1OCOB

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocoB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocoB02
3ERXA 4Q89A 2XV2A 5I6LA 2IDSA 1B3IA 2PPDA 4KOBA 3NSDA 4KO6A 3SBRA 4E9TA 3IE9A 2YAFA 1AQ8A 2YQBA 3X1EA 2H3XC 3ABMB 2XXFA 5I28A 2CCWA 1PNCA 3NJLA 1QHQA 2HX7A 2Y1AA 2EIKB 3X1GA 2HX8A 3PAVA 4G7SB 1SF3A 2CALA 3QJRB 3QPKA 4NB7A 3OM3B 4ENZA 4BK5C 3NJHA 1JERA 3FYIB 4G72B 3IBOA 1IKOP 2J57A 2FJSA 3H4HA 3MBWB 4A2GA 5IY5B 3S3CB 3RYMA 3T71A 1E30A 2YXVA 4AKQA 1WS8A 3FSVA 1CUOA 1W6WA 3WIAA 3NYKA 3NT0A 1WA2X 4YSEA 1A8ZA 3S3DB 1JVLA 1KV7A 1MDAA 2CAKA 4A2EA 5LDUA 3KW7A 3T9WA 3HB3B 1PLBA 2XYBA 4YSDA 1AS8A 4E9QA 3FSAA 4YSAA 2FT8A 1BYOA 1M56B 2JFCA 1J9RA 3T6WA 4YSSA 3FT0A 2BP0B 5I6OA 1MG2C 3QJTB 1VLXA 4BWUA 2IDUA 2ZONA 1WAEA 3ZIYA 2DV6A 4DP9X 2BW5A 2XV0A 1MZYA 1AR1B 1CC3A 3OD3A 3AZUA 5AFAA 2TSBA 2OCCB 3MX0B 3QJUB 3EH3B 1SDDA 2BO0A 2CUAA 3D12B 4HHWA 4YSCA 1IUZA 1AACA 1WA1X 3QJQB 2IDTA 3FSWA 3PXLA 2BW4A 1TEFA 5I5MA 3AW5A 2GBAA 4KO7A 3OQRA 4E9WA 1IC0A 4AX3A 1KBWA 3NJFA 5PAZA 1RKRA 2PP9A 2X87A 2IDQA 5B1JC 1PLCA 3FQ1A 1GR7A 1NZRA 1RCYA 4NAJA 2DYRB 2CBPA 1CURA 3QJVB 1ASPA 1E5YA 2DY2A 3WKQA 2EIJB 1JZJA 1XB3A 3ZX1A 4F2FA 1URIA 4E9YA 1TKWA 1OE1A 1L9RA 2GHZA 3FSZA 2Q9OA 3FQYA 1EZLA 1J9QA 1AIZA 3CVDA 2JKWA 1E67A 3BQVA 4G7RB 1KCWA 2AFNA 1UATA 2YAPA 2QT6A 3C75A 1JOIA 2YEVB 3EH5B 4A2DA 1A3ZA 3OMAB 1SFDA 3FQ2A 3AY2A 4DPCX 2I85A 3ABGA 4JKNA 2HRGA 2FQEA 4P5RA 2PP7A 1HAWA 3AG1B 4E9XA 4HHGA 1NPJA 7PAZA 1J9SA 1AZBA 1OE3A 2W88A 2X88A 5B7FA 1PZBA 3TA4D 4CSZA 2GIMA 1OCRB 1NTDA 1V54B 1JZGA 3NJMA 1WS7A 4DP2X 1SFHA 1NIAA 2PPAA 1TU2A 2BZCA 2QPDB 2H5UA 1PZAA 2XV3A 1WA0X 1L9SA 2R7EB 2XWZA 2LLNA 4BWWA 1KYAA 1X9RA 1AG0A 2FT6A 2ZWNA 1V10A 3GDCA 3PLYA 4DP6X 2PPFA 4HALA 1AZCA 1E65A 3CVCA 3ABLB 2J56A 5B1KA 3NJIA 2HLEB 2PPEA 1FA4A 2AVFA 2IAAC 4K9JA 2XXGA 2UX6A 1KDIA 3UACA 1F56A 5FC9A 3JTBA 4WKXA 3NJKA 1N68A 5AKRA 1PNDA 2Q5BA 1N70A 1IBZA 2BP8B 4YSUA 2BP0A 1R1CA 3FPYA 5I6PA 2UXGA 7PCYA 4UF7C 4ZK8A 3CDZB 1JVOA 4G7QB 1A4AA 1CYXA 1JZFA 2DWTA 4YVNA 5A7EA 1JXGA 2MRYA 2XLLA 5PCYA 9PCYA 1GY2A 1NIBA 2FWLB 1FFTB 1XMEB 4KNSA 4E9VA 2AANA 3DTUB 3FPXA 3NSFA 2PCFA 4Q8BA 3T6XA 1KDJA 4YSQA 2UXTA 4PCYA 1BEXA 4PAZA 4DPBX 1ASQA 1ILUA 2YAQA 4DP0X 2VW4A 3BVDB 4GP4B 4HIPA 4A2FA 3TBCA 3HEIB 1NWOA 1ZIBA 1OE2A 5AZUA 3WKPA 3WNJA 1BXAA 2N0MA 3PCYA 1W6LA 2DYSB 2XX1A 3IN0A 3FU7B 4DP5X 2GC7C 1PCSA 5B1BB 2GB2A 1J5CA 4HAKA 3UAEA 4YSTA 1MZZA 4G70B 2GC4C 4G71B 3DIVA 1PF3A 1SNRA 1ET7A 2XX0A 5B1JA 3QQXA 3ZBMA 3NSYA 4BDVB 1EHKB 2E86A 3IN2A 4HCGA 2AZAA 4QKTA 2DWSA 2FQFA 1BYPA 2HX9A 2I7SA 2ZOOA 1L9TA 4GP5B 4GP8B 1OCOB 3FU9A 3WI9A 5I6NA 3CVBA 1OOWA 4AKOA 1L9QA 1NDTA 5D4HA 2VN3A 3EH4B 2GSMB 1PY0A 1NIFA 3NP4A 1NINA 2WO2B 4WTQA 4F2EA 1XB6A 2NRDA 3UGEA 3ZDWA 3WNIA 1AZNA 1HFUA 1NWPA 1BQ5A 2YAHA 4GYBA 2VW7A 3X1FA 2VSKB 1A65A 1ID2A 4A66A 3PAZA 2QDWA 2PP8A 2PLTA 5F7AA 3QJSB 4E9RA 2R7EA 1BXVA 1ILSA 2YARA 3SQRA 1NIEA 1AZRA 1AZUA 1PAZA 3L45A 4EF3A 1ADWA 2J55A 4GY4A 2IWEA 1PMYA 1BAWA 4A2HA 5B7EA 2ZXWB 4HZ1A 3OMNB 2PPCA 3UABA 1OCCB 3GYRA 1GY1A 4N8UA 1KCBA 1GS8A 1E5ZA 1ETJA 4KNTA 2H47C 4KO5A 4HCFA 1A4BA 1ET5A 1HAUA 4BXVA 4DP7X 2BHFA 2HZHA 4UAHA 3S8FB 1A4CA 1PLAA 2VMJA 3CG8A 5I6MA 2BP8A 2Y69B 1BXUA 4F7KA 3N55A 3FU8A 3TU6A 1TEGA 1AOZA 2XU9A 2BWDA 3X1NA 2GI0A 4CSPA 8PAZA 4DPAX 3CDZA 4KNUA 4HCIA 2UXFA 3NJJA 4NERA 1J9TA 2IH9A 2CJ3A 5D4IA 1OCZB 2I7OA 3DKHA 3WG7B 3GXUB 5EHFA 2EINB 2IDFA 1JXFA 3T6ZA 4AKPA 1T5KA 3PPSA 3V9CA 3AG4B 5D4JA 2FQDA 1BQKA 1L9OA 2IH8A 4QLWA 4N4YB 1JXDA 2WSDA 4A68A 5F7BA 4AZUA 3S8GB 3UADA 1X9UA 3FYEB 1GSKA 3FU7A 4P5SA 5ANHA 1XB8A 2QPEB 2YAEA 3PAUA 6PCYA 2EILB 3X2QB 1GW0A 1QNIA 3OMIB 3JT2A 3N2JA 2IWKA 3TASA 3UAAA 1ZIAA 4M3HA 1SF5A 1I53A 1GS7A 4TXVB 1QLEB 4YVUA 4BDVA 4BWTA 2VM4A 3U25A 5I5IA 1FWXA 2AZUA 1W8EA 2B08A 1ZDQA 1BQRA 1DYZA 5B1AB 1L9PA 2MTAA 2UXVA 4M4RB 5TK2A 2EIMB 2TSAA 4DP4X 3S3BB 1RZQA 1NICA 1CYWA 3FS9A 1AANA 3H56A 3NSCA 4BXSV 2BWIA 1IBYA 2HXAA 1SHXA 2UX7A 4YSRA 5I26A 3SBQA 3H4FA 2IWFA 1JZHA 2YAMA 4GXFA 4AI7A 1GS6X 5E9NA 1M57B 1SDDB 1ZDSA 3AG2B 1ZV2A 3T6VA 1JZEA 5B7MA 2FNWA 4W1TA 1SJMA 3CZUB 3G5WA 2FT7A 3V9EA 3IEAA 4FAAB 3SBPA 1KGYE 3TBBA 1NPNA 4YSPA 4FA7B 1AS6A 5I5JA 1DZ0A 4E9SA 2XUWA 1JZIA 3NJNA 1RZPA 1AG6A 2XVBA 3ABKB 1AAJA 3NP3A 4RH4A 3ASOB 3NJGA 4A67A 2RACA 3EF4A 2FQGA 1OV8A 5B3SB 2FTAA 4KOCA 1ET8A 1SHWA 2P80A 2A3TA 2P80D 4MFHA 2OJ1A 2W8CA 4DP8X 1ASOA 1ZPUA 1J5DA 4KO9A 4YSOA 4JHUA 3EHBB 1MG3C 4JHVA 2YAOA 1M9WA 2PCYA 1V55B 4L0PB 3KW8A 2WO3B 4W9ZA 2J5WA 1OF0A 5TK4A 1NIDA 2BZ7A 4YL4A 1AS7A 6PAZA 3AG3B 2JXMA 5I6KA 4X4KA 2OV0A 2VM3A 4DP1X 2VW6A 1YLBB 1PZCA 3X1BA 2B3IA 4UANA 1KBVA 2HRHA 2VSMB 2YXWA 2QDVA 3ASNB 1GYCA
chains in the Genus database with same CATH superfamily
