MJEA 1Q98A 1KBNA 2PERA 3HVXA 2TIRA 5HFKA 1SKRB 2JSYA 2H72A 3DIEA 3ZYWA 1A2MA 1V57A 2OBIA 1HNCA 2L5LA 1J08A 1DUGA 1VGLA 2H6YA 4PUAA 4Q5FA 1AQXA 1KEBA 4X1UA 3HKRA 1T4YA 3M9JA 2O7KA 1B4PA 2C0DA 3IRAA 4HS1A 2A2RA 4CY8A 2XC2A 4PNFA 2H71A 2QKEA 2FWGA 3BCIA 4ACSA 4BWQA 1K3YA 4MJCA 2H6XA 2L57A 4O32A 4V2NA 3UIWA 3M0FA 3ZITA 3EE2A 5F06A 1OVNA 1TK5B 3Q6OA 4RQXA 4ISDA 2NTOA 2VAFA 2I9HA 1IYIA 1HD2A 5GAPD 14GSA 4GWRA 4CW9A 1G6YA 2GLRA 1FHEA 1F2EA 1M9AA 4XTSA 3GSSA 4HZ2A 4WBRD 1FOHA 1LJRA 2LTKA 4KSOA 3CMIA 3CYNA 5JWQB 5IQYA 2GZPA 3NIVA 2DC5A 2H19A 1K0CA 4D73B 2C0FA 1SU9A 3QD9A 1B8XA 4PTSA 2DIZA 4NHWA 3QCPA 4KE3A 1R7HA 5G1LA 4HU9A 4MNNA 3ZMKA 1ACVA 1K3LA 3UAPA 3WYWA 4NMUA 5ECKB 5G2ZA 12GSA 4IN0A 3KGKA 1T1VA 3IPZA 1TRVA 2HXKA 1M3IA 3GRXA 5IMCA 3RDWA 1PSQA 5AISA 3GH9A 1GSSA 4V1Ag 1JFUA 2CT6A 17GSA 3CSJA 2TRXA 4OO5A 1W4VA 2H8LA 4X0XA 4EF0A 4YQMA 1WOUA 4PQ1A 4EIQA 2AB6A 3KH9A 1YQ1A 2H0GA 1B48A 3UEMA 2L6CA 2JZRA 1PX6A 4POLA 4KX4A 4MZBA 1TU7A 1G6WA 1WMJA 2L4QA 4HQSA 1HQOA 2YV7A 4MPGA 3VLNA 4TR3A 4YQVA 3TKQA 19GSA 2C4JA 2YCDA 2YV9A 4GF0A 4K8MA 1U3IA 1XW6A 3WT1A 2V6KA 2HRKA 1AQWA 3FHKA 5G1KA 1OC3A 5FWGA 2GDRA 4OCEA 1NM3A 2K9FA 3BD2A 2CA8A 3QOUA 1PKZA 2VCTA 1X5CA 1ERWA 4D73A 3ZFLA 3QMXA 4ZXGA 4ZL7A 1XFLA 1TJDA 3IE3A 3MNGA 3HXSA 4AJ8A 1ZYPA 4N30A 2ON7A 1K0OA 2LQQA 2JACA 4WF4A 2GQLA 3L9SA 2I1UA 2YP6A 4KGIA 5F05A 2CV4A 3ZRDA 2P31A 1S3DA 3MIXA 1EOGA 2PU9C 4IQ1A 3MSZA 4WEYA 4ECIA 1UN2A 4GQFA 1A24A 4NV2A 1YF1A 3ZTLA 1OAZA 2IMDA 3MDKA 1Y25A 3HVNA 3TUEA 3HHVA 2K8SA 4GQCA 2A4VA 1TI1A 2ES7A 2FA4A 1V2AA 5HR3A 4MK3A 5COHA 2AAWA 4BA7A 5ECNB 4G0LA 1TRSA 3PINA 1SKSB 1CQHA 2OADA 1ZCPA 1GTUA 3N5OA 4O5RA 2QC7A 3PR8A 3VFIA 2H6ZA 1XVWA 5ELGA 1K0AA 2A2SA 4WETA 3AY8A 2WS2A 1GNWA 5ECOB 2RUEA 2X8CA 4K5SA 4XRAA 4RI6A 2YZHA 4JZQA 2REMA 3LWAA 2KP1A 3IC4A 2HSHA 1M3JA 3D0ZA 4YAVA 3C1RA 1I9DA 2WDUA 2PPTA 3Q74A 2CVDA 3GSTA 2I3YA 5HR2A 2VCVA 4IKHA 3F9UA 2HZEB 4XHMA 3D21A 4KDXA 1RW1A 4L8EA 1GWCA 3F3RA 1JZRA 1USBA 3LJRA 3IR4A 2GQMA 1A8YA 4PGTA 2VLUA 4FO5A 3KJYA 1NHOA 5IPHA 2LSTA 5IMAA 1YKCA 3CSHA 3U5RE 1W89A 2MBTA 4G19A 1ML6A 3HZ8A 4N0VA 2GSTA 4HDEA 4WKWA 2IFQB 4EDYA 1PMTA 4MH2A 1QUWA 3ZL5A 2IN3A 1EV4A 5GZZB 5EVOA 3GKKA 1SK2A 2F51A 1QXHA 2B5EA 1T00A 3F63A 1PA3A 5GSTA 4ZB9A 1ST9A 3TKSE 3UBLA 2V2GA 4ZBBA 1V40A 3DRNA 4HZ4A 3O3TA 5CRGA 2VCQA 4KCAA 4EIPA 1TOFA 5KOXA 1OKTA 3KZQA 4N0ZA 4KDUA 1T7PB 2IMEA 4OO4A 2LEGA 2FNOA 4AJ7A 3KD0A 3GA4A 4LL4B 3GMFA 4PXOA 4TR1B 3IK9A 2HZEA 4FQUA 2LRCA 5IO2A 2WZ9A 5D93A 3BBYA 1TXXA 4ICYA 1ZYNA 2HE3A 2JSZA 2OE0A 2VL2A 4I2TA 3J7Yb 3GV1A 4V1Ap 5IM9A 3ERWA 4OWYA 1GTIA 4HUAA 3IK7A 3TGZA 2PUKC 5HFIA 5JCUA 5G5FA 3KEBA 5DBQA 4ZB8A 2CAQA 5J5NA 4IBPA 3DMLA 1F37A 1TDIA 2WGRA 4K7NA 3HJMA 1NW2A 2V32A 4DSSA 2CX3A 3F3QA 1SENA 3H1NA 3TKSC 2AV4A 3VPTA 3KMOA 3F8UA 3TOTA 1MEKA 2FY6A 4MDCA 4ZL8A 1OE7A 4AJ6A 1GNEA 5ECPB 2AUVA 2VLTA 1BQ7A 4KW6A 3GX0A 3BOAA 3J7Yk 1WJKA 2K6VA 1WP0A 3VWVA 2LJKA 3BJ5A 3A5WA 5E59A 4ID0A 3CBUA 2DKIA 3C8EA 3KXOA 4XS4B 3LG6A 2CZ2A 3R2QA 1SK0A 1Z3EA 2NPBA 4ECBA 3ISOA 1U87A 4OCFA 3FMWA 3RPNA 2YJ7A 4E8EA 3ZIVA 4F2IA 3IDVA 1BG5A 4BIKA 5JWRB 3KMNA 1O81A 2GT6A 3SWLA 3I9V2 5LCZA 2HYXA 16GSA 4PUFC 3GL5A 2ON5A 4BPYA 3TDGA 3A2WA 3KP9A 4G0KA 2NVLA 4IGJA 1SKWB 3F4SA 3WGEA 3DWVA 2HRAA 5GSSA 1QK8A 2DJ0A 3KTLA 4TRXA 4CHSA 3QAGA 1EWXA 4I8BA 4ML1A 3CSIA 1TI3A 4MF7A 4WR5A 3W8SA 2PVOC 5JWOB 4IP6A 1PFOA 3HVVA 2B1KA 1KNGA 2VO4A 2YNXA 4FYCA 1B9YC 3D6IA 1YF0A 5C00A 4IJIA 1GTAA 4MMMA 3RPPA 1XBSA 2VCZA 5ECIB 4EVMA 1DBYA 2J9HA 3RBTA 4F82A 2B7KA 5C04A 1S3CA 4Z2UA 5ECSA 3IAS2 4XS4A 4TOPA 5F0GA 1X0RA 1U6TA 5EY6A 4USSA 3CTGA 4L5OA 1MDKA 4HJMA 1K0DA 1A23A 3IXRA 1XIYA 4FYBA 2DSAA 1SYRA 1EEJA 5IIZA 3ZFBA 2WULA 1ILOA 2BJXA 5D9TA 3L9UA 1EOHA 5DAKB 2FUG2 2H73A 2CVBA 2H1DA 2IWTA 1SK1A 2WRTA 3WD6A 2YOIA 3QFBC 2CX4A 1XWGA 1M0UA 2O89A 3C73A 4ECCA 1XVQA 2JZTA 3VPQA 4HSCX 4QL7A 3LXZA 3IHQA 5IMZA 2IMIA 1XW9A 2GSRA 3ME7A 2R6KA 2VLVA 3FW2A 3GURA 5ECRB 2YPMA 5HFGA 3M1GA 4XS1A 4Q5QA 1PKWA 1IYHA 4O92A 2IPAA 3EURA 3SBCA 4ZILA 3E3EA 2FHEA 2FWHA 2H0HA 4MJAA 1ZYQB 5IO0A 1V9WA 3GKXA 3HYPA 4J57E 3N9JA 3OR5A 5D8IA 3ED3A 3LSZA 3F6DA 1SD8A 3ZLPA 3GFKA 3GHAA 1GSUA 3Q18A 1VF3A 1ZGNA 5H5QA 5H5RA 3HCZA 3TJBA 3EU4A 2YWNA 1TK8B 4F0CA 4KUNA 3WGDA 5KOWA 1E6BA 1PL1A 2VIMA 2IJYA 3VWWA 4OFTA 2LV3A 1AQVA 2H0IA 3G9BA 2H74A 4G2EA 3CRTA 3WGXA 5B7CA 2H01A 5LD0A 1I5GA 5DALB 3UARA 2N5AA 1U88A 5INYA 2DJ1A 3C71A 5FT3A 2PGTA 3DXBA 3APQA 3IBHA 3ZVJA 4MJBA 3L0HA 3KTBA 5JCGA 3HA9A 1TU8A 3P7XA 1PX7A 4ZBDA 1TW9A 2JL4A 4OD7A 2VUPA 4TXOB 2YWIA 1VRSD 4XIHA 1SJ6A 4X4JA 3DVXA 2DKHA 5G30A 2FWEA 1URMA 3NOFA 2FGXA 4HI7A 3VURA 2B7JA 4EO3A 3Q19A 1FO5A 3EYTA 1GULA 4F0BA 4K5RA 1LU4A 4CDOA 1WIKA 3TJJA 4XS6A 4QL9A 2F8AA 1NHYA 2QGVA 5AGYA 2FA8A 1GP1A 5AIVA 1PN9A 4MZCA 2JU5A 2YJHA 4YQUA 2C0EA 3ZZXA 3A2VA 4EDZA 5CREA 1PD21 1JLVA 1Z5YE 1J9BA 2DMLA 4F9ZA 5DALA 3TJGA 2P0GA 1TRUA 3H4KA 1K0MA 5B6NA 5IMVA 1MDJA 1VF2A 1GSQA 1V58A 5B8BA 5D73A 5IOWA 2C8UA 20GSA 4TXOA 3GTUB 3KH7A 1N8JA 4POMA 1PN0A 2H1AA 4GSNA 4N11A 1FOVA 4POKA 1OYJA 2R37A 3H8QA 4PURA 3DGQA 22GSA 1X9SB 1ERUA 3M3MA 1M2DA 2MMNA 3GN3A 4FH8A 9GSSA 3QAVA 2XBIA 1ZMAA 2V6OA 2QSIA 1THXA 2OE3A 1XOBA 2MZCA 2WB9A 5JCWA 2V1MA 1O8XA 2A2PA 2H76A 4DVCA 5D9WA 5DQYA 1YZXA 1RQMA 4NV5A 13GSA 4OFNA 4BVXB 4HEA2 4MH3A 2VM1A 2AJQB 2YZUA 2P5RA 5IMFA 3LYKA 1GUKA 1YDKA 3KP8A 4TR0A 3LYPA 1RK4A 1A0FA 2V41A 3L78A 2VD0A 4GRFA 3F4RA 1JZDA 1R4WA 4NAXA 3UJ1A 3GTUA 1SYXA 3ZVJD 1QQ2A 2WJUA 5E4WA 5B6MA 3DD3A 2LUSA 2H1GA 1A2JA 2X49A 4GCIA 2H75A 1SJIA 5AN1A 3S9FA 1M99A 2OBKA 2C1YA 1AC1A 1Z9HA 2M46A 2N5BA 3ERGA 1YEXA 2YN1A 4DSQA 5CRHA 1Z6MA 4GLTA 4I97A 3LFLA 1XW5A 4WXTA 1H4OA 1ERTA 5ELAA 2R5GA 2IFQA 2LS5A 4WR4A 4FIWA 1XWKA 4O5QA 5KN3A 5G5EA 2CQ9A 2O87A 3HJOA 3W6GA 2XBQA 2F9SA 3U6VA 1EGOA 3A2XA 5ENUA 3KCMA 3GX8A 3QPMA 4MLYA 5D9XA 2BTOT 4Z2TA 5ECHB 2CZ3A 5DQSA 1QGVA 3GYKA 1CQGA 1MD3A 4BVXA 1GSYA 3A5IA 6GSWA 1PGTA 3G7YA 4XRDA 5J9CA 1JLWA 1EZKA 2P5QA 1DE1A 3MWHA 4J2FA 5J4UA 3DKSA 2NDOA 2HZFA 4JR6A 4POBA 2IMFA 1XWBA 2MMOA 3E0UA 1HNAA 2IMKA 1GSEA 4K7IA 1F6MC 3ME8A 3FK8A 2HRNA 5G31A 3VK9A 4TR1A 2RUFA 1M2BA 1S3AA 5H5SA 1QMVA 4J56E 2DMMA 1AAZA 1GSFA 4OFMA 1XPVA 3FZ9A 1BJXA 4NHZA 4MF6A 4EE0A 4ULXA 2JZSA 1VF1A 1OKDA 1R26A 2FLSA 4ZBAA 4GXZA 3FKFA 3FZ4A 1X5DA 1JZWA 2D2ZA 5IMDA 1BEDA 5IOXA 1T3BA 1OC9B 2X4AA 18GSA 5EPFA 1AIUA 1O85A 1HNBA 1XCCA 3FR6A 5KN2A 3BCKA 3D4MA 3FYGA 3P2AA 1O6JA 4A5PA 3VWXA 1X5EA 5DJLA 4Z2RA 2G0FA 1N2AA 4PNGA 1XG8A 2VM2A 4K7OA 2FWFA 2F8FA 2ALBA 4NPBA 5D9VA 3VI7A 2XPEA 2K8VA 5B8AA 1GRXA 3APSA 1FB0A 4HOJA 3GIXA 4N10A 2RM5A 5DDLA 8GSSA 4QQ7A 2B6MA 2MMZA 3ERFA 2WCIA 1U3AA 5A4UA 2X8HA 3CQFA 1ERVA 5BMUA 1ZOFA 10GSA 2R0PA 3FY7A 3L4NA 4YKGA 3QFAC 2LRNA 4TN8A 1EV9A 1GL8A 4IVFA 7GSSA 2OA7A 5HR1A 2FD3A 2OKAA 4Q5NA 3TJKA 5DJMA 4LL1B 2J23A 3I6AA 3VWUA 4RUVA 2R4VA 3ZIJA 4X43A 2JADA 1FVJA 2N5FA 5DCGA 1OC9A 2I81A 4PQIA 6GSSA 1Z7RA 1B9XC 2GSQA 1O73A 2PMTA 4EC0A 5CNWA 1DSBA 4KF9A 4IW9A 4EUYA 4ML6A 2H30A 1GH2A 3V1WA 2RIIA 4K0NA 1JZOA 1THOA 1YEPA 6GSYA 5CAXA 4FYUA 3F4TA 5J9BA 4TW5A 2OJLA 3O76A 4TXVA 1F9MA 4KAEA 1XWCA 3KM6A 3FZAA 3EMPA 1SJZA 4BVYB 5ECMB 1AXDA 1UA5A 1MDIA 1ON4A 4G9HA 1GLPA 2L6DA 4HU7A 3A3TA 2DBCA 3UOMA 4O5UA 2GTUA 4I5QA 3DVWA 1X9WB 1UVZA 3EINA 2TRCP 2HNLA 1T4ZA 3US3A 2HI7A 1PL2A 1R5AA 3LEFA 3P90A 2PWJA 3G7JA 2IL3A 4BL7B 2VL3A 3R3EA 2CAIA 4LMVA 1XXUA 1ABAA 4TR4A 1AUCA 2XPDA 4KH7A 2MYGA 3I69A 2HLSA 1NSWA 3DEXA 4LA1A 5CRWA 4F03A 4K0GA 5DAKA 1F3BA 2KP2A 2KHPA 2GS3A 4DSRA 1M7TA 4G10A 2VCXA 3TCOA 4HQZA 2GT5A 2EIOA 1MD4A 2XHFA 2QA2A 3HVSA 5DCHA 2G2QA 3H93A 3DYRA 4K9ZA 2LNSA 2Z9SA 4MCUA 2EC4A 1Z7PA 6GSXA 1GTBA 2C80A 2DJJA 3FEUA 2E7PA 1JHBA 4BVYA 3C7MA 4ZB6A 4Q5RA 1FG4A 2R3XA 3TKPA 1TKDB 1C72A 4JR4A 4RI7A
chains in the Genus database with same CATH topology
