1OCOB

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocoB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocoB02
2PPDA 3MX0B 6PAZA 1MZZA 1A4CA 5AFAA 1BQKA 1JZIA 1L9PA 2IH9A 5B1KA 2DV6A 3QQXA 4GXFA 1OCZB 3IE9A 4KO9A 1QNIA 3GXUB 4KO7A 4HCFA 2XV3A 4BWWA 4YSOA 2JXMA 1T5KA 2DYRB 1ASPA 1BQ5A 1W6WA 2GC7C 5B7FA 2YAOA 3AG2B 1XB8A 5ANHA 3NYKA 1AR1B 5FC9A 1PZAA 2PCFA 5TK4A 3AY2A 1OE1A 1FWXA 1PY0A 4YVUA 1JXGA 2YARA 4A2FA 3EHBB 3ASOB 2CAKA 2DYSB 4E9SA 5F7BA 4HAKA 1JERA 2YAHA 3PAZA 1PLAA 1JXFA 2UXFA 3JT2A 2ZXWB 1V55B 4BWUA 2UXTA 2XV0A 1TKWA 3QPKA 1JZFA 2XWZA 1CYWA 2BW4A 2P80A 1FA4A 2HX7A 1OCOB 1AS8A 4A2GA 1TEFA 5I6LA 1KCBA 4HIPA 2XYBA 3ERXA 3NSYA 1AG0A 1JVLA 5F7AA 1PNDA 4AKPA 3FQ2A 1TU2A 1SDDA 2EIJB 1DZ0A 4ZK8A 3DTUB 4QKTA 2YAEA 1KCWA 2IWFA 4G7SB 1J5CA 3NJHA 1MG3C 2CBPA 2I85A 5I5MA 1J9TA 2HXAA 2J55A 3FSZA 2Q9OA 1L9RA 3T6XA 2HX9A 3TBCA 2J5WA 4E9RA 3NJGA 1OF0A 3PCYA 4W1TA 1A4BA 1PF3A 2GC4C 3WNIA 1ZV2A 1RZQA 1V10A 1SF3A 1ID2A 3PAVA 2HRHA 4N8UA 1NIDA 2AZAA 1URIA 1V54B 1BEXA 1WA0X 2B08A 3V9CA 3WKPA 3QJTB 2GIMA 1RCYA 1ASOA 2BZ7A 3CDZA 3X1EA 3ABGA 2MTAA 1X9RA 4DP2X 3DIVA 4KOBA 4KO5A 5A7EA 5B1AB 3EF4A 3D12B 4GY4A 1W6LA 3FS9A 3UABA 1ETJA 1BYOA 1NINA 8PAZA 3UAEA 2QPDB 1PZBA 4JHUA 3IEAA 4BDVA 1CYXA 4E9TA 1AQ8A 3S8FB 7PCYA 1IBYA 1DYZA 6PCYA 5B3SB 1RZPA 1AACA 3NSCA 4YSEA 1E67A 1SFHA 4YSSA 4YSQA 2J56A 1GY1A 1OCCB 1M9WA 2VW6A 2VW4A 4AX3A 2CUAA 1EZLA 1BXAA 2AANA 4L0PB 4X4KA 1GY2A 3GYRA 2IWKA 2FQGA 5I6MA 3FSWA 3CVCA 3KW8A 3FYIB 2FNWA 5I6PA 3GDCA 3BQVA 4KOCA 3HEIB 5I6KA 3NJMA 2IH8A 2XU9A 3SQRA 2YXWA 4QLWA 2GBAA 1KGYE 1NZRA 4E9XA 2H5UA 3AW5A 3N55A 3H4HA 4DP6X 2BP8B 1AG6A 3FU9A 2VMJA 5PCYA 4DP4X 1KBVA 3QJRB 9PCYA 4DP0X 1ZPUA 1ADWA 1ZDQA 4Q89A 3H56A 3NJIA 1MDAA 4YSTA 2RACA 2HLEB 2AFNA 4A2HA 3OMNB 2VW7A 4A2EA 2VM4A 1NIBA 2AVFA 4HALA 4AKOA 3ABKB 3X1BA 3FT0A 3S3CB 3SBQA 1NTDA 2W88A 2LLNA 2GSMB 2IAAC 1NWPA 3ABMB 4HCGA 2XXFA 3FSVA 3S3BB 4AZUA 3TA4D 4G71B 2TSAA 1ASQA 2CALA 1W8EA 3OD3A 2XLLA 1ILSA 1OV8A 3G5WA 4DP9X 1XB3A 2YAMA 1AZUA 2PP7A 2QT6A 1NWOA 4A67A 2Y69B 1OCRB 1J5DA 1N68A 1PNCA 4GP5B 5I28A 2PP8A 4G72B 2I7SA 3CZUB 1VLXA 2HX8A 4KNUA 1IBZA 3T6VA 2BHFA 3FU8A 1IKOP 1WAEA 2EIKB 3EH5B 4WKXA 3WKQA 4NERA 2JKWA 3CG8A 5TK2A 1OE2A 2BWIA 1KYAA 1A3ZA 2QPEB 3FYEB 2DWSA 3EH3B 3X1NA 2IWEA 2H47C 1KDJA 2X88A 3L45A 3ZDWA 4E9WA 3FU7A 1AZCA 1PMYA 3IN2A 1BQRA 2PLTA 3NJNA 2PCYA 4KNSA 