2IQ9H 3K2MC 3WN5A 2K9PA 4QRSA 1OF2A 2AEQH 1AZZC 2HYMA 2IDSA 2WWNA 5CEZH 5JW4N 1JP5A 1R3IH 4ICXA 4DCQA 4U1KB 1VQ8V 2Z8VC 3QYNA 4LWSA 2VDRB 2YAFA 3GEWB 1XL4A 4LLWB 2BMKA 4A6YL 1KBKA 2JCCE 2RCSH 3AVEA 2OCHA 1GL4B 1M6OA 2YD1A 4ZMLA 1KENH 4N9GB 4EI0A 3S34H 4QRQB 3X12B 4AM0A 1Y7VA 2W5PA 4MJID 3SE3C 2BOLA 1V7NL 2NNCA 3QG7L 4U3XA 3FF7A 3DX9A 2LGQA 1VFBA 3RLSA 1EX0A 1UKQA 2YEZA 5IQ9A 1O7SA 3PQYB 5FHBH 1H5BC 2YXVA 4O5LH 1YN7A 5DHDA 4AKQA 1IGIH 5DHVB 4G8FB 4AW7A 1ED3B 2BM3A 3QEHA 2F53A 5J2TB 2VLKB 1FFPA 2Q8AH 3A22A 5K1VA 4YSEA 1HHJB 1L5GA 4EXKA 2ZG2A 4JFED 1W80A 3OHXC 3A23A 2OKMA 4N0FA 4S10A 1KCRH 5FO2A 2F7RA 1H5BB 1IGTB 1J9RA 2J44A 2IGTA 2ZWSA 5AVUB 4XNUH 3MZTA 1FAKT 2WTOA 4LRIA 5IB1A 5EO9A 1WIUA 2QWNB 4J3WA 1YMMB 3JATA 4N20A 2FECI 3B9KC 4RDQF 1OCWL 1P4LA 2BW5A 1QR4A 3FFQA 1RULL 4UMGA 3TVMC 4CVWA 4L4TB 2TSBA 4NTYA 4U6XB 3MRIB 2YXHA 4FXKC 2BNQD 3GJFK 5DWPA 4UOJA 3D12B 2EIBA 2HJFC 3A0BZ 1T1ZA 2FYUH 4FFZH 4AWJC 3D3QA 1K9TA 4HOWA 4YPGA 3C60C 1YAZA 1K3ZA 1AD0B 2OP4L 2GEQA 4JUSA 4LCYA 1NGWA 1Q0XH 4Q9CA 5DF0A 5IWAO 3JD0A 2OSYA 3B9KB 4DVRH 2XTJE 1YEHH 1I8KA 3KBPA 3TVMB 3DDGA 2IDQA 2K9UA 1BP3B 5B21A 2KL6A 2UUCB 4Y4HC 4FXKB 3STBA 2BC4A 4YDKH 1NDGA 4JY6A 4R3SA 2HJFB 3MNDA 3VWKA 2OXHA 4S11A 3OC8A 4Y19E 5CJOH 4DHLA 1JRHI 2CK0H 3D6GA 3C60B 1A1NB 3O9WD 1IZ3A 4KJYA 1KFAH 4Q9BA 4EDWL 2CHDA 2KKQA 4GQPH 1ZGLM 5FOBB 3OWEA 2I9LA 4H0HB 1DLFL 3QA3A 2A9BA 4OLVL 4YLQT 2L4OA 4Y4HB 4LPVA 4Z3GA 2GHZA 2OR7A 4AT6A 1MVUA 1M1XA 1U3HA 1QNMA 4FNRA 1OPOA 1TVHB 4K9EH 5J8OA 1OCRC 4JN1L 2APTA 3IAYA 3QDAA 1IAIH 2AV1A 4TYUA 3K2UH 3RW0A 4XNYH 2L8AA 3ABGA 2P7TC 2NNAA 2W91A 1LP9E 2EDDA 4GX2A 2Z31A 2YQ2A 3EJYD 3TBSB 3E8BA 2WXOA 1J9SA 2FUQA 2XAGA 4HV8A 4MDJB 4GAGL 2OL3H 2A0LD 1RMFL 3BIKB 3RI5F 1MVYA 3K6OA 1U36A 1OCRB 5E56A 1A1OB 3ULUE 2EYSB 2DB8A 3LYRA 4YEFA 1DQDH 1E8WA 5FUZL 2DQDH 4RNRB 2P7TB 3W82A 4LLMB 1KXHA 3QISA 5B3JF 1A3LL 2A83B 3C8KA 5JIPA 3GS0A 3Q1SH 4U1MB 3SBWA 1HDMB 4HKBB 1S78C 1T6WA 4L0ZA 1L9SA 3OD4A 2DIJA 2L7UA 1URLA 5C6WH 4KQ0A 3JVFC 1OT2A 4TQHA 2W94A 4Q20A 2HH0L 4H4NA 5DJDA 2DMGA 5B5EZ 1AG0A 3JWOH 4X4XA 2V37A 3RT3C 1NC4D 3D3VB 4X8GA 4Y4KC 5C0EB 2JSFA 1OAKL 4KQ4H 1FV1A 3FU6A 3HG1A 1JPFB 2YHGA 1S2EA 5DEFB 4H5SA 1LR1A 5ESAA 2RALA 5D7LB 1F23A 1C5BL 3FRPG 3NJKA 1RSOB 2A77H 4JI2B 3BKCL 2EYTA 3O4LB 3DHMA 3J8F7 4YZWA 3M7MX 3ULVE 3M46A 4PJGE 1PNDA 1YJDC 3ILPB 4UILL 2XRAL 4Q0XH 3QO0B 3M1CA 4NO0B 1FNSL 3FUJA 4Y4KB 4M1DH 5JXED 1E5UI 3PL6A 2G3ZA 2WN3A 3N1MC 3IKCB 5I76A 4GG6F 4RFOL 2UXBB 1KGIA 3U0TB 5A2IH 1VQ9V 2Z0BA 4ALAH 3HC4H 3VMOA 3SDLA 5A6IA 1M1KW 4W70A 3RX9A 3VXUE 2ITDA 4MMZC 4BFKA 1NCWL 1NMAL 5ERWB 2YMOA 5DJZA 4L4VE 4JAAA 1JN6A 4YHML 5CEYA 2HN7A 1Q3EA 4PRPE 4PJFA 2F95B 4ZUTB 5IB4B 4G8IA 3L16A 4Q6YA 4OTXH 3HC0B 1K34A 1J8SA 3C3SA 1A14L 1RJLB 1CDHA 4F6RB 1E4WL 1MFAH 3CCUV 2R9AA 1RK0A 2JLLA 1KJ2A 1X5AA 5J1AB 3KPQB 1NCTA 3OR6C 1F18A 1KTRL 4MMZB 4OAWA 1QABA 5E23A 2LU5A 2ARJQ 3RWJA 4N0RA 3PJSB 4XNAA 3VFSA 3V0EA 3NIGB 4HD9A 4GRMB 4DW1A 4AQEA 1Y18A 3BIAX 5AZUA 3UBXG 2W81C 2CGOA 1BXXA 2EIJC 4WFFD 2NSXA 4D9QE 4EUPG 3DETC 4YJ2A 3K9SA 1A6VH 1BOGA 4HAKA 5JA8B 3UAEA 4R7LA 3OW2U 3PWVB 5G55A 4U49A 5DT1L 1AGEA 1BZOA 3OR6B 2CJSA 5C07A 4A6YA 1LVEA 1GW6A 4OXSA 4ICGA 4P07A 5IJ9A 4MS8D 2CMRH 5ISZE 4DR3O 4MVZA 3M45A 4OX9B 3F3HA 5CKAA 4YHOH 3HMXL 1T2QL 1KYDA 5L3FA 1LEGA 2AQSA 4MQXD 5EO1B 3HMWL 3QEGH 5EU6B 4X7FC 4O2FA 3MRCB 4UZUA 4OCYH 3L74H 4WUKH 5EU4B 1WG3A 1B4RA 4Y2DC 4F37K 2DYPD 4DN4L 3FT4A 5KSUB 1N34O 4TV9A 1AJNA 4BUHA 4PA7A 3POHA 3IC7A 4GG6B 5HDWA 1RJYB 3GPEA 1BZQK 2G4EA 1JRHL 2YPKA 4DVBB 2LU4A 4JR9H 3VJ6B 4P30A 2XPGA 4YBQC 1GZHA 3QORD 3TBTA 4GAJL 3RPBA 2WYZA 4Y2DB 1KECA 5JOPD 1X5GA 2YIHA 2UWEB 1WZ1H 3H8NA 4AEIH 4PVLA 4NHCL 1AZRA 4HIHB 3TYGH 4NSKB 4O4JA 2VDKL 4K8RL 3OJVC 5HGDA 2EH8H 5G4MA 2IAMC 4U6HA 4R6UA 4TUOA 4FLQA 1ACYH 2VITA 4P46D 4ZHQB 2WSKA 1GY1A 1J05A 5DD1L 3Q44A 3FRPA 1CTNA 4GI8A 5ESVB 4OV5B 5KG9A 3JWDL 5CIPH 3UTTD 2WGXA 5FYJL 4IGBA 1ROWA 2WZ5A 4HJTA 4PR5B 5HDOA 1NFDF 3V4PH 1YHQV 2IAMB 3MUY1 5SWZD 2BP8A 3X3GH 1X5LA 3U7YL 1ZLVH 2OXGB 3VG9C 3OR7C 5DDHA 1E2ZA 2EUXA 5KYXB 1LYQA 1DL7H 2ENPA 3PWJB 4BA0A 3X1NA 1EHLH 2WLKA 3IRPX 3MRNB 5CCJA 2Y7LA 1JWUA 1XF4A 2X3AA 2XA8H 4LQ1A 4XPGH 4R4FL 3DSQA 4MQSB 2V9TA 1IE4A 3GLZA 3ZL4H 4L5FH 1QTYT 3MC0A 3AQYA 4YQXL 2VISB 4J4PC 3ZRVA 2R59A 1Q6UA 3EYOB 2UZYA 4JHAH 1RZIA 3OR7B 2I7OA 3AS3A 3VG9B 2A6IA 1KCLA 3UBGA 4XPAH 4RUEA 2YQ3A 2Z93B 3G6DH 2QQQA 4Z76A 4EJ1C 3K72B 3KYNB 3K6IA 4P04A 4PV9A 1D6EA 2BVEA 2YR3A 4IU3B 1K4CA 2FQDA 2OMTA 4OZGB 4EZLA 1I1AD 3UBXA 1FFOB 1ITCA 1QLEC 2EZPA 4EUPA 2DMHA 2B4CC 4AZUA 3WLWC 2F53D 4TQPA 3QEQA 4X1IB 1I94O 1UH3A 2KKWA 4KL1A 1U8CB 2XN2A 1GSKA 3LTVA 1KN2L 3O0LA 4GO9A 1YUHA 1G5GA 2QPEB 4GSDL 3DOSB 4U7KA 1WYJA 3A4AA 2A5UA 4EI5A 3N40P 3ZHTA 2K7QA 2JGUA 1HNXB 1JGUH 3H9SE 1P0SE 4FPPA 4NUJA 1QLEB 3Q4HB 2OTWA 1N0LA 3CK0H 4QF1A 4LKCA 5FYKE 3VH8G 4ZMVA 1ZHKA 1FWXA 1GHFL 1A2YB 3QNZB 1FD9A 4QO1A 3FHQA 3HZKB 4X5WA 4D7SA 4LKXA 4JI0O 1TPXC 5TDPA 5L88H 1IMHC 3VWJA 2AC0A 4PB9L 1LWRA 2DWDC 1IB5A 1M57C 2JELH 4JRYB 3U4EB 3N41F 3U83A 1XGYH 4CRPA 2G75A 2OSXA 3LZRA 3MLTA 2C3XA 2DLFL 1BW8A 3CC4V 1NFDB 5HHME 4HS8H 3WKYA 1XREA 4PVNA 2NMSA 4EAEA 2G0LA 3ZTCC 2HXAA 2DLGA 2IJIA 1TPXB 1TVKB 2VQFB 5JDJA 1GS6X 4ZDHB 3DXRA 1P4RA 4OPAA 2DWDB 1M57B 2QQKH 2BIIA 2BCKA 1ZRUA 3LX9A 1PG7L 