1OCOB

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
b'MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocoB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocoB02
2IWKA 1AANA 2HX9A 9PCYA 2X88A 1TKWA 2AFNA 1ZV2A 3DIVA 3NJNA 6PCYA 1L9TA 2BZCA 1PY0A 3PPSA 2YARA 3TBCA 3FSVA 3FYIB 3PLYA 3T71A 2OJ1A 3ZIYA 3ABKB 3FPYA 1JZHA 4YSQA 3QPKA 1PAZA 2QDVA 3FU8A 5LDUA 2EILB 4DP8X 3AW5A 2CCWA 5F7BA 5EHFA 3GYRA 3UAAA 1SHWA 1ASOA 1L9QA 1DZ0A 3WNJA 3QJTB 1CC3A 3NSDA 5ANHA 5I28A 3NYKA 4AZUA 2HRHA 5A7EA 2XV3A 3FU7B 2VSKB 3S8FB 4E9XA 4GXFA 4YSPA 2IDUA 2OCCB 1L9OA 4A2DA 2YAMA 1ZPUA 3NJKA 3NT0A 4E9TA 2P80A 3QJSB 4UF7C 2IH8A 1V54B 1AG6A 2XU9A 1W8EA 2GC4C 2YAQA 5I5JA 2I7OA 1KV7A 1SFDA 1JZIA 1ET7A 2IAAC 2ZONA 3QJQB 3X1BA 4A2HA 5E9NA 4A67A 2VW4A 3ASOB 1KDIA 1BQKA 1L9RA 2MTAA 1FWXA 2WO2B 3T6XA 2CALA 4DP7X 4KNUA 4GYBA 1IBYA 1DYZA 2FTAA 4HALA 2H47C 4F7KA 1N68A 3QJUB 1E65A 5D4JA 3QJRB 2FNWA 1A4CA 2CAKA 1XB6A 1OCOB 3IN0A 4FA7B 2DV6A 1ASQA 3H4HA 2GBAA 4WKXA 1OCRB 5B1BB 3ABLB 5B7EA 4ENZA 1QNIA 5AKRA 3NSFA 2EIMB 4HZ1A 2PPFA 1NWPA 4DPAX 4A66A 2VW7A 1NIBA 1QHQA 2FJSA 1B3IA 2BO0A 1AACA 1NIFA 1E5YA 1JZGA 2ZOOA 3OM3B 2EIKB 1I53A 1MZYA 3OMAB 1URIA 2YXVA 3NP4A 5I5IA 3NJHA 5I6NA 3S3BB 2EIJB 1IBZA 1CYWA 3TBBA 1MZZA 1WS7A 2JFCA 2FT7A 2HX8A 2PPAA 1GR7A 1NPJA 2ZWNA 4GP5B 4HCGA 4JHUA 7PCYA 5I6MA 2TSAA 3OMNB 3RYMA 3SQRA 2YAEA 4YSUA 1NIEA 1L9SA 1SJMA 3WKPA 4CSPA 2QPEB 3NJJA 1NWOA 5I6LA 1X9RA 2XWZA 2AANA 4WTQA 2PLTA 2XXGA 8PAZA 1OOWA 1PZCA 3PXLA 1HAWA 2BWIA 1JVLA 4PCYA 1UATA 2QDWA 1ETJA 3DKHA 2FQDA 1M57B 1AZCA 2XV0A 1EHKB 4KO6A 1E67A 3WIAA 1F56A 5I26A 1J5CA 4K9JA 1A3ZA 1R1CA 1V10A 1JVOA 4GP8B 3IE9A 5I6OA 1JOIA 2GI0A 5D4HA 2EINB 4DP6X 1OCCB 4A2FA 2PCFA 3IEAA 5AFAA 1JXFA 4NB7A 1NPNA 2HXAA 2LLNA 1ET5A 2YAOA 1X9UA 1TU2A 3FPXA 3NJMA 4G7SB 3S8GB 1BAWA 5TK4A 1A4BA 1BQRA 3FQ1A 4BDVB 2JXMA 4G7RB 1NINA 3UACA 3CDZA 3FQ2A 4KO7A 3U25A 1SHXA 2DYRB 2B08A 3S3DB 2GSMB 2FQGA 3QJVB 1E5ZA 2XX0A 4KNTA 4YVUA 3FSZA 3TA4D 4YSAA 5B1AB 1TEFA 2CJ3A 2BP8B 2J56A 3X1EA 1SDDA 2H3XC 3V9CA 5I5MA 2W88A 1CURA 1ID2A 1NICA 4HCIA 5I6KA 3NJIA 1BXAA 1IUZA 4G71B 3G5WA 1W6LA 3FU7A 5TK2A 4X4KA 2XUWA 4YSTA 4FAAB 3SBQA 3WNIA 4DP2X 2PPCA 3NSCA 4JHVA 3T9WA 2H5UA 2YEVB 2BP0A 2J5WA 4DPCX 3OQRA 2YXWA 4GP4B 2UXTA 5F7AA 4E9QA 2PCYA 2UX6A 2YAHA 1ILUA 4AKOA 4YSSA 2HLEB 3PCYA 2XXFA 4YSDA 1ZDSA 2BWDA 1SNRA 2PP7A 1KBWA 5PAZA 2GB2A 3CVCA 1ILSA 1KDJA 2XVBA 4CSZA 3ZBMA 3EH5B 2Y69B 1AZBA 4MFHA 4N4YB 3CVDA 1RKRA 2R7EA 3FT0A 3PAUA 2IWFA 1AQ8A 1GSKA 1FFTB 4KO9A 4P5SA 3ABGA 4AI7A 3X1FA 1J5DA 3AG3B 2AZAA 3BQVA 4YSEA 1J9TA 1GW0A 1IC0A 2B3IA 1BEXA 3D12B 2TSBA 4G70B 2NRDA 1JERA 2GC7C 3SBRA 3WKQA 1WS8A 1MG3C 1GY1A 1KYAA 4KNSA 3ASNB 3EHBB 4A2EA 2Y1AA 3KW8A 4NERA 2HX7A 2XYBA 3GDCA 3UAEA 4E9VA 1SF3A 2E86A 4N8UA 2VM3A 2AVFA 5B1KA 1MDAA 2GIMA 2VN3A 3AZUA 1PF3A 1AAJA 2A3TA 2XLLA 4KO5A 4Q8BA 5I6PA 4AKPA 1NDTA 4QKTA 2PPEA 3X1GA 2WSDA 4BXVA 2HZHA 2RACA 1PNCA 2UX7A 1JXGA 3AY2A 5B1JA 2FT8A 1ASPA 4W9ZA 4DP9X 2W8CA 3FSAA 2DWTA 3OMIB 1BYPA 2N0MA 1WA0X 4HCFA 2VMJA 2DWSA 3PAVA 4G7QB 4Q89A 1L9PA 4DPBX 3EF4A 1OV8A 4HHWA 1WAEA 5IY5B 1MG2C 2XX1A 3S3CB 1KGYE 2BHFA 1JZEA 3NJFA 1BXVA 1OE1A 2Q9OA 3UGEA 4YSCA 2IDSA 2FQFA 1ZIBA 2GHZA 1PMYA 2JKWA 2AZUA 2FQEA 4DP1X 3C75A 3FYEB 1NIDA 4DP4X 1AR1B 4P5RA 3CZUB 1EZLA 1KBVA 3N55A 1T5KA 3IBOA 1ADWA 4NAJA 2J55A 1ZIAA 1N70A 5AZUA 4BK5C 1XB3A 3CDZB 3EH4B 2I7SA 1BQ5A 1BYOA 3TU6A 3DTUB 1RZPA 2QT6A 1AZNA 3NSYA 5FC9A 2VW6A 5B7FA 2IH9A 3OD3A 3ABMB 1NZRA 4UAHA 1KCBA 1V55B 1SDDB 3EH3B 3FQYA 2UXGA 3TASA 1M56B 3KW7A 1HFUA 4L0PB 1PZBA 3T6ZA 1AS8A 5D4IA 4BXSV 3HEIB 4KOBA 5PCYA 4TXVB 4YL4A 3X2QB 1GYCA 3SBPA 4BDVA 3HB3B 1ZDQA 2YAPA 2PP8A 4RH4A 4F2FA 1AZUA 4A68A 4BWWA 2J57A 2OV0A 1AZRA 1OE2A 2HRGA 3FS9A 4G72B 2BW4A 1PZAA 1GS6X 2VSMB 3BVDB 4HIPA 2BP0B 2DYSB 1CUOA 1A8ZA 1J9QA 1HAUA 1SFHA 1AS6A 3FU9A 2BP8A 2YAFA 2MRYA 1A4AA 3GXUB 4YSOA 1J9RA 3AG1B 1NTDA 3NJGA 3T6WA 3ZDWA 4HAKA 4QLWA 1PNDA 1XMEB 2PPDA 4A2GA 2UXFA 2IDFA 4M3HA 1WA2X 3ERXA 1YLBB 3PAZA 3UADA 3MBWB 1FA4A 4E9SA 1AIZA 1GY2A 2YQBA 1XB8A 2R7EB 5B1JC 4E9RA 4ZK8A 5B7MA 3JT2A 2FT6A 1M9WA 2DY2A 3N2JA 1JZJA 2UXVA 3IN2A 3ZX1A 4DP0X 3AG4B 1PLCA 1GS7A 4E9WA 2X87A 2BW5A 3X1NA 2I85A 1ET8A 1JZFA 1W6WA 4AX3A 1SF5A 1OCZB 1BXUA 4M4RB 4UANA 4W1TA 2XV2A 1PLBA 3WG7B 2PP9A 4BWTA 1NIAA 3NJLA 3L45A 4YSRA 1AOZA 2Q5BA 4EF3A 4BWUA 3CVBA 4YVNA 1JXDA 1IKOP 2WO3B 1A65A 5B3SB 1VLXA 3JTBA 1RCYA 1PLAA 4KOCA 1RZQA 2CBPA 2IDQA 1OE3A 3H56A 3QQXA 1PCSA 2BZ7A 4E9YA 1E30A 3FSWA 2CUAA 1TEGA 2FWLB 3NP3A 1AG0A 3AG2B 3UABA 4JKNA 3MX0B 1KCWA 3WI9A 4F2EA 2P80D 4GY4A 3H4FA 2IDTA 4AKQA 1J9SA 4PAZA 2VM4A 1QLEB 1GS8A 1WA1X 1AS7A 2IWEA 1CYXA 3T6VA 3V9EA 4HHGA 7PAZA 2ZXWB 1OF0A 6PAZA 4DP5X 2QPDB 3CG8A
chains in the Genus database with same CATH superfamily