2FWLB 5I6NA 1RKRA 1AZRA 4YSPA 1A4AA 1WS7A 3ABLB 4BWTA 1PLBA 1F56A 2PPEA 4KNTA 3X2QB 2JFCA 2BO0A 1YLBB 3X1GA 2R7EB 5I6OA 3MBWB 4HZ1A 4DP5X 2CCWA 3C75A 2VN3A 4W9ZA 5B7MA 1IUZA 5EHFA 4BDVB 1QHQA 2BP0A 4DPCX 1B3IA 2J57A 1PZCA 1SNRA 2FQEA 3PAUA 2CJ3A 1PCSA 4E9YA 4TXVB 3FSAA 4GYBA 3QJQB 3FU7B 2IDSA 2YAQA 3T9WA 2UX6A 2BWDA 1AS7A 1SFDA 3V9EA 4DP7X 2P80D 3N2JA 1GR7A 2FT7A 1NPNA 1NIAA 1WS8A 2YAPA 1HAUA 3NT0A 2FQFA 5I5JA 1AZBA 2BW5A 2XUWA 5B7EA 4E9QA 2DY2A 4K9JA 2BP0B 1XB6A 4JHVA 4DPBX 4NAJA 1ZIBA 3FQ1A 1TEGA 1JZHA 4G7QB 3FQYA 1JZJA 4G7RB 4DP1X 1N70A 1ZIAA 1L9SA 4P5SA 3ZIYA 4P5RA 5AKRA 1PAZA 2OV0A 2OCCB 1GS6X 3CVBA 1NDTA 1NPJA 2XVBA 2IDUA 4YSDA 1AANA 2FJSA 5B1JC 1SDDB 5D4HA 1GYCA 3EH4B 2GI0A 2UXGA 2XX0A 3CDZB 4Q8BA 1A8ZA 2YAFA 4AI7A 4YL4A 3SBPA 2HZHA 7PAZA 3QJVB 1BXVA 2Q5BA 5E9NA 1EHKB 3TASA 2VM3A 3H4FA 5AZUA 2R7EA 3TU6A 1L9OA 1QLEB 2BP8A 2ZONA 3BVDB 3NP4A 1CURA 1GS7A 1NIEA 4EF3A 5D4IA 3HB3B 1JZEA 4E9VA 3AG3B 2EIMB 2WSDA 5LDUA 1BAWA 3NSFA 1AS6A 3JTBA 2Y1AA 1KV7A 2UXVA 2MRYA 4A68A 3OM3B 3T71A 1ILUA 3NJKA 3UGEA 4CSPA 2VSMB 4RH4A 2IDFA 4ENZA 2DWTA 1HFUA 4BXVA 2NRDA 3T6ZA 4F7KA 1AAJA 5I5IA 1CC3A 2AZUA 4BXSV 1JXDA 1AIZA 3T6WA 1WA1X 4DP8X 2YQBA 4FAAB 2I7OA 3KW7A 2GHZA 4HCIA 2W8CA 4F2FA 4FA7B 2EILB 3X1FA 1NICA 4WTQA 4PAZA 3S3DB 4A2DA 3OMIB 1J9SA 2FT6A 4HHGA 3WIAA 1SHWA 1J9QA 2PPFA 1FFTB 1AZNA 1KBWA 1R1CA 3DKHA 4UF7C 2QDVA 4UAHA 1E5YA 2GB2A 2VSKB 3ASNB 2XXGA 4CSZA 1UATA 4AKQA 4GP8B 1L9TA 4YVNA 2YEVB 4YSCA 3UACA 2BZCA 3PPSA 3UADA 3OQRA 3AG1B 1CUOA 1E65A 1OE3A 5B1JA 4DPAX 1GS8A 1ET8A 2ZOOA 3CVDA 4M4RB 2FT8A 1ET7A 1SHXA 2UX7A 3OMAB 3NJFA 2OJ1A 5I26A 3UAAA 1OOWA 3ZX1A 5PAZA 1ET5A 1A65A 1I53A 4MFHA 2XX1A 3SBRA 4YSAA 4KO6A 4NB7A 3U25A 1MG2C 2N0MA 1PLCA 3NJJA 3WNJA 2A3TA 5D4JA 2WO2B 1L9QA 2IDTA 2B3IA 2FTAA 4BK5C 4F2EA 4YSUA 2QDWA 3WG7B 3NSDA 3FPYA 2PPAA 1HAWA 1E5ZA 2PP9A 1ZDSA 2TSBA 2E86A 4M3HA 3NP3A 3PLYA 4A66A 1MZYA 3QJUB 2IDQA 3RYMA 3PXLA 1SJMA 1WA2X 4N4YB 5IY5B 1GSKA 1M56B 1E30A 3FPXA 1JVOA 1BXUA 2X87A 3AG4B 4YSRA 1NIFA 1XMEB 3S8GB 4JKNA 1GW0A 3NJLA 2FQDA 4HHWA 2PPCA 1JZGA 1X9UA 3WI9A 4G70B 1M57B 2ZWNA 3QJSB 1SF5A 3IBOA 1J9RA 1BYPA 3IN0A 2H3XC 2HRGA 1JOIA 4UANA 5B1BB 4GP4B 2EINB 3AZUA 2WO3B 1AOZA 3ZBMA 2YXVA 4PCYA 3TBBA 1IC0A 1KDIA 2XV2A
chains in the Genus database with same CATH superfamily