3MXWH 4MMYB 1RP8A 3DGCR 3FFDA 3HAEH 2J8UA 1ACZA 2YA1A 1MI5A 3WU2Z 2RH0A 2Y06H 1Q5OA 2W9LA 1RFDH 32C2B 3QS2A 2Q86B 1X44A 1MUJA 3U48A 1AKJA 1K5NB 3ELAT 4XX1E 3ECWA 1KF9B 1R3HB 2CO2A 4UCTA 3ME0B 4PU2A 5JDSB 3MRRB 3FQTA 2ESVE 3FNKA 5AL0A 3U1SH 1RD6A 1H19A 2ED8A 4DUVA 1F11B 1U3HD 3RIAF 4Z3JA 1VEOA 4C83A 1D6VH 3BQUA 3DRTB 1UEYA 3HS0C 5MEOB 3LS5L 4C56E 4TSCL 2KQNA 3GMQA 4KQ3L 5H6QA 3SDXF 3MLYL 3D9AL 2NY5C 5IQ7H 4BZ1A 4QXUL 2BIPA 4KPHL 5EBMC 2AXGB 2NOYA 1UKSA 4NQDB 3VB9A 4FYRA 2Z31D 1I8LC 3WTSA 3BDBA 3VI4A 1NGXB 1IVTA 4I48A 1MQKL 2F4VB 3LPPA 4NNYA 4E41A 2Z1KA 3HS0B 4P8QA 1CFQA 2H8PA 3FO0L 1PEWA 4L3EE 4A55A 4EIBA 2EIDA 5GS0C 5IHBA 3HS9A 5TGBA 4GQQA 1IFRA 3D30A 3W5NA 2HT4C 1Z0NA 4RGMC 1QBLL 2IIJA 3VGDA 5I1EH 5EBMB 3WS3A 2A9NH 3FB6C 1YJNV 2Q69A 2YWYA 1GYCA 4LPXA 4PP1D 2XV2A 1RHHB 4GKOA 1E7UA 3KPLA 5LP6A 1G0YR 3ARSA 2E8ZA 4H26A 1CQYA 2GV9A 4KO6A 2XWBB 3BUPA 5DK0A 1HHKA 1K6QH 1MWAB 3HMXA 4ZNEE 5FUOL 1N5YH 2ZKWA 3MU3A 4NO5A 3LKRB 4OFVA 4OZFH 4ZPTB 5F88A 4RGMB 4XAKD 4EE2A 3NJLA 1H3TA 2X53A 3MJ7A 3L7EB 4UM8B 4IGGA 1MCIA 2IDCA 3FB6B 4U0QB 3GBNH 3ARUA 4LCWE 2CALA 3NN8A 2R70A 1TQWA 2AAAA 1IBLB 5HJDA 3D48R 3T0BA 3HG1D 3TP4A 3RFRA 1A7QH 2GIXA 4QI3A 3ORJA 5EU7C 2V9UA 2BIMA 3MBWB 1UM5L 4KROD 2G0KA 2X1PA 3CC5A 5H37G 3QRGH 3VH8A 3QARA 4ZFFA 4OZIE 1CFBA 3JD3A 1FZJA 4MJIB 1W72H 3CSTA 4S2SB 1ZE3H 3L3DB 3RZWA 4OT1H 4UBDD 1T20A 5CF3A 1BS3A 3MFFB 3PL6D 4WQOA 3TJHD 3KPMA 2GJPA 3WFZA 4JV5O 2WKLA 4B9PA 1PLBA 1H15B 3WE1A 1UCBH 3SD5A 1VQLV 3GWOA 1ERNA 1I3UA 4YSAA 1BAFH 1HCZA 1DJWA 1SXZA 2C4FT 2JFCA 3EO9L 3N06B 4M4RA 4PJ7F 3NFPB 1J18A 4RDBA 4ETQB 2Q87A 1RPQA 1M4UA 4ZTPL 4YY3B 3OKDA 2CJUL 3EOAB 1MNUH 1KGCE 5L9DL 2C9VA 2XA3A 4IKJA 1NBZB 1JI2A 3B40A 3A6CL 3G3LA 4JDZA 2HT3D 4RWHA 2JNZA 3RWHA 1WBZA 3NAAH 1PIFA 2BTQA 2AQRA 5GS3A 3H3BC 1BSMA 4WENB 1PM9A 3NCXA 2EDRA 1BVZA 2ZUYA 2KPWA 4FFWD 5ECJE 4UQIM 3INOA 1PFCA 2KC0A 4OZHA 1QBMH 2OSWA 1E79G 1GJWA 4ZYKB 3SGKC 5JIDA 1DP0A 5CUSL 4TV3A 4WFGA 2Z3FA 4MDRA 3QXWA 4DGVH 1FL5A 5C07D 2AEOA 4QGYA 3DUUB 2YGQA 3CDFA 4ODVH 2Y07L 4F9PA 3PDOB 5KLVH 1NCBH 3GJFH 2OYKA 1I7TB 1LGVA 1XB3A 4NP9A 2X4NB 4HCRH 4KX7A 5C0BA 4ERSL 3E35A 3SSGA 1SXBA 1CDUA 3E8HA 5B8CC 1XAKA 2WLZA 3BVNB 5E8OB 3MLWH 5C9JB 1J9QA 3TIEB 4FMKA 2YZ1A 2EVHA 1W0KG 2XIDA 1JZ7A 3G9VA 1YSCA 1Q9LB 1N8ZB 3L6FA 3I9PA 3SYCA 1FO0H 3MJGX 4HMDA 4XVJH 5DRWB 3SDXB 4D0BA 1AC0A 3SGJC 4A2DA 1V54C 4XBEH 3EGXA 2Z0AA 4WRLA 3RWIA 4DPCX 3GLEA 3PXHA 4YMPA 5B8CB 2WLYA 4HEMA 5EU3A 2QM7A 4YXHL 5D7KD 5SWQA 4ZTOL 3EJYC 1H3XA 3OAAG 4OGAD 3L1EA 1OARH 3BP7A 4E9XA 4PJ7B 2BSEA 5F97E 5LO7A 3SPVA 1JHTA 2N0KA 5KYYA 4HZLB 2Q7NA 5FO9B 5DD3H 1V54B 1XCTA 2D0GA 5B38B 4RWUA 2QELA 4X4MA 4OGZA 3CN4A 2FWOB 1UXWB 2FD6H 1T5WB 2QBWA 3UIYA 1BFSA 2ZE0A 2HKOA 5L2KE 1VPOL 5DQ9A 3ZMEA 3TEWA 3ARXA 2CXKA 4P99A 5FGRA 4HBCL 3T65A 5IP4A 3UO1L 1KGUA 5LA6A 5AW5B 4WCYH 5H37A 4KZEL 2ZWNA 3CLWA 2EDXA 3IGLA 2APBA 3POCA 3IB4A 4NM8H 5IBUG 5KSAA 4M6NH 1RI8A 2RGSA 4I4TB 2J56A 3K6DA 5B1KA 3WFHB 4MS2A 4TLKA 3O65A 1PZ5B 1DUYA 4R7DA 4XVTL 5DJCB 5KVGE 2XXGA 5DR5L 5E8EA 2MW2B 2XXMB 3T1FA 1PPIA 2A9CA 4AEHL 3B6SB 4GKSA 4KGLA 1LQSR 4U6YA 2ORBH 1KOAA 4I88A 3MREB 4XDJA 3F7LA 3F62A 4OBRA 1NC4B 1M9SA 2AK1L 2WXRA 5E1QA 5JXEC 1F7YA 3GXNA 3W39B 2BP0A 2NUTB 1SVZA 4YGVB 2NZ9D 2AJZA 2QZ5A 4HC1L 4JVPA 4LVHC 4ABVA 5CWSA 1X5KA 3F65A 4CC4C 5E1HB 2GY7B 1E9PA 2BSSA 2R23B 5KSVB 2E7LA 1A4AA 1HCVA 4ODSH 4UV7H 1WZMA 1L8DA 2KB1A 4TULL 3GWJA 2R0ZH 1N33B 4PMEA 2X4OA 4R6ZA 1QG3A 5AKSA 1EA9C 3FCGA 2MPAH 2E6JA 3TN0A 3VFPA 4GX0A 2CRIA 3AADB 4JFZL 4XP4L 4Z95H 5EC1C 4Z3HA 2XETA 2AANA 1HNZB 3VFUA 5JLZA 4ZUUA 3K8LA 1OAQH 2P44B 4FXGC 2PMZA 4GAAA 4LVHB 4G82A 5LXTA 4NI6A 1J10A 4XI5D 2Z6FA 4XNQA 5KAQF 4EI5D 3FJTA 4P2QB 3BVDB 5F7FA 1NFIA 5I15H 4LNVA 5EC1B 4NC1E 3ZHRA 2V2WA 4YS4A 5IOPB 1WPCA 3PCYA 3QBTB 4FXGB 3E9TA 1K73W 1YQVH 4XPHL 3ZMNA 4KTGA 4CGUB 2Z64C 2KT6A 4G70B 4D8PB 3RVUD 4LSVL 4N2CA 3MV7A 3CWGA 5DO2D 4BK8A 2OYQA 3BWAB 2XX0A 4MS8C 1EN6A 3CU7A 4FX5A 1TJHH 4QPEA 1KB9J 2G3MA 5B1JA 4I85A 3CCJV 3KKYA 3T2PA 1CXZB 4B97A 1SXCA 3MGTA 1MFCH 5D70L 3FRUB 1RIVL 4DGYH 1NJIW 4MQXC 1ODUA 1FVDB 4G6ML 4YFLF 3TA3D 3F7KA 3UJJL 1C12A 2FSEA 2EDBA 1F1GA 1UZGA 1CU4L 4GP8B 4ICWA 4KBPA 5HYIA 2Z35B 2A9ML 5FPOA 2EXWD 4JBSA 4FABL 2QTEA 4I2XA 2KDGA 3KYKH 1L9QA 4G2AA 5EBWC 5EZOL 2AHYA 3A6OA 1ZT7A 1FNEA 3BIBX 2IANA 3D52A 4NENB 1TMQA 4FKKA 4Z7WE 5E0FA 5E4OA 3SDDC 1XCQA 3TTSA 1MI5D 2P22C 5IQLA 3CSYB 4ABWA 4Z78A 1TQSA 2R0KL 1U4EA 1KGXA 4AK1A 1AKJD 4LP4A 1WICA 3O3DB 1JDAA 4XOCA 4XMWA 4PJEA 3ULUL 5JNYA 2EDNA 4QJ3B 1SBBA 2VR4A 5EBWB 4NKQB 1OCCC 5GXBB 1XQ4A 3GMPA 3S3WA 1I7UB 2RB8A 2Y5QA 4K3EL 1BWMA 2BSKB 1H8LA 3ABUA 5CA0B 2XWTA 2XWXA 3BQUD 3DXAE 3I9GL 3UTZB 3SDDB 4UT9H 1AZUA 4K3HA 5K39B 1OTSC 3OKNA 2WZPA 4TWKA 3CFCH 4GQ9L 5I9QC 5T3ZH 4EF3A 3V6BR 4AH2A 4KFZC 5FHAH 4A2HA 3J07A 4P46C 1QW8A 1ZA6B 2VXSH 4XMZA 3ABZA 2XUMA 1OCCB 1O9WA 1QYGL 3MRBB 4GAFB 4HAGA 2L0DA 2O5ZL 4LXFA 5LHHA 5HGBA 3KPOB 4KNTA 4MTGA 3DIFB 1N59B 1UH2A 4HAFA 4WFHA 4E41D 1MAMH 4BXVA 3FB5C 4E5XG 5C0FA 