1E2YA 2LQOA 2MBSA 4YAPA 1V98A 1A0RP 2GGTA 4MF5A 1G7EA 3W8JA 4V2LA 2ZCTA 3M8NA 3GKMA 5ID2B 4K2DA 5EL8A 2NBSA 1ZL9A 4BL7A 3GUSA 3TB2A 3LW9A 3EU3A 3P8WA 5ECQB 1B4QA 2LJRA 5J3RA 1R5PA 1A8LA 1TRWA 3HY2A 3TKRA 2YWOA 3IOSA 3TRQA 1PRXA 2R2JA 2QA1A 2O8VB 5KN0A 4ZL9A 2R0CA 1Z6NA 5ECLB 2DJ2A 5A4VA 1FB6A 1VF4A 3IHGA 3PH9A 1K0NA 1GUHA 3IAM2 4EKZA 4IS0A 2DIYA 5FHIA 1H75A 4KDYA 4L0WA 2DJKA 4K1FA 4YH2A 3CTFA 4TVEA 3LGCA 3HDCA 3FR3A 2CVKA 2X99A 1DE2A 2GSSA 3EMXA 2B5XA 1T8EB 2HFDA 2LJAA 1GUMA 5F07A 4DEJA 2MMAA 1YY7A 4EXJA 3D5JA 4MP4A 5CO3A 3MAKA 4JBBA 3WT2A 3PGTA 4IELA 4L5LA 2PBJA 5CP1A 1FAAA 5HR0A 2BMXA 3CRUA 3C1SA 5BRTA 2C3QA 1K0BA 2YWMA 6GSUA 2R0GA 1F3AA 2OACA 2ZUPA 6GSTA 3JCML 4Z7XA 1TK0B 2VD1A 5ID2A 2C0GA 4MABA 6GSVA 4LMWA 3MYDA 3GKNA 1HYUA 2X8GA 3GH6A 2VCWA 4IQAA 2LRTA 1TTZA 4I2UA 3K8NA 2DLXA 1SD9A 2PVQA 2GVPA 3LXTA 2F3MA 2X64A 1O7UA 4MA9A 3HD5A 3UVTA 1BYEA 2EIRA 1ZZYA 4GSSA 5D96A 1UC7A 2AHEA 2B1LA 4P3YB 3F0IA 1EEMA 2HSYA 1J0FA 2UZ8A 3F6FA 4IJ3A 3LORA 3FZ5A 4PQHA 2VL2C 4KCEA 2E2GA 3EWLA 2M72A 5A4WA 3EC3A 4HJ2A 4KA0A 1M9BA 2B5YA 1M2AA 3TOUA 2FCHA 1XZOA 2I4AA 3FRCA 3GL3A 1BAYA 1ZYEA 2L4CA 4DSSB 4AF2A 3QDNA 4XCSA 4GTUA 1X9MB 2A4HA 4YKFA 3L9VA 3G7IA 3IC8A 4EL1A 1EGRA 4OMVA 1G0TA 2L59A 4K6XA 4JRRA 2VOCA 3D22A 3GNJA 3E9JB 5AIXA 1WWJA 1SL2B 1Y6EA 1GLQA 2HSMA 2C3NA 4JEDA 2L5OA 1G7OA 1AW9A 2HT9A 1SL1B 3TRXA 1OE8A 2H1BA 4KSMA 3TJFA 1K3OA 3M9KA 2E0QA 5F8BA 2E2MA 4GSTA 3D4TA 3RAZA 1WPIA 1FVKA 2YANA 3IA1A 3RHCA 2HRFA 1LBKA 4IP1A 3EPTA 1KTEA 3H79A 3QR6A 2LNTA 2K18A 2RM6A 4LLRA 4JE1A 2H66A 3NZNA 5GAND 3UL3A 2H70A 4O7HA 3IV4A 2O85A 4I6XA 2EIQA 2KLXA 4IHUA 3EVIA 5J41A 3HJPA 5ABRA 4L0UA 4BWSA 3KIJA 3ZREA 5A5KA 3QAWA 3APOA 1QFNA 4KNDA 2M80A 4E8HA 4WBJA 3TRPA 4H86A 3PPUA 4WF5A 5IPGA 1XWAA 1XOAA 11GSA 1YKAA 3I43A 1BX9A 1WE0A 4V2MA 2GZZA 2GZYA 1EP7A 1YJ6A 1A2LA 4NWYA 4NXIA 4MPFA 1GSDA 2KUCA 3CXGA 2B3SA 2LKUA 2WFCA 4TKYA 2VL9A 2ZNMA 1EP8A 3VI5A 3RHBA 2RLIA 3UMAA 3TKSA 4JU5A 1O8WA 1MTCA 3UBKA 3UVHA 2AYTA 3FR9A 4G0IA 3HZ4A 3O6TA 1PQNA 4MZWA 3LQ7A 5HQPA 4KB3A 1OC8A 1TP9A 2C3TA 4ZIJA 1WRYA 5CYYA 4K2XA 1Q4JA 5KEJA 2PN8A 2KOKA 4PX1A 4RQRA 5LNKe 2IIYA 5CRDA 5L71A 4CY6A 2GQKA 4AGSA 5KN1A 4ILFA 5DVBA 3ZMLA 4ECJA 1FW1A 1SL0B 2OE1A 2DJ3A 4MJEA 1Q98A 1KBNA 2PERA 3HVXA 2TIRA 5HFKA 1SKRB 2JSYA 2H72A 3DIEA 3ZYWA 1A2MA 1V57A 2OBIA 1HNCA 2L5LA 1J08A 1DUGA 1VGLA 2H6YA 4PUAA 4Q5FA 1AQXA 1KEBA 4X1UA 3HKRA 1T4YA 3M9JA 2O7KA 1B4PA 2C0DA 3IRAA 4HS1A 2A2RA 4CY8A 2XC2A 4PNFA 2H71A 2QKEA 2FWGA 3BCIA 4ACSA 4BWQA 1K3YA 4MJCA 2H6XA 2L57A 4O32A 4V2NA 3UIWA 3M0FA 3ZITA 3EE2A 5F06A 1OVNA 1TK5B 3Q6OA 4RQXA 4ISDA 2NTOA 2VAFA 2I9HA 1IYIA 1HD2A 5GAPD 14GSA 4GWRA 4CW9A 1G6YA 2GLRA 1FHEA 1F2EA 1M9AA 4XTSA 3GSSA 4HZ2A 4WBRD 1FOHA 1LJRA 2LTKA 4KSOA 3CMIA 3CYNA 5JWQB 5IQYA 2GZPA 3NIVA 2DC5A 2H19A 1K0CA 4D73B 2C0FA 1SU9A 3QD9A 1B8XA 4PTSA 2DIZA 4NHWA 3QCPA 4KE3A 1R7HA 5G1LA 4HU9A 4MNNA 3ZMKA 1ACVA 1K3LA 3UAPA 3WYWA 4NMUA 5ECKB 5G2ZA 12GSA 4IN0A 3KGKA 1T1VA 3IPZA 1TRVA 2HXKA 3GRXA 5IMCA 3RDWA 1PSQA 5AISA 3GH9A 1GSSA 4V1Ag 1JFUA 2CT6A 17GSA 3CSJA 2TRXA 4OO5A 1W4VA 2H8LA 4X0XA 4EF0A 4YQMA 1WOUA 4PQ1A 4EIQA 2AB6A 3KH9A 1YQ1A 2H0GA 1B48A 3UEMA 2L6CA 2JZRA 1PX6A 4POLA 4KX4A 4MZBA 1TU7A 1G6WA 1WMJA 2L4QA 4HQSA 1HQOA 2YV7A 4MPGA 3VLNA 4TR3A 4YQVA 3TKQA 19GSA 2C4JA 2YCDA 2YV9A 4GF0A 4K8MA 1U3IA 1XW6A 3WT1A 2V6KA 2HRKA 1AQWA 3FHKA 5G1KA 1OC3A 5FWGA 2GDRA 4OCEA 1NM3A 2K9FA 3BD2A 2CA8A 3QOUA 1PKZA 2VCTA 1X5CA 1ERWA 4D73A 3ZFLA 3QMXA 4ZXGA 4ZL7A 1XFLA 1TJDA 3IE3A 3MNGA 3HXSA 4AJ8A 1ZYPA 4N30A 2ON7A 1K0OA 2LQQA 2JACA 4WF4A 2GQLA 3L9SA 2I1UA 2YP6A 4KGIA 5F05A 2CV4A 3ZRDA 2P31A 1S3DA 3MIXA 1EOGA 2PU9C 4IQ1A 3MSZA 4WEYA 4ECIA 1UN2A 4GQFA 1A24A 4NV2A 1YF1A 3ZTLA 1OAZA 2IMDA 3MDKA 1Y25A 3TUEA 3HHVA 2K8SA 4GQCA 2A4VA 1TI1A 2ES7A 2FA4A 1V2AA 5HR3A 4MK3A 5COHA 2AAWA 4BA7A 5ECNB 4G0LA 1TRSA 3PINA 1SKSB 1CQHA 2OADA 1ZCPA 1GTUA 3N5OA 4O5RA 2QC7A 3PR8A 3VFIA 2H6ZA 1XVWA 5ELGA 1K0AA 2A2SA 4WETA 3AY8A 2WS2A 1GNWA 5ECOB 2RUEA 2X8CA 4K5SA 4XRAA 4RI6A 2YZHA 4JZQA 2REMA 3LWAA 2KP1A 3IC4A 2HSHA 3D0ZA 4YAVA 3C1RA 1I9DA 2WDUA 2PPTA 3Q74A 2CVDA 3GSTA 2I3YA 5HR2A 2VCVA 4IKHA 3F9UA 2HZEB 4XHMA 3D21A 4KDXA 1RW1A 4L8EA 1GWCA 3F3RA 1JZRA 1USBA 3LJRA 3IR4A 2GQMA 1A8YA 4PGTA 2VLUA 4FO5A 3KJYA 1NHOA 5IPHA 2LSTA 5IMAA 1YKCA 3CSHA 3U5RE 1W89A 2MBTA 4G19A 1ML6A 3HZ8A 4N0VA 2GSTA 4HDEA 4WKWA 2IFQB 4EDYA 1PMTA 4MH2A 1QUWA 3ZL5A 2IN3A 1EV4A 5GZZB 5EVOA 3GKKA 1SK2A 2F51A 1QXHA 2B5EA 1T00A 3F63A 1PA3A 5GSTA 4ZB9A 1ST9A 3TKSE 3UBLA 2V2GA 4ZBBA 1V40A 3DRNA 4HZ4A 3O3TA 5CRGA 2VCQA 4KCAA 4EIPA 1TOFA 5KOXA 1OKTA 3KZQA 4N0ZA 4KDUA 1T7PB 2IMEA 4OO4A 2LEGA 2FNOA 4AJ7A 3KD0A 3GA4A 4LL4B 3GMFA 4PXOA 4TR1B 3IK9A 2HZEA 4FQUA 2LRCA 5IO2A 2WZ9A 5D93A 3BBYA 1TXXA 4ICYA 1ZYNA 2HE3A 2JSZA 2OE0A 2VL2A 4I2TA 3J7Yb 3GV1A 4V1Ap 5IM9A 3ERWA 4OWYA 1GTIA 4HUAA 3IK7A 3TGZA 2PUKC 5HFIA 5JCUA 5G5FA 3KEBA 5DBQA 4ZB8A 2CAQA 5J5NA 4IBPA 3DMLA 1F37A 1TDIA 2WGRA 4K7NA 3HJMA 1NW2A 2V32A 4DSSA 2CX3A 3F3QA 1SENA 3H1NA 3TKSC 2AV4A 3VPTA 3KMOA 3F8UA 3TOTA 1MEKA 2FY6A 4MDCA 4ZL8A 1OE7A 4AJ6A 1GNEA 5ECPB 2AUVA 2VLTA 1BQ7A 4KW6A 3GX0A 3BOAA 3J7Yk 1WJKA 2K6VA 1WP0A 3VWVA 2LJKA 3BJ5A 3A5WA 5E59A 4ID0A 3CBUA 2DKIA 3C8EA 3KXOA 4XS4B 3LG6A 2CZ2A 3R2QA 1SK0A 1Z3EA 2NPBA 4ECBA 3ISOA 1U87A 4OCFA 3FMWA 3RPNA 2YJ7A 4E8EA 3ZIVA 4F2IA 3IDVA 1BG5A 5JWRB 3KMNA 1O81A 2GT6A 3SWLA 3I9V2 5LCZA 2HYXA 16GSA 4PUFC 3GL5A 2ON5A 4BPYA 3TDGA 3A2WA 3KP9A 4G0KA 2NVLA 4IGJA 1SKWB 3F4SA 3WGEA 3DWVA 2HRAA 5GSSA 1QK8A 2DJ0A 3KTLA 4TRXA 4CHSA 3QAGA 1EWXA 4I8BA 4ML1A 3CSIA 1TI3A 4MF7A 4WR5A 3W8SA 2PVOC 5JWOB 4IP6A 3HVVA 2B1KA 1KNGA 2VO4A 2YNXA 4FYCA 1B9YC 3D6IA 1YF0A 5C00A 4IJIA 1GTAA 4MMMA 3RPPA 1XBSA 2VCZA 5ECIB 4EVMA 1DBYA 2J9HA 3RBTA 4F82A 2B7KA 5C04A 1S3CA 4Z2UA 5ECSA 3IAS2 4XS4A 4TOPA 5F0GA 1X0RA 1U6TA 5EY6A 4USSA 3CTGA 4L5OA 1MDKA 4HJMA 1K0DA 1A23A 3IXRA 1XIYA 4FYBA 2DSAA 1SYRA 1EEJA 5IIZA 3ZFBA 2WULA 1ILOA 2BJXA 5D9TA 3L9UA 1EOHA 5DAKB 2FUG2 2H73A 2CVBA 2H1DA 2IWTA 1SK1A 2WRTA 3WD6A 2YOIA 3QFBC 2CX4A 1XWGA 1M0UA 2O89A 3C73A 4ECCA 1XVQA 2JZTA 3VPQA 4QL7A 3LXZA 3IHQA 5IMZA 2IMIA 1XW9A 2GSRA 2VLVA 2R6KA 3ME7A 3FW2A 3GURA 5ECRB 2YPMA 5HFGA 3M1GA 4XS1A 4Q5QA 1PKWA 1IYHA 4O92A 2IPAA 3EURA 3SBCA 4ZILA 3E3EA 2FHEA 2FWHA 2H0HA 4MJAA 1ZYQB 5IO0A 1V9WA 3GKXA 3HYPA 4J57E 3N9JA 3OR5A 5D8IA 3ED3A 3LSZA 3F6DA 1SD8A 3ZLPA 3GFKA 3GHAA 1GSUA 3Q18A 1VF3A 1ZGNA 5H5QA 5H5RA 3HCZA 3TJBA 3EU4A 2YWNA 1TK8B 4F0CA 4KUNA 3WGDA 5KOWA 1E6BA 1PL1A 2VIMA 2IJYA 3VWWA 4OFTA 2LV3A 1AQVA 2H0IA 3G9BA 2H74A 4G2EA 3CRTA 3WGXA 5B7CA 2H01A 5LD0A 1I5GA 5DALB 3UARA 2N5AA 1U88A 5INYA 2DJ1A 3C71A 5FT3A 2PGTA 3DXBA 3APQA 3IBHA 3ZVJA 4MJBA 3L0HA 3KTBA 5JCGA 3HA9A 1TU8A 3P7XA 1PX7A 4ZBDA 1TW9A 2JL4A 4OD7A 2VUPA 4TXOB 2YWIA 1VRSD 4XIHA 1SJ6A 4X4JA 3DVXA 2DKHA 5G30A 2FWEA 1URMA 3NOFA 2FGXA 4HI7A 3VURA 2B7JA 4EO3A 3Q19A 1FO5A 3EYTA 1GULA 4F0BA 4K5RA 1LU4A 4CDOA 1WIKA 3TJJA 4XS6A 4QL9A 2F8AA 1NHYA 2QGVA 5AGYA 2FA8A 1GP1A 5AIVA 1PN9A 4MZCA 2JU5A 2YJHA 4YQUA 2C0EA 3ZZXA 3A2VA 4EDZA 5CREA 1PD21 1JLVA 1Z5YE 1J9BA 2DMLA 4F9ZA 5DALA 3TJGA 2P0GA 1TRUA 3H4KA 1K0MA 5B6NA 5IMVA 1MDJA 1VF2A 1GSQA 1V58A 5B8BA 5D73A 5IOWA 2C8UA 20GSA 4TXOA 3GTUB 3KH7A 1N8JA 4POMA 1PN0A 2H1AA 4GSNA 4N11A 1FOVA 4POKA 1OYJA 2R37A 3H8QA 4PURA 3DGQA 22GSA 1X9SB 1ERUA 3M3MA 1M2DA 2MMNA 3GN3A 4FH8A 9GSSA 3QAVA 2XBIA 1ZMAA 2V6OA 2QSIA 1THXA 2OE3A 1XOBA 2MZCA 2WB9A 5JCWA 2V1MA 1O8XA 2A2PA 2H76A 4DVCA 5D9WA 5DQYA 1YZXA 1RQMA 4NV5A 13GSA 4OFNA 4BVXB 4HEA2 4MH3A 2VM1A 2AJQB 2YZUA 2P5RA 5IMFA 3LYKA 1GUKA 1YDKA 3KP8A 4TR0A 3LYPA 1RK4A 1A0FA 2V41A 3L78A 2VD0A 4GRFA 3F4RA 1JZDA 1R4WA 4NAXA 3UJ1A 3GTUA 1SYXA 3ZVJD 1QQ2A 2WJUA 5E4WA 5B6MA 3DD3A 2LUSA 2H1GA 1A2JA 2X49A 4GCIA 2H75A 1SJIA 5AN1A 