4Z5RA 2IWKA 4HSAC 1NH2D 4N21A 5HHQB 2NY4D 1L7TH 1UZ6E 1L0NH 4PRBA 3CJHB 3ARQA 3Q8FA 4JY6A 1L7IL 4ZFZA 1Q1PA 2VLJA 4H2CA 4Y4HA 5GSVA 4ZI8A 4PJIA 1I0HA 2VQTA 2LW7A 4PJXF 4JFFE 2AKRA 4ZMYA 1YO4A 2BM3A 3BGFB 2FJFA 4JFEB 4X7SH 1P1VA 2JXMB 1ZV5A 1V05A 2I69A 2ZKMX 4XMXA 1G9ML 3P0VL 3JV4B 1RZGA 4AQAA 2IC2A 3LIZA 4B50A 3H3BC 1GRJA 3OKEA 4LFCO 4GKKO 1U8IB 5I71C 1QR1B 3QXUA 3RE0A 2JJTA 1NUDA 4HETA 5CA1B 3DMMA 4HIJB 2BY1A 1T7VA 3S36L 5EZIL 3KYOA 4U3SB 3NSDA 5KSBF 2V6HA 1PZDA 4PG9A 3CH1A 4ILDA 3QNZB 1KTLA 2E47A 2JB5H 2HRHA 1E5CA 4TUUA 3MLRH 1XFPA 3GMNA 4Y4FB 2R1XA 4BUGA 5EIIA 3QE5A 4YAQB 2VSKB 2F1BA 4RDQF 5FGRA 2OYPA 2H32H 4IDJH 3BKJL 1XCTA 1S5LZ 4NCC1 3BY6A 4FGMA 3BYYA 5HGHA 3CSPA 1IBGH 2WVSA 4MTXA 2B9ZA 3G80A 4WUUB 1H38A 3EW3B 2IH8A 5T3XE 3F01A 3WFZA 2LAAA 1MFNA 1RZ8B 2OZNA 3I2CL 4LCWA 4LVNC 3M7MX 3OL2A 4TNWF 5I9QC 4PV8A 2YD6A 3Q1EA 3E86A 2EAEA 3OF6A 1GGTA 4LBAA 2CGOA 5CCJA 3DJ9A 1W8OA 3RYHA 3QIBB 1XL6A 3MUUA 4KHXL 4HUMB 2AHIA 4F33B 1DQKA 4KZEL 3ZEDA 1VARA 3P30H 4JAVA 5C0JB 2VUYA 3RIAF 1KY6A 5FHBH 3TK1A 4JI5O 1CLOL 3ZDYF 5CMAA 3BFWA 3D8MA 5AL0A 2TAAA 3BHBA 4N26A 3FN0L 5DRXB 1CE1L 3QUMB 3QH3B 2HT4D 4G59C 1CL7H 4YR6B 1XVSA 2LW3A 4Q6IC 2XN9B 5J0BA 4F37K 3U1QA 1PM9A 2KERA 2WTOA 3Q6FA 5TDOA 3VI4E 4NBXB 2IANB 3VNZA 1LWRA 4IBSA 1SN0A 2YPKB 2H9GB 5A40E 4BW5A 3VH8G 2VDPB 2RFXA 1A9BB 2BNQE 2B2XL 4AE1A 5AENA 5EU3A 4RZCB 3RFRA 4BA8A 3B2DC 4HZ1A 2NY3C 4N23A 1SXNA 5JHDB 5CWSA 1D3CA 3OB8A 4KXZI 4A66A 5T1DL 3O65A 1O75A 3HMXL 4PRID 4XPGL 4UT9A 3QXWA 3GBMH 4FLUA 4S0HA 4LP8A 1JZGA 3K2IA 1LO3L 2Q3AA 1OF2B 2JJVA 4MJ2A 4JI1O 4N0FA 4WFGD 4M6OH 5C0AA 2OJEB 3D3VB 4LVHC 1AQDB 4MKMA 5BOZG 3S6CA 4B3SO 4A6YB 4UIMB 3X3FL 2CBTA 1DSWA 5GRWA 5IHZB 2F1EA 5HDRA 3UAJD 5KVFH 4FCHA 2OJZH 5DEZA 5LHHA 3U4KA 2IOMA 1AR1C 3AFLA 3TNMB 1TTGA 1UJ3C 4UCTA 5E9DB 4ZFOB 2H8PB 4OF8A 4HCGA 4U2YA 4EZLA 1AJPA 4NN6B 4GSDH 4Z5RB 5JPNA 3AAZA 1ZA6A 1A6UL 1HE8A 4YHPA 4N24A 1DVSA 3CH8A 1FO0A 2JIXD 4PRBB 1L0XA 1BZ7B 4H8QA 2XZQH 3RPKA 4JY6B 1C1EH 1N5AA 3S3SA 4ZFZB 3VQWA 1UZ8A 2VLJB 3KVQA 4JJ5A 2QGBA 4PJIB 1ZLWH 3SKJL 2DQ3A 4RX4D 2AKRB 1E9PA 1MWOA 4P5KB 2FJFB 2VDQH 1G1YA 2OYMA 3VXTB 1XF3B 2XV0A 2W6IG 1FNGA 1KYOK 4KJWC 4CH5A 3OLGA 3O6FC 1RZGB 1VAHA 2E9WA 2ORBL 2P9RA 1S8DA 2G4GA 4TRPH 4AQAB 1KPUA 4KK5C 3OKEB 1WNSA 3CVHL 1ZVSA 4DETA 3T0XA 4MSWA 2EINB 4YLQT 2HFEC 1G9MC 3MV7E 1F18A 1VCAA 4DP6X 4KRPD 2X6CA 2K0RA 5CIPH 4PJGA 4Z7UF 3PGCA 3OUFA 1Z5VA 3L1GA 3MGTA 3P73A 1NCWH 3SYCA 1GZQB 3T2QA 1AP2B 1SLWA 2JVDA 4JFFD 4NCDA 4U6HA 1KTLB 2WTPA 4GS7B 5KJRH 2YUVA 5ALCL 1GJIA 1OT2A 2JCCF 4ONGL 4FTVD 3VQLA 3QULB 3VXSE 3DSFL 5DS8B 1CGYA 1N34B 1XCTB 5K33A 1RFDH 3FTGA 4JGMA 2XX0A 4RQEA 4YSAA 3BRFA 2KSDA 4R4FH 2HVJC 3OGCA 4FJYA 3ZE2F 3P77B 1BGXL 4G80A 2EVIA 2B1HL 4FM1A 1DO6A 1JF1B 3DJRA 4E41A 2G75A 3K5NA 3MV01 1UUSA 1DUYB 4KV5F 3AQYA 4X8JA 4HFWA 1A7PH 3QO1A 1YNKH 1BECA 1MRCH 3BH9B 1QWNA 4AUJA 1RIVH 4FC3E 1WISA 1QO3B 4Z6AT 1RZKL 4DP2X 3B9KA 5FYLL 4XO3A 1BVNT 2C4XA 3GRBA 1WPCA 2PPCA 5HI3D 3WBDA 3BHBB 4TUOB 3OXRB 2DJUA 3UDWA 3WAJA 5T3XD 1G5AA 2ZICA 3KGRA 2OSWA 1F4NA 2ITFA 4MW3A 1QNZL 3A67L 3N40F 2MK3A 4GXUM 4QMEA 5J6HB 4GQ9H 3BFRA 2LU5A 5FXCH 1HSAA 3CZFA 3KGSA 2ZKHH 3JSSA 3PCYA 3Q6FB 5TDOB 4LGPB 1K9TA 2BIIA 3HRZA 3PU7A 1VRSA 3UX9B 1EXUA 1M2VA 3VM5A 5FB8B 3ULVE 3LKPA 3JYCA 3NA4A 2D3LA 5C3LD 2P43B 1ZTXE 2X89A 1QFWL 1DL7L 3CVCA 2BH0A 2JJUA 3L48A 4C83A 4H20L 4CSZA 1HNWO 4F8TA 3GSNA 4N4YB 2X2YA 1JTTA 2EIDA 3H53A 4NR1A 3OR6B 2IALA 1TVHB 2WB1A 3GLZA 2EKSB 4NO0D 1FE8L 4G6AD 2DQEH 1CGTA 3FRUA 4KX8A 4LIQL 2ZIMA 5ESQA 3BAXA 4HPOL 1BEXA 4EVNA 5C0AB 3OKKA 4R83A 4Z3HA 5D5MF 5BOPA 3MYJA 5EZPA 3T1CA 2BNQD 1IAKA 5EIBC 3T04D 3K03A 3KM1A 5FS5A 3U9PH 3ZL2A 3SDLA 1NKDA 1QTSA 5CCGE 4ISVA 2IH1C 2N01B 2E86A 1GC1L 1A9VA 2X4NB 5JMRA 2DN9A 3U7WH 4J3OC 2X6VA 5JHLL 5EN2A 4F9PC 4LFBB 5IQOA 2RGSA 3OKYA 5C86A 5JW4R 1EJ8A 3HZMA 1TETH 2EVHA 4M29A 3QPXH 3N1PC 3ZZSA 1XDCA 4I89A 2XLLA 1YUHA 3DXRA 1RIUH 1YEGL 5DS2A 1DQML 1I3UA 1N5AB 2Y3NA 2YOAA 2LAGB 2EACA 5DMIL 3H3PL 5IYZA 1EGJL 5LP6C 1CDCA 3RTLA 2GHYA 1H8HG 3LD8B 1E9PB 3SGEH 1E6OH 4W9ZA 1Q9KB 1JI1A 1N9PA 4JREB 1F4YL 5AKVA 3PAVA 3O8XC 5FYJE 4PPTA 4JZJC 1Z9NA 4PRAA 4Z7QF 5I0DA 5KBLA 4DV5B 1IURA 1KPUB 4ZMVA 2LTQC 2NNUA 1M90W 2W9LA 4HUUA 4W4OA 5CEZH 4I0XB 2AJXH 2PXYD 5GGVH 3VYPA 3O3DA 4GW4B 2E7LC 4AC4A 3PGCB 5D1ZB 2FQEA 3MGTB 3MRLA 4XTRD 4F7EB 4XNZC 3BPLB 4PGZA 4HV8A 2OZ4A 4P2OA 3L75H 2DWDB 5CA3A 4K5NA 3TT1H 2ZAIA 3O2WL 3N9GH 4ZOAA 3W56A 4GRLD 4RSYA 1YEFL 1TUBA 2APXA 1Q3EA 5GJSL 4ALAL 1ZLUH 2ITDC 3L6FA 3E22B 3L4ZA 5I2IB 3FQTB 4ZPTB 4PJFB 5IV2A 1QAWA 2VLKE 1QI5A 5DYFA 1ADQL 1YF2A 5C0IB 3SDAA 1IC7L 1MRFH 3KW7A 3QP3A 4IKKA 4OLYL 4E41B 4L0PB 2G75B 3SCMD 1JHTA 3MOAH 4X7CC 1R4XA 1XF4B 5GS0D 3LZOA 4HC1H 4ONOA 3VWJC 4YL4A 3VXUA 4PJ8D 5EOCH 3O0RH 1AI4A 4NZUL 1L3NA 5CJ8A 1J10A 3VXSD 3BC9A 2EDBA 2Y25A 3VCLA 3B9KB 4EPSA 3HG4A 4AKOA 1MUJA 3HKEA 4EN3C 1OGAE 4YE4L 2QLVB 4LDOB 5KSAD 2O61A 3ZDZF 5EBMA 3VFOB 1I3VA 5I15L 3MLYH 2FL5A 1K85A 2FE0A 4A2GA 3DV6A 1M2VB 3LKPB 3TN0C 3ZMZA 5KS9F 3PWVB 4WU5B 5D7SL 4JQIA 2N7AA 3BAYA 2XNDG 2Q8VA 5LDSA 3DOSA 2IALB 4JCWA 3DHPA 2V17H 1TFPA 5D2NC 1YEDA 1AROP 1KLGB 4TLTA 4ZK8A 2IVFC 1VA9A 3F84A 1M9WA 4EIBA 3D48R 4E2OA 1A3LH 1WIOA 1OALA 1FVCA 2DJVA 4MVOA 2NY2D 1OO2A 3FRUB 1GS7A 