3ES6B 5I9QB 1MHCB 3PN1A 4Y1AA 4U2YA 4P46B 4TQDA 4TUJA 2XNAA 4HUVB 4F7KA 4ELDA 1EFXA 3WN5C 1IBMB 1B3JA 1J0ZA 1IFGA 4MRCA 4J3VA 1AOZA 1RU9H 2BSBA 3JWNG 1WEJH 2P5PA 4NP4L 1FKAO 3UTTB 1IV8A 1LJMA 3D4YA 3FB5B 4YGAB 1QLRA 4QXVA 2C1OB 5SWZB 3GUTA 4TSFG 1YEDB 4OGYH 1JK9B 3P40A 2RMNA 4GIPD 4N5ED 3L7FA 5ITFB 4N2MA 3WN5B 1E90A 4QRSB 3QFJA 5DQDH 1JZ3A 5L3EA 1RIUL 4PRNB 3ZS8C 1XGRA 3QK0A 4DCQB 4LWSB 3QUML 1RSFA 3PPSA 1OXYA 3RPIA 2BMKB 1AMXA 4NBZB 3TWCH 5K1PA 1M6OB 5LGNA 1X5FA 5AWNL 1OT1A 1FL3A 5JW4M 3AUWB 3BP5B 4AM0B 1ENVA 4HDIA 1TO4A 4XBFA 3VW3H 3HPJB 3WBDA 2YAEA 3DX9B 1VFBB 3ARGC 2YEZB 5IQ9B 4JFOA 1QR1A 4PJ5E 3EBIA 2EJ1A 1FPTL 4BQBA 2DJVA 1IZKA 2H41A 1YN7B 1G1CA 4PI2A 1A7RL 3L3GA 4K8RD 1GGCL 1QSEA 1SRDA 4LRIC 3NPSC 2JCCA 3QEHB 3HG0A 5IQNA 4W9KC 2VAJA 3LMJL 1MIMH 2B08A 5TF1H 1L5GB 3MNWA 1FGNH 1GAFH 1RK1A 5CJQL 5KHKA 1B4TA 1OIOA 5HHOE 4YUEL 2X4QA 3ARGB 5CNHA 5JMRA 4N0FB 1G6UA 2NYZA 1IAII 3D7PA 2BS8A 4P3DA 2QADC 5FYJD 1LDPH 1TXKA 3T08A 3UC0H 2YO3A 1PQZB 1BSIA 1TQTA 1FNGA 2YD3A 4RMQA 3UGXA 3NPSB 4ORGA 4PRHA 4DR5O 4IKLA 4Y5YA 3MLUL 3ZMUA 3JATB 4O2AA 4HBNA 4TNWK 2AGAA 1XEQA 4IMLA 1P4LB 1QHPA 3VFMA 4A37A 1DBAH 5KZCB 5T33L 4KC3B 4PS7A 2DQCL 5ITBH 2JK5C 1JZHA 4CN6A 5E94A 4D7BA 4GCZA 5E9NA 3S4SG 4JI6B 2D03H 4FZ1A 2FX8L 3NSXA 2X9ZA 2QADB 4WFGD 5FFGA 3T6VA 3VWKC 1BJ1J 3ZMVA 1T1ZB 2AITA 1IBGL 4YPGB 1EDYA 2Y7NA 1YYLL 4R4ND 4Z7QF 2NY1D 2WBKA 2JJ2G 1SS3A 2WV3A 3F04A 3QO1A 4M00A 1I8KB 5C0BD 2QDOA 2JK5B 3FFCE 4A1RA 2HWZH 3LXAA 2BC4B 2BERA 4D2NA 1OM3L 2NY7L 4MAYA 2XN9E 1NDGB 4JY6B 4R3SB 3ZIMA 1KPRA 3VWKB 1HC1A 3DHJA 2A7WA 2C8NA 1WFUA 2K45A 2OXHB 2YUXA 5KX5A 1AAJA 1OSYA 4ZI7B 2ZXEB 3NJGA 5FFOA 5JOEA 1A6TA 3VXSA 4KJYB 3BMWA 4G5AA 2EZ0D 5D1XA 1KBGH 4DO6A 1BM3H 2P80A 1UWXH 3PJSK 2ICWB 4E2OA 4DGUA 1P7QD 4TQFA 2EH7H 2I9LB 3QA3B 3EFFK 1ZPUA 1WTLA 3BEWA 3L3JA 3P4MA 1JPSH 3IT8D 2HUEA 2HPOA 1DVFD 2IQ9L 2Z31C 1HTYA 4AT6B 1MVUB 2YRBA 1M1XB 5F1IA 3WFBH 2AEQL 3ZHSA 43CAA 5CEZL 1JSYA 1R3IL 1QTPA 1NIDA 5LQBH 3LXCA 3GI9L 4NZRL 5F89A 5JXAL 5I6KA 4X4KA 2AV1B 2CKBB 2RCSL 3EFDH 3QR2A 3R4DA 2EO9A 2NNAB 4PSRA 4F58H 5IJVA 1KENL 2HRHA 3CIAA 4PYHA 4PP1C 2Z31B 4F6EA 3SBWC 4FI8A 1MSPA 4YHIB 3KWVA 4GAYA 4HV8B 4Z7VA 2HFEA 1B3IA 3RVXC 4ANVA 3OXSA 4N24A 2GJ6E 4LPTA 3RWEA 1NOLA 4H8UA 4MASA 1RJZA 5AKVA 3D0LB 2OX5A 3BAIA 5FHBL 1TYRA 4R50A 1CDGA 4LVNC 4O5LL 1MFEH 4JG0H 4ANKA 1IGIL 2NNUA 4ZT1A 5EZLB 2TRHA 2MK3A 2CCWA 1NEUA 4OCWH 2W59A 1XBLA 5KSAD 1FZOA 2LO1A 2HX8A 3C8KB 5F3FA 3RKPA 1K97A 2WXHA 3QPKA 4CILA 2A4EA 4PD4K 4PTTA 5E2VH 5JJJB 2H6OA 3GI8H 5DJDB 1NLBL 5ALCH 1D5MA 4Z7QB 4LVNB 4KI5F 4X4XB 5CZRA 5ALBL 5DUMH 5BV7C 5I0DA 4G8GA 4XNUL 3VBBA 3WB1A 3PPEA 4XMVA 3WIAA 4UBDC 1FV1B 3PL6C 2WANA 3HG1B 3MOQA 3RGVA 2UUBB 4NNPH 4BIOA 3JSLA 3S3DB 4H5SB 5LGKA 4RVBA 5D2LE 3QJXA 5ESAB 4L9LC 3CH1A 3F64A 4BJLA 2XNDG 5D9SB 2ITDC 1L6PA 3FSAA 3SN6N 3GB7A 2JEXA 4AJYV 3RL2A 2EKSA 1FIGH 1X4TA 2WQXA 4MLSA 5BV7B 3T6WA 4FJYA 2OTJV 3ZBHA 2YGPA 2YLHA 4KDTA 4X9HA 2BIHA 5F9JA 1Y6KR 2FBOJ 4P0DA 3TN0D 1G9NH 3PL6B 1Q0XL 5I76B 1YEHL 5FL7G 4ZW6A 4RIRB 3S4SA 2PO6A 4L9LB 2HT3C 1NMBH 3SKUD 5CN0A 2ITDB 2IU0A 2J12B 4YDKL 3QDGE 5DJZB 1JN6B 5CEYB 2HN7B 4WTZA 5CJOL 3EYQD 2HLAA 4G6KH 4PJFB 4JI4B 1T21A 3KJ4C 1KP3A 5D7EA 2OMWA 5D7JA 4G9FE 1S5LZ 1KFAL 4G8IB 4BH7A 3UTSE 1EAJA 5A16A 4FFWC 3FTYA 2J1ZA 2BSRA 1L9NA 2HT2D 4BFNA 1IC0A 4BQ9A 1RK0B 3NJFA 1JZ5A 1HL8A 3D5OF 1FE8L 1KJ2B 2PW2A 4ONOA 3N91A 3VFGL 5FYLE 4NFBA 2CH7A 1CXKA 4OAWB 3B7UX 2ATPA 3G9AB 3O4OC 4LQFH 3RWJB 5BZBA 4JM4L 3MV7D 3VFSB 4KI5C 1DQIA 5TE6H 4X4YA 4K35A 5FFLA 1LK3H 3DIDA 3KJ4B 3KPPA 4K9EL 4L4VA 1Y18B 1XXFC 3UKMA 2CBPA 2OZ4L 3QJVB 1EDHA 1S72V 4PRPA 4WI3A 1IAIL 2V7QG 2LVCA 4YJ2B 3K2UL 1BOGB 4XNYL 5C9KA 3PV6A 1OGTA 4AE1A 4KVCH 1AGEB 4GJTB 1QQDA 4FZ8L 2FH6A 2HP8A 5DQJB 4YAQA 1UB5A 3O4OB 4A6YB 4HUCA 5JCOA 2V3DA 2F5AH 3R4RA 1PTZA 5IJ9B 2E6QA 2D7TL 2OL3L 1EANA 5A2BA 4KK9D 3LOWA 2IAND 3RYFA 4MKTA 1DF5A 4EZMA 1SFDA 1LEGB 4FLHA 2NR6D 4O2FB 4N0YH 1UUSA 1DN0A 4WY7H 3SJAC 4OGAC 1GZHC 4JREC 4BKSC 3Q1SL 1QSFA 2M7WA 4HHGA 3H1JH 3FT4B 4TV9B 3K08A 1FORL 2EDEA 2NW2A 2EVFA 3JD4A 2Y5EA 1WPXA 4XC1H 4ZO7A 5T3ZE 3JWOL 2C4XA 4WKZA 1HP8A 1NTKH 1OZTG 1T22A 4MW3A 4D9RE 2X0LA 3L2NA 3HZMA 3OWRA 4PV8A 2YPKB 1DQQA 2WZPD 3CMAV 1WS7A 5AVQB 1N6VA 2J1XA 2XPGB 3AQXA 4KQ4L 4JREB 4ODHH 2QGDA 3TBTB 3OBAA 4HIEB 3KGRA 1OD9A 4OF6A 5F9WC 5DEGA 1USZA 2IVFC 5TDOA 2WO4A 4J2QA 2LLNA 2A77L 4BWWA 4OIAA 3LKPA 4JI5O 5FYKU 4WFHD 3PLYA 1QACA 4IGBC 4Q0XL 3T4AA 4F7TA 1GYAA 3NBNA 2ADFH 2I25N 4HALA 1WVZA 5HGDB 3P73A 4M1DL 2DLTA 3RUGF 4U6HB 3INUH 4TUOB 9CGTA 1RVFH 4Y1AD 4LCCA 2VITB 3WELA 3F2LA 2KG7A 1E5BA 1J05B 1EFXD 5F9WB 3WY2A 3FRPB 2GITA 3HC4L 4CS2A 2BOBA 4WEEA 1ROCA 4WCEV 5KG9B 1U58A 3NEOA 5FB8A 3VE0A 4P9PA 5EUOA 2AXWA 4IGBB 3K6FA 2ALAA 3RWFA 2VRZA 5AKRA 1EJ6A 4UT6L 4ZIBA 3SYPA 1AKPA 2BP8B 2NZ9C 1G8MA 3RQ3A 1WK0A 3BH8A 5JHLL 2PYLA 5AB2A 5DDHB 4OTXL 2V17H 1DHKA 1MFAL 1AYRA 4IHJB 3LVTA 3B34A 3BSZH 3QFJD 5KUKA 4U7OA 4N90E 4G42A 5J2UA 3BKJH 5KA6A 2ETNA 1F2QA 3TETA 2ZKHH 1K4CC 