3S9FA 1M99A 2OBKA 2C1YA 1AC1A 1Z9HA 2M46A 2N5BA 3ERGA 1YEXA 2YN1A 4DSQA 5CRHA 1Z6MA 4GLTA 4I97A 3LFLA 1XW5A 4WXTA 1H4OA 1ERTA 5ELAA 2R5GA 2IFQA 2LS5A 4WR4A 4FIWA 1XWKA 4O5QA 5KN3A 5G5EA 2CQ9A 2O87A 3HJOA 3W6GA 2XBQA 2F9SA 3U6VA 1EGOA 3A2XA 5ENUA 3KCMA 3GX8A 3QPMA 4MLYA 5D9XA 2BTOT 4Z2TA 5ECHB 2CZ3A 5DQSA 1QGVA 3GYKA 1CQGA 1MD3A 4BVXA 1GSYA 3A5IA 6GSWA 1PGTA 3G7YA 4XRDA 5J9CA 1JLWA 1EZKA 2P5QA 1DE1A 3MWHA 4J2FA 5J4UA 3DKSA 2NDOA 2HZFA 4JR6A 4POBA 2IMFA 1XWBA 2MMOA 3E0UA 1HNAA 2IMKA 1GSEA 4K7IA 1F6MC 3ME8A 3FK8A 2HRNA 5G31A 3VK9A 4TR1A 2RUFA 1M2BA 1S3AA 5H5SA 1QMVA 4J56E 2DMMA 1AAZA 1GSFA 4OFMA 1XPVA 3FZ9A 1BJXA 4NHZA 4MF6A 4EE0A 4ULXA 2JZSA 1VF1A 1OKDA 1R26A 2FLSA 4ZBAA 4GXZA 3FKFA 3FZ4A 1X5DA 1JZWA 2D2ZA 5IMDA 1BEDA 5IOXA 1T3BA 1OC9B 2X4AA 18GSA 5EPFA 1AIUA 1O85A 1HNBA 1XCCA 3FR6A 5KN2A 3BCKA 3D4MA 3FYGA 3P2AA 1O6JA 4A5PA 3VWXA 1X5EA 5DJLA 4Z2RA 2G0FA 1N2AA 4PNGA 2VM2A 4K7OA 2FWFA 2F8FA 2ALBA 4NPBA 5D9VA 3VI7A 2XPEA 2K8VA 5B8AA 1GRXA 3APSA 1FB0A 4HOJA 3GIXA 4N10A 2RM5A 5DDLA 8GSSA 4QQ7A 2B6MA 2MMZA 3ERFA 2WCIA 1U3AA 5A4UA 2X8HA 1ERVA 5BMUA 1ZOFA 10GSA 2R0PA 3FY7A 3L4NA 4YKGA 3QFAC 2LRNA 4TN8A 1EV9A 1GL8A 4IVFA 7GSSA 2OA7A 5HR1A 2FD3A 2OKAA 4Q5NA 3TJKA 5DJMA 4LL1B 2J23A 3I6AA 3VWUA 4RUVA 2R4VA 3ZIJA 4X43A 2JADA 1FVJA 2N5FA 5DCGA 1OC9A 2I81A 4PQIA 6GSSA 1Z7RA 1B9XC 2GSQA 1O73A 2PMTA 4EC0A 5CNWA 1DSBA 4KF9A 4IW9A 4EUYA 4ML6A 2H30A 1GH2A 3V1WA 2RIIA 4K0NA 1JZOA 1THOA 1YEPA 6GSYA 5CAXA 4FYUA 3F4TA 5J9BA 4TW5A 2OJLA 3O76A 4TXVA 1F9MA 4KAEA 1XWCA 3KM6A 3FZAA 3EMPA 1SJZA 4BVYB 5ECMB 1AXDA 1UA5A 1MDIA 1ON4A 4G9HA 1GLPA 2L6DA 4HU7A 3A3TA 2DBCA 3UOMA 4O5UA 2GTUA 4I5QA 3DVWA 1X9WB 1UVZA 3EINA 2TRCP 2HNLA 1T4ZA 3US3A 2HI7A 1PL2A 1R5AA 3LEFA 3P90A 2PWJA 3G7JA 2IL3A 4BL7B 2VL3A 3R3EA 2CAIA 4LMVA 1XXUA 1ABAA 4TR4A 1AUCA 2XPDA 4KH7A 2MYGA 3I69A 2HLSA 1NSWA 3DEXA 4LA1A 5CRWA 4F03A 4K0GA 5DAKA 1F3BA 2KP2A 2KHPA 2GS3A 4DSRA 1M7TA 4G10A 2VCXA 3TCOA 4HQZA 2GT5A 2EIOA 1MD4A 2XHFA 2QA2A 3HVSA 5DCHA 2G2QA 3H93A 3DYRA 4K9ZA 2LNSA 2Z9SA 4MCUA 2EC4A 1Z7PA 6GSXA 1GTBA 2C80A 2DJJA 3FEUA 2E7PA 1JHBA 4BVYA 3C7MA 4ZB6A 4Q5RA 1FG4A 2R3XA 3TKPA 1TKDB 1C72A 4JR4A 4RI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2Y A;  2LQO A;  2MBS A;  4YAP A;  1V98 A;  1A0R P;  2GGT A;  4MF5 A;  1G7E A;  3W8J A;  4V2L A;  2ZCT A;  3M8N A;  3GKM A;  5ID2 B;  4K2D A;  5EL8 A;  2NBS A;  1ZL9 A;  4BL7 A;  3GUS A;  3TB2 A;  3EU3 A;  3P8W A;  5ECQ B;  1B4Q A;  2LJR A;  5J3R A;  1R5P A;  1A8L A;  1TRW A;  3HY2 A;  3TKR A;  2YWO A;  3IOS A;  3TRQ A;  1PRX A;  2R2J A;  2O8V B;  5KN0 A;  4ZL9 A;  1Z6N A;  5ECL B;  2DJ2 A;  5A4V A;  1FB6 A;  1VF4 A;  3PH9 A;  1K0N A;  1GUH A;  3IAM 2;  4EKZ A;  4IS0 A;  2DIY A;  5FHI A;  1H75 A;  4KDY A;  4L0W A;  2DJK A;  4K1F A;  4YH2 A;  3CTF A;  4TVE A;  3LGC A;  3HDC A;  3FR3 A;  2CVK A;  2X99 A;  1DE2 A;  2GSS A;  3EMX A;  2B5X A;  1T8E B;  2HFD A;  2LJA A;  1GUM A;  5F07 A;  4DEJ A;  2MMA A;  1YY7 A;  4EXJ A;  3D5J A;  4MP4 A;  5CO3 A;  3MAK A;  4JBB A;  3WT2 A;  3PGT A;  4IEL A;  4L5L A;  2PBJ A;  5CP1 A;  1FAA A;  5HR0 A;  2BMX A;  3CRU A;  3C1S A;  2C3Q A;  1K0B A;  2YWM A;  6GSU A;  1F3A A;  2OAC A;  2ZUP A;  6GST A;  3JCM L;  4Z7X A;  1TK0 B;  2VD1 A;  5ID2 A;  2C0G A;  4MAB A;  6GSV A;  4LMW A;  3GKN A;  1HYU A;  2X8G A;  3GH6 A;  2VCW A;  4IQA A;  2LRT A;  1TTZ A;  4I2U A;  3K8N A;  2DLX A;  1SD9 A;  2PVQ A;  2GVP A;  3LXT A;  2F3M A;  2X64 A;  1O7U A;  4MA9 A;  3HD5 A;  3UVT A;  1BYE A;  2EIR A;  1ZZY A;  4GSS A;  5D96 A;  1UC7 A;  2AHE A;  2B1L A;  4P3Y B;  3F0I A;  1EEM A;  2HSY A;  1J0F A;  3F6F A;  4IJ3 A;  3LOR A;  3FZ5 A;  4PQH A;  2VL2 C;  4KCE A;  2E2G A;  3EWL A;  2M72 A;  5A4W A;  3EC3 A;  4HJ2 A;  4KA0 A;  1M9B A;  2B5Y A;  1M2A A;  3TOU A;  2FCH A;  1XZO A;  2I4A A;  3FRC A;  3GL3 A;  1BAY A;  1ZYE A;  2L4C A;  4DSS B;  4AF2 A;  3QDN A;  4XCS A;  4GTU A;  1X9M B;  3L9V A;  3G7I A;  4EL1 A;  1EGR A;  4OMV A;  1G0T A;  2L59 A;  4K6X A;  4JRR A;  2VOC A;  3D22 A;  3GNJ A;  3E9J B;  5AIX A;  1WWJ A;  1SL2 B;  1Y6E A;  1GLQ A;  2C3N A;  4JED A;  2L5O A;  1G7O A;  1AW9 A;  2HT9 A;  1SL1 B;  3TRX A;  1OE8 A;  2H1B A;  4KSM A;  3TJF A;  1K3O A;  3M9K A;  2E0Q A;  5F8B A;  2E2M A;  4GST A;  3D4T A;  3RAZ A;  1WPI A;  1FVK A;  2YAN A;  3IA1 A;  3RHC A;  2HRF A;  1LBK A;  4IP1 A;  1KTE A;  3H79 A;  3QR6 A;  2LNT A;  2K18 A;  2RM6 A;  4LLR A;  4JE1 A;  2H66 A;  3NZN A;  5GAN D;  3UL3 A;  2H70 A;  4O7H A;  3IV4 A;  2O85 A;  4I6X A;  2EIQ A;  2KLX A;  4IHU A;  3EVI A;  5J41 A;  3HJP A;  5ABR A;  4L0U A;  4BWS A;  3KIJ A;  3ZRE A;  5A5K A;  3QAW A;  3APO A;  1QFN A;  4KND A;  2M80 A;  4E8H A;  4WBJ A;  3TRP A;  4H86 A;  4WF5 A;  5IPG A;  1XWA A;  1XOA A;  11GS A;  1YKA A;  3I43 A;  1BX9 A;  1WE0 A;  4V2M A;  2GZZ A;  2GZY A;  1EP7 A;  1YJ6 A;  1A2L A;  4NWY A;  4NXI A;  4MPF A;  1GSD A;  2KUC A;  3CXG A;  2B3S A;  2LKU A;  2WFC A;  4TKY A;  2VL9 A;  2ZNM A;  1EP8 A;  3VI5 A;  3RHB A;  2RLI A;  3UMA A;  3TKS A;  4JU5 A;  1O8W A;  1MTC A;  3UBK A;  3UVH A;  2AYT A;  3FR9 A;  3HZ4 A;  3O6T A;  1PQN A;  4MZW A;  3LQ7 A;  5HQP A;  4KB3 A;  1OC8 A;  1TP9 A;  2C3T A;  4ZIJ A;  1WRY A;  5CYY A;  1Q4J A;  5KEJ A;  2PN8 A;  2KOK A;  4PX1 A;  4RQR A;  5LNK e;  2IIY A;  5CRD A;  5L71 A;  2GQK A;  4AGS A;  5KN1 A;  4ILF A;  5DVB A;  3ZML A;  4ECJ A;  1FW1 A;  1SL0 B;  2OE1 A;  2DJ3 A;  4MJE A;  1Q98 A;  1KBN A;  2PER A;  3HVX A;  2TIR A;  5HFK A;  1SKR B;  2JSY A;  2H72 A;  3DIE A;  3ZYW A;  1A2M A;  1V57 A;  2OBI A;  1HNC A;  2L5L A;  1J08 A;  1DUG A;  1VGL A;  2H6Y A;  4PUA A;  4Q5F A;  1AQX A;  1KEB A;  4X1U A;  3HKR A;  1T4Y A;  3M9J A;  2O7K A;  1B4P A;  2C0D A;  3IRA A;  4HS1 A;  2A2R A;  2XC2 A;  4PNF A;  2H71 A;  2QKE A;  2FWG A;  3BCI A;  4ACS A;  4BWQ A;  1K3Y A;  4MJC A;  2H6X A;  2L57 A;  4O32 A;  4V2N A;  3UIW A;  3M0F A;  3ZIT A;  3EE2 A;  5F06 A;  1OVN A;  1TK5 B;  3Q6O A;  4RQX A;  4ISD A;  2NTO A;  2VAF A;  2I9H A;  1IYI A;  1HD2 A;  5GAP D;  14GS A;  4GWR A;  4CW9 A;  1G6Y A;  2GLR A;  1FHE A;  1F2E A;  1M9A A;  4XTS A;  3GSS A;  4HZ2 A;  4WBR D;  1LJR A;  2LTK A;  4KSO A;  3CMI A;  3CYN A;  5JWQ B;  5IQY A;  2GZP A;  3NIV A;  2DC5 A;  2H19 A;  1K0C A;  4D73 B;  2C0F A;  1SU9 A;  3QD9 A;  1B8X A;  2DIZ A;  4NHW A;  3QCP A;  4KE3 A;  1R7H A;  5G1L A;  4HU9 A;  3ZMK A;  1ACV A;  1K3L A;  3UAP A;  3WYW A;  4NMU A;  5ECK B;  5G2Z A;  12GS A;  4IN0 A;  3KGK A;  1T1V A;  3IPZ A;  1TRV A;  2HXK A;  3GRX A;  5IMC A;  3RDW A;  1PSQ A;  5AIS A;  3GH9 A;  1GSS A;  4V1A g;  1JFU A;  2CT6 A;  17GS A;  3CSJ A;  2TRX A;  4OO5 A;  1W4V A;  2H8L A;  4X0X A;  4EF0 A;  4YQM A;  1WOU A;  4PQ1 A;  2AB6 A;  3KH9 A;  1YQ1 A;  2H0G A;  1B48 A;  3UEM A;  2L6C A;  2JZR A;  1PX6 A;  4POL A;  4KX4 A;  4MZB A;  1TU7 A;  1G6W A;  1WMJ A;  2L4Q A;  4HQS A;  1HQO A;  2YV7 A;  4MPG A;  3VLN A;  4TR3 A;  4YQV A;  3TKQ A;  19GS A;  2C4J A;  2YCD A;  2YV9 A;  4GF0 A;  4K8M A;  1U3I A;  1XW6 A;  3WT1 A;  2V6K A;  1AQW A;  3FHK A;  5G1K A;  1OC3 A;  5FWG A;  2GDR A;  4OCE A;  1NM3 A;  2K9F A;  3BD2 A;  2CA8 A;  3QOU A;  1PKZ A;  2VCT A;  1X5C A;  1ERW A;  4D73 A;  3ZFL A;  3QMX A;  4ZXG A;  4ZL7 A;  1XFL A;  1TJD A;  3IE3 A;  3MNG A;  3HXS A;  4AJ8 A;  4N30 A;  2ON7 A;  1K0O A;  2LQQ A;  2JAC A;  4WF4 A;  2GQL A;  3L9S A;  2I1U A;  2YP6 A;  4KGI A;  5F05 A;  2CV4 A;  3ZRD A;  2P31 A;  1S3D A;  1EOG A;  2PU9 C;  4IQ1 A;  3MSZ A;  4WEY A;  4ECI A;  1UN2 A;  4GQF A;  1A24 A;  4NV2 A;  1YF1 A;  3ZTL A;  1OAZ A;  2IMD A;  3MDK A;  1Y25 A;  3TUE A;  3HHV A;  2K8S A;  4GQC A;  2A4V A;  1TI1 A;  2ES7 A;  2FA4 A;  1V2A A;  5HR3 A;  4MK3 A;  5COH A;  2AAW A;  4BA7 A;  5ECN