3ARFB 4E9WA 1LEIB 3FU5A 4EB6B 1A9EB 1MCHA 4KUCD 4HGWB 4HUXB 1OP5K 3T4ZA 4EVNB 3CCHB 3ULVD 1IQDB 2DM4A 2BY3A 2NX5E 2XZCH 2EH7L 4BIUA 3GXNA 5CZKA 1XGRB 1MH5A 4K3JL 1NMAH 4ISVB 5FL7G 4BWUA 3HUJA 5AAWC 4EUPA 3KD4A 3I50H 3SB3A 3APCA 4NO2A 1G6UA 3MA9H 1I9JL 2CBPA 3HZMB 2MPVA 4QWWC 1GC1C 2OMTA 5BRQA 4PEEA 2EO9A 5ANMA 4JFDB 5EF2A 1YUHB 1YHPA 4ONFL 3DJZA 4JVPA 4XX5A 5C09A 1AG0A 4BQBA 1J88A 5J12B 1Z0MA 1F4AA 3F7KA 2K6ZA 2BVQA 4YE0A 2E7HA 3RT3C 1QG3A 2YZ1A 4M6AA 5E2VL 5DVNA 1QLEB 4PRAB 3FB8C 3FRPA 3QI9C 3VSUA 4BQ8A 2DH3A 2E6QA 4X65B 3HLKA 3FQXB 3ZW3A 4HUUB 5L2KB 1PIGA 4C4BA 1ZPLA 3APNA 4HH8A 3O3DB 3QUZA 3MNMA 2DYRC 1BBJA 1SQ2N 4I13B 4UILL 4UB0L 1MCJA 4CZZA 2YRBA 4KXCA 4FLTA 3UGUA 3LQMA 4WHYH 5AOKA 1HDMB 1IIKA 5DWPA 2WXPA 2MCPL 4JN1H 2JKTM 4IMLA 1X7QA 2X9XA 5FYJD 3SDXF 2ZG1A 5DRWB 3AUWB 3K1DA 3AB0C 3HCVB 1TUBB 1S3KH 2EABA 3C6SA 3L3KB 1CXLA 1EO8L 1Q72H 3MUGA 4DRXA 4LLWB 4XMKL 2WXQA 5D1ZI 5IV2B 5D6DC 4UV7L 2BSBA 3HC4H 1EO5A 4ALAC 3SDAB 3D2UA 1NL0H 1KJ2B 3DOHA 3KH3A 2JJWA 4XWGL 4OGQC 1I8KB 2WINB 1ZSDA 3SGJA 4XVJL 3GC3A 4G8GE 4JKMA 4OV6F 4LCUA 4MA7L 4PRIA 4ZAKA 2V2WA 1G4MA 4E5XA 2JJSA 3FHQA 5KBPA 2BPBA 1MHCB 4JRXA 1Q90D 3BWAA 4WFGA 4JYAO 3LRMA 3HKEB 2JWYA 4WW2B 2VLKD 4BE5A 4O51B 3ETQA 3NJKA 2C3VB 2GQHA 2O61B 1S7QA 2UVEA 2ZUQB 2NY7L 3S48A 4G8AC 1V54B 3HA0A 5DDHA 4KUCF 1GN6A 4Y16D 1XBRA 3VGFA 1BQHG 3F58H 1KV7A 1NEZA 2BNUB 2YZ8A 4XX1G 5J1AA 5C6TH 5FNVA 4A2HA 1QR8A 1F6LL 4F9LC 3WFEH 3L3OB 1LE9A 1BQKA 1DBBL 4GSXA 3DOSB 5AYTA 5IEKA 4GXVL 2F8IA 1OGAD 3OUSA 4HCRA 4WI0A 1N0XL 5GS3A 3W39B 5HVWA 1GZPB 2ZUSA 3JD3A 4QOKE 5IMKA 5J6GA 1S5JA 4JR9H 4TPRL 1VGKB 4AYEC 3FOLA 4JDVB 2O57A 4YDJB 3IU4L 4AOFA 1K73W 4Q52A 4TVUA 4DEWA 3H4HA 3N1FC 4I55B 4QXTA 2V9TA 1JGEA 1T03H 2X0WA 2CGZA 4MMXC 1XHXA 2JKXA 2VUOA 3ZKND 4K0KO 2VQ1A 2Z7ZA 1H2KA 3BVWA 3KPMB 4CW1B 1HNXB 3FB7C 4W81A 1FZKA 3GMMA 3KDPB 4O2EA 2YGNA 4JFFA 1X3DA 2OPCA 3CC2V 1KT2B 3GHBL 1KPRA 2OMTB 3JBG7 3VFSB 3ZZLA 5ITFA 3ZPDA 2OI9B 4S0SD 2LVCA 1DVFD 1I3GL 5E2WL 4DHLA 3QC6X 3FTZA 2EJ7A 4DR1O 4JYYA 2QQLL 1T0NA 2NX5D 2COVD 1GM7A 1NC2A 5G55A 2EXYD 4WK0B 5J2UB 4D0CB 1WO2A 1JS4A 4TNVK 4UAOB 3HE7A 3DA0A 4AJ0A 3P4MA 4GW1B 3BEWA 5KVFE 4IBVA 2ZNXA 32C2A 3P0GB 4XNDA 3S9DB 2E8ZA 2Z1PA 2F58H 5IQLA 2K7QA 3K0DA 5KBDA 4XXWC 1HOCB 2W0FC 5LHGA 1MCSA 5ESAA 1XMQB 4Z0BL 3QUZB 3PGDA 2WXFA 5I0WA 1FG9C 1P6FA 4FM0A 1VIBA 4Y5XB 1NWOA 2AANA 3MRPA 3CD4A 1FDLL 4M4PA 5EZLB 1MFBH 2L04A 2PUQT 4R6UA 3BVNA 4HEME 4IMLB 2VH5H 4KK9D 4YWGH 2LOEA 4PB0H 1N33O 3ELQA 1JGDB 3MLUL 3MUGB 2C7UA 3K91A 1GGIH 4DRXB 3LH9A 3L2MA 4OB5L 3IE9A 3FQWA 3TA3C 3G6JE 1MLBA 3L1OH 2WZ0A 4YZWA 3ZE1B 3D2UB 5AWNH 3NA9H 4RDBA 4M6ML 1A7RH 2LR4A 1MFMA 3ULSA 3KPOB 2PYFA 4M5TA 4ZJ9A 1CLZH 2YAOA 3IGAA 3T2LA 3S8GB 2DPKA 4EI6A 4MVQA 4TN9A 5E1AA 4LCUB 4NO0A 4ZAKB 2V2WB 2Z1KA 4E5XB 1UJ3A 1PKQE 3FQ1A 1IX9A 2DTSA 4NT6A 3VI4A 5LNDA 3BWAB 3V4PH 3T1FA 4U0RC 4X8AA 4XVSL 4B95C 3BT0A 1P4RA 4I18C 4NQEE 4O9HL 1GAFH 2BERA 2BNQA 5EBLA 1R47A 2AQSA 1IKNC 3IF1A 4JFPA 3UC0H 2CJ3A 2XN2A 3KXFA 4DN4L 1YQ2A 3QUXC 5F96L 1CLYH 4YJ2A 1HJBC 3QJHB 1R5IA 5DDHB 3ES6B 1CDBA 3QISA 3M1BB 4NI3A 1SUJA 2UUDK 1XH3A 1NCJA 4KTEL 4WF7A 2Z31A 3EJZC 3H6JA 3AG4C 5FNVB 4FQXC 5GJTL 1OWWA 3RY5A 2MCMA 4HUVA 3QIUC 3G5WA 3GFUA 5I71B 2IG2L 5JOFB 1IV8A 1OAJA 1TLKA 2E56A 3BP4A 3QA3A 3SBQA 5IEKB 2C5DC 3L95A 3U0PA 1AFVH 1J0YA 4WI0B 2BVTA 4OZ4A 4P23A 2BIPA 2HMIC 4JHVA 4Y0GA 2VYRE 3T9WA 3BEHA 3EFFB 2J5WA 2GFBA 4N2DA 4ELKB 5GS1A 3SBWA 5IMKB 3K6DA 2PCPA 3MLXH 1FN4B 2HEPA 3HG0A 2PCYA 2HVKA 4GKOA 4PGCA 3PWNB 2AXFA 4GRMB 3TH3T 1KBWA 3U4BH 5EK0A 5MENB 3RJDA 4KKQA 3BIBX 1WB8A 4NQSB 4Y1TA 5CUSL 4N5ED 5AD0A 4PJ9C 2CIKA 3GMMB 3LQZB 5BQ7A 3PQYD 2H41A 2JTYA 3CVDA 3EO9L 4XPHH 3EDJA 4O2EB 5EU7C 4XXDB 2NR6D 4QOKD 4JS7A 4LVNB 4UINL 1KPRB 2AJVH 4WNJA 5I9QB 1J5DA 5I6XB 1KTDB 4WFAV 2WUBL 3MHZA 4PLJC 1TYRA 2YS8A 5KWYC 2YMXL 2RR3A 3K59A 1T0NB 1GK9A 3HI6H 1S4IA 5IMMB 2X4PA 1P4IH 2VOTA 1HN1A 1NMBH 5DMYA 2X1QA 3MV7A 2XWJB 3HE7B 4JPRA 1GMIA 1I1AD 4RBPK 3T0EE 5C2BL 4C54A 2YQ2A 3OC8A 4MDIB 4MS6A 2KC0A 3QQ9D 4PQXA 5DZLA 1I7ZB 3CRAA 2AJSH 2A99A 3O9WC 2VM3A 3SCMA 4Q6IB 3RWDB 4M62H 1VEOA 4JPWL 5IWLC 1NCBL 4O2AA 1BOGA 2CUIA 1MDAA 1J8KA 4PJ8A 4RUEA 5HFMA 5ESAB 1NSNH 3ABKC 5FUCC 5BXFA 4DNLA 2ZX5A 1AAJA 4BZ2H 1NM4A 4X0NA 5MP6H 4KO5A 1MCPH 4ZRGA 2VXSH 4CKVX 3LN5A 3Q9PA 4HWBA 1LE5B 1A1MA 2HZHA 1N0LA 1I1FA 3BI9X 2NY3B 6FABH 2QKIC 2W92A 2VMJA 3QFJA 5DO2C 2CBMA 3WS6A 1NGPH 5L3FA 3H55A 5FCUL 4ODVL 1QMUA 5FO7B 4R2GC 1D6EB 5ID1B 3FQWB 3TONA 3TCUA 1D2PA 3I84A 5CEZE 1E8XA 1JZEA 1NANI 2CNZA 3SPGA 4XP5H 43CAA 3WY2A 2WBXA 1RIHH 5IFJA 1TZGL 4LVHB 4M5ZL 1MY7A 5ERWB 4JI5B 4TULH 5KYXB 4GT1A 3LN4A 3G5VB 4OGYH 3MOBH 4I48A 2PTVA 2J6EH 4EI6B 1VFAB 1JA8A 5E1AB 5F1NA 1AR1B 5IB5A 5KYUB 4J6IA 4HXAL 3S37L 1UJ3B 1KBVA 3QQ4A 4FLYA 4RRPA 5DHVH 4UTBH 3DVFA 4Q9CA 4CU6A 5I6XC 1USQA 3CV5A 1SERA 5ETUA 1BCIA 4LFAO 4AEIL 1TVBB 2FEEI 2CM6A 3Q6GH 1YTFD 2I27N 4WEBH 1JPTH 3JZYA 3M45A 4X6DB 3TO4D 2R4RH 2VW6A 2PYJA 2IH9A 3TV3H 1SEQH 2VABA 3N41B 4DR4O 5ADOH 4JFPB 1YEKL 