5A7EA 4JFUA 1UM4L 2C1PA 2HG5C 2J8UF 4RFEA 1IAMA 1T04A 4B3RO 3ARED 3VYOA 4JDTL 4W9LC 4PJCF 4PJ9A 1NCDH 2UZYB 5CGTA 1L0XA 1RZIB 3DTUB 2A6IB 3FPXA 4Q8BA 1WD8A 1TIUA 4F8TA 4Z76B 4EI5C 3CSXA 5KMGA 3G67A 3TO4A 1D6EB 1OAUH 1K4CB 2OMTB 4L8JA 2LV4A 1KP2A 2HG5B 3UBXB 1DJIA 4HIPA 2CMRL 1ZTMA 3TBCA 1SQBH 3HEIB 3ESNA 1QSED 1XSKA 2G5BA 2JJUA 4U05A 2F19H 2ENSA 4YHOL 4HIXH 3GF8A 3GD1C 3QEQB 3T2LA 4B9YA 4GQZA 3QEGL 5IMOA 3VA2C 1YUHB 2BVUA 1KCVH 1L6ZA 4P06A 3VWJC 3RVUC 4EI5B 1B6DA 4WUKL 4G71B 4HMCA 1A9EA 3FQUA 3NFSH 4OCSH 3VI4F 3B5TA 2DJ4A 2E74C 4NUJB 5DUPL 1MCNA 2OTWB 1N0LB 1Q1JL 4QF1B 4LKCB 4NM4H 2H2SC 3RUGB 1ZHKB 2WN2A 3BUQA 1ZSPA 4LFHG 3OMZA 4YHZL 1Y1DA 4PRHD 5DJ2A 4E9LA 2BZDA 2UXDB 4QO1B 1S3JA 3LQAH 4X5WB 2VZSA 4LKXB 3IJ7A 3MCLL 1U9KA 5TDPB 3VWJB 4IK6A 4NKMA 4JR9L 3T0EA 3MD0A 1PDKA 2ARWA 2EXWC 2VL5A 2X2JA 1ZEAH 3GGWA 5DN6G 2V6HA 2BIQA 1BGXH 1CO1A 2NT1A 2CBQA 3OX8A 1KG0A 3OZLA 2E74B 2G75B 3MLTB 2RQ8A 1F41A 2VZTA 4AEIL 4WDIA 3WUWA 1QZNA 4H8WC 1XDCA 1TZHA 4L2LA 4N9OB 3TCUA 3TYGL 1G1XB 3WB2A 3WNIA 4H8PA 1TYJA 2D0FA 3E6HB 3VD5A 2DQEH 3C5SA 4M5TA 1KN4H 4NFCA 4EQ3A 1KXQE 1DSFH 3DXRB 4KJWD 4P2RE 1ZX3A 4HLJA 1ACYL 3MI6A 4K7FA 2AP2A 4FFZA 3PGFH 2NXYD 1AIFA 3CD6V 2CDEA 1FHNA 2J8UB 2VDNB 3BQUC 3R7QA 1O6VA 4E9RA 4FLTA 3G5ZA 1KGWA 4F7EA 4LH6A 2YARA 4PJCB 4A7SA 1MUJB 1BMWA 1US6A 1GCFA 4U6TA 1AKJB 1IQDA 4LF6B 3W9EB 3GDBA 4KZCA 1N8RW 3AB0C 3X3GL 3CJHA 4YH6A 1EEQA 1TKWB 3FQTB 5I6XC 1OLLA 4XP5H 2VABB 3BJ91 5EF2A 3OMNB 1DL7L 4OFDA 5I8KH 2VQEB 3ECBA 1WAAA 3MA9H 3BDYH 4L2YA 4C83B 2OMNA 3BQUB 5D2NA 5KVGL 2CPCA 2XA8L 4EOWH 4BQ8A 2H8PC 3STLA 3UJTL 3GMQB 4Y19D 4DT2A 4L3AA 4GW1A 3B2XA 1QEXA 3AS1A 2UU9B 4L5FL 3ZL4L 5GZOD 3BEVA 5K1NA 3AB0B 1FFRA 3T2NH 4WNSA 4CBPA 5KVDH 1KCUH 5I6XB 4FLRA 4XHJC 3RWCA 4I9QA 4MQ7A 5K59E 4XPAL 3TU6A 5LP6C 4OJFH 5DMKA 4I48B 2ESVA 4HUUA 3G6DL 4LSQH 5E6IA 3VI4B 4AL8H 4NNYB 5HP5A 4CSPA 5EIBD 1GA2A 4E41B 1FHGA 4QOKA 5I17A 4CS4A 1CFQB 2H8PB 5JIQA 2R29L 3G6EV 5TGBB 3QCVH 1CL7H 3DARA 3G6JE 4JFVA 1KIRA 4JY5H 4M5ZL 3WS3B 5I8CA 1PX3A 3BGFC 4XWGH 4NC2B 2VZ1A 1P7KA 2OL3A 3L75H 5LP6B 3WNLA 4JRWA 4H26B 1WGOA 1R6KA 2IQAA 3KLHD 1HHKB 1JXFA 3RGBA 3BEHA 4XZUA 4MNQA 4NO5B 3KG5A 3MUJA 3QHFH 5F88B 3HZYA 4TN9A 4JJOA 4L3EA 1Z9NA 3MJ7B 4MX7A 2WUBL 3CK0L 4G8GD 1FZKB 1CE6A 1UA3A 4PV1C 5DS1A 4QLWA 3ULUD 3BGFB 1MCCA 1QHOA 5GGVH 1DQTA 3NN8B 4GB9A 1YAIA 1P1ZA 3RGVD 5TFSH 3BCFA 1A3RH 4NQEA 5J9PA 5L88L 3WEOA 4X6CE 4B6ZA 4HJGA 3ZCCA 4P23D 5GISH 3WHE0 3WFEH 2Z4QA 1Q90A 2JELL 3UP6A 3DVGA 5JWPA 2WXGA 2MFNA 3CC5B 1G7IA 1XGYL 4K8RC 3VH8B 3HVDA 1SF5A 5KBDA 1N4XH 5HI5D 4ZFFB 4PV1B 5DVNA 4B5ZA 3K81A 4KU1A 4HS8L 1VQ6V 1XAUA 4UV8A 3U25A 2OWOA 1T20B 3KLKA 4O02H 3MTRA 3DX6A 2NQ3A 1TJXA 3CRQA 1JGEA 5AZEH 2PO6D 1A7BA 2QQKL 2VKWA 2KLRA 4M4RB 3M8AA 3VD7A 4X9QA 3SYOA 5H2BA 3S3BB 1XQ8A 4HA1A 3VGFA 3ZZ1A 4WI2A 3H56A 4LFCO 1Q0YH 1AR2A 1RFDL 1HINH 5HVWA 1NGZA 2EVJA 3TH3T 2XZCH 1JCVA 4YXLH 5FNVA 5F8QC 4I77H 3H4FA 4JDZB 5EZIH 3CQQA 4LLAA 1Q86W 4O58H 1GC1C 3VM5A 3U1SL 2Y1YA 4UT6A 3VQXA 5C0CB 3HNTH 2EUWA 1WBZB 4X98A 3VXUD 1GGIH 4R4NC 5F93C 3ASOC 4MZIA 4F9PC 2CO3A 2BTQB 2NY1C 1L7IL 4L4VD 2ZUUA 3BABA 2ADYA 5T1LA 2ROXA 2XHNA 4PRPD 2ADPA 3KL3A 2NN4A 4OZHB 2BNUA 4GSXA 2JEUA 4LFBB 2AMUA 5ID1B 1DZ0A 4HISA 3A4FA 1FL5B 3II1A 4BFEA 1RZPA 4P05A 2Q7YA 4RA0C 1B0GA 2J20A 3NP3A 3ASOB 2QZQA 2EZ0C 2ZYHA 2NY1B 4AQ1A 2GW5A 1WNSA 1FNLA 3RG1C 4K73A 5C0BB 3KPRE 5I1EL 5HY9B 1DVZA 4X7SH 2A9NL 2O5XH 1A25A 3UG5A 5DA0B 3VGHA 2HRPH 4MVQA 4I13B 2WSSG 3M7FB 4IHBA 1QSFD 1U21A 3FTXA 3FU5A 3GJEA 1BIHA 3C6LA 3LDEA 4LBAA 3LZFH 1GVIA 3PWNA 1AXTL 3E8VA 4NLHA 2IADA 3L6FB 3IVKA 1YZZA 1K6QL 4G6FB 4D0BB 3VXQA 3A47A 1N5YL 1MCRA 4DP1X 4XBPA 3RWIB 5ISZD 3FKSG 1I9IH 2GG1A 1PZCA 3BI9X 3JYBA 4DSYA 4XB3A 2NQCA 4YLBA 5EU3B 4P9HH 3RDTA 2X0WA 3D25A 4P3WA 4PP2A 5DMGC 3BP7B 2ZF9A 4YE0A 1TTBA 1A7QL 3SPVB 3HKCA 1MJ7H 1JHTB 5F7HA 2AQ3A 1DQMH 4Z2WA 5ACZA 4PELA 2HTLC 3NSDA 4JI1B 4Z7NF 4CS3A 6TAAA 1A7OL 1XCTB 5DJXA 4XXCA 2H3XC 1QFWM 3H9HA 1NVPB 1WA8A 5KSAC 1QHQA 2Y1AA 3QDJA 1R34A 1G6RB 1W72L 3PV7A 1KC5H 4TNFA 4MJ5B 5EOCJ 1M05A 1HIMH 1U8JA 5DQ9B 1A1MA 1UZ8A 4S0SD 3DECA 3T65B 1KLUB 3HAEG 3WNMA 1JERA 4XO4A 1YITV 5LA6B 1LO2L 2WLJA 1UCBL 4X64B 2E9BA 1BAFL 3GSNH 3T3PF 4A2GA 4F1SA 2FEJA 3K5SA 3RYMA 2ZSWA 3DNKA 2WWMC 5KSAB 4G7VH 1JGDA 3BAKA 1KWGA 1DUYB 1VGEL 1WA2X 3QUXA 3L4CA 5E8EB 3TNMB 1KV7A 4EKXA 3T1FB 1E8XA 3KW7A 5CIPA 5AYUH 2HKAA 2AEIT 5I74C 2O5NA 1INEH 1AS8A 4JGJA 4U6YB 2CIIA 3FTZA 3QUKA 3T8MA 3WHE1 5ICXA 2E7LC 4A7VA 3G04A 1JNHA 2CTRA 3CFJB 3V4PA 4N5UA 3GM0A 5DMIL 4X89A 3TJTA 3LS4H 3TN0C 2BP0B 2EZOA 3HLAA 3I3BA 4PM1A 1G1YA 2AJZB 4M62H 3SY6A 1OWRM 2FLMA 4M6AA 2X4TA 2V0AA 4DP9X 1GSMA 5TE7H 5CWSB 5CEZD 3QQ4A 1QBML 4J3UA 3IC9A 3H9ZA 4PJEF 5I74B 1E9PB 2BSSB 5GGRY 1Z9SA 1CEZA 2R2BA 5D6DA 1SDDA 3EYQC 2X4OB 4HHWA 3QIUA 3CRAA 4ODVL 3VFPB 4LGSB 3OGIB 2QSTA 3BH4A 3TN0B 2AHZA 2L7JA 2VDQH 1U96A 3ESPA 3SZKC 3VFUB 2AW2A 4ZUUB 2HT2C 5JLZB 1K85A 3AW5A 4HCRL 4RQQA 4LAJH 5T3XH 5AYQA 1KBWA 3CFEA 3N44F 4N28A 2WPDG 2K78A 3D07A 