3KM2A 2DLEA 3GHPA 5FGCE 1KCVH 3SDXF 3C5ZB 3QK0A 4ES8A 3MBXH 4JM2F 4ZUTA 3TBVB 4OXSA 1DDTA 4RFNC 5C07E 3D4GA 1W72B 4RMVA 1BJMA 3RKDC 3CTTA 3ROLB 4AENA 2F1BA 3WTUA 4NB5A 4XNBA 1ZAUA 1I8LC 1KLGA 2FD6H 2XVLA 2FJUB 3H1LH 3ML0A 3WO4C 1HE7A 5I66A 3CFIC 2JXMA 1Y18B 1NCIA 3D3VB 1HL8A 3FT4B 4LLYB 5FYKE 1IC4H 2K8MA 5I30H 2W0KA 4MXVF 3CCQV 3BJ91 4RQQA 3DSNA 2YGPA 3F8UB 5I8EA 3X3GL 4AYFB 1GMIA 4OZGE 1DSFL 1LHZA 2W0LA 2X3AA 1CFSB 3QUXA 5IJBC 1OE1A 2BVQB 2LQTA 4NTXA 3B4NA 5HBBA 2DH2A 1Z1WA 4JFFA 4YDVA 1CXIA 3RWEA 4ABUA 5E2JA 4L9LA 2XACC 3E89A 1AQDB 2ICWI 2ZXCA 5DD0H 4Z0BL 2EDYA 3VI3F 2R2HB 1KQSU 4BR6A 3MRNA 3ZKXB 4M7ZC 3IJHB 1P5UB 1NGWB 1V55B 2R0ZH 4JANA 1KG0A 1JZFA 5CBEA 4PRPA 1CYWA 1AILA 1YSOA 5T1LA 5ICZB 3GTTA 5L0QB 2ED6A 2GY7B 2XWBB 3QAZB 4JZJA 4Z76B 2YIDA 5AAWA 2YRLA 2WZ0A 2WWMC 2EECA 1WA8A 2EIJC 4XOBA 4CC0A 4JAMB 1P9MA 2F7OA 4WWKC 3B37A 4HOZA 3BFQG 4QR7A 2AJSH 2X89D 5JH7A 3QJZA 2A74A 5I16A 3VFUA 5K9OA 1MVUA 3MLPA 4IU3B 5JHMA 1KJ3H 4UCVA 2E56A 5TQ0H 1TVBA 4Y2LA 2GTZB 1AR5A 1O7DE 3OEEG 1QKZH 3P2DA 2QL1A 4FQ2L 4G7SB 2R15A 5FHBL 3FT4A 4LLYA 3PWVB 1OARH 2VL5A 3GD1C 2RJZA 3FF7A 1XCTA 4KFZC 1H15A 4G59C 4JM0A 3CCRV 4RAIA 3HI6H 5CJOL 3CFKA 4K3EL 5KA6A 4LNVA 4HIIB 4W1TA 5LG6A 1KLGB 3CCMV 2AQRA 3TZVC 4G9DA 1VDGA 5LAXA 2IBGA 1PF3A 5E9DB 1ZV2A 2VN4A 4NRZB 3O11A 4D94A 1ITCA 3FMGL 4TQEH 2FUQA 3QDAA 2BCMA 4HKZB 1DVTA 1ZHLB 4I3RH 4EI0A 3VRJA 4OGZA 5D96C 2NLJA 4MJ4A 4UM9A 4WFFA 4CN1A 1E4XH 3QWQB 5D8JH 4I3RL 2XAFA 2C9AA 3QDJB 3FTVA 4KOBA 4NPKA 2WYIA 2E8YA 5FKPA 5SX5H 1BAFL 3BVOA 3MV9A 4KO5A 2X0UA 1D7FA 3W11C 4UUJC 2QGDA 4U3FH 4DR1O 1Y74A 3KPSA 4JHUA 1IURA 2C4FT 3QDGB 4NXSA 3KWWB 4MMYA 4PY7B 4XPHL 2PW1A 4OSUL 1AQ8A 4W9CC 1H5BB 2B77A 3M46A 4IRZH 2A38A 2YEZB 4B9PA 4AEFA 1J8HD 3HC0B 2HJKB 3M99B 3LNDA 1KB9F 2EC9U 1Y1DA 5IM7A 2EZ0C 5D2NA 2OSLA 2V5SA 3PIQA 1T2QL 3EOAA 5CB4A 1R33A 4LCCC 4MNQD 1KGUA 4RQQB 2EIMC 1GK9A 4JI5B 1Z32X 2YGOA 4AX3A 1CBJA 1DQQA 1AR1D 2Q68A 3L1OH 4L0PB 4X4ME 2IWKA 5EO0A 2YKLH 5HVGB 3ZDYB 3BIKA 1TG8A 3RGVC 4Z7AA 4K9EL 4L1LA 4UINL 3U0TB 2X4UA 4K23L 4XC1H 1FNAA 3JAWB 5T3XE 4H1LB 3GDCA 3CBJB 2PYFA 4WI2A 2E7DA 1WP8A 4ANUA 1MCLA 3NJMA 1DHKA 2X4NA 3QIBB 3WE6A 4POZC 5T1MA 4LAQL 4KBPA 4YPJA 5DJAB 2PETA 3PGCB 4NHUB 3AW5A 2OT5A 5GJSL 3P02A 1WD9A 1U3HC 4JFFE 4Z3HA 1JZ7A 3TO2B 5EOCJ 3FU9A 3JD2A 2Z0AA 5C9JA 4G9FD 1E9PA 4DP0X 1MG1A 1XCXA 4C59B 1KTDA 5E1GA 5AOZA 3ETBF 4F33A 2RACA 1FPTH 4GUPB 4K55A 4OLWH 1G94A 2K6WA 5T1KA 4PJHB 1GYWA 2X89A 