3B8SA 1K8DA 1BFVL 5LP6A 3KXFB 4IRZL 4YJ2B 1E1QG 4DSYA 1R5IB 1TCMA 1WFOA 2ZUUA 2QJ1A 1RJYA 4NXKA 5C2UB 3Q1SL 4A37A 2H1PH 1IEAA 1DANT 4PMFA 2Z31B 3O8XA 3PP4H 1BM3L 4W9DC 1PL0A 1RSFA 2P45B 3O6FB 2QFRA 3CHSA 4WFED 4A2LA 5BRZB 2AEOA 5ISZD 1EMTH 2UZXA 2F5BH 4N2EA 1DHKA 3V4VL 4OJYA 1PPJH 1XILA 2YAPA 4NGHL 1L1FA 3QA3B 5IB2A 4E36A 2OMXA 4JI1B 3L95B 4NQED 5CP3A 3TXQA 2YBRB 2HRGA 2R0LH 4OZ4B 3U0PB 1YXBA 1EN5A 1XD0A 3ABLC 4XCCH 2VISB 3CVHA 2GFBB 1YHQV 2MFNA 3MBEA 4B3SB 4MBOA 1V3JA 4HIEA 2E0PA 1HAUA 4M1GH 4HSCX 1JZ7A 5BRZE 3P3RA 2AJYH 3UBXA 2PCPB 4OD2B 4IOIA 1NTDA 2CBQA 2AXFB 3ZDWA 1T04B 5KLVH 2R0ZL 1GHFL 4LOUD 1IZJA 1LK3L 5I1GL 1LUWA 4LH7A 4NTWA 2H26B 4LDLB 3OJVC 2DI7A 4CJ1A 1W72H 1JV2A 4NC0B 4UOQA 2CDEA 1YPZF 3MRFA 3MBWB 4J3BA 5GTHZ 2BRRH 2YK1H 2ZT9C 3WFCL 4AL8L 5B39A 1KY7A 2VDRH 5CGYD 1LO2H 3QPQD 1ITBB 2C4FT 1J05A 5JXAL 3UCSC 3NIFF 2EIJC 5J9PC 1DEEB 2F66C 3EFDH 4XBPA 4H26A 3WXWL 5CCKH 3B6SA 1JK8B 4UQEA 5EO9A 2A06H 2DM3A 4AVKA 5A2CA 1WDAA 2X4PB 2NZ9D 5K9KB 2HFGH 5JORA 3MV7B 4M4RB 4DYLA 4NIYE 3GDBA 1QSFA 3ISWA 1UGKA 3PE9A 5HDWA 1EZSA 3E3QE 4G3YL 4UT6A 5DSCB 5IW6B 1Z5HA 5BCAA 3CYOA 1WTLA 1VLXA 5EZYB 2Y36H 3ARZA 2YSSA 4B9KC 1P5UA 3BMVA 4R50A 2DQHL 1RL1A 3BUDA 4Q9RH 3RW0A 5JW3H 3ROOA 3UTSB 3CU1A 3H56A 5BXFB 2WZPD 3TN0A 1AYOA 3T8MA 5KJ7E 3QEQE 4MD5A 3LN5B 3WFDL 1Q90A 2ADPA 4LSSH 1A1MB 3BD5A 4L8DA 1N0LB 4EJ1C 4L23A 7CGTA 2LFSA 3NZSA 1YEIL 4G6JL 2X1XR 3ISRA 1SQQH 2G3XA 3HE6D 4MTMA 3T0ED 2CGRL 4EAEA 2W6JG 4PA7A 3QFJB 1T5WA 3DPBA 3C5ZD 4ZYKA 5GS2H 2MWCA 5T1LB 1NCHA 4YHMH 2HH0L 4CC0A 1WA8A 3V6BR 4AUUA 4OCYL 3TZVC 2I60H 3AGWA 5A2AA 4M8RA 3HI5L 4MW8A 2NY5H 1AVMA 1DQJA 1AANA 4AYGA 3GB7A 2RCVA 2UVFA 5ILTL 1TKWA 1ZD6A 4MXWH 4OKVA 4U2ZA 1WT5A 1E4KC 1BMWA 1NDMA 5F2VO 3G04A 4G5AA 1OGAA 4J3OG 4I48B 2IH1B 1MDTA 4C7UA 5LB1A 2QTOA 5IB5B 1I9IL 1FL6B 5GTIZ 1OAYL 1TZAA 2DYPA 5F1NB 3WLWC 3LUTB 1MI5E 3QQ4B 1IEBA 4JQVA 1I9RL 1ED3A 4WCYH 4KK6C 3VGAC 4JM2D 4JO3H 4GSUA 3QORA 4N25A 1F6AB 4OGZA 1G94A 4NQVA 1PAZA 2EKJA 2IXQA 5CEZD 5LDUA 5GQBA 2CCWA 1OT4A 3CVIL 4KZCA 3STLA 4WY7H 4D9RE 4GMTL 4YHHO 1ZLUK 5CSBA 5LP6B 5ALBL 3U0ZA 1HNWB 2HB0A 4PSPA 5DC2A 1VEWA 1AZVA 4WV1A 1URZA 2X4QA 1FFPB 4LL9A 1JGUL 4WI4A 4OM1H 4GOSA 1IEAB 1P4BL 3O8XB 2X7RB 4MVSA 4IGBD 4JZJB 4E2LA 3L5XL 3OAWA 3PNRB 1DVFA 2LTQB 2GCYA 3WNKA 1NAML 5LHIA 2B16A 2WANA 3HMWH 2P5OA 2NX5A 1OP3K 4WZ9A 3IFNL 1HHIB 3LJ3A 4B0MB 1RZJL 5CEYA 3B2VH 3CVHB 1A7QH 1Q8MA 3MRMB 4AQEA 1ZPUA 3JSNA 1SQPH 3NT0A 4XNZB 1BEYH 1HCFX 2EEFA 2KLSA 5CBEA 5IVZA 4IRSC 4IOIB 1KP3A 2XU9A 1I7UA 4JG5A 7FABL 1UM5L 5I5JA 1A0QL 4C8XA 4KRMB 2IBBA 3HRPA 2QWRB 4LF5O 4OFVA 3IETA 4MRCA 1K3EA 4MB5A 2CDEB 2ITDB 4POZC 1CFTB 3QYNA 4DGIH 1HHJB 5D6DA 3FF8A 2YDEA 3OSKA 1JNJA 1J05B 3VVWA 2UYLB 4AL8C 1EV2E 5GISL 4AENA 1JPFB 3OHXC 4XBPB 2FNWA 4H26B 1A4CA 4UM9A 4X88A 4OUUB 3SDCD 3B6SB 3PDOB 1RMFH 3VWJB 4W9EC 2XQ0A 3LNEA 2ZR3A 4AYFA 3JVGC 3OTFA 1MSPA 1Z66A 3QS2A 4YFLF 5DFTA 5HYSG 3AQDA 2AEWA 4R5VA 3KWWA 4IBZA 1QSFB 4EN3B 1E5UI 3A47A 4DESA 2JH2A 1BAFL 1SY6L 2MKLC 3VFUA 2FBJH 4YGAB 5I16A 3NSFA 2FX8L 5JIIA 3ARDD 1OTTD 4K4KA 4DPAX 2ZNWA 4HKXA 4IOFC 4LR3A 3CXCU 3TN0B 3PJSB 1NJ9B 2HN7B 1WF5A 1CDHA 1J1PL 4YHKH 1FBIH 2BDNH 1YMHA 4MQ7B 3NG5A 1MNGA 3IS1X 4L8DB 1MZYA 4K7PH 3OMAB 2ZJSL 4ZSOA 3LS4L 1U41A 5F0PB 4J8QA 4PJ7E 3WNNA 3GBEA 4WSJA 1JBJA 2DOSA 1S77D 7TAAA 4KITB 1WSST 2XIDA 3DPBB 4ZYKB 3OZ9L 4ZFQA 2JFCA 5CFAA 1I08A 1EFXD 2OL3L 2LW1A 2BSSA 4N0YL 5T8IA 5D7EA 4G8GA 2O6CA 3OWEA 5F7EH 2BJML 2R69H 1LMKA 3MUHL 3V4UL 4XMTA 2AK4E 1VQ6V 2HT2C 4ZDHA 5HBBA 5E6IC 2XTAA 1MFCH 1DQJB 3GB7B 3QEQD 4GUPB 4U1KA 1TENA 4LP5A 4OKVB 3KWTA 1JFFA 1FPTL 1QLRA 1DFBL 3K81A 2XWZA 3IKCB 1KACB 3SE9L 4HT1L 1WJ3A 1X5FA 3ZKMD 4OGAD 4XN9A 4MYWB 4RMSA 3QHTC 2IO5A 2DYPB 4IBTA 1IFHL 4K3DL 2C1PA 1IEBB 1IGFL 3TTSA 2XC8A 1HQ4B 4HMEA 4YN3A 2FQDA 4MZRA 2QADC 3A4DA 4K35A 4L3AA 3NAAH 4PA9A 2WZ6A 4NO5A 3QDHA 5HDBE 4MNQB 2IXQB 3H0TB 5F8RC 1QVOB 2APWA 1ZRUA 5SWSB 2N3JA 4M6NH 3NCXA 3ZQWA 3P30A 2CBOA 4OSUL 4OZHB 3STLB 5ACZA 1J5OL 1G84A 2QWQB 2NY4C 2YPLA 4PI2A 4EFEA 4AMKH 1KCVL 4L4VA 3LQAL 2M1KA 3LDBC 3V5KA 4LBEC 3QWRD 1JXFA 1TJIH 2CPCA 3FW6A 2K78A 1QBLL 2YD3A 1FORL 1QQDA 5T1KD 4PJ0Z 2VT0A 3T2NH 1PVHA 3UPAA 4CJ0A 4MXQD 3U4EB 3TF7C 2A5UA 4JFTA 1B2YA 2QGEA 1P5VA 1BL8A 1Q9LA 2WJ7A 5D55A 3FB8B 3WTWA 3CN0A 1SN2A 3QI9B 2JEUA 1T2QL 4PJ5B 4G7RB 1GM8A 3T65A 2GSGA 2X4TB 1RUMH 3Q2CA 3CIQA 1T0PB 2F15A 2DYRB 4L8CB 2CUHA 4PVMA 3KVDD 4NJ9H 2G9HB 4AQEB 4D9RD 2ICEC 3KLLA 5F0LB 4YFDB 5ITBH 2JDIG 1F23A 5DD0H 4PWGA 3JXAA 3N27A 5IFHH 1RZJC 1RVFH 5IVZB 2R2BB 3S35L 4JAMB 4TTDD 5E99H 5LG6A 5E1QA 1I7UB 2GY7B 3NFSL 4HH9B 1D6VL 1NICA 4WTXA 4OZGA 1VF5C 4KXAA 1E43A 1AGFA 2WBJA 3AB0B 3MDJA 1OTSD 1PG7W 3IETB 1UFIA 2A9ML 2HKAA 2WQAA 4LU5H 2Y2WA 1NGQL 1CBVH 2BHZA 1WZ1L 3ZHKA 4MD0B 5CB4B 1SYVA 4NC1E 4NYLA 1ZHNA 3THMH 5EOQH 2ENJA 3PWPE 5AW4B 4X4YA 4K2UL 4OGQB 4MCZA 3O2DH 4RWYH 1OAUH 5DJCB 1MRDH 5C92A 4DQOL 4UM9B 4YEFA 4JVWA 5LGHH 1BFOB 5DR5L 1KCSH 3B9DA 4WI6A 1ILUA 4EEEA 4HKBA 5C07E 3O3BB 3QUKA 5IJVA 1GGCL 2F8VA 