3MLWL 4XNQB 1JYWA 2RN9A 3LZPA 4Z7NB 3AT0A 4LPCA 4WSJA 5B1JC 2I69A 1NFIB 2V3FA 4FNLH 2AJYH 1HHIA 4MNGE 1QKZH 1FO0L 1A66A 2V2WB 2VDOH 5IHHA 1HNWO 2ID5A 4FADA 4MB5A 1MZEA 1JZJA 1NKDA 2NTSP 4PHXA 4DKFH 3BD3A 4TTGA 2WLHA 4JQVA 5FXCH 4EDXA 4WWID 3KR3H 4ES8A 1AXSA 4OF3A 1IBKO 1L9RA 3EJZD 3T3PB 4X50A 3IJEA 4BYHA 4OU3A 1AIZA 1JNLH 1HZHH 4KY1L 1RIHH 4BBWA 4X6DE 4M9PA 5DD3L 1FLRH 3EH5B 3I84A 4K7PL 2VLJE 3NDZE 2FD6L 3FQ2A 1C12B 2FSEB 4JO5A 2RTTA 3WTYA 4NYLA 5BPPA 5C08E 1N0NA 3FU0A 2LLGA 4I2XB 3WNKA 2UY6B 1K2DA 1BBDH 1ZT7B 2E7MA 2D2OA 1FNEB 3CFMA 1SLXA 2IANB 1E6OH 2J7LA 3QQ9D 2X88A 4PRBA 4WCYL 1PZBA 1UVQB 1AJPA 4POUB 1SLWA 4Z78B 4NM8L 5IMLA 4Q97A 4B50A 1TVDA 1HH9A 5CHNA 4AJWA 3K1KC 1QASA 1AI1L 3X3FH 4PJEB 2V5RA 4ZSOB 5JNYB 3WD5H 4ADIA 5JQ6H 3OLGA 4OJEH 3HAEA 2QPDB 5IWAB 3F7PC 3GMPB 5CFAA 2XV3A 2BHYA 4LP5A 1NSNL 3U4KA 5D5PA 1UENA 4JFSA 3CHOA 2ORBL 4L87A 2QVFB 1XD1A 5IBUB 3HJEA 5HDBF 1E42A 5DO8A 2H26A 2CLRB 2FEEI 1AZCA 4AH2B 1BMGA 1L0NH 3M7OA 3CVCA 5IUSA 1K33A 2CG9X 4P2CG 1OB1A 5BMVA 4ZW8A 2ED6A 2XZQH 1CR9L 1TTFA 1VESA 3M1BA 5FWRA 2VJXA 1UT1A 1F56A 2ESVD 1F58H 1QFUH 2W07A 5E6ID 5HGBB 1M42A 3TXSA 1WHOA 4QOKD 4ZS7L 4UV7L 3RJDA 5TQ0H 1M4KA 4I50A 1QWNA 1CGUA 1TZIA 5C0FB 2BP5M 1BECA 1OK8A 2MPAL 4Z95L 4N25A 3NCWA 3NCYP 4Y1AB 4C56D 3EFOA 4TUJB 2XNAB 1OAQL 2NTFA 4JEGB 1S9WA 3UFIA 3P2BA 1ID5I 3HNSH 3ZGIA 1K8AW 1FZMB 4KRPD 4S1RH 5GGVY 5DZLA 1U91A 1MPAH 2B2XH 3BZFA 1ROPA 2CHWA 2CIKA 1UXSA 3KWXA 2GEEA 1F90H 4I8DA 4MNQD 2ZOTA 3QJOA 1GRWA 5I15L 1E27A 1SF9A 3QIBC 3GUTB 4L3ED 1CD9B 1NIBA 4TOIA 4KKRA 3IMSA 4LHJB 1SJHA 1F0LA 2ETWA 4FFKA 3IWVA 3QFJB 3TV8A 2DYSC 5FCUH 2JI3A 1XGRB 3W2DH 3VYPA 4K23L 3WU1A 2IV8A 1F42A 2B14A 4OZFA 4X6CF 5DK3A 1Q90D 3RPIB 1E9OA 4Z7UA 3ILQD 4I0PD 2NLJA 3H6JA 3QIBB 4GP4B 2RBLA 4OFPA 2P4KA 1FL3B 1HEZA 2EC9T 5BRZE 5HXMA 4DGYL 4LFHD 1BF2A 4XN5A 3FUIA 5E2UH 3WNJA 4HDIB 1JPEA 4OH2A 1TQUA 2AQ2A 4YHKH 2DYSB 4BGLA 3RL1A 3GO1H 4O2BA 1L0QA 4HT1H 1NMCB 4LCWD 1J5CA 1TQBC 2EDMA 5G4OA 1Z3GH 1JR9A 4JFOB 2QGBA 1QR1B 2JQMA 2BCCH 3KYKL 2VLLA 2ITEA 3UT5A 3OAYH 3HI6H 1GN4A 3L3GB 1W72A 1J8HE 1QSEB 4OI9A 1IC4L 4QMEA 3II2A 4Y5YC 4PYGA 1CBJA 5LAXB 3OB0K 4I87A 3V55A 4AEEA 3MNWB 2N74A 1PPJH 2WA3A 1W0WA 3GZKA 2X4QB 3WENA 1TQBB 2OQJA 2KBGA 2D2CC 1MFDH 5AW2B 2QLVB 4Z7VF 3MACL 1YY8A 3EDKA 5DRNA 2KSDA 2IEPA 4PJ5A 1FNGB 3ZDZF 4RAVA 2X89A 3QIWD 3NP4A 1XH2A 4PI0A 2R1YA 4PRHB 4Y5YB 5I2IA 1JF1A 1WLHA 2WO2B 3RA7H 3K0WA 4DUZO 4O2AB 4UT9L 1UXMA 2OJZH 2EE0A 3N85H 4YHLL 1AHWA 2WTPA 4IMLB 5T1LD 2JB6A 3VFMB 1N12A 3EGDA 5FUCC 3ARWA 4MTOA 5T3ZL 3ZZLA 3L5XH 2D2CB 1E3ZA 1KGCD 1T7ZA 5HHOA 2VXSL 4MAYC 3ZHKA 2NXYC 3U36A 1TLKA 2CRMA 5B66Z 4A66A 5A2AA 2JVDA 3F00A 1J7VR 2ZXDA 3QJSB 4YE4H 4RSYA 4NB5A 1XGPB 3C8HA 4WK4B 3IDJA 4ZJ9A 5D1XC 3TIDA 1MAML 3QO1B 2P5EE 3T0DA 4LLQA 2J1WA 3QO7A 5JZ7C 1RFYA 1BAWA 3VSQA 4MAYB 4M6OH 3CCQV 1B2YA 2NXYB 2Z7WA 1KPRB 4MD0A 3JWNC 5KX5B 2V4DA 2HG0A 1WEJL 1HWHB 3C6LD 3GJFA 4R90H 3VXSB 4WF7A 1E5ZA 2KI6A 3RVVD 5D1XB 4HCRA 4NUPA 3NK4A 3ATFA 1C5CH 3L3JB 3BEWB 3P4MB 1XMQO 1UFGA 3CX5J 2FL5A 4OGYL 2GQHA 2V9QA 1PLAA 1PX8A 2LVEA 4DR3B 4ZXBA 2AQNA 4WFBV 3RDTD 4HXBH 1S3KL 4TOYL 5F1IB 2AXHA 4G1MB 43CAB 2VM9A 4NOFA 3NPZB 3B77A 5EIBC 1FO0A 1UTDA 3SE9H 4JZNA 1O7DE 4Y8AA 3CDZA 4MTXA 1S6NA 4NQCE 3MNMA 4AYMC 2C9PA 4AVJA 5B4MC 5H94A 4X8JA 5E8PA 1N34B 2YXLA 2XJKA 3NCEB 2HPTA 4NUQA 2JLPA 3LXUX 3W37A 3O11A 1S7UA 3DHUA 3KMDA 2Y48A 4GAYB 4Z7VB 4GT1A 1D5BA 1ETZA 1G43A 4TRPL 3U2JA 3VW3L 4M9OA 5DVPA 4GSRA 2FEEL 3OXSB 5AW1B 3ZDZB 3RWEB 1EZVY 1RJZB 2VL4A 3D18B 3KM1A 2OX5B 2W0PA 2M26A 1O7VA 4BINA 4P48A 4N2FA 4AG4H 3GLAA 3WTWA 3WAKA 4LOUD 1FZOB 3RGVC 2PW1A 1MIML 1N9PA 5TF1L 4LASH 3VVWA 1FGNL 1GAFL 5JIIA 3W7SA 3RYCA 1N10A 3QUXD 5L4FA 2I07A 3CRCA 2VRQA 3I6KA 2ADGA 3LKOA 1QCEA 4O4YH 4TNEA 5BZZA 4LGRB 3DJZA 5L2KD 1U8QA 3P3UA 4IOFD 4F9LA 1D5MB 3GB7C 3OMIB 5IW3A 4TLSA 3MBXH 1A6UL 4G8GB 1H9DA 4JANA 4KDTC 4KK6D 3UTOA 3RGVB 1XZWA 4A7TA 3B5HA 3CUPA 3U9PL 4AMXA 4ATTA 1BQRA 1DBAL 4TPRH 1NBYB 2AEWA 4PN6A 2PO6C 3CH1B 2MTAA 2A06H 4F33A 3GB7B 3B8YA 3RL2B 3EYUH 2EKSB 1IFHH 5C0GA 2MQCA 2JJSA 4HPYL 4XN1A 4BFGA 2AAVA 2XZAH 3DHPA 4QAMB 5D7JC 5F9JB 3V8OA 3QIUD 4UZSA 1L7TH 3ZW3A 3E8UH 3DROA 2IJ0C 2ZF8A 2R0WH 1VCAA 5SWSA 3K8MA 4TQ8A 2M2DA 4OD3H 5BW7A 1NR7A 5FV2A 4PWEA 4NGHH 1HJCA 1DFXA 2IWFA 4NX0A 4GXFA 1J1OL 4DEWA 3CFNA 1I9RH 4UQ2A 5F71A 2P5WE 3BXNA 2EDQA 2HLAB 5D7JB 1T21B 4HZAA 1JDCA 1CXEA 1UA6L 4P9OA 4BH7B 2ZPKH 5A16B 1BM3L 2BSRB 1EFRG 1IBFA 2EH7L 3NACH 3TBBA 1KCKA 2PW2B 4P2ZA 3HUJF 4IOSD 4YSPA 2CH7B 1S77D 4L1HA 2ATPB 3WGVB 4X4YB 3EHBD 2VS0A 5JCOC 3WFBL 1KBPA 4LHUD 2YUWA 3GKWH 4OD2A 4B3VA 5HI4D 3KPPB 4A67A 4UAOC 3PABA 1RZKH 4UV4H 3SKNA 2RACA 5LQBL 3E1ZA 1OV8A 2C5DC 1BZ9A 3DURA 3Q6GH 5EUOF 1NL0H 3VFRA 4YHYC 3FUDA 4G9FA 3DGGA 1IEBA 4PPTA 1EZVX 4U7SA 4DQOH 2GUYA 4R7CA 3PV6B 1OGTB 1SM3H 1XHHA 2D4FA 3KD4A 1QQDB 5E2TH 4YAQB 3HRPA 1KBHA 3K4AA 1HN1A 1YYML 1UB5B 3O9OA 1IO4C 2O93L 4U1SA 2VR3A 4G6JL 2VRKA 2I5YH 2F54E 2VXTH 3BDXA 3NTCH 4LPUA 1B6UA 4PUBL 1BQ0A 5CGYC 5JIKA 