1QUNA 2YQGA 3ULSA 4X88A 2IBZX 4F5CA 2W88A 2EXYD 4Y5VA 3VFGH 1N8ZA 5LXTA 2F43G 2K9UA 4R2GB 3VFMA 5J6HB 2AQ2A 3L70H 2VR3A 3DX8B 4OM0H 3V79C 2VLME 5AVYB 4XMKL 1CXZB 4ODWB 2B1IA 3VD1A 5CA1B 1PD0A 2ZXAA 3MRHB 4G6KH 5DD6A 1KTLA 4HXBL 1AKJB 1FNEB 1YA5A 3LDBC 1FXVA 1G1CA 1YEEH 1AZUA 3GJFH 4PRBB 4CMHB 5IP4A 3TJTA 3MNZA 4PJGB 4PJ9B 2FR4B 2XNAA 3L6FB 2CH7B 5FYKH 4UNVA 1GN4A 2ARJQ 3TCXA 3DBXB 4H1LH 4KXZI 5D2LE 1O9HA 1SQFA 2HX8A 3LV3A 1LILA 1YCIA 2J1XA 1NCTA 4FQLH 4KNUA 4MS2A 2LV4A 2JV6A 5JMOC 5F7LB 2MTPA 2WLIB 3O2VL 1KCLA 2HT4C 4MB3A 3RPKA 3RYHB 2E7LC 4AG4H 4M1CC 4XNQA 1HXMA 2CTPA 2Y4SA 1KPRB 3L5XH 5D7IE 3W81A 3OKMA 3NIFF 3SZKC 2A9AA 1S5IH 2WK2A 1C8QA 1OE2A 1CR9H 4Y1AB 1UM5H 2VSCA 5HGBB 1N0LB 4G11A 1BQHB 2QPEB 1OM9A 3UG4A 1TLMA 5I1AA 1U8NA 4FNLH 3MBED 1XNQB 1UT1A 4M7LH 4Z6AT 3L3IA 4KNSA 1MHEA 1CFQA 1S7UA 4LKCA 1QR8A 3LIZA 4QHKJ 5JIMA 1KMGA 3NGBC 3U82B 2RIKA 1PCXA 3KCXA 2K45A 3FB5A 4TWKA 3U7WL 4WTZG 4KZEH 3ZDYF 2ZX8A 5E8EB 1MCKA 3EGSB 3VUAA 3NRPA 1R5WB 4JRYA 1LQBC 4P5TB 3A22A 1UXMA 2FIRT 3O9WA 3F7VB 1YJDL 5D1XA 4FABL 4GSQA 2XFGB 5TGBB 4R6ZA 1X9QA 3CMGA 3KGSA 1IAIM 2N59A 1J5OH 2CCWA 1A66A 3VTTA 1F7YA 4QJ5B 1QI4A 2AW9A 4XX1E 1KB5H 2J57A 1YMMB 3N3EA 5JDSA 5GZNC 2Y5TA 5IEKA 4E9YA 3MNWB 1CGTA 1KLUB 1TSHA 2HSIA 4TXVB 3WUZA 4UCSA 4OD3H 5K59E 1BZ9A 2BWDA 3WFHB 3ZYJA 4P4RB 3STLC 5IYCO 4O2FA 3TA3A 4NRYB 2ZYSA 3IFNL 1XR8A 3CLEH 3TA3C 4F8PA 5IW6B 3MKGA 2RN9A 4ZSOB 3UMNA 1NGQL 2OULB 1EEUA 1MCFA 5JNYA 1JV5B 4JHVA 4N8VB 2NX5B 2QWPB 5GJTL 2OMVA 1S9VA 2MIZA 5K9KA 2ODHA 4IRJD 1WK0A 3P9MB 2L7JA 4LSUL 1IZ3A 3KJ4B 1YEWA 5IT9N 5ECJE 3L5WA 1MWAB 2X7RB 2OYMA 4JHZA 2OR8A 4WFGE 3NK3A 2QJ1A 1JCKA 3CVHB 3EOBB 4M61B 4W6XB 4YXKL 3SDCA 3VQMA 1LP9F 1G7QB 1VRSA 1DFBL 2OCCB 2SEBB 4HMDA 3UDWC 1G7JA 5FS5A 3S5LG 4B3TB 2LW7A 3JV6A 1QNMA 4HU2A 4Q9QL 1U4FA 3T08A 2XAGA 5E2TH 4EIBA 4EJ1C 2NXYC 2PW2B 3ISWA 4R3SB 5E8PA 1BZKA 4MJ2A 1VQLV 2WQXA 3CDZB 4HK3N 4EN3D 1RUPH 1F2QA 4LKXB 1U8JA 3LNIA 3NQKA 4PGBB 3UZQB 4BFGA 4W81A 1LE5B 4JYAO 4KKNA 3KYAA 2X2YA 4P2QB 1TQSA 3EYFB 4UDUA 4XVTL 4WFHD 4GKZB 3UTPE 2A6KA 5L6YL 1K3EA 3OGCB 3TASA 3VJ6B 1Q8MA 1JZ3A 4OD1H 5FHAL 1XBDA 2GQHA 2NNXA 4JG0L 2VZ3A 5J56B 4HIEB 3C60D 1SUJA 2P7TC 3CFBA 5EEZA 1CQYA 32C2A 1NCHA 2KQMA 2XHNA 4JFHD 4X6DA 3RWHA 1IAIH 5C9KA 3WD5L 2VLMD 2YBRB 5D4IA 1FVEB 3OKLA 1CU4L 1CZ8L 4H20L 4HUWA 4AQZA 5I76B 1P1ZA 3MBEA 3BJLA 1H8HG 2ZAGA 3ULUL 3CN1A 