3BIKB 4I4WA 5DJ8B 2APBA 3I6KA 1ZDSA 2BWDA 2RJZA 3LVTA 4QD2E 4UYPA 5SWZB 3KPPB 1KCRL 3BUYA 3KWWB 4R26H 5JQ6H 5B38G 4M8UA 4KL1A 3C6LC 1U2HA 3DTDA 5AW5B 3VFUB 5B66Z 1EUUA 2VAAB 4Z95H 4QI3A 3TIEA 4JRYE 3FT0A 2EXWD 3PAUA 1CFBA 1F13A 2VR9A 4KKBD 4HEMA 4HKXB 4GEJA 5ICZA 1JD7A 2Z91A 2KDGA 3WIFA 4F6RA 2WKOA 3K3WA 3NEXA 4UQBA 1AQMA 4BZ1H 1IAIM 3VFPB 3LHAA 2QGNA 5CO1A 1TAEA 2B3IA 3QIUA 4M1CD 1YMHB 3D12B 3HAEG 2TSBA 3L2NA 2LV4A 4I8DA 3SDDC 5A3ID 3W7SA 3I9GL 4FOMA 4ZSOB 1WS8A 1E4JA 3G6JA 3BSGA 3NCMA 1YG9A 2FZ3A 4DFHA 4I1RA 2JMRA 1KWGA 4UCOA 4DJMA 1OQOA 1AI7A 2CTRA 1MF2L 5CIPA 3T09A 2XYBA 4HEPG 1SF3A 1QI4A 2BSSB 3FMGH 1G6VK 1DVYA 1NR1A 2AVFA 1H6UA 3HNTL 1EZVY 5C0EA 3LV3A 3K0YA 3LZQA 1NBVL 4ZDHB 1R0AL 2LJ2A 1AR4A 5LYJA 1H3VA 1QFWI 4K23H 4U1KB 4JG0L 4PBXA 1JFFB 2AI0L 2YA0A 4MMXB 3X1GA 4NQEA 4JYAB 4NO3A 3FB7B 4OCWH 4PJ9A 4F7PA 3K4ZA 4ERSH 3MSPA 4JM0A 2LLLA 2C1PB 4FG4A 3ZYZA 1OZTG 2N0MA 4OJEH 1KXQE 3H42H 1FS0G 3K5RA 2H6PA 3O6ML 1YJNV 1F4WH 3I74A 5JXED 3DX7A 2A83A 2X38A 4XC3L 3SJAC 2XX1A 2WLNA 1MQKH 3U6RB 3JSLA 1SM3H 4IIZA 3BZEA 1BQ0A 2YPLB 2DWEA 5B4MD 4L4VB 5M7QA 1T2XA 2CJUL 3JCUZ 1M1KW 2CHXA 3ZTDC 1SBSH 1ZIBA 4LF8O 2JKWA 2NW2B 1PKXA 3EDEA 3F6LA 5EIQA 4AGLA 4JDTH 2ZOLA 4K8ZA 3LQAC 4XCNA 1BGYH 1P5VB 2OSLA 3O9WA 3A4FA 3WXVL 4P3CL 3FCBA 2DQMA 5E5RB 3D3QA 4BJLA 2X7LA 2YXFA 3T0BA 2W0FB 1CXIA 1XB3A 2B1AH 2F6AA 4H5SA 2F23A 5DLML 1KJVA 2Q87A 4TLKA 3PV6A 2VR7A 1E8ZA 1Y0LB 5HGBA 3GEWB 1UOKA 1FYJA 5TH2B 4PHZA 2FDBP 4HXBL 3KBFA 4ZTOL 2K9UA 5J3HD 1A14L 3BH4A 4K0KB 4JFHE 1NFAA 5DJ2A 3GXMA 5L4FA 3CZGA 5IVNA 3C8KA 3ARBC 1JZDC 2BLFA 2BC4B 3JTSA 5D70L 2ZUWA 2AQ3A 1EJ6A 4WTZA 5F1IB 4OZGB 1M71A 3I6LD 4MAYA 1JF6A 2WNKA 2F8XC 1AGBB 3REVB 5EG6C 1VPOL 3HEIB 1VB9A 1BF2A 4UBDD 5DD1H 5C0BB 4CL7A 4YBQC 4DUXA 3TA3B 4BIOA 4DR1B 1OGTA 2XBZA 3UCRA 1WZLA 4AYBA 2J71A 3RY4A 1LO0H 1UCTA 1ACYH 3HG1B 4BSJA 4MCZB 4MNGB 5IMLA 3HE6A 5JLZA 4NWUL 4FFZH 4LRNH 4YSOA 1QBML 3C5ZA 1FZJA 4PP1D 3NJVA 3LKRA 1QKZL 2J44A 3U7YL 3WCYA 5IJVB 1TTUA 1YEHL 5IF0A 3Q8AA 4I4WB 4QLWA 3I6KB 1BJMA 3MV8E 2IEPA 2UXFA 3FZUD 5H35A 4TQ8A 2QSCL 4U0RB 2OIEA 4I18B 2EIKC 4FABL 4WI8A 1Z5WA 5HI3C 2UXBO 3WU2Z 1FLRL 3PWPD 3TIEB 3KEDA 3QUXB 3KPRB 4P9HH 4ES8A 4FULA 2VZVA 4X9GA 4YHOH 4ZD3H 3RVXC 5ICZB 1U8QA 3LMJH 4UCFA 3S3WA 4F6RB 2I5YH 3FT9A 3KS0J 5I74B 3IN2A 4XNXH 3WIFB 5I5RA 4U6VH 3AG4B 5CILL 4FQXB 5F7DA 1N33B 5C07D 2GHWB 1JVMA 5GZOD 3SZKC 3QIUB 3LZFH 1E27B 1OTUD 3GXIA 1ET8A 1X5ZA 3MI6A 3OC5A 4R96B 4P4RA 1DJHA 1OCZB 3EYSH 5CN1A 3LKQB 4HP5A 3T3ME 3MXWL 1MCLA 3DARA 3TBVB 1ETZA 1CGUA 1K4DA 2IQAA 3UMNA 4KK8D 1CXFA 4KPHL 3WEBA 1WQVT 4JRYD 2KHAA 4J7RA 5IEHA 4S1DD 2B5IB 5EORH 1DN0A 4LHQB 1DANU 4IGBA 1SMAA 1VGEH 4OZFA 5LYJB 1C08B 4GJTB 2J1ZA 1OT1A 1A6PA 2PW1A 4FMFA 3DYPA 1OGSA 4NO3B 1MOFA 4NHCH 1BS3A 2H3KA 2VJ0A 2OLDA 1TQUA 1DBJL 3BVUA 4L5FL 4ONHB 4PJ9B 1ZCRA 4XCYA 3RDTC 3PWLA 2UUCO 3K8KA 3WUWB 2RMKB 2VSCA 1YYLH 5TE4L 5ADPH 1G9EA 3B8MA 4UTAL 5J9PA 3WO3B 3SO3C 1XIWD 4P9PA 4G9FA 3EXLA 5AVUB 4ZMOA 1Q4NX 1PDKB 3DX7B 2A83B 3E9UA 1DBAH 1RP8A 4Q9QL 1N5YH 2YRLA 4TUJA 1F90L 2ZSWA 1OF0A 3FT1A 4LC1A 1AD9A 4B96A 5IT2L 1UKTA 1KC5L 2W9DH 5HD8D 2UXCO 3RB7A 3GKZA 1SQVH 5I1IL 5HDLA 4QHNB 1XOUA 1N59B 3B9AA 4NAMA 2C4FU 4M7LL 1WE5A 4K3EH 4YO0A 4H1LH 5AW2B 4ZUSA 3IU3A 4I2XE 2OSLB 5BRZA 4AJYV 3O9WB 4PJEF 1PY0A 1HWYA 5EIIG 4HVBA 2XWTB 3IJ7A 2X7LB 1XGZA 4CAGA 4KMTH 1YEEL 2HKHH 5E4EC 4XBFA 1KJVB 3ABKB 4H8WL 5HGBB 5JQGB 3SJBC 5JH7B 3MXVH 4RMTA 4YK4C 5AB1A 1J8HE 4PYGA 5F7BA 2DLEA 3U0WL 4YDMA 1X4YA 1RPOA 5F9OH 5DJ2B 4AEEA 3D39B 1QSEE 2WTRA 5AW6B 12E8H 2HAZA 4N0CD 4ZOCA 5T3ZL 3LSUA 4ORGA 1FVEA 1K6QH 5FA4A 1DBMH 3PL6D 4DV3O 1WZAA 3ARDA 5KA5A 4L0ZA 1FPOA 3NK3A 4M8QA 2OMWB 4R2GB 1WHOA 2HWZL 3ILQD 4MMYA 1FFRA 2CDFA 4OCRL 1OL0A 3FU7B 4WFFE 4GRLC 4ZX5A 4ODWB 1JUFB 4B9GA 3S8FB 1IE5A 1M93A 2RQEA 3RUGE 1PW3A 5CJQL 4QHMA 5AB2A 3OZKA 4NQCE 3SPHA 4YHML 1L9OA 3L3HA 3X3GL 2Y06H 4JFHD 5HJ3A 3C2SA 4Y1AE 3VI3E 3KEHA 1HILA 4L8BA 5IMLB 3IRZA 3QIWC 2YD0A 5DK0A 2AQRA 4LCIH 5K9QI 4JK0D 1FZJB 2OSYA 2PR4L 5A2QN 4PD4K 5FUOH 1LNQA 1BJ8A 1XHHA 3CFKA 3DTXA 2W0LA 1ZS8A 4N2AA 5T5FL 1XEUA 2I7OA 5D7IF 3X1BA 4GUNA 4ZFFA 4H7VA 3FAXA 5I17A 4FFYH 2ICCA 2IBZY 3CFCL 5KOMC 3U1PA 4WUKH 4O4JA 3ZHSA 3G4SV 3B4SA 2OP4L 3GMPA 4OLVH 3ZL4L 4DR2O 3EGDA 1SJXA 4KJQD 1BREA 2P28B 4PJAF 2MNWA 1EEQA 4XN2A 3L74H 5BRPA 1GH7A 3QJRB 3NABL 2ARWA 5IESH 4U3XA 2ZINA 1OP9A 2W9EL 3L8QA 2EDQA 3MV8D 4LQFH 4YJ3A 1HZHL 4P4RB 1GAXA 2HJKA 3TH2T 4S1RL 1JN6A 1BIIB 3ABLB 1HINH 3V4VA 1K4DB 1QYGL 4RMWA 1WAAE 3JTTA 5TF1H 4MDJA 1INDH 5CXPA 2A9AA 4FNLL 5IEHB 1ZHLB 1S7WB 1TQCC 1USZA 1BCCH 1DN0B 2Z92A 1J0KA 1XNQO 3GI8H 4OGXH 1UD5A 3EYUH 3TWYA 3R4DA 1MI5A 1UJTA 1GN3A 5A7BA 4OZFB 3CFDA 3G08B 1A6VL 2J4WL 1L8DA 2WIIA 1AACA 3B2UD 4LFAB 1XBDA 1X4TA 2O5XL 3MTXA 5EBGA 4BQ9A 1YN6B 3HNVL 4MBRA 5D1XE 3GXPA 3OV6A 4XCYB 3MGAA 4HJJL 4DR4B 1ACXA 5HDOA 3ZKXC 3S0PA 4P49A 2EIJB 1CG9A 3RVUC 5J9PB 1YEJH 2ZG3A 5JIMA 5L3CA 4G9FB 3RKDC 3PHAA 3RWJB 3QEUB 2KMWA 4KP4A 1A64A 4XB3A 4KQ4L 4P59H 2Q7NA 2XKUA 4R7XA 5LNEA 