5HHXH 4JI0B 2V5MA 5H2FZ 1JL8A 3DRQA 4UAOB 2KLSA 3RYFB 2YKLH 4JK0D 4YHYB 3Q6FA 4JG0L 5IVOA 3W0WB 3BLBA 5E5LA 3LHAA 1T83A 3F58H 1YLBB 1X9QA 1IAOA 3OKMB 1DN0B 3BVWA 3EOTH 3OXRA 3X1BA 2ZR2A 5D93C 5IW6A 5ADPH 1QSFB 2EEBA 4DO2A 1H8SA 4G6AC 4MS6A 2WHVA 2NW2B 3AMLA 4J10A 2ZCEA 1DJGA 4KOBA 5KYNA 5AEAA 4FFVD 4WKZB 1T22B 5DUML 4ZW3A 3ZN1A 3HZMB 4LL1A 4PV8B 3T4AC 5I28A 1DQQB 1GTNA 5L7XH 5FA3A 3LDDA 2HX7A 4MVUA 4PQXA 4PA9A 5D93B 2VJ8A 4FMFA 3NRFA 3EJSA 1O6SA 5CLZA 3FK3A 2K6WA 3SQOL 1GK9A 3HKBA 5DEGB 3Q13A 2YRLA 3MLRH 5TDOB 3QQDA 2BOBC 4A7GA 4G72B 2DQIL 4UT9A 5EO0A 4I9XA 3LKPB 4IW4C 5F0PB 1FIGL 4F7TB 3T4AB 3ZYJA 2X7RB 3DXAD 3P73B 4V2CB 3HUJB 2ZAGA 4FLUA 3IDIA 3LRMA 1G9NL 1T3FA 4UT7L 2XBZA 3LRHA 2KG7B 3QXTA 1DJXA 2PYEA 2GITB 4W4NA 5FM8A 2BOBB 5CZXC 4CMMA 3U0ZA 1NMBL 1YNLH 1U58B 5FB8B 3VE0B 5KVFH 3QWRA 3SDCD 2OTLV 5EUOB 1KQSU 3RWFB 3V4UH 4G6KL 3RHWK 4ZMTA 3L3KB 1KLFA 1QRKA 3FB8A 3T2QA 3IJHA 5HHQA 3RILA 5I6OA 4PJ9C 3ABTA 3S5LG 2CU9A 3LIZL 4BWUA 3WYRA 4IBQA 3OF6A 2QVIA 2ADJB 2ZCKL 1R3IC 4PJ8D 2EUVA 1U6AH 1J87A 2R39A 4X6BA 4FCHA 1TETH 5J2UB 4G42B 4QGTA 3DO7A 4PRDA 4LQFL 2HFFA 3TO4C 4G43A 3BT2H 4N2HA 3SJQC 5TE6L 1LK3L 2C1PB 4RFEB 1J11A 1JTTA 3DV6A 3QJQB 3VDCA 4DQAA 4PJ9B 1TEFA 2VN6A 4JPSA 2BLFA 2FH8A 2LW3A 4E9WA 5F7EH 5C0RH 1FAIH 2ZZUT 4JO8A 1HCYA 2WGNB 4KVCL 4DFIA 2PP9A 3EDJA 3MNZA 3NMEA 4DV6O 4JI8O 3RU8H 2PF4E 5KMGB 3TO4B 2C9QA 2YFNA 1PL3A 4LIQE 1H3VA 3OQ3B 1VKXB 4ZI8A 5D5MA 1WAAF 4MZ3A 3VXME 3TOPA 2GSIA 2PABA 3BZEA 1E1QG 4NAJA 3BUBA 5LBSH 3W5MA 4YR6B 1FH2A 3ZE0F 2G5BB 5IEKA 3BZ4A 3F01A 1UXLA 4M7KH 2BWQA 1E5YA 4GX5A 3C2AL 4GPVA 3Q8CA 2SEBA 5IMOB 4A39A 3ARFA 1WBXA 1MDTA 2LABA 2YRZA 2IH1A 4N0YL 4WY7L 3T0EC 5JTWA 3EJZC 4E9YA 4KH2A 3AGWA 5ANMB 1A9EB 3B2EE 2MEJB 3ZOAA 3IFNH 3J7AU 4JV5B 3BFOA 5JHMA 3RJOA 4PJ5D 4XC1L 1TR7A 3UROR 2X89D 2YAPA 5DJ2B 5HHNA 3Q8BA 3H55A 5KVMC 4ZOLA 12E8H 1LTXA 3A6BH 1W0VA 4NUGH 3AY2A 4NKMB 2D9QB 3T0EB 3VX1A 1PDKB 2VL5B 4ODHL 5BOZG 1A5FH 1RP9A 2D7NA 1YJ9V 4IIJA 5HHOD 4BIZA 3I50L 3OX8B 1KG0B 1U30A 5KTEH 4V33A 3QQ9C 2ROYA 4L1TA 3AAZA 4PTUA 3N6YA 3PUUA 4WDIB 4X9BA 3WUWB 1A6AA 1TZHB 2GYSA 1XD0A 2GIMA 3UYRL 1XFPA 3TBVA 3ZDYF 1K8DA 4YO0B 1JZGA 3C5SB 4DK5A 2NR5A 1G9MH 4BE6A 2W92A 3L3OA 5CSZA 4HZ3A 1RVFL 2VZVA 5HDRA 1DUZA 1X5IA 4NKOA 3D8MA 4DP2X 3QEUA 4K7FB 3KCXA 5LYJA 1F4XH 1KLGA 5JMOC 2BZCA 4YDNA 3CCRV 3BA9A 2CDEB 4BKLA 4YN3A 5BR8O 1INDH 4QD2E 5HYQA 5D2NC 4P57A 3ET9F 3G5ZB 4F7EB 3STLC 2JWYA 4IHOB 1FXKA 2X6UA 4QRPE 1B4LA 2YD8A 3CJHB 2WMPA 2ZUVA 3O45A 4F57L 2JJVA 4K71C 1NDMA 2V17L 5KVEE 3BKMH 3FFCD 4ZOCA 3BSZL 4K9EC 1ZUQA 1HR0O 2VWEC 3BKJL 1XILA 5E6IC 5D2NB 2XWCA 2XN9D 4K2UL 1TTUA 1FFXA 3ZE0B 3STLB 2YBRB 3U4BH 2ZKHL 1OAYL 5C8YA 4GW1B 1X5HA 3BEVB 1P49A 3S5LA 5JW4R 5KSBE 1Q9KB 1W0YT 2CCLA 4K71B 3BN9D 3RWCB 4MQ7B 4LLYA 4MJ4A 3ZKND 3FPYA 2DH3A 3NZ8A 4KRPC 4V1DE 5C7ZA 4DERA 4GRLD 4HUUB 1H6FA 5E6IB 4PJDA 4KJQD 4OW6A 1CI5A 1XGTB 5I17B 1V3JA 4QOKB 4QJ5B 4WHCA 3DMMD 5GTHZ 4XO3A 4K3DH 1CYXA 2DWTA 2RJMA 3HG4A 1C1EL 1KIRB 4FG6D 4RBPK 1UOLA 4LOEA 4CC5A 1EMTL 4XOAA 5B22A 2OTPA 5I8CB 5DVKA 2FWLB 2CJTA 2P6JA 1E1RG 4HIXL 4UOZA 5JW5B 3S98A 2OL3B 4KRPB 2LU3A 1WRFA 1Y0LA 5J9PC 4TLTA 4O4HA 1KCVL 3ZK0A 4C57C 2IQAB 3JWOC 4I5SA 1JXJA 2IXQA 1T6VN 3V9FA 3ILQC 4DPBX 4XZUB 4B9JA 1HKFA 3NFSL 4MNQB 4OCSL 4Z6AT 5M94B 3HZYB 2K1EA 1ILUA 3ZDYB 5C0AE 4UQEA 4L3EB 4MX7B 5LXGL 2P46B 3H1IH 4K8XA 1CE6B 4P5MA 3CFUA 1WJZA 1ZCRA 1FQ9C 1P1ZB 1BJ1H 4X9YA 1MCWW 3LQAL 3SCMA 3V0DA 2ICWJ 3ASNB 1MXGA 4NQEB 5F1OB 3ZUCA 5J9PB 3VFTA 4R26L 4HJGB 4PJAA 4X0NA 2Z4QB 4YSTA 3HCVA 4QXTA 2AABH 1ZEAL 5F6HJ 3DVGB 1RZ7H 5ITZA 1LWJA 1N8OE 2F4VO 4DK6A 4JO1H 2E8YA 2YSSB 1I7ZA 4Z77A 4WFAV 2VB5A 4ONHA 1JZ8A 1SMDA 1UT9A 2G9HA 4HCGA 3DX6B 4XCYA 4ALAC 1JGEB 4H7VA 2DQEL 3MO1A 2FQFA 1JMKC 2NW3B 5KS9A 1DSFL 1X4XA 4XE0A 1SKVA 4PBVC 5K5YA 2JIXA 3EXJA 4AQAB 1BZKA 5E24E 2Q67A 3PGFL 4OCXH 1ZLUK 3VXRE 5H2BB 1P1VA 3LEVL 2O6EA 3HIZA 1FN4A 4PBWD 4NZFA 1MMMA 3NXSA 4F2EA 4J2XA 4MYWB 3BZ5A 2QTOA 1GKEA 1NGZB 2DMBA 4L8SA 1EZUA 3ZDWA 3MUHL 1J5OL 5BY1A 5FNVB 4GYBA 1HHGA 3B2VL 3FQNA 5L3DA 4XP5L 1M93A 4XMTA 2NY6D 1A65A 3LN4A 5I8KL 3IGKA 3MA9L 4X98B 1D5AA 2XI9A 2YA0A 4UYPA 2WLIA 2F5BH 4GEIA 3FZUC 4L3FA 4A63A 1WBYB 4AQ1C 3LIZA 4EOWL 2E4TA 5T1LB 1EHXA 4K07A 4ELKB 1MHPL 2CHNA 5DJAA 1T89A 4G9FD 2BNUB 3SGDH 4YHHO 3ELQA 1WO2A 5KVDL 2G2RA 3T2NL 1KCUL 2EXYC 3E3QC 2P1YA 5TTRA 1NJ9A 3DSFH 3GINA 2FATH 2Q7YB 4HJSA 3L2LA 3C6LC 4RMBA 3L08A 5C71A 4X1KA 3RVVC 4AQ1B 3P9MA 2P3YA 4JPRA 5TJWK 4OB5L 5F9OH 4UTAH 3CDGA 4C4KO 1CL7L 5GRXG 3HRZA 3MCG1 3VQ1C 4ZAKA 4WNJA 3RDTC 3G4SV 3RAJH 1F3JB 4NCC2 2ZP0T 4F3FA 3VD3A 1EBAA 5BOJA 1IC1A 4HLZH 3C6LB 1ES0A 2GBTA 3PWNB 4EBQH 5IFJA 2NXZD 3IVKB 5KHJA 4RGOH 3RY6A 2X41A 4XTRD 3VXQB 4DPAX 3QHFL 5HTSA 3T77A 3RVTC 4XBPB 4XXCC 4TSBL 3WFDH 1AGFA 1FSKC 3DPDA 1SUHA 2N7AA 4NERA 4Z1PA 2IH9A 5GGVL 2CO7A 3RDTB 5JR1H 2IPUG 3D25B 1D9KC 3O8XC 3T1CA 1M71A 3NIDF 4NC0B 5EORH 5EOTA 5TFSL 5IEHA 2BY1A 3KPSE 3HKCB 1D7CA 5HJBA 3DKHA 5ACZB 3LXBA 2YWZA 4U1LA 1T7WA 4X5QA 2QKIA 1CZ8H 