B;  1TRS A;  3PIN A;  1SKS B;  1CQH A;  2OAD A;  1ZCP A;  1GTU A;  3N5O A;  4O5R A;  2QC7 A;  3PR8 A;  3VFI A;  2H6Z A;  1XVW A;  5ELG A;  1K0A A;  2A2S A;  4WET A;  3AY8 A;  2WS2 A;  1GNW A;  5ECO B;  2RUE A;  2X8C A;  4XRA A;  4RI6 A;  2YZH A;  4JZQ A;  2REM A;  3LWA A;  2KP1 A;  3IC4 A;  2HSH A;  3D0Z A;  4YAV A;  3C1R A;  1I9D A;  2WDU A;  2PPT A;  3Q74 A;  2CVD A;  3GST A;  2I3Y A;  5HR2 A;  2VCV A;  4IKH A;  3F9U A;  2HZE B;  4XHM A;  3D21 A;  4KDX A;  1RW1 A;  4L8E A;  1GWC A;  3F3R A;  1JZR A;  1USB A;  3LJR A;  3IR4 A;  2GQM A;  1A8Y A;  4PGT A;  2VLU A;  4FO5 A;  3KJY A;  1NHO A;  5IPH A;  2LST A;  5IMA A;  1YKC A;  3CSH A;  3U5R E;  1W89 A;  2MBT A;  4G19 A;  1ML6 A;  3HZ8 A;  4N0V A;  2GST A;  4HDE A;  4WKW A;  2IFQ B;  4EDY A;  1PMT A;  4MH2 A;  1QUW A;  3ZL5 A;  2IN3 A;  1EV4 A;  5GZZ B;  5EVO A;  3GKK A;  1SK2 A;  2F51 A;  1QXH A;  2B5E A;  1T00 A;  3F63 A;  1PA3 A;  5GST A;  4ZB9 A;  1ST9 A;  3TKS E;  3UBL A;  2V2G A;  4ZBB A;  1V40 A;  3DRN A;  4HZ4 A;  3O3T A;  5CRG A;  2VCQ A;  4KCA A;  1TOF A;  1OKT A;  3KZQ A;  4N0Z A;  4KDU A;  1T7P B;  2IME A;  4OO4 A;  2LEG A;  2FNO A;  4AJ7 A;  3KD0 A;  3GA4 A;  4LL4 B;  3GMF A;  4PXO A;  4TR1 B;  3IK9 A;  2HZE A;  2LRC A;  5IO2 A;  2WZ9 A;  5D93 A;  3BBY A;  1TXX A;  2HE3 A;  2JSZ A;  2OE0 A;  2VL2 A;  4I2T A;  3J7Y b;  3GV1 A;  4V1A p;  5IM9 A;  3ERW A;  4OWY A;  1GTI A;  4HUA A;  3IK7 A;  3TGZ A;  2PUK C;  5HFI A;  5JCU A;  5G5F A;  3KEB A;  5DBQ A;  4ZB8 A;  2CAQ A;  5J5N A;  4IBP A;  3DML A;  1F37 A;  1TDI A;  2WGR A;  4K7N A;  3HJM A;  1NW2 A;  2V32 A;  4DSS A;  2CX3 A;  3F3Q A;  1SEN A;  3H1N A;  3TKS C;  2AV4 A;  3VPT A;  3KMO A;  3F8U A;  3TOT A;  1MEK A;  2FY6 A;  4MDC A;  4ZL8 A;  1OE7 A;  4AJ6 A;  1GNE A;  5ECP B;  2AUV A;  2VLT A;  1BQ7 A;  4KW6 A;  3GX0 A;  3BOA A;  3J7Y k;  1WJK A;  2K6V A;  1WP0 A;  3VWV A;  2LJK A;  3BJ5 A;  3A5W A;  5E59 A;  4ID0 A;  3CBU A;  3C8E A;  3KXO A;  4XS4 B;  3LG6 A;  2CZ2 A;  3R2Q A;  1SK0 A;  1Z3E A;  2NPB A;  4ECB A;  3ISO A;  1U87 A;  4OCF A;  3RPN A;  2YJ7 A;  4E8E A;  3ZIV A;  4F2I A;  3IDV A;  1BG5 A;  5JWR B;  3KMN A;  1O81 A;  2GT6 A;  3SWL A;  3I9V 2;  5LCZ A;  2HYX A;  16GS A;  4PUF C;  3GL5 A;  2ON5 A;  4BPY A;  3TDG A;  3A2W A;  3KP9 A;  2NVL A;  4IGJ A;  1SKW B;  3F4S A;  3WGE A;  3DWV A;  5GSS A;  1QK8 A;  2DJ0 A;  3KTL A;  4TRX A;  4CHS A;  3QAG A;  1EWX A;  4I8B A;  4ML1 A;  3CSI A;  1TI3 A;  4MF7 A;  4WR5 A;  3W8S A;  2PVO C;  5JWO B;  4IP6 A;  3HVV A;  2B1K A;  1KNG A;  2VO4 A;  2YNX A;  4FYC A;  1B9Y C;  3D6I A;  1YF0 A;  5C00 A;  4IJI A;  1GTA A;  4MMM A;  3RPP A;  1XBS A;  2VCZ A;  5ECI B;  4EVM A;  1DBY A;  2J9H A;  3RBT A;  4F82 A;  2B7K A;  5C04 A;  1S3C A;  5ECS A;  3IAS 2;  4XS4 A;  4TOP A;  5F0G A;  1X0R A;  1U6T A;  5EY6 A;  3CTG A;  4L5O A;  1MDK A;  4HJM A;  1K0D A;  1A23 A;  3IXR A;  1XIY A;  4FYB A;  2DSA A;  1SYR A;  1EEJ A;  5IIZ A;  3ZFB A;  2WUL A;  1ILO A;  2BJX A;  5D9T A;  3L9U A;  1EOH A;  5DAK B;  2FUG 2;  2H73 A;  2CVB A;  2H1D A;  2IWT A;  1SK1 A;  2WRT A;  3WD6 A;  2YOI A;  3QFB C;  2CX4 A;  1XWG A;  1M0U A;  2O89 A;  3C73 A;  4ECC A;  1XVQ A;  2JZT A;  3VPQ A;  4QL7 A;  3LXZ A;  3IHQ A;  5IMZ A;  2IMI A;  1XW9 A;  2GSR A;  2VLV A;  2R6K A;  3ME7 A;  3FW2 A;  3GUR A;  5ECR B;  2YPM A;  5HFG A;  3M1G A;  4XS1 A;  4Q5Q A;  1PKW A;  1IYH A;  4O92 A;  2IPA A;  3EUR A;  3SBC A;  4ZIL A;  3E3E A;  2FHE A;  2FWH A;  2H0H A;  4MJA A;  1ZYQ B;  5IO0 A;  1V9W A;  3GKX A;  3HYP A;  4J57 E;  3N9J A;  3OR5 A;  5D8I A;  3ED3 A;  3LSZ A;  3F6D A;  1SD8 A;  3ZLP A;  3GFK A;  3GHA A;  1GSU A;  3Q18 A;  1VF3 A;  1ZGN A;  5H5Q A;  5H5R A;  3HCZ A;  3TJB A;  3EU4 A;  2YWN A;  1TK8 B;  4F0C A;  4KUN A;  3WGD A;  1E6B A;  1PL1 A;  2VIM A;  2IJY A;  3VWW A;  4OFT A;  2LV3 A;  1AQV A;  2H0I A;  3G9B A;  2H74 A;  4G2E A;  3CRT A;  3WGX A;  5B7C A;  2H01 A;  5LD0 A;  1I5G A;  5DAL B;  3UAR A;  2N5A A;  1U88 A;  5INY A;  2DJ1 A;  3C71 A;  5FT3 A;  2PGT A;  3DXB A;  3APQ A;  3IBH A;  3ZVJ A;  4MJB A;  3L0H A;  3KTB A;  5JCG A;  3HA9 A;  1TU8 A;  3P7X A;  1PX7 A;  4ZBD A;  1TW9 A;  2JL4 A;  4OD7 A;  2VUP A;  4TXO B;  2YWI A;  1VRS D;  4XIH A;  1SJ6 A;  3DVX A;  5G30 A;  2FWE A;  1URM A;  3NOF A;  2FGX A;  4HI7 A;  3VUR A;  2B7J A;  4EO3 A;  3Q19 A;  1FO5 A;  3EYT A;  1GUL A;  4F0B A;  1LU4 A;  4CDO A;  1WIK A;  3TJJ A;  4XS6 A;  4QL9 A;  2F8A A;  1NHY A;  2QGV A;  5AGY A;  2FA8 A;  1GP1 A;  5AIV A;  1PN9 A;  4MZC A;  2JU5 A;  2YJH A;  4YQU A;  2C0E A;  3ZZX A;  3A2V A;  4EDZ A;  5CRE A;  1PD2 1;  1JLV A;  1Z5Y E;  1J9B A;  2DML A;  4F9Z A;  5DAL A;  3TJG A;  2P0G A;  1TRU A;  3H4K A;  1K0M A;  5B6N A;  5IMV A;  1MDJ A;  1VF2 A;  1GSQ A;  1V58 A;  5B8B A;  5D73 A;  5IOW A;  2C8U A;  20GS A;  4TXO A;  3GTU B;  3KH7 A;  1N8J A;  4POM A;  2H1A A;  4GSN A;  4N11 A;  1FOV A;  4POK A;  1OYJ A;  2R37 A;  3H8Q A;  4PUR A;  3DGQ A;  22GS A;  1X9S B;  1ERU A;  3M3M A;  1M2D A;  2MMN A;  3GN3 A;  4FH8 A;  9GSS A;  3QAV A;  2XBI A;  1ZMA A;  2V6O A;  2QSI A;  1THX A;  2OE3 A;  1XOB A;  2MZC A;  2WB9 A;  5JCW A;  2V1M A;  1O8X A;  2H76 A;  4DVC A;  5D9W A;  5DQY A;  1YZX A;  1RQM A;  4NV5 A;  13GS A;  4OFN A;  4HEA 2;  4MH3 A;  2VM1 A;  2AJQ B;  2YZU A;  2P5R A;  5IMF A;  3LYK A;  1GUK A;  1YDK A;  3KP8 A;  4TR0 A;  3LYP A;  1RK4 A;  1A0F A;  2V41 A;  3L78 A;  2VD0 A;  4GRF A;  3F4R A;  1JZD A;  1R4W A;  4NAX A;  3UJ1 A;  3GTU A;  1SYX A;  3ZVJ D;  1QQ2 A;  2WJU A;  5E4W A;  5B6M A;  3DD3 A;  2LUS A;  2H1G A;  1A2J A;  4GCI A;  2H75 A;  1SJI A;  5AN1 A;  3S9F A;  1M99 A;  2OBK A;  2C1Y A;  1AC1 A;  1Z9H A;  2M46 A;  2N5B A;  3ERG A;  1YEX A;  2YN1 A;  4DSQ A;  5CRH A;  1Z6M A;  4GLT A;  4I97 A;  3LFL A;  1XW5 A;  4WXT A;  1H4O A;  1ERT A;  5ELA A;  2R5G A;  2IFQ A;  2LS5 A;  4WR4 A;  4FIW A;  1XWK A;  5KN3 A;  5G5E A;  2CQ9 A;  2O87 A;  3HJO A;  3W6G A;  2XBQ A;  2F9S A;  3U6V A;  1EGO A;  3A2X A;  5ENU A;  3KCM A;  3GX8 A;  3QPM A;  4MLY A;  5D9X A;  2BTO T;  5ECH B;  2CZ3 A;  5DQS A;  1QGV A;  3GYK A;  1CQG A;  1MD3 A;  4BVX A;  1GSY A;  6GSW A;  1PGT A;  3G7Y A;  4XRD A;  5J9C A;  1JLW A;  1EZK A;  2P5Q A;  1DE1 A;  3MWH A;  4J2F A;  5J4U A;  3DKS A;  2NDO A;  2HZF A;  4JR6 A;  4POB A;  2IMF A;  1XWB A;  2MMO A;  3E0U A;  1HNA A;  2IMK A;  1GSE A;  4K7I A;  1F6M C;  3ME8 A;  3FK8 A;  2HRN A;  5G31 A;  3VK9 A;  4TR1 A;  2RUF A;  1M2B A;  1S3A A;  5H5S A;  1QMV A;  4J56 E;  2DMM A;  1AAZ A;  1GSF A;  4OFM A;  1XPV A;  3FZ9 A;  1BJX A;  4NHZ A;  4MF6 A;  4EE0 A;  4ULX A;  2JZS A;  1VF1 A;  1OKD A;  1R26 A;  2FLS A;  4ZBA A;  4GXZ A;  3FKF A;  3FZ4 A;  1X5D A;  1JZW A;  2D2Z A;  5IMD A;  1BED A;  5IOX A;  1T3B A;  1OC9 B;  18GS A;  5EPF A;  1AIU A;  1O85 A;  1HNB A;  1XCC A;  3FR6 A;  5KN2 A;  3BCK A;  3D4M A;  3FYG A;  3P2A A;  1O6J A;  3VWX A;  1X5E A;  5DJL A;  2G0F A;  1N2A A;  4PNG A;  2VM2 A;  4K7O A;  2FWF A;  2F8F A;  2ALB A;  4NPB A;  5D9V A;  3VI7 A;  2XPE A;  2K8V A;  5B8A A;  1GRX A;  3APS A;  1FB0 A;  4HOJ A;  3GIX A;  4N10 A;  2RM5 A;  5DDL A;  8GSS A;  4QQ7 A;  2B6M A;  2MMZ A;  3ERF A;  2WCI A;  1U3A A;  5A4U A;  2X8H A;  1ERV A;  1ZOF A;  10GS A;  3FY7 A;  3L4N A;  3QFA C;  2LRN A;  4TN8 A;  1EV9 A;  1GL8 A;  4IVF A;  7GSS A;  2OA7 A;  5HR1 A;  2FD3 A;  2OKA A;  4Q5N A;  3TJK A;  5DJM A;  4LL1 B;  2J23 A;  3I6A A;  3VWU A;  4RUV A;  2R4V A;  3ZIJ A;  4X43 A;  2JAD A;  1FVJ A;  2N5F A;  5DCG A;  1OC9 A;  2I81 A;  4PQI A;  6GSS A;  1Z7R A;  1B9X C;  2GSQ A;  1O73 A;  2PMT A;  4EC0 A;  5CNW A;  1DSB A;  4IW9 A;  4EUY A;  4ML6 A;  2H30 A;  1GH2 A;  3V1W A;  2RII A;  4K0N A;  1JZO A;  1THO A;  1YEP A;  6GSY A;  5CAX A;  4FYU A;  3F4T A;  5J9B A;  4TW5 A;  2OJL A;  3O76 A;  4TXV A;  1F9M A;  4KAE A;  1XWC A;  3KM6 A;  3FZA A;  3EMP A;  1SJZ A;  5ECM B;  1AXD A;  1UA5 A;  1MDI A;  1ON4 A;  4G9H A;  1GLP A;  2L6D A;  4HU7 A;  3A3T A;  2DBC A;  3UOM A;  2GTU A;  4I5Q A;  3DVW A;  1X9W B;  1UVZ A;  3EIN A;  2TRC P;  2HNL A;  1T4Z A;  3US3 A;  2HI7 A;  1PL2 A;  1R5A A;  3LEF A;  3P90 A;  2PWJ A;  3G7J A;  2IL3 A;  2VL3 A;  2CAI A;  4LMV A;  1XXU A;  1ABA A;  4TR4 A;  1AUC A;  2XPD A;  4KH7 A;  2MYG A;  3I69 A;  2HLS A;  1NSW A;  3DEX A;  4LA1 A;  5CRW A;  4F03 A;  4K0G A;  5DAK A;  1F3B A;  2KP2 A;  2KHP A;  2GS3 A;  4DSR A;  1M7T A;  4G10 A;  2VCX A;  3TCO A;  4HQZ A;  2GT5 A;  2EIO A;  1MD4 A;  2XHF A;  3HVS A;  5DCH A;  2G2Q A;  3H93 A;  3DYR A;  4K9Z A;  2LNS A;  2Z9S A;  4MCU A;  2EC4 A;  1Z7P A;  6GSX A;  1GTB A;  2C80 A;  2DJJ A;  3FEU A;  2E7P A;  1JHB A;  4BVY A;  3C7M A;  4ZB6 A;  4Q5R A;  1FG4 A;  2R3X A;  3TKP A;  1TKD B;  1C72 A;  4JR4 A;  4RI7 A; 