4LIQH 4I88A 1DFXA 1KLFB 1PIFA 1FSKB 5KYNA 1KV7A 3J07A 3AGVA 2KZ1B 3FTUA 1VQ7V 4J9ZB 3B77A 2RMNA 2WCPA 2VZ1A 2YHGA 4K3JH 4V2CB 3M1OA 3BT2H 4KKLC 4Z7UA 1KIQA 3NIFB 4J3OG 3SDAB 3SE8L 2A0LD 2BSSB 3Q8BA 5DK3A 1SESA 3D50A 1YITV 1TQCC 1GZHC 2PXYD 3FAXA 3QXVA 2X9XA 3PUCA 1SDAB 4IS6A 2QADB 4BXSV 3OAYK 2CLZA 4OGXH 5CEZE 1JAEA 3APNA 2V6HA 3QFJE 3T6WA 2NY4B 1XX9C 3WJMB 3HRZB 1I1CA 3MGTA 3W7XA 1HIML 1MCCA 1NA8A 3HI5L 5FCUL 2UXCB 4F2FA 5GS1C 5CLZA 3X1FA 4L37A 5IMLA 3ARDA 2DLIA 5F89A 2LT9A 2XWXA 4R7VA 4P2QE 4PAZA 5T3XD 4Z5RB 2UWEA 4APXB 1RP3B 3KEHA 3MLTA 4YHOL 3GWJA 2EKSA 1BVNP 3TA3D 1EXGA 4QPEA 2P44B 5CA0A 4W6WB 2AK4E 3C09C 4ZQKB 2BSKB 2X4QB 4UTAA 5H35B 1UQSA 4B3TO 5B21A 5DZAA 4GP8B 3ARYA 4XMWA 1CDIA 4NM8L 1P7GA 1HP8A 2YPLE 5D1ZD 4LF7B 3W9EA 1BBDL 1MFCH 3LCYA 3B43A 4LPXA 4P4KC 4GUOA 1M6OA 4GBXA 1Z0MA 2PWGA 4F6RA 4NZDA 4KK8C 2DYPB 3FTXA 4TN9A 1A5FH 3FRUA 5IBUB 4ZO7A 3QEHA 2CLVA 4HH8A 3CSYB 1XGTB 1ZLUK 3EBHA 4DIXA 5C0CE 1SOSA 3UJIL 4OF3A 1D6EA 4ZG1A 2OXGB 4IRJC 4RGOL 2FTAA 3QDHA 4QRRA 4Z78A 4YGVB 4M03A 2FEEL 1EAPA 1TPXC 4LCWB 2BSCA 1P4IH 4X64O 1IBHA 2QR0B 3IVKA 2VAJA 2OW7A 4M3HA 3HFFA 5CJXC 4FTVA 3N43F 2KHAA 2BPBA 2ZIDA 3QEQB 1AGDB 1IEBB 4K8XA 3QORB 1I1YB 5I74C 3ZHNA 2QV2A 1E30A 5GSRB 1KN2L 4WFHA 4OD2B 1FNLA 1QNZL 1XMEB 3EO9H 3QXUA 4P46A 4D9QD 5JIDA 4B27A 2DI8A 2XICA 4LVOB 4QTIL 3K9AA 1GW0A 2JK5C 4UT7L 1DBAL 1YECL 4ZMAT 4F15C 1WZ1H 3IJSB 3UO1H 4C55A 3GSNH 3A5VA 4G80A 2VDQL 2PYEA 2HVKB 3QQ9C 3HPLC 3IXAA 2AQQA 3KL5A 5FCSH 5I9QB 1HYSD 4Y9CA 2A77H 1UJTA 1IEAB 2GSIA 3GSNL 2R9IA 1QLEC 5BRZA 1TJGL 2OBGA 2YPLB 1JVMA 1MFVA 2EINB 1NQBA 2OCFD 1ESOA 2WO3B 4KHTH 4KTYA 2CHWA 4PJIA 3TEXA 2MHAB 3N04A 1ES0B 2F53D 3NK4A 3UP6A 1J1PL 1CIUA 1S7UB 3FL7A 5J12C 2EDBA 3CEIA 1AQKH 5LA6A 1MEXL 2EEBA 2Y7QB 3IKCB 5H37H 1JZ5A 2A9NL 5HYJA 4YJ3B 1P1VA 1U8KA 4K8RC 2ADQB 1E4HA 1T66D 4YDJB 5INCB 1F90L 3QFDA 1KPRA 4MT8A 3IDXL 4PCTA 5DO2D 3P4NB 3NJXA 4DW0A 1QFHA 4XAKD 5EH1A 4FMTA 2ERJB 3BAWA 1FV1B 3DJTA 4V1DA 4CC4C 3BWAA 4ONGH 4AEEA 4YR6A 2YAOA 4LLDB 4H8PA 2OL3H 3EO1B 4K3JL 5FC9A 5EZYB 4Z3IA 3ME0A 1KYDA 1NUFA 3ZGHA 3U79A 2N1KA 3J7HA 4UDTB 3N1QC 2YXMA 2X4OA 2Z35A 3SE4A 1X5HA 1P69B 4HCRH 4OTXH 2P5EB 4MD5B 1OAQH 2L8AA 1EFXD 2N4IA 3SE4C 3F6JA 3JWNC 2VN7A 5F44A 5FPIA 4RDBA 3VD4A 4KAQH 5CP7A 5DURB 2BRRL 5DD6B 2DEWX 3VI4A 2JIXB 5D71L 5IVXB 5IQ9B 1C1EH 4CW1A 1H2MA 1WNSA 2DQ6A 2LU7A 1EJ8A 3F7YA 1OEZW 