2YUVA 3L13A 1KUMA 2K3HA 5DJXB 2I9TA 4ZX4A 3QJZA 4F15C 3H9HB 3FT1A 1N4XL 1FSKB 2BINA 3V0HA 1WA8B 1OD7A 5T3ZD 2BX5A 3QDJB 4M48H 4LNUB 3MLZH 4NBYB 1D9KB 1ESOA 1M05B 3O8XB 1U8JB 4N4YB 1ML0A 4N8VG 1A1MB 1UZ8B 4O02L 4A68A 4QRUA 2LLLA 3QUXC 3ROLA 1BJ8A 4CC0A 3V7AG 1PV0A 3FYEB 1ZPLA 5AZEL 4IOFC 1M2VA 4F8QA 1XDTT 1H2MA 3B83A 1V7NH 2CO4A 4ZOAA 2LFGA 3QG7H 2MNUA 3QWRD 1OGAA 3JT2A 4UQBA 2YKKA 4F15B 4PRIA 1PVHA 4KK6C 1UM6H 2PWFA 4D94A 1SVCP 1JGDB 1QMUA 4HKZB 2FWSA 1Q0YL 1HINL 5IVXF 1YVWA 1B0RA 1EHAA 4AEFA 5K9QI 3QUXB 2XZCL 3OF6D 4YXLL 2GUOA 4I77L 5EZIL 1E4HA 5CIPB 3SE8H 1Y74A 3T4DA 2CIIB 3KXFA 3EBHA 1ORSB 3NDYE 3QUKB 5ICXB 4J27A 3G04B 4Y4FA 5D6DC 1G7HA 1JNHB 1YTFD 5H35A 3V4PB 5KJRH 4WZ9A 2EJ7A 3QIUC 1NFKA 5JORA 2P26A 1UWFA 1E4KC 1U95A 2B1AL 3HLAB 2VWJA 3LNDA 3P3NA 3GIZL 2X4TB 3BSZA 4DAGH 1OAJA 5I1JL 2BWIA 3AXHA 4XP6H 3QQ4B 4GUNA 2UX7A 4H8VA 1WCQA 2C3VA 2PXYC 3U30C 4PBXA 4NCDA 3UZEA 1IX2A 4TM9A 1A22B 4QTIH 4TMPA 2GTAA 1CI3M 2R2BB 1JNJA 2ENQA 1SDDB 1KU9A 1ZDSA 3CNKA 3GXIA 4ASUG 4N90D 2WWWA 3QG5A 1ZV2A 2TRYA 3QIUB 4LB8A 2X7LA 3VI3E 1KTDA 2DQGH 3IXAA 2QM4A 5BVJA 3NIDB 4RQQB 5ECGA 3SBPA 3B9VA 3CFEB 5E9DA 2O5XL 2JJTA 1HI6B 2BE3A 2PXYB 3U30B 2YPLE 4JQVC 4FA7B 2B3RA 3CFQA 1VZGA 2HRPL 3EHBC 1HXMA 2J6EH 4DN3L 3NJNA 2CBMA 1Y1UA 2DWEA 3QPQD 4HK3J 5CZKA 3TV3H 4YXWG 3ZRWB 4K3GA 1CLOL 5GGRA 2ZUSA 1RPKA 3PIQA 4KVPA 3U82B 4HOZA 1PL0A 4N23A 1DCLA 4EDXB 3PWPE 4GOSA 5EIIG 3EHBB 1AXSB 3OGOE 4F2MA 2O61A 1GKFA 2VWKA 3IJEB 5GS2D 1MJ7L 3VUAA 5A2FA 4CJ1A 1BF5A 5FW6A 1DQML 1GJIA 2J5WA 4BH8B 3H1ZA 1UD6A 3MRHA 1IBDA 3L4TA 5IVXB 4MNGA 4AK2A 5A2JH 1O9GA 3GRWH 4DZBA 4JRXE 5E51A 4TKWA 3VACA 1YDXA 3MDJA 2OMVA 1JV2A 1KBVA 1HIML 3CSGA 4DR5B 3MSPA 5EEXA 1CF1A 1Q7YW 5CLTA 3PREA 5LMUO 4X6EA 4EUPH 4PGDA 4PRBB 4FFVC 1YEGL 1XNQB 3GSNL 5AALA 4Z7UF 1JGLH 5IMLB 1RMFH 4Z7OE 1HH9B 4G7VL 5CHNB 5F6IC 2W0XA 4N8VA 4OFYD 4KVNL 3A0RA 1TZGH 3EJPA 5FUZH 3X1GA 5IG7A 4PIBA 1RM1C 3CVHH 3HAEB 2R83A 4K5LA 4P2RD 4H33A 4TT3G 1CDJA 3QI9D 5AYUL 1OP3K 2HKFL 1INEL 3IPFA 3WUZA 4JE4B 2CQVA 1XT5A 4QY8A 4LH7A 4JYAO 2H26B 4AUJA 5F6IB 2ZICA 3ZYZA 4MMXB 4M62L 1RM1B 5BMVB 1OB1B 3NYKA 4FEMA 4KX9A 3EDEA 3S35X 3M1BB 4LHQB 1MDAA 2ZCLH 4K94H 4CU7A 2W07B 1BM7A 4YLCA 4I50B 1TZIB 3O2WH 3FL7A 2NQDA 1NEZG 4R7NA 3BKCH 4J12A 2D7PA 3FT0A 2VDQL 3EFOB 3EOBA 3A4DA 4UILH 2A9DA 4M7ZC 4ORZC 2W9EH 3KBEA 1S9WB 1GPOH 3RNQA 2F8OA 1QFPA 1VFMA 2AI0H 1U91B 2XN1A 1IXMA 3BZFB 5IBLD 1A21A 3HI5L 2CIKB 4KV5E 1Y67A 1UXSB 2C3GA 1GTFA 1QVFU 2NLJC 1MLCA 2NNFA 4FNLL 1FG2B 1E27B 1NCWH 2KYIA 3HBZA 4A7UA 2CBOA 1GZPA 2VDOL 4BFIA 4M7ZB 1QR8A 1UKTA 3V6FA 2P52A 2CLVA 4HAMA 4FQIL 4OGXL 2B9ZA 3SCMD 3VRLE 4DKFL 4PVBA 3IFLL 1A6ZA 4OZFB 3QE5A 2JKXA 4BRVA 1ACCA 1E9OB 4Z7UB 1F02I 1HZHL 1S0VA 2NLJB 2HTKD 1GN2A 1RIHL 3FQ1A 4WI9A 3FTGA 1HEZB 1ZE3C 1NZ6A 2O6FA 5FA4A 5HDLA 5BQ7A 1K92A 1FLRL 2DM2A 5C2UB 2FYYA 3UTPE 4JCLA 5D55A 2BNRE 4O2BB 3H7BB 5EIIA 3BFWA 4PJHE 1P9MA 3QCTH 4GMSL 4XXWA 1L3NA 5KBMA 5HVHC 2JIXD 4AIZA 1T5XB 4XN2A 2YS4A 3UT5B 1BBDL 2VMEA 4RRPG 3QDME 2EDWA 4CW1A 1W72B 1E6OL 1MSWD 3E89A 4GINA 4O02A 5ABZA 2WAMA 2MIZA 3OZ9H 4GS7C 5BRZA 1AHWC 1R33A 4QTFA 3TXQA 3S5ZA 1W0WB 3L73H 5IFAL 3I02A 4K3AA 2OQJB 2VXUH 3X3FL 1QI4A 3OLIA 3WD5L 4J39A 1RUML 1VA9A 4DGIH 5HVHB 5JQ6L 4P5RA 3VGAC 3BAJA 5AVTB 1GMIA 1YY8B 3NABL 3QUYA 4U1IA 3AFLA 5DRNB 1VZHA 1XF1A 2C9SA 1BD2A 5AW7B 2D7QA 1BVLA 4B53A 4EIUA 4NHUB 4RAVB 5I2IB 2ZKOA 2R1YB 4P3CH 4APQA 2DQTH 1KYUA 4GS7B 1J8HA 3LIUA 1AHWB 3OV6A 1M7XA 1YECH 2JB6B 5I0XA 3EGDB 3JVGA 2IG2H 3EGSA 4AYFA 1MQ8A 3WGUB 3FN0H 2K70A 2E3VA 3VGAB 3U36B 1NOAA 2XZQL 4W81A 4GEJA 2N59A 1VQNV 2WXIA 3V6OA 1F58L 1QFUL 1ZHBA 3BKYH 4OFQA 5C6TH 5JJNB 3IDJB 2GI7A 3TIDB 4GUQA 2YBGA 5TQ0L 3NZSA 3OLDA 4LLQB 4Y9BA 1KJVB 2NX5E 3FUFA 4NHCH 1F13A 4L3CA 3Q05A 4ZAKD 4ZXBC 4TUYA 1RJCA 1HH6A 3CXCU 2VDKH 3D39E 2H3OA 3TF7C 3HNSL 4RGND 3PP3H 4ZX3A 2YD5A 2Q2LA 4S1RL 2PTVA 3GJFB 1TSRA 4MB1A 3C6SA 3F7YC 1MPAL 2B2XL 3UQ8A 4KK8C 5FC9A 5I1GH 3GXFA 1J0JA 3JAMN 4FTVE 1NEZA 1F90L 3TNNA 2YIDA 1B90A 5INDA 1IAIM 2FL5B 3JWDH 4ZXBB 5FYJH 5D1QA 1C9SA 2X9XA 3KPRD 2AW9A 3B09A 2F6AA 43C9A 3T3MB 1OALA 4DR2O 5ACMA 4RMRA 1HWYA 1CE1H 3F7YB 4ISVB 2Y36H 4JZNB 5A6MA 4UF7C 4N0UE 1MCOL 2GBVA 3CDZB 1AR1D 4R8CA 4JDEB 1NGYB 3LKSA 3ZL2A 2QHLA 2EO7A 1MH5A 5H94B 1RAMA 2ZNWA 4X8JB 2XLLA 5E8PB 3CJJA 2HCZX 3BLKA 4PLJD 1GN6A 4R4FH 3DWTA 1QPKA 3QNXA 2B1HH 1S7UB 1OSPH 4EKWA 3O11B 3OVUB 3TJPA 4YHKL 4ZW5A 1FNHA 3IGUA 1D5BB 1ETZB 3GO1L 3QVAA 4YQXH 1WSST 1OP5H 3CE1A 2Z65C 5B1BC 1S7VA 1X5JA 4F9LC 1BEXA 4CNIA 2C9XA 3NH7L 4OR1A 3HI6L 1OGAD 3WY3A 5DLML 4PRID 2DM4A 1IIIA 2P90A 4LIQL 3TT3H 5JVDA 1P5VA 2H1PL 4NZTL 4YDMA 4NO2A 4AYDC 1KTLA 2PW1B 3D1MC 4UQCA 3WKPA 3C5XA 4GRWH 4WFEE 1IILE 4JI5B 3RYCB 5BZWA 5C1MB 4JN2A 2P43B 1T7VA 4M8VA 2I07B 2J1KA 3LKOB 3I6KB 1BJMA 2ADGB 2VMCA 1M9NA 5B1BB 2WJ5A 5HD8D 3GSNA 3V5HA 4F24A 4GKZA 1MFDL 2VXVL 4OM0H 4XH2A 4RRPA 1W0JG 1FYJA 3RE0A 2UXCO 2JJSC 4Y4FD 2XVKA 4JANB 1YG9A 5BS0E 4LOFA 1DTOA 3S37X 5T5NG 4H20H 4NQSA 3RA7L 2ZR3A 3HNVH 5KW9H 2E86A