#chains in the Genus database with same CATH topology
 1E2Y A;  2LQO A;  2MBS A;  4YAP A;  1V98 A;  1A0R P;  2GGT A;  4MF5 A;  1G7E A;  3W8J A;  4V2L A;  2ZCT A;  3M8N A;  3GKM A;  5ID2 B;  4K2D A;  5EL8 A;  2NBS A;  1ZL9 A;  4BL7 A;  3GUS A;  3TB2 A;  3LW9 A;  3EU3 A;  3P8W A;  5ECQ B;  1B4Q A;  2LJR A;  5J3R A;  1R5P A;  1A8L A;  1TRW A;  3HY2 A;  3TKR A;  2YWO A;  3IOS A;  3TRQ A;  1PRX A;  2R2J A;  2QA1 A;  2O8V B;  5KN0 A;  4ZL9 A;  2R0C A;  1Z6N A;  5ECL B;  2DJ2 A;  5A4V A;  1FB6 A;  1VF4 A;  3IHG A;  3PH9 A;  1K0N A;  1GUH A;  3IAM 2;  4EKZ A;  4IS0 A;  2DIY A;  5FHI A;  1H75 A;  4KDY A;  4L0W A;  2DJK A;  4K1F A;  4YH2 A;  3CTF A;  4TVE A;  3LGC A;  3HDC A;  3FR3 A;  2CVK A;  2X99 A;  1DE2 A;  2GSS A;  3EMX A;  2B5X A;  1T8E B;  2HFD A;  2LJA A;  1GUM A;  5F07 A;  4DEJ A;  2MMA A;  1YY7 A;  4EXJ A;  3D5J A;  4MP4 A;  5CO3 A;  3MAK A;  4JBB A;  3WT2 A;  3PGT A;  4IEL A;  4L5L A;  2PBJ A;  5CP1 A;  1FAA A;  5HR0 A;  2BMX A;  3CRU A;  3C1S A;  5BRT A;  2C3Q A;  1K0B A;  2YWM A;  6GSU A;  2R0G A;  1F3A A;  2OAC A;  2ZUP A;  6GST A;  3JCM L;  4Z7X A;  1TK0 B;  2VD1 A;  5ID2 A;  2C0G A;  4MAB A;  6GSV A;  4LMW A;  3MYD A;  3GKN A;  1HYU A;  2X8G A;  3GH6 A;  2VCW A;  4IQA A;  2LRT A;  1TTZ A;  4I2U A;  3K8N A;  2DLX A;  1SD9 A;  2PVQ A;  2GVP A;  3LXT A;  2F3M A;  2X64 A;  1O7U A;  4MA9 A;  3HD5 A;  3UVT A;  1BYE A;  2EIR A;  1ZZY A;  4GSS A;  5D96 A;  1UC7 A;  2AHE A;  2B1L A;  4P3Y B;  3F0I A;  1EEM A;  2HSY A;  1J0F A;  2UZ8 A;  3F6F A;  4IJ3 A;  3LOR A;  3FZ5 A;  4PQH A;  2VL2 C;  4KCE A;  2E2G A;  3EWL A;  2M72 A;  5A4W A;  3EC3 A;  4HJ2 A;  4KA0 A;  1M9B A;  2B5Y A;  1M2A A;  3TOU A;  2FCH A;  1XZO A;  2I4A A;  3FRC A;  3GL3 A;  1BAY A;  1ZYE A;  2L4C A;  4DSS B;  4AF2 A;  3QDN A;  4XCS A;  4GTU A;  1X9M B;  2A4H A;  4YKF A;  3L9V A;  3G7I A;  3IC8 A;  4EL1 A;  1EGR A;  4OMV A;  1G0T A;  2L59 A;  4K6X A;  4JRR A;  2VOC A;  3D22 A;  3GNJ A;  3E9J B;  5AIX A;  1WWJ A;  1SL2 B;  1Y6E A;  1GLQ A;  2HSM A;  2C3N A;  4JED A;  2L5O A;  1G7O A;  1AW9 A;  2HT9 A;  1SL1 B;  3TRX A;  1OE8 A;  2H1B A;  4KSM A;  3TJF A;  1K3O A;  3M9K A;  2E0Q A;  5F8B A;  2E2M A;  4GST A;  3D4T A;  3RAZ A;  1WPI A;  1FVK A;  2YAN A;  3IA1 A;  3RHC A;  2HRF A;  1LBK A;  4IP1 A;  3EPT A;  1KTE A;  3H79 A;  3QR6 A;  2LNT A;  2K18 A;  2RM6 A;  4LLR A;  4JE1 A;  2H66 A;  3NZN A;  5GAN D;  3UL3 A;  2H70 A;  4O7H A;  3IV4 A;  2O85 A;  4I6X A;  2EIQ A;  2KLX A;  4IHU A;  3EVI A;  5J41 A;  3HJP A;  5ABR A;  4L0U A;  4BWS A;  3KIJ A;  3ZRE A;  5A5K A;  3QAW A;  3APO A;  1QFN A;  4KND A;  2M80 A;  4E8H A;  4WBJ A;  3TRP A;  4H86 A;  3PPU A;  4WF5 A;  5IPG A;  1XWA A;  1XOA A;  11GS A;  1YKA A;  3I43 A;  1BX9 A;  1WE0 A;  4V2M A;  2GZZ A;  2GZY A;  1EP7 A;  1YJ6 A;  1A2L A;  4NWY A;  4NXI A;  4MPF A;  1GSD A;  2KUC A;  3CXG A;  2B3S A;  2LKU A;  2WFC A;  4TKY A;  2VL9 A;  2ZNM A;  1EP8 A;  3VI5 A;  3RHB A;  2RLI A;  3UMA A;  3TKS A;  4JU5 A;  1O8W A;  1MTC A;  3UBK A;  3UVH A;  2AYT A;  3FR9 A;  4G0I A;  3HZ4 A;  3O6T A;  1PQN A;  4MZW A;  3LQ7 A;  5HQP A;  4KB3 A;  1OC8 A;  1TP9 A;  2C3T A;  4ZIJ A;  1WRY A;  5CYY A;  4K2X A;  1Q4J A;  5KEJ A;  2PN8 A;  2KOK A;  4PX1 A;  4RQR A;  5LNK e;  2IIY A;  5CRD A;  5L71 A;  4CY6 A;  2GQK A;  4AGS A;  1S3R A;  5KN1 A;  4ILF A;  5DVB A;  3ZML A;  4ECJ A;  1FW1 A;  1SL0 B;  2OE1 A;  2DJ3 A;  4MJE A;  1Q98 A;  1KBN A;  2PER A;  3HVX A;  2TIR A;  5HFK A;  1SKR B;  2JSY A;  2H72 A;  3DIE A;  3ZYW A;  1A2M A;  1V57 A;  2OBI A;  1HNC A;  2L5L A;  1J08 A;  1DUG A;  1VGL A;  2H6Y A;  4PUA A;  4Q5F A;  1AQX A;  1KEB A;  4X1U A;  3HKR A;  1T4Y A;  3M9J A;  2O7K A;  1B4P A;  2C0D A;  3IRA A;  4HS1 A;  2A2R A;  4CY8 A;  2XC2 A;  4PNF A;  2H71 A;  2QKE A;  2FWG A;  3BCI A;  4ACS A;  4BWQ A;  1K3Y A;  4MJC A;  2H6X A;  2L57 A;  4O32 A;  4V2N A;  3UIW A;  3M0F A;  3ZIT A;  3EE2 A;  5F06 A;  1OVN A;  1TK5 B;  3Q6O A;  4RQX A;  4ISD A;  2NTO A;  2VAF A;  2I9H A;  1IYI A;  1HD2 A;  5GAP D;  14GS A;  4GWR A;  4CW9 A;  1G6Y A;  2GLR A;  1FHE A;  1F2E A;  1M9A A;  4XTS A;  3GSS A;  4HZ2 A;  4WBR D;  1FOH A;  1LJR A;  2LTK A;  4KSO A;  3CMI A;  3CYN A;  5JWQ B;  5IQY A;  2GZP A;  3NIV A;  2DC5 A;  2H19 A;  1K0C A;  4D73 B;  2C0F A;  1SU9 A;  3QD9 A;  1B8X A;  4PTS A;  2DIZ A;  4NHW A;  3QCP A;  4KE3 A;  1R7H A;  5G1L A;  4HU9 A;  4MNN A;  3ZMK A;  1ACV A;  1K3L A;  3UAP A;  3WYW A;  4NMU A;  5ECK B;  5G2Z A;  12GS A;  4IN0 A;  3KGK A;  1T1V A;  3IPZ A;  1TRV A;  2HXK A;  1M3I A;  3GRX A;  5IMC A;  3RDW A;  1PSQ A;  5AIS A;  3GH9 A;  1GSS A;  4V1A g;  1JFU A;  2CT6 A;  17GS A;  3CSJ A;  2TRX A;  4OO5 A;  1W4V A;  2H8L A;  4X0X A;  4EF0 A;  4YQM A;  1WOU A;  4PQ1 A;  4EIQ A;  2AB6 A;  3KH9 A;  1YQ1 A;  2H0G A;  1B48 A;  3UEM A;  2L6C A;  2JZR A;  1PX6 A;  4POL A;  4KX4 A;  4MZB A;  1TU7 A;  1G6W A;  1WMJ A;  2L4Q A;  4HQS A;  1HQO A;  2YV7 A;  4MPG A;  3VLN A;  4TR3 A;  4YQV A;  3TKQ A;  19GS A;  2C4J A;  2YCD A;  2YV9 A;  4GF0 A;  4K8M A;  1U3I A;  1XW6 A;  3WT1 A;  2V6K A;  2HRK A;  1AQW A;  3FHK A;  5G1K A;  1OC3 A;  5FWG A;  2GDR A;  4OCE A;  1NM3 A;  2K9F A;  3BD2 A;  2CA8 A;  3QOU A;  1PKZ A;  2VCT A;  1X5C A;  1ERW A;  4D73 A;  3ZFL A;  3QMX A;  4ZXG A;  4ZL7 A;  1XFL A;  1TJD A;  3IE3 A;  3MNG A;  3HXS A;  4AJ8 A;  1ZYP A;  4N30 A;  2ON7 A;  1K0O A;  2LQQ A;  2JAC A;  4WF4 A;  2GQL A;  3L9S A;  2I1U A;  2YP6 A;  4KGI A;  5F05 A;  2CV4 A;  3ZRD A;  2P31 A;  1S3D A;  3MIX A;  1EOG A;  2PU9 C;  4IQ1 A;  3MSZ A;  4WEY A;  4ECI A;  1UN2 A;  4GQF A;  1A24 A;  4NV2 A;  1YF1 A;  3ZTL A;  1OAZ A;  2IMD A;  3MDK A;  1Y25 A;  3HVN A;  3TUE A;  3HHV A;  2K8S A;  4GQC A;  2A4V A;  1TI1 A;  2ES7 A;  2FA4 A;  1V2A A;  5HR3 A;  4MK3 A;  5COH A;  2AAW A;  4BA7 A;  5ECN B;  4G0L A;  1TRS A;  3PIN A;  1SKS B;  1CQH A;  2OAD A;  1ZCP A;  1GTU A;  3N5O A;  4O5R A;  2QC7 A;  3PR8 A;  3VFI A;  2H6Z A;  1XVW A;  5ELG A;  1K0A A;  2A2S A;  4WET A;  3AY8 A;  2WS2 A;  1GNW A;  5ECO B;  2RUE A;  2X8C A;  4K5S A;  4XRA A;  4RI6 A;  2YZH A;  4JZQ A;  2REM A;  3LWA A;  2KP1 A;  3IC4 A;  2HSH A;  1M3J A;  3D0Z A;  4YAV A;  3C1R A;  1I9D A;  2WDU A;  2PPT A;  3Q74 A;  2CVD A;  3GST A;  2I3Y A;  5HR2 A;  2VCV A;  4IKH A;  3F9U A;  2HZE B;  4XHM A;  3D21 A;  4KDX A;  1RW1 A;  4L8E A;  1GWC A;  3F3R A;  1JZR A;  1USB A;  3LJR A;  3IR4 A;  2GQM A;  1A8Y A;  4PGT A;  2VLU A;  4FO5 A;  3KJY A;  1NHO A;  5IPH A;  2LST A;  5IMA A;  1YKC A;  3CSH A;  3U5R E;  1W89 A;  2MBT A;  4G19 A;  1ML6 A;  3HZ8 A;  4N0V A;  2GST A;  4HDE A;  4WKW A;  2IFQ B;  4EDY A;  1PMT A;  4MH2 A;  1QUW A;  3ZL5 A;  2IN3 A;  1EV4 A;  5GZZ B;  5EVO