4XGZA 1MW2A 1OD9A 1U91A 2XBZA 5HHOE 1KPVA 2WP3T 1K8AW 3UBFA 3BXNA 1FO0L 4GO9A 1SF9A 3NCFB 3RILA 2E75C 4F33B 3BT0A 1NFDB 1INQA 2ICEB 3FQRA 2WIIA 1TF4A 2LFRA 1JVLA 1X7QB 2VO8A 3LZQA 1OOAA 4MB5A 2Q7GA 3TO2A 4N3TA 4NOFA 1SDDA 3IJ7A 4L8DA 4FD0A 2I24N 4FFTA 1VCBC 4ICXA 4G7YL 2ZKYA 2NYZA 1LK2B 4KXBA 2JCCA 1S3KL 1FO0A 2YAEA 4Y89A 2H32H 3ARDC 2BVOB 1C5BL 2FIKA 3BUYB 1RVFL 4MXWL 4PH8A 4KI5F 3PL6B 4JFQA 1YYMH 4I48A 3QISA 4GIOA 4NAMA 5JQIB 3CJHA 4G8GD 4X6CF 3IGAC 1AP2A 5M7QA 4XXCA 2D7TH 3C60C 5SX4H 2C2AA 5IVOA 3S35L 4BW9A 1FNSL 1UM6H 1I8IB 2HG0A 3G6JA 2ZM6B 4L37B 4NQDD 1QFPA 3B34A 4HHAA 1SF3A 1J48A 3ARXA 3WOVA 5HVHC 3WAJA 5IVNA 1ZK9A 1R47A 4ZAKC 2ICWA 2BY2A 4EUPH 3UJTH 4WENB 1QCEA 2BJMH 2BS9A 3JWNE 1CK0L 5AG2A 3VXNB 1RFYA 2J21A 2A6DB 3DX4A 3QQ9D 4AM0A 2D2OA 2Y4UA 2E7BA 1CMOA 1JL8A 5I15L 3RZCB 3WEXB 4K73A 5A2QN 1X9RA 1BS3A 4LH7A 2D0FA 4WHTA 5JJEB 3WUWB 3UERA 4ZMQA 1BHBA 3ECBA 2J6EA 3MV9E 1TQBB 1QQCA 1SLWA 4NHCH 1MWOA 4Y4FC 4ENED 1OK8A 3IEAA 3VFOB 4M6NH 2YIHA 5LO7A 1TOXA 4V2BA 4MMZC 1DO5A 3B7YA 4KK6C 4LSVL 1I08A 2FLMA 1CFBA 2YBRA 1CICB 3P77B 3APOA 5J13B 4HSCX 4O4YH 1IL1A 5KTEL 3DO3A 5E9DE 4O4JB 4JDTL 3UEQA 1CD8A 3TWYA 3OD4A 1TQTA 5DC2A 5E9DA 1LO5B 3K6FA 3F58L 4QXGL 1E5CA 5FFLA 1PKQB 5L2JA 2OMWA 4FXGA 1NFDE 2WWKO 4FQIH 3AAZA 3H9ZA 4KI5C 1PLGL 4UM8B 4X83A 4BFOA 3FYIB 2FNWA 1NUGA 4PI2A 3BQVA 3CXHJ 4KOCA 3RPIA 1JHKH 1WWAX 2FH6A 2IOOA 4N25A 4ODTL 4BZ1H 5LUMA 2IQ9L 1OWRM 2Y5QA 3GHEL 4ODHL 4WW1B 3D9AL 3VFSA 4J3WA 4WJG3 4AXWA 4UMGA 3RX7A 4NP9A 4GINA 1FFPA 1UCBH 4DUZB 1Z5LB 2NX5D 3PU7A 3TL5A 2VMJA 2WNKA 3VE0A 2VRZA 4Q89A 2B1AL 1F86A 2Z3YA 1I82A 3HFMH 3SJVD 1J8SA 3L4TA 2JI1A 4P2RB 1AI4A 3V5KB 4Y2OA 1Q82W 3AY4A 4C56D 1LO4H 3MGAA 1EFQA 1JNLH 1N33O 1NGZB 4GAYB 3G6EV 2NQDA 2BSBA 4OY9A 1AOHA 3FQNB 4FQCL 4DZ8B 3IDMA 2JB5L 5DC4B 1UKTA 3ZRSA 4FK5C 3LQMA 3T0ED 1JNHB 2DQ0A 2JKXA 1IBGL 5C86A 4LF6B 4PB0L 4RAVA 1XR8B 2X4RB 4I3SL 4KXAA 4D3CH 1JHTB 1XHHA 1MIML 3D2UD 4M1DL 4JI0O 3QCTH 4NI3A 2C3VB 4IOSD 1ZA6A 4MAUL 4MSWA 1S7XB 5CKGA 3BFOA 1O9ZA 3UFIA 3SGKA 5CEXB 5ITZA 2XTLA 3KVPA 4TNVK 5C92A 4Z8FH 3GDBA 4JNXA 2Q76A 4JZOB 2CIIB 3MO1B 4XCCH 2NY5L 4I9WA 3AREA 3NCJL 2BHFA 1HINH 3H2PA 3MKKA 4MJID 3MO1A 4O2BB 4WWOA 4AZ8A 4N86A 1UVQA 1TFHA 2DQCH 3EVKA 3FOMB 2FO8A 4P5TA 1R5WA 3E8VA 2X2UA 4JRYB 3ZTJH 2O26U 5IREA 1E27B 3ARGA 2BK8A 3BHBB 3KWTA 3LXUX 3BAEH 4JVPA 3IJEB 2BWIA 5DJ6A 2PTTB 