2NY1C 4L4TE 1B4LA 1NLBH 4OCXH 2R15A 1KULA 2VB5A 2YAEA 4R90L 2BSRA 5E8OB 4CSPA 2QPEB 2Q7YA 1I31A 3BSZL 3GHEH 1Q0EA 4ZUSB 2OYLA 1VENA 3STZA 4AW4A 3IU3B 3X13A 2XXGA 4JE4B 1H3WM 1Q94A 2F9BT 2PWHA 3ROLA 3HHMA 1Y1DA 2MMXA 1PLGH 2GUZB 2CLRA 3QDMA 4HIIB 2MCG1 4MVRA 4FYRA 4HF5H 2VQEB 2EEBA 4LO9A 5GS2D 4F7MA 3D0VA 2FSDA 5KMGB 3WFVA 1F51A 3CHQA 5I26A 2ZUYA 3S7GA 1U3ZA 5GIRA 3GUTA 2ZXGA 4GP8B 4QR7A 3SYQA 1YECH 2NSMA 2V4LA 3M17A 3PHSA 2FNBA 4H8WC 4IIQA 2IGFH 3B9VA 5I1HH 1R33A 2Y7QB 1QOKA 4FDWA 1HYSD 2WTRB 3DHUA 5E5LA 4BM7A 4ORGB 3LN9A 3MRIA 2C3WA 5FA4B 3WE6A 1MQ8A 1OPGH 4X9YA 4R7LA 3FCTA 3GKWH 2Z93A 2W0XA 2DKMA 3GRWH 4DUZB 4M8QB 3LPWA 1HH9A 3GJEA 2Y23A 3IDMA 4MMYB 4X83A 3TZVB 2CDFB 1NINA 1SZNA 2FIKA 4G6ML 3JQOB 3WIIH 4OTXH 4P9OA 2DQFA 1B3QA 2PYEB 5AOJA 5HJ3B 5J89A 2NY0C 5E2UL 4LASH 5KVGL 4MLIA 1QSED 5DK0B 3UTQA 2YRZA 3FSZA 4LPYA 2ZWYA 1ZANL 4QYOA 4X7SL 5E1IA 4XNMA 5HDQH 3V52H 5C08B 4X89A 4QJFB 5T5NG 4UOW1 3R1GL 3CFKB 5E8DH 4LPCA 4RQQA 3VGAB 1DQIA 4KDTC 3V8OA 2HRPH 1FQ9C 3MFGB 1BXAA 2B3RA 4FQJH 3RA7H 5I17B 3EJCA 4WFFD 1P7QA 4B7LA 4NQCD 3NSXA 4J3WA 2F19L 4S1QH 4PJ7A 4QE7A 4KKNA 4Y1AD 5F0MB 5A16A 3H9HA 5CD3B 2JB5L 4DPCX 5IIEA 4D9QE 4QXVA 4TSBH 3MLRL 5JJEB 5AALA 3N1MC 2I9TA 3LEXB 4AXWA 4NP4L 4Y16C 5D9SB 3GRGA 1KFAH 4N2FA 5JXEA 2VLLA 4YJ3B 1C5DB 2AK4A 2RCSH 5L7XH 1R3JC 2IJHA 3T3MF 1GH6A 5D5QA 5PAZA 3BP7A 3BZ4B 1V7MH 3DX1A 5TE6L 3V4VB 1HHGA 1XGTB 4RMVA 1NAMA 3U4AA 3ZTJG 2XVBA 5DZAA 5A43C 3EH5B 3OTOO 2XA8H 2H2PC 2Z92B 1GCFA 1PFOA 1Y67A 1IJ9A 4OIFA 5D96C 3MFFB 3ABGA 1EEZB 1UVQB 3CFDB 4PJXB 3MAQA 4X9BA 3VB9A 1ANUA 1WFNA 3ARED 1SQFA 3HPLC 2E4FA 5I23A 1LR1A 1VDGA 2V9QA 4PWKA 5HYIA 3N2KB 2RNBA 3JARA 1AKJD 4YHHB 4KKAC 4P04A 4N2BA 3VRLE 3EBGA 1CG9B 2JSFA 1LO5B 4QTHB 4AQ1A 1E9OA 3GDCA 3OHXB 4M5YL 1OZUA 3G6DH 4P46A 1NR7A 5KVEL 5KSBB 2NTFA 1UM4L 5D2LE 4HOMA 4GIOA 3V0FA 1QVFU 4BKSC 1CQYA 1DBKL 1DVZA 1BZ8A 4APXA 1LWJA 5FV1L 1BBDL 2A3TA 3F85A 1E4HA 1Y6MR 5D1XD 4NRXA 2F74B 2HPOA 2R51A 3A0HZ 5BUGA 1XDTT 1X9LA 1PG7L 2RACA 3C6LA 3X13B 2JB6A 1Q94B 2WYIA 3TO2A 3ROLB 3QDMB 2AQNA 3NMEA 5SWQB 2CLRB 1FZOA 3LSQA 1Q6UA 3MHSC 1SESA 2J73A 2NCMA 1PP9H 5DQDL 3GBML 1ND0A 4QHLB 1CXZB 4IK7A 3TEZA 3G5YA 3MACH 4K5MA 3PREA 2APVA 4BSVA 4EO5A 3QXVA 5GGSY 2J8UE 3UEZA 3VDBA 4P2QD 4HJGA 4L4TD 3SDDA 3CCMV 3CHPA 4WFHE 2YUZA 4UMGA 2CXKA 1A7BA 1WLHA 2VDLL 2GSIA 3WGVB 2X3AA 2PN5A 3MRIB 4KTYA 5JDJA 1CGXA 3PWPA 4NRYA 3WE6B 2ZKOA 1XX9C 3C75A 3NH7H 2Z93B 3H9SB 5KHGA 4OQTH 3IDMB 4NZTH 1D2OA 4PJBF 4XMWA 3LZRA 2FIKB 5DD6B 2JGUA 5E6IB 2DQFB 2Q7HA 5KUKA 1HTYA 5F3HA 4HISA 5CMUA 4FVMA 3C60C 1NA8A 4U1JB 1C1EL 1BYOA 4KTDH 4TQIA 5BMVB 3EUDA 3OEEG 1YYML 4P30A 1B0IA 1GCYA 3KAAA 3PHQA 3WJLC 1NZRA 5EULV 4QYOB 4DGYH 1V55B 5F70A 4JN2A 1M3JA 3LRSA 2GTSA 3QGVA 3BEVA 4QHKJ 1MHEA 3BKML 4ODUA 2QPUA 4U31A 1A7OL 2IPUK 2QADB 3EIFA 1LHZA 4XDKA 4NHUA 5DEFA 1UFGA 3S88L 4A7GF 3LB6D 1BVLB 1PL4A 1P7QB 2R1WA 1ZDQA 4CUCA 4PGEA 4P5TD 3FT2A 4U3HA 4RH4A 2DLIA 4HKJB 2V33A 4RFEA 4XAKE 1AZRA 5A16B 4K9EH 1F97A 3LDBB 3BVDB 3IPFA 4I0KA 3MNDA 3KJ6L 4HSQA 1CB4A 3SOTA 5KJRL 3V6OC 1J9QA 4FN0A 2Q69A 5DEGA 4AXWB 3K74B 1XIWA 5B3SC 4LSVL 1DR9A 5DTFA 5JDSA 5AAMC 2YEZB 4QF1A 4BKLA 5DK2A 1XMEB 3F04A 2W1NA 3UJJH 3QJZA 1Q0XL 5AVYB 1HHGB 3CMOH 4DW0A 1WAAF 1ZT1B 2AV7A 3L5IA 3OG6B 1NAMB 1S7TB 2ICEB 2VMCA 4NQDA 1JZ4A 1UKSA 1FRGL 5CNHA 4QE9A 1QNMA 3Q4HA 1FXVA 5BS0B 1L6PA 2D8KA 1XB8A 1V3MA 2MHAA 4M1DL 4D9QD 4FD0A 5EWIH 2FT6A 3HS0C 3DVNA 2DY2A 1KXQA 1VF5B 3CE2A 2PWGA 1N64L 2UXVA 3JWNG 4NUPA 3QO0B 3LHPH 3SGDI 3VXQB 5HGDA 3N85H 4GAYA 2O26U 4TSCL 3NDYE 3CJJA 5IFAL 4HJEA 1PX3A 4Z7VF 5DWUH 2ZXWC 2LVEA 4LARL 2Q0AA 4HBCL 1Y7VA 3RBSA 2EIEA 1J5EB 4IBYA 2VDKB 4Y8AA 2K4AA 1TVKA 2JK5C 1XTMA 3BPOB 3DX9A 1Y4MA 5DJ0A 5BZWA 5JHBA 2BVEA 1BQLL 2W80C 4U49A 4AQ1B 3SJVE 1WWBX 3RX5A 2J6EA 4P46B 3AMLA 1ZE3H 2NR6C 3FRPG 3T4AA 4Z7UB 1YN7A 3QG6A 1RUAH 1RZFL 5DHVA 4QXGL 1U8MA 1OE3A 3COOA 2R1YA 4APXB 4EE2A 2DEYX 1ZHBB 1H3UA 3IGFA 4JAUA 4OLWH 1Q0YH 4TT3G 3ILPB 1MEXL 1FV1A 5IYCO 2ZE6A 3C6LB 3TNNB 2JB6B 5F3BA 3VRJA 1UM6L 3LDDA 1I1AC 1X5JA 1A6AA 2FD6H 1FGVH 1FZOB 4GI6A 4HWZA 1K9MW 1HL4A 2R29H 4V1DA 1FJ1A 3TYFB 4BH8A 2DQEL 3RYFB 1KENH 3G5YB 2WB7A 1RD6A 3D2TA 3ZE2B 3JAWB 1S6NA 2GAZA 2P8MA 3SDYH 4OIIL 3RWGA 4JI7O 2OX5A 2P5EA 4HJGB 2X44D 3OPZH 3SDDB 4XMLL 1REIA 4DP5X 5JHAA 3VQ2C 4JANA 1MPAH 2VDOH 1IILE 1Q38A 2GSIB 4YDKH 1QBZA 4J23A 5HHOE 2R4SL 3MRKA 2A7WA 1B2WH 3Q13A 5D72L 3WD5H 4MAUH 5FO8A 1A2YA 3QPXL 3VGDA 1J18A 1Q9OB 2WXRA 1GYWA 1L6ZA 3CX5F 1MFAL 2OL3B 1UWEH 4IKJA 4TUKH 1UA6L 3MV8A 2EBOA 2AQ1A 4WFHD 3PHQB 5HYJA 3CZSA 1NMCB 3A22A 5E2TL 3NUKA 1AGEA 2VQFO 4Y9GA 3KPLA 4FYTA 3LRSB 4ZXBD 4PDMA 2XPGA 2F4VO 2HCZX 3BEVB 4PRPE 1CF8H 1MHEB 3U1SH 5LXGH 5HHNB 1NEZG 3KH4A 1QU7A 3QEHA 4J3TA 4NHUB 3F64A 4M93C 2ED7A 2WXJA 3F5WA 4MT8A 2AHZA 5ID0A 3P9MA 3ECVA 1T1WA 3M46A 1M7DA 4RFEB 4FMKA 3CXHF 4GXFA 5FWQA 4E9XA 3G71V 4ZNEA 4Q7DA 4F27A 2ZD0A 3TXAA 4G7VH 2EZ0C 1N6QL 5TDPB 3O11A 4DV6O 2MOVA 4L8SA 3G9VA 3OXSA 4LHJB 3IKKA 3N9GL 5FOBA 5JDSB 5DTFB 3WKNA 3QHFH 4QF1B 