A;  3GKK A;  1SK2 A;  2F51 A;  1QXH A;  2B5E A;  1T00 A;  3F63 A;  1PA3 A;  5GST A;  4ZB9 A;  1ST9 A;  3TKS E;  3UBL A;  2V2G A;  4ZBB A;  1V40 A;  3DRN A;  4HZ4 A;  3O3T A;  5CRG A;  2VCQ A;  4KCA A;  4EIP A;  1TOF A;  5KOX A;  1OKT A;  3KZQ A;  4N0Z A;  4KDU A;  1T7P B;  2IME A;  4OO4 A;  2LEG A;  2FNO A;  4AJ7 A;  3KD0 A;  3GA4 A;  4LL4 B;  3GMF A;  4PXO A;  4TR1 B;  3IK9 A;  2HZE A;  4FQU A;  2LRC A;  5IO2 A;  2WZ9 A;  5D93 A;  3BBY A;  1TXX A;  4ICY A;  1ZYN A;  2HE3 A;  2JSZ A;  2OE0 A;  2VL2 A;  4I2T A;  3J7Y b;  3GV1 A;  4V1A p;  5IM9 A;  3ERW A;  4OWY A;  1GTI A;  4HUA A;  3IK7 A;  3TGZ A;  2PUK C;  5HFI A;  5JCU A;  5G5F A;  3KEB A;  5DBQ A;  4ZB8 A;  2CAQ A;  5J5N A;  4IBP A;  3DML A;  1F37 A;  1TDI A;  2WGR A;  4K7N A;  3HJM A;  1NW2 A;  2V32 A;  4DSS A;  2CX3 A;  3F3Q A;  1SEN A;  3H1N A;  3TKS C;  2AV4 A;  3VPT A;  3KMO A;  3F8U A;  3TOT A;  1MEK A;  2FY6 A;  4MDC A;  4ZL8 A;  1OE7 A;  4AJ6 A;  1GNE A;  5ECP B;  2AUV A;  2VLT A;  1BQ7 A;  4KW6 A;  3GX0 A;  3BOA A;  3J7Y k;  1WJK A;  2K6V A;  1WP0 A;  3VWV A;  2LJK A;  3BJ5 A;  3A5W A;  5E59 A;  4ID0 A;  3CBU A;  2DKI A;  3C8E A;  3KXO A;  4XS4 B;  3LG6 A;  2CZ2 A;  3R2Q A;  1SK0 A;  1Z3E A;  2NPB A;  4ECB A;  3ISO A;  1U87 A;  4OCF A;  3FMW A;  3RPN A;  2YJ7 A;  4E8E A;  3ZIV A;  4F2I A;  3IDV A;  1BG5 A;  4BIK A;  5JWR B;  3KMN A;  1O81 A;  2GT6 A;  3SWL A;  3I9V 2;  5LCZ A;  2HYX A;  16GS A;  4PUF C;  3GL5 A;  2ON5 A;  4BPY A;  3TDG A;  3A2W A;  3KP9 A;  4G0K A;  2NVL A;  4IGJ A;  1SKW B;  3F4S A;  3WGE A;  3DWV A;  2HRA A;  5GSS A;  1QK8 A;  2DJ0 A;  3KTL A;  4TRX A;  4CHS A;  3QAG A;  1EWX A;  4I8B A;  4ML1 A;  3CSI A;  1TI3 A;  4MF7 A;  4WR5 A;  3W8S A;  2PVO C;  5JWO B;  4IP6 A;  1PFO A;  3HVV A;  2B1K A;  1KNG A;  2VO4 A;  2YNX A;  4FYC A;  1B9Y C;  3D6I A;  1YF0 A;  5C00 A;  4IJI A;  1GTA A;  4MMM A;  3RPP A;  1XBS A;  2VCZ A;  5ECI B;  4EVM A;  1DBY A;  2J9H A;  3RBT A;  4F82 A;  2B7K A;  5C04 A;  1S3C A;  4Z2U A;  5ECS A;  3IAS 2;  4XS4 A;  4TOP A;  5F0G A;  1X0R A;  1U6T A;  5EY6 A;  4USS A;  3CTG A;  4L5O A;  1MDK A;  4HJM A;  1K0D A;  1A23 A;  3IXR A;  1XIY A;  4FYB A;  2DSA A;  1SYR A;  1EEJ A;  5IIZ A;  3ZFB A;  2WUL A;  1ILO A;  2BJX A;  5D9T A;  3L9U A;  1EOH A;  5DAK B;  2FUG 2;  2H73 A;  2CVB A;  2H1D A;  2IWT A;  1SK1 A;  2WRT A;  3WD6 A;  2YOI A;  3QFB C;  2CX4 A;  1XWG A;  1M0U A;  2O89 A;  3C73 A;  4ECC A;  1XVQ A;  2JZT A;  3VPQ A;  4HSC X;  4QL7 A;  3LXZ A;  3IHQ A;  5IMZ A;  2IMI A;  1XW9 A;  2GSR A;  3ME7 A;  2R6K A;  2VLV A;  3FW2 A;  3GUR A;  5ECR B;  2YPM A;  5HFG A;  3M1G A;  4XS1 A;  4Q5Q A;  1PKW A;  1IYH A;  4O92 A;  2IPA A;  3EUR A;  3SBC A;  4ZIL A;  3E3E A;  2FHE A;  2FWH A;  2H0H A;  4MJA A;  1ZYQ B;  5IO0 A;  1V9W A;  3GKX A;  3HYP A;  4J57 E;  3N9J A;  3OR5 A;  5D8I A;  3ED3 A;  3LSZ A;  3F6D A;  1SD8 A;  3ZLP A;  3GFK A;  3GHA A;  1GSU A;  3Q18 A;  1VF3 A;  1ZGN A;  5H5Q A;  5H5R A;  3HCZ A;  3TJB A;  3EU4 A;  2YWN A;  1TK8 B;  4F0C A;  4KUN A;  3WGD A;  5KOW A;  1E6B A;  1PL1 A;  2VIM A;  2IJY A;  3VWW A;  4OFT A;  2LV3 A;  1AQV A;  2H0I A;  3G9B A;  2H74 A;  4G2E A;  3CRT A;  3WGX A;  5B7C A;  2H01 A;  5LD0 A;  1I5G A;  5DAL B;  3UAR A;  2N5A A;  1U88 A;  5INY A;  2DJ1 A;  3C71 A;  5FT3 A;  2PGT A;  3DXB A;  3APQ A;  3IBH A;  3ZVJ A;  4MJB A;  3L0H A;  3KTB A;  5JCG A;  3HA9 A;  1TU8 A;  3P7X A;  1PX7 A;  4ZBD A;  1TW9 A;  2JL4 A;  4OD7 A;  2VUP A;  4TXO B;  2YWI A;  1VRS D;  4XIH A;  1SJ6 A;  4X4J A;  3DVX A;  2DKH A;  5G30 A;  2FWE A;  1URM A;  3NOF A;  2FGX A;  4HI7 A;  3VUR A;  2B7J A;  4EO3 A;  3Q19 A;  1FO5 A;  3EYT A;  1GUL A;  4F0B A;  4K5R A;  1LU4 A;  4CDO A;  1WIK A;  3TJJ A;  4XS6 A;  4QL9 A;  2F8A A;  1NHY A;  2QGV A;  5AGY A;  2FA8 A;  1GP1 A;  5AIV A;  1PN9 A;  4MZC A;  2JU5 A;  2YJH A;  4YQU A;  2C0E A;  3ZZX A;  3A2V A;  4EDZ A;  5CRE A;  1PD2 1;  1JLV A;  1Z5Y E;  1J9B A;  2DML A;  4F9Z A;  5DAL A;  3TJG A;  2P0G A;  1TRU A;  3H4K A;  1K0M A;  5B6N A;  5IMV A;  1MDJ A;  1VF2 A;  1GSQ A;  1V58 A;  5B8B A;  5D73 A;  5IOW A;  2C8U A;  20GS A;  4TXO A;  3GTU B;  3KH7 A;  1N8J A;  4POM A;  1PN0 A;  2H1A A;  4GSN A;  4N11 A;  1FOV A;  4POK A;  1OYJ A;  2R37 A;  3H8Q A;  4PUR A;  3DGQ A;  22GS A;  1X9S B;  1ERU A;  3M3M A;  1M2D A;  2MMN A;  3GN3 A;  4FH8 A;  9GSS A;  3QAV A;  2XBI A;  1ZMA A;  2V6O A;  2QSI A;  1THX A;  2OE3 A;  1XOB A;  2MZC A;  2WB9 A;  5JCW A;  2V1M A;  1O8X A;  2A2P A;  2H76 A;  4DVC A;  5D9W A;  5DQY A;  1YZX A;  1RQM A;  4NV5 A;  13GS A;  4OFN A;  4BVX B;  4HEA 2;  4MH3 A;  2VM1 A;  2AJQ B;  2YZU A;  2P5R A;  5IMF A;  3LYK A;  1GUK A;  1YDK A;  3KP8 A;  4TR0 A;  3LYP A;  1RK4 A;  1A0F A;  2V41 A;  3L78 A;  2VD0 A;  4GRF A;  3F4R A;  1JZD A;  1R4W A;  4NAX A;  3UJ1 A;  3GTU A;  1SYX A;  3ZVJ D;  1QQ2 A;  2WJU A;  5E4W A;  5B6M A;  3DD3 A;  2LUS A;  2H1G A;  1A2J A;  2X49 A;  4GCI A;  2H75 A;  1SJI A;  5AN1 A;  3S9F A;  1M99 A;  2OBK A;  2C1Y A;  1AC1 A;  1Z9H A;  2M46 A;  2N5B A;  3ERG A;  1YEX A;  2YN1 A;  4DSQ A;  5CRH A;  1Z6M A;  4GLT A;  4I97 A;  3LFL A;  1XW5 A;  4WXT A;  1H4O A;  1ERT A;  5ELA A;  2R5G A;  2IFQ A;  2LS5 A;  4WR4 A;  4FIW A;  1XWK A;  4O5Q A;  5KN3 A;  5G5E A;  2CQ9 A;  2O87 A;  3HJO A;  3W6G A;  2XBQ A;  2F9S A;  3U6V A;  1EGO A;  3A2X A;  5ENU A;  3KCM A;  3GX8 A;  3QPM A;  4MLY A;  5D9X A;  2BTO T;  4Z2T A;  5ECH B;  2CZ3 A;  5DQS A;  1QGV A;  3GYK A;  1CQG A;  1MD3 A;  4BVX A;  1GSY A;  3A5I A;  6GSW A;  1PGT A;  3G7Y A;  4XRD A;  5J9C A;  1JLW A;  1EZK A;  2P5Q A;  1DE1 A;  3MWH A;  4J2F A;  5J4U A;  3DKS A;  2NDO A;  2HZF A;  4JR6 A;  4POB A;  2IMF A;  1XWB A;  2MMO A;  3E0U A;  1HNA A;  2IMK A;  1GSE A;  4K7I A;  1F6M C;  3ME8 A;  3FK8 A;  2HRN A;  5G31 A;  3VK9 A;  4TR1 A;  2RUF A;  1M2B A;  1S3A A;  5H5S A;  1QMV A;  4J56 E;  2DMM A;  1AAZ A;  1GSF A;  4OFM A;  1XPV A;  3FZ9 A;  1BJX A;  4NHZ A;  4MF6 A;  4EE0 A;  4ULX A;  2JZS A;  1VF1 A;  1OKD A;  1R26 A;  2FLS A;  4ZBA A;  4GXZ A;  3FKF A;  3FZ4 A;  1X5D A;  1JZW A;  2D2Z A;  5IMD A;  1BED A;  5IOX A;  1T3B A;  1OC9 B;  2X4A A;  18GS A;  5EPF A;  1AIU A;  1O85 A;  1HNB A;  1XCC A;  3FR6 A;  5KN2 A;  3BCK A;  3D4M A;  3FYG A;  3P2A A;  1O6J A;  4A5P A;  3VWX A;  1X5E A;  5DJL A;  4Z2R A;  2G0F A;  1N2A A;  4PNG A;  1XG8 A;  2VM2 A;  4K7O A;  2FWF A;  2F8F A;  2ALB A;  4NPB A;  5D9V A;  3VI7 A;  2XPE A;  2K8V A;  5B8A A;  1GRX A;  3APS A;  1FB0 A;  4HOJ A;  3GIX A;  4N10 A;  2RM5 A;  5DDL A;  8GSS A;  4QQ7 A;  2B6M A;  2MMZ A;  3ERF A;  2WCI A;  1U3A A;  5A4U A;  2X8H A;  3CQF A;  1ERV A;  5BMU A;  1ZOF A;  10GS A;  2R0P A;  3FY7 A;  3L4N A;  4YKG A;  3QFA C;  2LRN A;  4TN8 A;  1EV9 A;  1GL8 A;  4IVF A;  7GSS A;  2OA7 A;  5HR1 A;  2FD3 A;  2OKA A;  4Q5N A;  3TJK A;  5DJM A;  4LL1 B;  2J23 A;  3I6A A;  3VWU A;  4RUV A;  2R4V A;  3ZIJ A;  4X43 A;  2JAD A;  1FVJ A;  2N5F A;  5DCG A;  1OC9 A;  2I81 A;  4PQI A;  6GSS A;  1Z7R A;  1B9X C;  2GSQ A;  1O73 A;  2PMT A;  4EC0 A;  5CNW A;  1DSB A;  4KF9 A;  4IW9 A;  4EUY A;  4ML6 A;  2H30 A;  1GH2 A;  3V1W A;  2RII A;  4K0N A;  1JZO A;  1THO A;  1YEP A;  6GSY A;  5CAX A;  4FYU A;  3F4T A;  5J9B A;  4TW5 A;  2OJL A;  3O76 A;  4TXV A;  1F9M A;  4KAE A;  1XWC A;  3KM6 A;  3FZA A;  3EMP A;  1SJZ A;  4BVY B;  5ECM B;  1AXD A;  1UA5 A;  1MDI A;  1ON4 A;  4G9H A;  1GLP A;  2L6D A;  4HU7 A;  3A3T A;  2DBC A;  3UOM A;  4O5U A;  2GTU A;  4I5Q A;  3DVW A;  1X9W B;  1UVZ A;  3EIN A;  2TRC P;  2HNL A;  1T4Z A;  3US3 A;  2HI7 A;  1PL2 A;  1R5A A;  3LEF A;  3P90 A;  2PWJ A;  3G7J A;  2IL3 A;  4BL7 B;  2VL3 A;  3R3E A;  2CAI A;  4LMV A;  1XXU A;  1ABA A;  4TR4 A;  1AUC A;  2XPD A;  4KH7 A;  2MYG A;  3I69 A;  2HLS A;  1NSW A;  3DEX A;  4LA1 A;  5CRW A;  4F03 A;  4K0G A;  5DAK A;  1F3B A;  2KP2 A;  2KHP A;  2GS3 A;  4DSR A;  1M7T A;  4G10 A;  2VCX A;  3TCO A;  4HQZ A;  2GT5 A;  2EIO A;  1MD4 A;  2XHF A;  2QA2 A;  3HVS A;  5DCH A;  2G2Q A;  3H93 A;  3DYR A;  4K9Z A;  2LNS A;  2Z9S A;  4MCU A;  2EC4 A;  1Z7P A;  6GSX A;  1GTB A;  2C80 A;  2DJJ A;  3FEU A;  2E7P A;  1JHB A;  4BVY A;  3C7M A;  4ZB6 A;  4Q5R A;  1FG4 A;  2R3X A;  3TKP A;  1TKD B;  1C72 A;  4JR4 A;  4RI7 A; 