2X1PA 4J3UA 5C07B 3JBG7 3LDDA 2L35A 2KL6A 3N1GC 3O6KH 5FOBA 4CH5A 5SV3A 3WJJA 2XQYK 4F37F 1N10A 5DHVB 4D7BA 3IN2A 1TO5A 4FFKA 2B2XH 2GUYA 4KROD 3ZDYE 3K9SA 4XP4L 3P3SA 1UUSA 1IGYB 1GCYA 5HHMD 5JHLL 4LEOA 4NJAH 4MNGA 4G6AD 1M7DA 2WV3A 5DRWA 4GAYA 1PLBA 2IAND 3GLAA 1F56A 1J11A 3BD3A 4BE6A 5KYWA 1RUQL 1B0IA 3ARFB 3U2SB 1M3JA 3X2QB 3H6JA 4GEIA 3RUGF 1J88A 3SJAC 2I5YL 4TL4A 5B39B 1UYWL 3KKYA 1UEYA 2CCVA 4JFUA 4EDXB 4HULB 4UYQA 1QHQA 2BP0A 5EB9A 4WTZA 1G7MB 4Z7NB 5L7XH 1R73A 2UU9B 1SHMA 2AJVL 4H1LG 4NUJA 4WUUE 5GSVA 3T4YA 4RMUA 4AVHA 4WAFA 1T5XB 1JF5A 3E6FB 2QWOB 2DE0X 5J2UA 1MRCH 25C8L 3M1BA 3QJQB 2VABB 3WFDL 1UD8A 1R5IA 2UX6A 1XSKA 3N9GH 4WIQA 4Z7VF 3NIGB 4RWUA 4IBLT 4NQXB 4P3WA 1AHMA 1JFFA 3SOTA 4BFNA 5I9QC 4DFIA 4PJAF 2ROXA 2IAMB 4MGXA 4JG1L 3LNMB 1X4XA 1PG7X 3CNKA 4LPWA 4ECNA 4NKOB 3ATBA 4LO9A 4R97B 1AR1C 4AZ8B 2QQLH 5IEHA 2DY2A 4D6TH 5DN6G 4EI6A 1FYHB 4NIKB 2MQ3A 1ZIBA 1CE1L 3QNEA 4L4TA 3FQYA 1EAOA 2GABA 2R0LH 5LN4A 2OSWA 3IWUA 1B3QA 3WE1A 4HDIB 4PRHB 4IGBD 3MRMA 3WS6C 3FB7A 1LP9E 3EYQD 4PRDA 3T2NH 1DL7L 1JRHI 1TJIH 4P5RA 5EUOE 1A0QH 4MDIB 2ZE8A 4FM2A 4DR7O 1QSED 2FAUA 2UVFA 3RWJB 3B6SA 3GMPB 1ZK5A 2HN7A 2AEPL 3HCVA 5JXEC 1DVFB 3MN8A 4PYGA 5DUPH 1U33A 3D69B 5EZJA 3FT2A 2E6QA 3P3YA 4Z7OB 2JI3A 1ZJBA 5DFWH 1V3LA 4MJ5B 3FQWB 2DWDB 3G67A 2OZ4L 2YAFA 3JSLA 4F7CB 1EDHA 2QKIB 2EABA 1DJYA 3I5DA 2Y7LA 4KX9A 1R5VA 3EGXA 3JSSA 4AMXA 3T2NL 1BOGA 2EICA 3B4SA 1DEEB 1AI1H 4CBZA 1ZHNA 2GAZA 5HSFA 3BLBA 3B7UX 4UT6A 5GHWL 5KUMA 4X6FA 4N21A 3EJQA 2M6YA 2AQ3A 5K1PA 5E5MB 2E46A 2VR7A 3CVIH 2PCPB 4N0UB 3S37L 3T3MF 1JSYA 3DGEA 1D6VH 2Q8BH 5MEQA 3CN0A 3GC3A 3LZNA 3RY6C 1DQJB 1OAXL 4WBNA 3J27A 1LXMA 3KLLA 1XH3B 1AB3A 1IBKO 2BVOA 1S72V 3JALB 2WSDA 3NDYE 3CH1B 1UOVA 5DJXB 1OAJA 4BKSC 5EFIB 5IVXF 1Q9WB 4UM8A 2UXVA 4C83B 3IGUA 3H6AA 2WZ5A 3IDYC 4WI3A 3QO0A 4BEIA 2ADJB 3LKPB 3K6SA 1YQ2A 1QMUA 4I0XB 4HC1L 2DQMA 1ZLWH 3D25B 4KJQC 4F7KA 4OB5H 3K71A 3IS0X 5ERWB 3G5XA 3FQRB 1A14L 2YXFA 3HN8A 5GZOD 4XI5C 2EXWD 1YN6A 2AV1A 4QJFB 1WRFA 3ABLC 4P2RA 1QACA 4C8XA 1LD9B 1ZHLA 4GMTL 3VNYA 1SBSL 1AGEA 4XPHH 2JEUA 1FYTE 1GPOH 3VXOA 4U1GB 1I8MA 3FO0H 1YRKA 2Y3AA 5KYXA 1B9ZA 4N2CA 3WFCH 5LAXB 2GI7A 1DN0B 3RGVA 3JUYA 4GAAA 1U8LB 3T4DA 4PJCB 3ECBB 4Y9GA 4XMPH 3VFTA 1EEYA 5D9SA 2F1AA 1CE6A 1SJEA 5CP7B 5FGCB 1EGJA 4LCCA 1EANA 2XWJB 3MA9L 5I1EL 5FW6A 3GJFK 4EMZA 5KS9B 1K4CB 3QZLA 4AUJA 5FLXN 