2ZYSA 2HPTA 1FYHB 4MWFA 5DK2B 4AUYA 5LXTA 1T6WA 2BFVL 1V5JA 2AAVA 3QCTL 4JY4B 1TZHB 2AV7B 2JE8A 1U3HD 4NQDB 5JPMC 1PZUB 3GSXB 5IM7A 3N43B 5DQJA 3Q4HB 2KLTA 3JALB 3J81N 1KEMH 3L3IB 4K55A 1CS6A 1IBYA 3SE3C 1KG0A 3T1HO 2OYQA 3ARBB 1SRDA 2X4UB 3JWOL 1A5FH 4WW1A 2YD9A 4N8PA 1QFHA 3MPCA 3P40A 4XNUH 4HG4K 3O0RL 5D7JD 3QHZH 5MERA 3KCPB 4IEFA 4FA7B 4NVPA 4N8VA 3SKNA 3IDIB 5AKTA 4LNRB 3DC0A 4Z7QB 5D1QE 3TWCL 1T89C 2PETA 2WZ5A 2WZAA 4UWQB 1TVKB 3DX9B 5E4AA 2DW4A 1JPSH 2DMXA 3AT9A 4LSDA 5CGYC 4YDIL 5LCVL 3TFBA 3QPQC 1ENVA 3K58A 3RYCA 5DZVA 2ZE5A 3P3PA 4LF8B 1CD1A 35C8L 3AJ7A 5JIKA 3U0TA 5IGXH 2GYSA 4BGDA 1YN7B 2QJDA 1JJUA 3FQUA 3QG6B 5GONA 4NI6A 1BG9A 3H54A 2P48B 1E4XL 1U8MB 1DLFH 2DMHA 1T80A 4CC6A 4ZHQB 2ZWSA 2G9KA 3QVAA 1QHQA 4IBQA 4P9MH 5L4JA 2CH7A 4GIPD 3IDXH 2ZOOA 5I1EH 1J8HA 1FF5A 3F6IA 3KWXA 5FOJA 2Q8BH 2EIKB 1EQWA 3VYOA 2BTQB 2CCLA 3E8UH 2YHGA 5F3BB 1QFUH 1VZHA 3QZPA 3OB0H 1A6AB 1P4UA 4KJYA 4KROD 4TLSA 3UYPA 4ELME 5D93C 4DUYO 1TJMA 4V1DB 5I6NA 1FJ1B 3LXBA 4AVIA 1R9FA 5KUMA 4YHYC 3A6BH 4HMCA 2C9QA 3MRQA 4P06A 5C0ND 2CLVB 3IBEA 1J1XL 5BVPH 3OGOE 3EH1A 3GD1C 2P1YA 3MROB 4PIRF 3VRIB 3CSBA 2K4WA 4PJDA 5ACLA 3RWGB 3UGXA 1MCCA 2P5EB 2KG7B 2XZCL 4HWEH 1ACZA 3K80A 2CMRH 3FU6A 3WB1A 4WFFA 2ICWA 3ELAT 5BPPA 2XYCA 3RUGA 5ICUA 1EH9A 2VGLM 3PNWB 4NQCA 3MRKB 4KVPA 4Y1AA 3VI3A 4F7TB 1E2VA 2O5ZH 1ETJA 4FQ2L 4I3RL 4U05A 3ARGC 3WL9A 3ZDZB 2L6LA 3QUMH 5J11C 2D4DA 5SX5K 1J5CA 1A3ZA 4NB5A 1L6XA 1TJGH 2YEQA 5AZEH 3TCLB 5M94B 3US1A 4TVPL 4NKMA 3WJMB 5HYJB 2CIIA 4LGSB 4N9GA 5KS9B 1EVTC 2GI0A 1U6AL 5D4HA 3RDTB 1L3WA 3IFLH 2DQCH 5HHOD 3VFTB 2UXBB 1P7KA 3ZE0E 2VDPH 4LHUA 5C93A 4QJ4B 2R9HD 4NB7A 4PW4A 3SIKA 4N6QA 2Y22A 3SO3B 5ITZA 1TU2A 2HUEA 1EEYA 3GIZL 4ICWA 4CVXA 1DSFL 3K6SA 3Q9QA 4NXMO 5ID0B 3PDGA 4AIXA 1E6JH 5FPRA 3BCDA 3T1YO 3APMA 4J80A 1M7DB 4J6RH 4W6YB 5E08H 1HYRC 1QLNA 4G6FB 3BWUF 4XO8A 1F2QA 1GJUA 1Y66A 2WWKO 3O11B 4FK5C 4KNTA 4XHJD 3RKPA 4U1LA 3TA4D 3VWKD 3OXSB 5B1AB 3CTTA 4DVRH 3IGLA 4K7FA 4PRPD 2H3XC 4HOZA 5FOBB 4UV8A 4FZ8H 2Y9RT 4MJIA 5HPMB 4A6YH 5IHUL 4HZ3A 2ODIA 2WXIA 1KIRB 3K2UH 1HC1A 4MWFB 1Q72L 5I30L 1Y74B 2HHHO 1MCEA 5E4EB 3WDHA 1I7FA 3BMWA 4YK4B 4PJCF 3VXMB 5JMOC 1IUZA 2ZE7A 1JV5A 1NL0L 5LOVA 5D1XA 1U8NA 4PJHE 5BVJB 4I4TB 1I8UA 4NM8H 2NXYC 1X7SA 2AEIT 2BNRE 4W9KC 5AOLA 2UUCB 2H5UA 1X4XA 2BP0A 5IHWA 5L8KB 2UWEA 4QRPB 3OQRA 2Q4PA 5F9JA 4EIZC 3RZCA 1O9GA 3PWUA 5I1JL 4OM0L 1H3PH 2EYRB 3BXNB 3UT5A 2WSPA 3JWOC 1PNMA 4JY5H 2R69A 1U93B 3SKNB 1AO7A 4U1SA 4R0LA 1VQNV 2P67A 5HYQA 5F6HJ 5I1KL 2EYSA 4GAFB 4GRLB 4YSDA 3RWCA 3IMVA 4L4TA 3VUAA 2MQGA 3SE8H 1IM3A 3IAQA 4TM9A 4XP9H 1RFYA 3CCQV 4U1HB 4NLAA 3LIZH 2UXCB 1AY1H 4HJ0C 3MRRA 3QIWB 3AG2C 1CD1B 1BW8A 3Q2LA 2GTWA 2EVGA 4MTFA 2DDQL 2IMMA 4GT7A 3UM7A 1TIUA 2FB4H 1P9MC 2IWFA 3F58L 1ERNA 3L7FA 4LSRL 1IKFL 3SDCC 1Y6KR 4CNIB 2YFOA 2A4EA 1BD2B 1W16A 4ANXA 4P8QA 2CH7B 4IL6Z 1MNUL 5EOTA 3SDXB 3JAKA 4NYKA 1KGUA 2F7PA 3D18B 2RQ6A 5D1QD 4AEHL 2WKGA 4JBSA 4KJYB 4FJZA 1LYQA 2XZZA 1MG1A 4X2UA 1O6TA 4H8HA 1LP9E 1RURL 2VWEC 3LH8A 1PSKH 3SODB 1JWMA 1U36A 3MRQB 2BY2A 4HS6A 5KBKA 4GQRA 3PHOA 4ZMXA 4DV3B 4PJDB 1OTTC 2EYTB 4U7OA 1C7TA 1XF2B 2ESVD 3L71H 4OF7A 4Z3GA 1T03L 1UOVA 4OI9A 4Q6YA 5IROC 3VXRE 3A6CL 4AMWA 3NIDB 4GO9A 1ZHKA 3Q48A 1OB1B 2PTTB 4JHWL 5KANG 1O7DE 3B37A 2Q2LA 3RWFB 5INCA 2MIZA 15C8L 2N1KA 5GZNA 2FWUA 4A38A 3L9YA 4CS2A 1B4JH 2DD8H 1O7VA 3HPJB 2UX7A 1N4CA 3NIGF 4PV1C 4HS8L 1G87A 3E8FA 4FQHA 4ZZFA 1S5HA 3GMOB 4X1YA 3NZHL 4PBDA 1IFRA 1EM1A 4A7TA 1KMIZ 2RAMA 1AE6H 3QCUH 5FW7A 3WL9B 3D7PA 4DWHA 3TFKD 3BJLA 4JO1H 2DICA 4DPBX 3QG7L 4WSGA 4TQFA 2F0CA 1M05A 4GG8B 2DQGL 1QBAA 4GQZA 2G4EA 3RJOA 4NKMB 2A74A 1PZ3A 1OOAA 2CIIB 4GMSH 1T0MB 5FGCE 5H37A 3BE1H 1THZA 4YHZL 1P7KB 2E4TA 3ZKXB 4LHUB 3E80A 4DR2B 3MBXH 5LMNB 4RETB 3O2DA 4N2CA 1AGCA 4OGAC 2YPVH 2AZUA 1D9KD 4UOW0 4XP1H 5ITZB 3BO8A 3FYEB 1EEYB 5D6CA 3EYOA 3R06A 3K5OA 2W59A 5FDWB 4HQQH 3W0WE 4CDHA 4OLUL 2VKWA 3K6SB 2NXZD 4RAUB 3GSUB 3CXDH 4PJ6A 3BP6A 1D5IL 1AB3A 4G1EB 4QRQA 4N68A 4UT9H 2NY1B 5DHYA 3RX7A 5C8JA 1T1ZA 4NKOB 2HJDA 4XCEB 3RPBA 5DFAA 2ZWZA 5I0XA 1PZ2A 2UXNA 2HLFC 2O6FA 2OMZA 3ZK0A 3UBXG 5A2IH 5IMOB 1HH6B 2FX9L 2PKDA 2ZXEB 3MLWH 4K7FB 4KWUA 2A0LA 1M53A 4KAQH 4MJIB 3LRKA 2UXGA 1M56B 1A7NL 2CDYA 1JDDA 4W9GC 5F7MC 4MXQC 1XNQB 1GGIL 3T6ZA 2V7QG 4S1SL 4KVNL 3AUVA 4BZ1A 2AEPH 4CH4A 1CVRA 3O9OA 1H8LA 1TMCB 4X1IB 1JV5B 4FI6A 5E5MA 5B39G 1TT6A 3A6OA 1JMXA 1K97A 4JFOB 5JW5A 5JIPA 1NCAH 4BWWA 3Q44A 4UNIA 1RULL 1PZAA 4AQ8C 4P3DA 2BP0B 3U6XS 5HGAA 1IC4H 2UWEB 5F9JB 1NOAA 3RZCB 3H9ZA 3FU9A 4DAGH 4KHTH 3UT5B 2NN4A 1X9QA 1J9RA 1BM7A 1ZLVH 1AO7B 4U1SB 4R0LB 4BINA 1S9WA 3P54A 4N3TA 3V4PL 1NCCL 5D2LA 4AYDC 3MCLL 5HYQB 4JTCB 3KWVA 5L6YH 1PNDA 4KI5E 2LE9A 4DW1A 4EI5D 2L7QA 3JD0A 3C60A 1IM3B 1AJNA 1OAZH 4ACTA 3ERXA 3UC0L 4YBLB 1GIGH 2NY0B 2GITB 1IX2A 4XNYL 1FA4A 4YOKA 5L4IA 3C9NA 4H88H 3UZQA 4GIAA 4ZS6D 3L5JA 2BNRD 2GTWB 3MJ9H 3RPIA 2VN6A 1SF9A 3KR3H 1E4WL 3ZDXE 3BISA 4BK8A 3HN8A 3BRGC 1M7IA 1Y6XA 3QDJE 1TQWA 5ENWA 1C5BH 4DV4B 1MA1A 