#chains in the Genus database with same CATH homology
 1E2Y A;  2LQO A;  2MBS A;  4YAP A;  1V98 A;  1A0R P;  2GGT A;  4MF5 A;  1G7E A;  3W8J A;  4V2L A;  2ZCT A;  3M8N A;  3GKM A;  5ID2 B;  4K2D A;  5EL8 A;  2NBS A;  1ZL9 A;  4BL7 A;  3GUS A;  3TB2 A;  3LW9 A;  3EU3 A;  3P8W A;  5ECQ B;  1B4Q A;  2LJR A;  5J3R A;  1R5P A;  1A8L A;  1TRW A;  3HY2 A;  3TKR A;  2YWO A;  3IOS A;  3TRQ A;  1PRX A;  2R2J A;  2QA1 A;  2O8V B;  5KN0 A;  4ZL9 A;  2R0C A;  1Z6N A;  5ECL B;  2DJ2 A;  5A4V A;  1FB6 A;  1VF4 A;  3IHG A;  3PH9 A;  1K0N A;  1GUH A;  3IAM 2;  4EKZ A;  4IS0 A;  2DIY A;  5FHI A;  1H75 A;  4KDY A;  4L0W A;  2DJK A;  4K1F A;  4YH2 A;  3CTF A;  4TVE A;  3LGC A;  3HDC A;  3FR3 A;  2CVK A;  2X99 A;  1DE2 A;  2GSS A;  3EMX A;  2B5X A;  1T8E B;  2HFD A;  2LJA A;  1GUM A;  5F07 A;  4DEJ A;  2MMA A;  1YY7 A;  4EXJ A;  3D5J A;  4MP4 A;  5CO3 A;  3MAK A;  4JBB A;  3WT2 A;  3PGT A;  4IEL A;  4L5L A;  2PBJ A;  5CP1 A;  1FAA A;  5HR0 A;  2BMX A;  3CRU A;  3C1S A;  5BRT A;  2C3Q A;  1K0B A;  2YWM A;  6GSU A;  2R0G A;  1F3A A;  2OAC A;  2ZUP A;  6GST A;  3JCM L;  4Z7X A;  1TK0 B;  2VD1 A;  5ID2 A;  2C0G A;  4MAB A;  6GSV A;  4LMW A;  3MYD A;  3GKN A;  1HYU A;  2X8G A;  3GH6 A;  2VCW A;  4IQA A;  2LRT A;  1TTZ A;  4I2U A;  3K8N A;  2DLX A;  1SD9 A;  2PVQ A;  2GVP A;  3LXT A;  2F3M A;  2X64 A;  1O7U A;  4MA9 A;  3HD5 A;  3UVT A;  1BYE A;  2EIR A;  1ZZY A;  4GSS A;  5D96 A;  1UC7 A;  2AHE A;  2B1L A;  4P3Y B;  3F0I A;  1EEM A;  2HSY A;  1J0F A;  2UZ8 A;  3F6F A;  4IJ3 A;  3LOR A;  3FZ5 A;  4PQH A;  2VL2 C;  4KCE A;  2E2G A;  3EWL A;  2M72 A;  5A4W A;  3EC3 A;  4HJ2 A;  4KA0 A;  1M9B A;  2B5Y A;  1M2A A;  3TOU A;  2FCH A;  1XZO A;  2I4A A;  3FRC A;  3GL3 A;  1BAY A;  1ZYE A;  2L4C A;  4DSS B;  4AF2 A;  3QDN A;  4XCS A;  4GTU A;  1X9M B;  2A4H A;  4YKF A;  3L9V A;  3G7I A;  3IC8 A;  4EL1 A;  1EGR A;  4OMV A;  1G0T A;  2L59 A;  4K6X A;  4JRR A;  2VOC A;  3D22 A;  3GNJ A;  3E9J B;  5AIX A;  1WWJ A;  1SL2 B;  1Y6E A;  1GLQ A;  2HSM A;  2C3N A;  4JED A;  2L5O A;  1G7O A;  1AW9 A;  2HT9 A;  1SL1 B;  3TRX A;  1OE8 A;  2H1B A;  4KSM A;  3TJF A;  1K3O A;  3M9K A;  2E0Q A;  5F8B A;  2E2M A;  4GST A;  3D4T A;  3RAZ A;  1WPI A;  1FVK A;  2YAN A;  3IA1 A;  3RHC A;  2HRF A;  1LBK A;  4IP1 A;  3EPT A;  1KTE A;  3H79 A;  3QR6 A;  2LNT A;  2K18 A;  2RM6 A;  4LLR A;  4JE1 A;  2H66 A;  3NZN A;  5GAN D;  3UL3 A;  2H70 A;  4O7H A;  3IV4 A;  2O85 A;  4I6X A;  2EIQ A;  2KLX A;  4IHU A;  3EVI A;  5J41 A;  3HJP A;  5ABR A;  4L0U A;  4BWS A;  3KIJ A;  3ZRE A;  5A5K A;  3QAW A;  3APO A;  1QFN A;  4KND A;  2M80 A;  4E8H A;  4WBJ A;  3TRP A;  4H86 A;  3PPU A;  4WF5 A;  5IPG A;  1XWA A;  1XOA A;  11GS A;  1YKA A;  3I43 A;  1BX9 A;  1WE0 A;  4V2M A;  2GZZ A;  2GZY A;  1EP7 A;  1YJ6 A;  1A2L A;  4NWY A;  4NXI A;  4MPF A;  1GSD A;  2KUC A;  3CXG A;  2B3S A;  2LKU A;  2WFC A;  4TKY A;  2VL9 A;  2ZNM A;  1EP8 A;  3VI5 A;  3RHB A;  2RLI A;  3UMA A;  3TKS A;  4JU5 A;  1O8W A;  1MTC A;  3UBK A;  3UVH A;  2AYT A;  3FR9 A;  4G0I A;  3HZ4 A;  3O6T A;  1PQN A;  4MZW A;  3LQ7 A;  5HQP A;  4KB3 A;  1OC8 A;  1TP9 A;  2C3T A;  4ZIJ A;  1WRY A;  5CYY A;  4K2X A;  1Q4J A;  5KEJ A;  2PN8 A;  2KOK A;  4PX1 A;  4RQR A;  5LNK e;  2IIY A;  5CRD A;  5L71 A;  4CY6 A;  2GQK A;  4AGS A;  5KN1 A;  4ILF A;  5DVB A;  3ZML A;  4ECJ A;  1FW1 A;  1SL0 B;  2OE1 A;  2DJ3 A;  4MJE A;  1Q98 A;  1KBN A;  2PER A;  3HVX A;  2TIR A;  5HFK A;  1SKR B;  2JSY A;  2H72 A;  3DIE A;  3ZYW A;  1A2M A;  1V57 A;  2OBI A;  1HNC A;  2L5L A;  1J08 A;  1DUG A;  1VGL A;  2H6Y A;  4PUA A;  4Q5F A;  1AQX A;  1KEB A;  4X1U A;  3HKR A;  1T4Y A;  3M9J A;  2O7K A;  1B4P A;  2C0D A;  3IRA A;  4HS1 A;  2A2R A;  4CY8 A;  2XC2 A;  4PNF A;  2H71 A;  2QKE A;  2FWG A;  3BCI A;  4ACS A;  4BWQ A;  1K3Y A;  4MJC A;  2H6X A;  2L57 A;  4O32 A;  4V2N A;  3UIW A;  3M0F A;  3ZIT A;  3EE2 A;  5F06 A;  1OVN A;  1TK5 B;  3Q6O A;  4RQX A;  4ISD A;  2NTO A;  2VAF A;  2I9H A;  1IYI A;  1HD2 A;  5GAP D;  14GS A;  4GWR A;  4CW9 A;  1G6Y A;  2GLR A;  1FHE A;  1F2E A;  1M9A A;  4XTS A;  3GSS A;  4HZ2 A;  4WBR D;  1FOH A;  1LJR A;  2LTK A;  4KSO A;  3CMI A;  3CYN A;  5JWQ B;  5IQY A;  2GZP A;  3NIV A;  2DC5 A;  2H19 A;  1K0C A;  4D73 B;  2C0F A;  1SU9 A;  3QD9 A;  1B8X A;  4PTS A;  2DIZ A;  4NHW A;  3QCP A;  4KE3 A;  1R7H A;  5G1L A;  4HU9 A;  4MNN A;  3ZMK A;  1ACV A;  1K3L A;  3UAP A;  3WYW A;  4NMU A;  5ECK B;  5G2Z A;  12GS A;  4IN0 A;  3KGK A;  1T1V A;  3IPZ A;  1TRV A;  2HXK A;  3GRX A;  5IMC A;  3RDW A;  1PSQ A;  5AIS A;  3GH9 A;  1GSS A;  4V1A g;  1JFU A;  2CT6 A;  17GS A;  3CSJ A;  2TRX A;  4OO5 A;  1W4V A;  2H8L A;  4X0X A;  4EF0 A;  4YQM A;  1WOU A;  4PQ1 A;  4EIQ A;  2AB6 A;  3KH9 A;  1YQ1 A;  2H0G A;  1B48 A;  3UEM A;  2L6C A;  2JZR A;  1PX6 A;  4POL A;  4KX4 A;  4MZB A;  1TU7 A;  1G6W A;  1WMJ A;  2L4Q A;  4HQS A;  1HQO A;  2YV7 A;  4MPG A;  3VLN A;  4TR3 A;  4YQV A;  3TKQ A;  19GS A;  2C4J A;  2YCD A;  2YV9 A;  4GF0 A;  4K8M A;  1U3I A;  1XW6 A;  3WT1 A;  2V6K A;  2HRK A;  1AQW A;  3FHK A;  5G1K A;  1OC3 A;  5FWG A;  2GDR A;  4OCE A;  1NM3 A;  2K9F A;  3BD2 A;  2CA8 A;  3QOU A;  1PKZ A;  2VCT A;  1X5C A;  1ERW A;  4D73 A;  3ZFL A;  3QMX A;  4ZXG A;  4ZL7 A;  1XFL A;  1TJD A;  3IE3 A;  3MNG A;  3HXS A;  4AJ8 A;  1ZYP A;  4N30 A;  2ON7 A;  1K0O A;  2LQQ A;  2JAC A;  4WF4 A;  2GQL A;  3L9S A;  2I1U A;  2YP6 A;  4KGI A;  5F05 A;  2CV4 A;  3ZRD A;  2P31 A;  1S3D A;  3MIX A;  1EOG A;  2PU9 C;  4IQ1 A;  3MSZ A;  4WEY A;  4ECI A;  1UN2 A;  4GQF A;  1A24 A;  4NV2 A;  1YF1 A;  3ZTL A;  1OAZ A;  2IMD A;  3MDK A;  1Y25 A;  3TUE A;  3HHV A;  2K8S A;  4GQC A;  2A4V A;  1TI1 A;  2ES7 A;  2FA4 A;  1V2A A;  5HR3 A;  4MK3 A;  5COH A;  2AAW A;  4BA7 A;  5ECN B;  4G0L A;  1TRS A;  3PIN A;  1SKS B;  1CQH A;  2OAD A;  1ZCP A;  1GTU A;  3N5O A;  4O5R A;  2QC7 A;  3PR8 A;  3VFI A;  2H6Z A;  1XVW A;  5ELG A;  1K0A A;  2A2S A;  4WET A;  3AY8 A;  2WS2 A;  1GNW A;  5ECO B;  2RUE A;  2X8C A;  4K5S A;  4XRA A;  4RI6 A;  2YZH A;  4JZQ A;  2REM A;  3LWA A;  2KP1 A;  3IC4 A;  2HSH A;  3D0Z A;  4YAV A;  3C1R A;  1I9D A;  2WDU A;  2PPT A;  3Q74 A;  2CVD A;  3GST A;  2I3Y A;  5HR2 A;  2VCV A;  4IKH A;  3F9U A;  2HZE B;  4XHM A;  3D21 A;  4KDX A;  1RW1 A;  4L8E A;  1GWC A;  3F3R A;  1JZR A;  1USB A;  3LJR A;  3IR4 A;  2GQM A;  1A8Y A;  4PGT A;  2VLU A;  4FO5 A;  3KJY A;  1NHO A;  5IPH A;  2LST A;  5IMA A;  1YKC A;  3CSH A;  3U5R E;  1W89 A;  2MBT A;  4G19 A;  1ML6 A;  3HZ8 A;  4N0V A;  2GST A;  4HDE A;  4WKW A;  2IFQ B;  4EDY A;  1PMT A;  4MH2 A;  1QUW A;  3ZL5 A;  2IN3 A;  1EV4 A;  5GZZ B;  5EVO A;  3GKK A;  1SK2 A;  2F51 A;  1QXH A;  2B5E A;  1T00 A;  3F63 A;  1PA3 A;  5GST A;  4ZB9 A;  1ST9 A;  3TKS E;  3UBL A;  2V2G A;  4ZBB A;  1V40 A;  3DRN A;  4HZ4 A;  3O3T A;  5CRG A;  2VCQ A;  4KCA A;  4EIP A;  1TOF A;  5KOX A;  1OKT A;  3KZQ A;  4N0Z A;  4KDU A;  1T7P B;  2IME A;  4OO4 A;  2LEG A;  2FNO A;  4AJ7 A;  3KD0 A;  3GA4 A;  4LL4 B;  3GMF A;  4PXO A;  4TR1 B;  3IK9 A;  2HZE A;  4FQU A;  2LRC A;  5IO2 A;  2WZ9 A;  5D93 A;  3BBY A;  1TXX A;  4ICY A;  1ZYN A;  2HE3 A;  2JSZ A;  2OE0 A;  2VL2 