4MRBA 4B5EA 5EBWC 2XETA 5EOTB 2XASA 4FLXA 1A6ZA 3JAKB 1L5GA 2J8UA 2I85A 3TP4A 5EU5B 5J6SA 5JIDA 4XR8C 1S9YA 1FNSH 2CKBA 5DJXA 3DX4A 5KAIZ 4ELMF 1R3LC 3GMRA 4UANA 2XV2A 3BH8B 3LH2H 1HZLA 1BMGA 1YY8A 3R8QA 3UZEA 1MIEL 4I0PD 1AXIB 2X4SB 2PF4E 1KBGL 2JI2A 1JWMB 1LQBC 4ZXBA 2DB8A 3K06A 3E38A 2YWYA 1XAKA 3PHOB 2R9AA 2EXWC 1EDQA 3E8GA 2WO3B 3LXUX 4Z3IA 4L05A 1WCBA 4Y16B 3U4BL 4EDWH 2B77A 2JGDA 2OQJA 3GI9L 3KWUA 2UU9O 3CLFH 2YIAA 3QQXA 1PCSA 2EEXA 1R3JB 1P2CB 1CU4H 3DDFA 4O00A 4RGOH 3GSRA 4ZMNA 2FWLB 4XPHL 1WV7T 5A3IC 3NP3A 3EYQD 3UMTA 5JYLA 2KZWA 2AABL 5FM8A 2J8HA 3DBSA 1O0VA 1SEBB 2ZKXA 4LSQH 2PWEA 4JL2A 1S5HB 3IVKA 1R3HA 1XGQA 3UPRA 2FATL 1X5HA 2OBGA 3DRTA 4Y2DC 3G3LA 4N87A 1U8HA 4MX7B 3GSQB 2EDDA 3VFMB 4JO2H 4QRUA 4YXKH 1Z3GH 1P4IL 3V9EA 4XPTL 5EEYA 4HIHB 4MJJA 4HHGA 3MJ7B 3HLAB 1H6FA 1N4XH 1U3HA 5E9AA 2P42B 2X88A 2EIBA 1M2OA 4DT2A 2ZF8A 3IS0X 1MFUA 3PRZA 5D6CB 3BO8B 2QKCA 2WVUA 1MHHB 1RZ7H 3R06B 4JQXC 4L3EE 5SX4H 4GAJL 4YXLH 1NSNL 2Y7SA 3T71A 3EJTA 4QRQB 5CF3A 2TRYA 5DHYB 1T1ZB 4CILA 4OI7A 1FFOA 4UQIM 1ZLSL 4WWKA 2EDMA 3KPNA 1P53A 1ZEAH 2NQCA 5B4MC 3PGFH 4IRJA 6FABL 1UWGH 1R5WB 3E2HC 4U1MB 1UQSA 2EVFA 4YHLH 4M5SA 5LAXB 2XIBA 3ZZQA 4N0UA 3F7VA 1ITCA 5I28A 1D5MB 3EVKA 4QXWA 3ZSSA 1MJ8H 3PF2A 2P5PA 1KBBA 2VJ8A 1Q7YW 5KHHA 2VQUA 4J1UA 3NRPA 1S9XA 1CFNA 4OI8A 3D8CA 1FXKC 2VR6A 2OTJV 5KA6A 3GTVA 1AHWC 4D9LH 2XAFA 5JW5B 3PWJB 3T3PB 4AIZA 4KX9A 5DJ6A 5HI5C 2DQIL 3NFPA 5LGJA 1HEZA 1B6QA 1NFDF 3SJVA 2CTPA 1FC1A 2UZYB 3EHBD 3FFDA 4X5XA 4EFBA 4QPJA 1MJJB 2V7NA 4UF7C 4CN4A 1IBBA 4K8RH 5LUMA 4KX7A 1S9WB 3GLEA 1OD9A 5F7WC 4DO5A 1UB5A 5BUAA 3DX8B 4JF3A 3ZN1A 1QLEH 3C60B 4BKTC 4UBDC 5E9NA 4OR1A 4ZS7L 3CCJV 2A6KB 1D2DA 3L4YA 1UENA 1JHKH 1OJHA 3RPIB 2J21A 2Z65C 3MRGA 4WK4B 2H1PL 1QCEA 2H47C 4F7KA 3ASNC 4UM8B 1ZT4A 4ZUTA 2AZ2A 3K0WA 5I66A 1M7IB 2EQDA 4WHCA 3VD3A 1VQ5V 4RWUA 1LD9A 5DD5H 2BOBC 4PP1C 3DX6B 4LKXA 4MMZC 5IKCA 4JFEE 3CSYB 4JRWA 1GPOH 5GGSB 2X1PA 1L5GB 2VSDA 1MIMH 1HIMH 2Z3YA 1NTZH 4UUJC 1S9YB 1J12A 2CKBB 3K8MA 2Z0UA 4XCCL 1ASQA 1MHPL 5DJXB 3GMRB 4GFXA 4NKIH 4Y2OA 1LP9F 2WW8A 1WEJH 5DUPL 4WKXA 1DTOA 1YY8B 2NR5A 3B4NA 4QRSA 5HHOA 2Y7MA 3U2SA 2AK1H 1M4UA 4H1LA 1LDPH 1J7VR 4ENZA 3QNXA 2WKLA 1Y76B 5EYPA 2PF6A 2ZX7A 4UFZA 1KJ2H 4MKTA 2VKXA 3QDJD 1F5WA 2NLJC 2KQMA 3MAWA 2OQJB 3VXPA 2F95B 2ENYA 2FB5A 3B56A 3P2TA 1BFTA 4NM4H 3QEGL 5GZOC 2D03L 3BDYL 2VDRL 3VFWA 4Q20A 4EXPX 3PUCA 3OM3B 2F7OA 4AY0A 1J0ZA 4R4BB 4JAAA 4ZO7A 4M48H 5BO1L 2AMGA 3FO9A 2DJ4A 2QWNB 3SE3A 4HPHA 5I1AB 2A9NL 2EICA 1MFDL 4NKDA 3DSNB 1R3HB 1XGQB 4G1MA 4KK8C 2BSEA 3NN8A 4DEPC 3DRTB 4PRPA 3HS0B 1RV6X 1IBZA 2J43A 1U8HB 2IQ9L 3FO2A 4WUUE 5IQ9A 3S5ZA 3V0EA 3NGBB 3MNVA 1EAOA 1FH5H 3QQDA 4FF9A 4FPPA 4JG1H 1W0VB 5JIHA 4CC1A 3DURB 2R8SL 4P07A 3T77B 4JDZB 4ANKA 2WWOA 1BLNA 2F5AH 1JAEA 3RYMA 5TJWK 4O5LH 2RD0A 2XTSA 3DRQB 2ARJB 4FHBD 2H7WA 3RVZA 2DQTL 3D09A 4RAHA 4S10A 2V8MA 4J5VA 2DKSA 2XPYA 1J48A 3HIZA 3MLSH 1AZCA 3VD7A 2KQXA 5GRJL 1KGJA 4UDUA 2XN9E 3KPNB 4WWKB 4NNXA 5BO0D 4J3XA 5DVKA 4IMKA 3BQUD 1JVOA 4YPJA 4LMQE 3HB3C 3O6LH 3ULUD 5I6OA 4IRJB 2XQBH 1CPYA 2QQKH 1I1AB 1S78D 1UQSB 1AJ7H 1YPZB 2V2XA 4ZPVA 1OB0A 2PCFA 3Q43A 4I0CC 1S2EA 4LNUA 1U58B 2LFGA 3UXFA 2FYUH 1MZFA 3F7VB 1BHBA 4L3ED 4N0UB 4G7SB 4L2LA 4HA1A 1H9VA 4L4JA 4QRRB 2XG4A 3NIFB 1J1OH 4WHTA 5EEWA 2Q0OC 5JHDE 3A3YB 4J1UB 4MVBC 5DC0A 1CFNB 1NFKA 5F93C 1DQQA 2HJLB 3FUKA 4AIZB 1QASA 1QSVA 4RNRB 2I9LA 3S3DB 1SQGA 3HTLX 1XSIA 4JKPL 4F1ZA 4O2BB 3QTCA 4YVUA 4EUPB 3EJJX 1WBYB 3U83A 2VDLB 2OR9H 5KVDL 4JO3L 3PL6C 5I8CB 4P2ZA 4YDVB 3EXJA 5GGTA 1XR8A 3U2JA 2WGNB 3P32A 4NNPH 1JR9A 4JB9H 1AD0B 1EA9C 3CFUA 1KEGH 2P4AB 4D0DB 2XUWA 1CDJA 4NKQB 4X6CF 4FE9A 1EAQA 4G42A 2JELH 1P7GA 3UCQA 2DWYA 5I66B 1NI8A 4APQD 4PJIE 5EUOE 1N6UA 1LD9B 1NANH 2DAVA 4H0GA 5H2BA 3ZVVA 2EIZA 3HC2A 3U79A 4LKXB 4PTUA 4M93B 5JUEH 5IKCB 1KIQA 1VF7A 3FO0H 3OKDA 3HMWL 2SEBA 2VE6A 4K3HA 4Z0XB 2DQJH 3V2AR 3KPSE 4JI7B 3B1UA 2VUKA 1CTMA 1XUQA 1YQVL 3FTXA 4HIXL 1BVKA 4Z3EA 3JYBA 1GOFA 2AW2A 3TVMD 3LEYH 4QRSB 5LBGA 1HEHC 1AJQA 4MJ5A 3FFCB 3HN5A 3UJTH 3VD0A 1Q9WB 4HU2A 1AR5A 5FYKL 4KJQC 1D9KA 2R7EA 3EF7A 4FXTA 3FD9A 4LEXL 25C8H 5IBLC 5LBSH 3C8HA 5ISZB 2RN9A 4YSEA 3EJRA 1IQWH 4DH2A 4E42A 4MNHA 4AT6A 1R73A 3P4LA 1PZ5B 3IRPX 4UT7H 3H9VA 3KL5A 4YDZA 4ZTPL 4L9DA 1YAZA 4N2GA 1XREA 3WMQA 1GO3F 1ZKAA 4OPAA 3UO1H 2VQFB 3NN8B 4HUCA 4LSUL 2F4VB 1Z5YD 4F5CE 5GPRA 4E9VA 3P9LB 4W6XB 3MNVB 2WWWA 3BYTA 1F3JA 3GRWA 5BV7L 5FECB 3QYMA 2Q8AH 3JASA 2VWKA 2FEDD 2PO6C 1BLNB 4Z7IA 5LA6B 3ULUF 3B2UC 2D3NA 1LEGB 4Y4FD 1VQPV 4FNSA 2Y07H 2EDNA 1UXMA 1BXXA 1P4LA 4KFZC 2WSDA 1ZY9A 3TYGH 3QJFB 5F1SA 3WS3A 5HP5A 2GUOA 4N2HA 4W9IC 5B8CC 3AWGA 4DV7O 4HCRH 2W5PA 3HI1A 3DYMA 4WUUD 1MAMH 1BYPA 5AL8A 3UL4A 2GK2A 4F24A 5LWYH 1QLFB 2BDNL 1JGLH 3DX0A 1KELH 1MXGA 4PGBA 2AXHA 4EI5A 4X98A 2D0GA 3E8HA 4FI8A 2WUCH 1VFOA 3L3JA 3M8OL 3QQ3A 2E9GA 4PCSA 3BPNC 4PJHA 3T8XA 4ZPVB 3MU3A 4LCYB 3D50A 1CL7I 4G7YL 4ENED 4NBYB 4WTZG 4EKJA 2BNRA 2PCFB 1N36O 5I19H 4LNUB 1K4CA 3FTSA 4YHYB 5F7EL 1UACL