A;  4I2T A;  3J7Y b;  3GV1 A;  4V1A p;  5IM9 A;  3ERW A;  4OWY A;  1GTI A;  4HUA A;  3IK7 A;  3TGZ A;  2PUK C;  5HFI A;  5JCU A;  5G5F A;  3KEB A;  5DBQ A;  4ZB8 A;  2CAQ A;  5J5N A;  4IBP A;  3DML A;  1F37 A;  1TDI A;  2WGR A;  4K7N A;  3HJM A;  1NW2 A;  2V32 A;  4DSS A;  2CX3 A;  3F3Q A;  1SEN A;  3H1N A;  3TKS C;  2AV4 A;  3VPT A;  3KMO A;  3F8U A;  3TOT A;  1MEK A;  2FY6 A;  4MDC A;  4ZL8 A;  1OE7 A;  4AJ6 A;  1GNE A;  5ECP B;  2AUV A;  2VLT A;  1BQ7 A;  4KW6 A;  3GX0 A;  3BOA A;  3J7Y k;  1WJK A;  2K6V A;  1WP0 A;  3VWV A;  2LJK A;  3BJ5 A;  3A5W A;  5E59 A;  4ID0 A;  3CBU A;  2DKI A;  3C8E A;  3KXO A;  4XS4 B;  3LG6 A;  2CZ2 A;  3R2Q A;  1SK0 A;  1Z3E A;  2NPB A;  4ECB A;  3ISO A;  1U87 A;  4OCF A;  3FMW A;  3RPN A;  2YJ7 A;  4E8E A;  3ZIV A;  4F2I A;  3IDV A;  1BG5 A;  5JWR B;  3KMN A;  1O81 A;  2GT6 A;  3SWL A;  3I9V 2;  5LCZ A;  2HYX A;  16GS A;  4PUF C;  3GL5 A;  2ON5 A;  4BPY A;  3TDG A;  3A2W A;  3KP9 A;  4G0K A;  2NVL A;  4IGJ A;  1SKW B;  3F4S A;  3WGE A;  3DWV A;  2HRA A;  5GSS A;  1QK8 A;  2DJ0 A;  3KTL A;  4TRX A;  4CHS A;  3QAG A;  1EWX A;  4I8B A;  4ML1 A;  3CSI A;  1TI3 A;  4MF7 A;  4WR5 A;  3W8S A;  2PVO C;  5JWO B;  4IP6 A;  3HVV A;  2B1K A;  1KNG A;  2VO4 A;  2YNX A;  4FYC A;  1B9Y C;  3D6I A;  1YF0 A;  5C00 A;  4IJI A;  1GTA A;  4MMM A;  3RPP A;  1XBS A;  2VCZ A;  5ECI B;  4EVM A;  1DBY A;  2J9H A;  3RBT A;  4F82 A;  2B7K A;  5C04 A;  1S3C A;  4Z2U A;  5ECS A;  3IAS 2;  4XS4 A;  4TOP A;  5F0G A;  1X0R A;  1U6T A;  5EY6 A;  4USS A;  3CTG A;  4L5O A;  1MDK A;  4HJM A;  1K0D A;  1A23 A;  3IXR A;  1XIY A;  4FYB A;  2DSA A;  1SYR A;  1EEJ A;  5IIZ A;  3ZFB A;  2WUL A;  1ILO A;  2BJX A;  5D9T A;  3L9U A;  1EOH A;  5DAK B;  2FUG 2;  2H73 A;  2CVB A;  2H1D A;  2IWT A;  1SK1 A;  2WRT A;  3WD6 A;  2YOI A;  3QFB C;  2CX4 A;  1XWG A;  1M0U A;  2O89 A;  3C73 A;  4ECC A;  1XVQ A;  2JZT A;  3VPQ A;  4QL7 A;  3LXZ A;  3IHQ A;  5IMZ A;  2IMI A;  1XW9 A;  2GSR A;  2VLV A;  2R6K A;  3ME7 A;  3FW2 A;  3GUR A;  5ECR B;  2YPM A;  5HFG A;  3M1G A;  4XS1 A;  4Q5Q A;  1PKW A;  1IYH A;  4O92 A;  2IPA A;  3EUR A;  3SBC A;  4ZIL A;  3E3E A;  2FHE A;  2FWH A;  2H0H A;  4MJA A;  1ZYQ B;  5IO0 A;  1V9W A;  3GKX A;  3HYP A;  4J57 E;  3N9J A;  3OR5 A;  5D8I A;  3ED3 A;  3LSZ A;  3F6D A;  1SD8 A;  3ZLP A;  3GFK A;  3GHA A;  1GSU A;  3Q18 A;  1VF3 A;  1ZGN A;  5H5Q A;  5H5R A;  3HCZ A;  3TJB A;  3EU4 A;  2YWN A;  1TK8 B;  4F0C A;  4KUN A;  3WGD A;  5KOW A;  1E6B A;  1PL1 A;  2VIM A;  2IJY A;  3VWW A;  4OFT A;  2LV3 A;  1AQV A;  2H0I A;  3G9B A;  2H74 A;  4G2E A;  3CRT A;  3WGX A;  5B7C A;  2H01 A;  5LD0 A;  1I5G A;  5DAL B;  3UAR A;  2N5A A;  1U88 A;  5INY A;  2DJ1 A;  3C71 A;  5FT3 A;  2PGT A;  3DXB A;  3APQ A;  3IBH A;  3ZVJ A;  4MJB A;  3L0H A;  3KTB A;  5JCG A;  3HA9 A;  1TU8 A;  3P7X A;  1PX7 A;  4ZBD A;  1TW9 A;  2JL4 A;  4OD7 A;  2VUP A;  4TXO B;  2YWI A;  1VRS D;  4XIH A;  1SJ6 A;  4X4J A;  3DVX A;  2DKH A;  5G30 A;  2FWE A;  1URM A;  3NOF A;  2FGX A;  4HI7 A;  3VUR A;  2B7J A;  4EO3 A;  3Q19 A;  1FO5 A;  3EYT A;  1GUL A;  4F0B A;  4K5R A;  1LU4 A;  4CDO A;  1WIK A;  3TJJ A;  4XS6 A;  4QL9 A;  2F8A A;  1NHY A;  2QGV A;  5AGY A;  2FA8 A;  1GP1 A;  5AIV A;  1PN9 A;  4MZC A;  2JU5 A;  2YJH A;  4YQU A;  2C0E A;  3ZZX A;  3A2V A;  4EDZ A;  5CRE A;  1PD2 1;  1JLV A;  1Z5Y E;  1J9B A;  2DML A;  4F9Z A;  5DAL A;  3TJG A;  2P0G A;  1TRU A;  3H4K A;  1K0M A;  5B6N A;  5IMV A;  1MDJ A;  1VF2 A;  1GSQ A;  1V58 A;  5B8B A;  5D73 A;  5IOW A;  2C8U A;  20GS A;  4TXO A;  3GTU B;  3KH7 A;  1N8J A;  4POM A;  1PN0 A;  2H1A A;  4GSN A;  4N11 A;  1FOV A;  4POK A;  1OYJ A;  2R37 A;  3H8Q A;  4PUR A;  3DGQ A;  22GS A;  1X9S B;  1ERU A;  3M3M A;  1M2D A;  2MMN A;  3GN3 A;  4FH8 A;  9GSS A;  3QAV A;  2XBI A;  1ZMA A;  2V6O A;  2QSI A;  1THX A;  2OE3 A;  1XOB A;  2MZC A;  2WB9 A;  5JCW A;  2V1M A;  1O8X A;  2A2P A;  2H76 A;  4DVC A;  5D9W A;  5DQY A;  1YZX A;  1RQM A;  4NV5 A;  13GS A;  4OFN A;  4BVX B;  4HEA 2;  4MH3 A;  2VM1 A;  2AJQ B;  2YZU A;  2P5R A;  5IMF A;  3LYK A;  1GUK A;  1YDK A;  3KP8 A;  4TR0 A;  3LYP A;  1RK4 A;  1A0F A;  2V41 A;  3L78 A;  2VD0 A;  4GRF A;  3F4R A;  1JZD A;  1R4W A;  4NAX A;  3UJ1 A;  3GTU A;  1SYX A;  3ZVJ D;  1QQ2 A;  2WJU A;  5E4W A;  5B6M A;  3DD3 A;  2LUS A;  2H1G A;  1A2J A;  2X49 A;  4GCI A;  2H75 A;  1SJI A;  5AN1 A;  3S9F A;  1M99 A;  2OBK A;  2C1Y A;  1AC1 A;  1Z9H A;  2M46 A;  2N5B A;  3ERG A;  1YEX A;  2YN1 A;  4DSQ A;  5CRH A;  1Z6M A;  4GLT A;  4I97 A;  3LFL A;  1XW5 A;  4WXT A;  1H4O A;  1ERT A;  5ELA A;  2R5G A;  2IFQ A;  2LS5 A;  4WR4 A;  4FIW A;  1XWK A;  4O5Q A;  5KN3 A;  5G5E A;  2CQ9 A;  2O87 A;  3HJO A;  3W6G A;  2XBQ A;  2F9S A;  3U6V A;  1EGO A;  3A2X A;  5ENU A;  3KCM A;  3GX8 A;  3QPM A;  4MLY A;  5D9X A;  2BTO T;  4Z2T A;  5ECH B;  2CZ3 A;  5DQS A;  1QGV A;  3GYK A;  1CQG A;  1MD3 A;  4BVX A;  1GSY A;  3A5I A;  6GSW A;  1PGT A;  3G7Y A;  4XRD A;  5J9C A;  1JLW A;  1EZK A;  2P5Q A;  1DE1 A;  3MWH A;  4J2F A;  5J4U A;  3DKS A;  2NDO A;  2HZF A;  4JR6 A;  4POB A;  2IMF A;  1XWB A;  2MMO A;  3E0U A;  1HNA A;  2IMK A;  1GSE A;  4K7I A;  1F6M C;  3ME8 A;  3FK8 A;  2HRN A;  5G31 A;  3VK9 A;  4TR1 A;  2RUF A;  1M2B A;  1S3A A;  5H5S A;  1QMV A;  4J56 E;  2DMM A;  1AAZ A;  1GSF A;  4OFM A;  1XPV A;  3FZ9 A;  1BJX A;  4NHZ A;  4MF6 A;  4EE0 A;  4ULX A;  2JZS A;  1VF1 A;  1OKD A;  1R26 A;  2FLS A;  4ZBA A;  4GXZ A;  3FKF A;  3FZ4 A;  1X5D A;  1JZW A;  2D2Z A;  5IMD A;  1BED A;  5IOX A;  1T3B A;  1OC9 B;  2X4A A;  18GS A;  5EPF A;  1AIU A;  1O85 A;  1HNB A;  1XCC A;  3FR6 A;  5KN2 A;  3BCK A;  3D4M A;  3FYG A;  3P2A A;  1O6J A;  4A5P A;  3VWX A;  1X5E A;  5DJL A;  4Z2R A;  2G0F A;  1N2A A;  4PNG A;  2VM2 A;  4K7O A;  2FWF A;  2F8F A;  2ALB A;  4NPB A;  5D9V A;  3VI7 A;  2XPE A;  2K8V A;  5B8A A;  1GRX A;  3APS A;  1FB0 A;  4HOJ A;  3GIX A;  4N10 A;  2RM5 A;  5DDL A;  8GSS A;  4QQ7 A;  2B6M A;  2MMZ A;  3ERF A;  2WCI A;  1U3A A;  5A4U A;  2X8H A;  1ERV A;  5BMU A;  1ZOF A;  10GS A;  2R0P A;  3FY7 A;  3L4N A;  4YKG A;  3QFA C;  2LRN A;  4TN8 A;  1EV9 A;  1GL8 A;  4IVF A;  7GSS A;  2OA7 A;  5HR1 A;  2FD3 A;  2OKA A;  4Q5N A;  3TJK A;  5DJM A;  4LL1 B;  2J23 A;  3I6A A;  3VWU A;  4RUV A;  2R4V A;  3ZIJ A;  4X43 A;  2JAD A;  1FVJ A;  2N5F A;  5DCG A;  1OC9 A;  2I81 A;  4PQI A;  6GSS A;  1Z7R A;  1B9X C;  2GSQ A;  1O73 A;  2PMT A;  4EC0 A;  5CNW A;  1DSB A;  4KF9 A;  4IW9 A;  4EUY A;  4ML6 A;  2H30 A;  1GH2 A;  3V1W A;  2RII A;  4K0N A;  1JZO A;  1THO A;  1YEP A;  6GSY A;  5CAX A;  4FYU A;  3F4T A;  5J9B A;  4TW5 A;  2OJL A;  3O76 A;  4TXV A;  1F9M A;  4KAE A;  1XWC A;  3KM6 A;  3FZA A;  3EMP A;  1SJZ A;  4BVY B;  5ECM B;  1AXD A;  1UA5 A;  1MDI A;  1ON4 A;  4G9H A;  1GLP A;  2L6D A;  4HU7 A;  3A3T A;  2DBC A;  3UOM A;  4O5U A;  2GTU A;  4I5Q A;  3DVW A;  1X9W B;  1UVZ A;  3EIN A;  2TRC P;  2HNL A;  1T4Z A;  3US3 A;  2HI7 A;  1PL2 A;  1R5A A;  3LEF A;  3P90 A;  2PWJ A;  3G7J A;  2IL3 A;  4BL7 B;  2VL3 A;  3R3E A;  2CAI A;  4LMV A;  1XXU A;  1ABA A;  4TR4 A;  1AUC A;  2XPD A;  4KH7 A;  2MYG A;  3I69 A;  2HLS A;  1NSW A;  3DEX A;  4LA1 A;  5CRW A;  4F03 A;  4K0G A;  5DAK A;  1F3B A;  2KP2 A;  2KHP A;  2GS3 A;  4DSR A;  1M7T A;  4G10 A;  2VCX A;  3TCO A;  4HQZ A;  2GT5 A;  2EIO A;  1MD4 A;  2XHF A;  2QA2 A;  3HVS A;  5DCH A;  2G2Q A;  3H93 A;  3DYR A;  4K9Z A;  2LNS A;  2Z9S A;  4MCU A;  2EC4 A;  1Z7P A;  6GSX A;  1GTB A;  2C80 A;  2DJJ A;  3FEU A;  2E7P A;  1JHB A;  4BVY A;  3C7M A;  4ZB6 A;  4Q5R A;  1FG4 A;  2R3X A;  3TKP A;  1TKD B;  1C72 A;  4JR4 A;  4RI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...