5ITFB 4ZFGL 1ZL8A 1MVYA 4APQB 1VF7A 1MLCA 3BABA 4U0QB 5SWZA 1ZWIC 4UOW1 3FMGH 1JGLL 3H7BB 2FT8A 4JI6B 4S0SD 2CDFB 5B3JE 5ABAA 2ILMA 3DDFA 3V8OA 3UO3A 4Z76A 2NTFB 5JCOA 5EF3A 3P4OA 3VXSD 2Z8RA 2PXYC 3QR2A 4NO0A 4AL8C 5L9DH 3DYPA 5DA0B 3C6LB 1YMME 4K9EH 3FFCA 1JR9A 4LL4A 4UINH 5DZVA 3OZ9L 4MMZB 4F2EA 5DI8B 4WKZB 2A0LC 4OW6A 5FWRA 2H0PA 1HAWA 4TVPL 3L54A 3NSXA 5BOJA 1AGBA 2IGLA 5E1QA 4S1SL 3ULUH 3QJUB 2ZKWA 5TJWK 1BVKB 3MRPA 2CK0L 2OP4H 2JTYA 3Q43A 3QZMA 4BFFA 15C8H 5JIQA 2Q86A 4YBHA 5HDBF 5ESAA 4U6TA 4L8CA 1NIFA 4M7ZB 3TV3L 2OYPA 5KJRL 4J28A 1BECA 2CGZA 3CX2A 5GGRY 3QFJA 5CZXC 5CGTA 5C0BD 1GM7A 4AYFA 4MA8H 3BH9B 3TZVB 2WINA 3BD4A 3PQYA 5DS2A 4FPPA 4AQYB 1HIMH 4K0OA 1PZ2A 4D3CL 2JXMB 4TVSa 1UA6L 1UGKA 4JF3A 5CD5C 5EN2B 1CGSH 1OAZL 2BSED 4OD2A 3V4VL 2KQNA 4X98A 3W5NA 1I1YA 4FL4B 1NDGB 3JD4A 4WEBL 4MVQA 2CHDA 5E6YA 3UMTA 3WFEL 4K7PY 1CDYA 2FEEI 5JW3L 3BISA 1S7VB 3MX0B 3PHAA 4U6HA 2L7EA 2JJWA 3JASA 4WI0A 2DMXA 3HE7A 4ZFZA 3F12A 4P04A 3VXUD 1Y0LA 4C56B 5C0NC 1BQUA 4X0NA 4JDVA 2V37A 3JXAA 1K5NB 3WSQH 1MOEA 3PWUB 4LLDA 3PWNA 2EXTA 2AXHA 5GXBB 3ZSTA 3TURA 4FTDA 3BXNB 4PUBH 2P4KA 5EMYA 3T0WA 4HS3A 4Z7QB 1UH4A 2CTWA 2PWFA 3IFLL 4LRNL 4JI1O 4MCZB 5GGSY 4KPHL 5MI0B 3TWCL 3H1KH 4LESA 4U4IA 3LH9A 4DCQB 2XAQA 3ZHSA 1L6XA 1MCOL 3O3AA 3TYFB 3W9EB 3NQIA 4FXKB 3U10A 1R6KA 3L3DA 3G6AA 1B04A 2OJZH 3LXBA 3RVVD 3D39B 3EG9B 3EFFK 1DCEA 1RL1A 3KWXA 2I9LB 4I3SH 5IESH 1CTOA 2BX5A 3PAZA 1IEAA 4J4PD 4XWOC 4OM0L 1CFNB 2ITDA 4MS8D 4DQOL 3PXJA 1OCCC 2RTTA 3HJEA 4KQ0A 1MAJA 1P2CB 4HOWA 5CINL 2XWZA 3CHXA 1URZA 1ZV9A 4YC2C 2CRZA 5BVPL 5E00B 2C1PA 3HAEB 1AS8A 1C12B 3HNVL 1RIVH 2D31B 3P4NA 4A2GA 4ZMWA 3L4ZA 5I6LA 1DVFC 3RB5A 3CFCH 4R7CA 4M48L 3IDGA 2LQRA 4YJ3A 5LP6C 2C1OB 1PY9A 2YDEA 2GSGB 5EU5B 1RUMH 4OLZL 4TSCH 5HGAB 1LK3H 4AKPA 3SPGA 1CLYH 1KYFA 2ZR2A 4FTVB 2IBZY 2V9QA 5K33A 4J7KA 4G1EA 3UTSA 2GTWA 4H26B 4W68A 3T0VA 3TVMD 4G28B 4Z3EA 4UVAA 1KCWA 3KCYA 4NQCD 1UH3A 1MG3C 4HS3B 2O6EA 1QPPA 4OCSL 2DM7A 4NXNB 3ATAA 1QVOA 2A6IB 2EO9A 3DI2B 3TH3T 4PGEA 5CSZA 5CZKA 1IM3D 5CIPB 32C2B 4LF4B 4L18A 2NY6B 5HYSB 3AQZA 3CFBB 4PGDA 4G80B 3EHBD 3RX9A 1DE4B 4H44C 5L3CA 1E2WA 2JH2A 2HRHA 1HCYA 1ENVA 2HLFD 3HHRB 4I55A 3MNMA 3DO7B 3WKPA 2LGQA 1B9KA 1IBDA 2C1PB 3HAEA 5T5FL 3SY0B 4YDIH 2APWA 4KZEL 4YXHL 3UBXI 1XGQB 4PB0H 1N7MH 4NXMO 1MELA 3CDZA 2DDQL 5I23A 3FTZA 3CZLA 1ORSB 4HCRL 4JO2L 4OTXL 4BYHA 3VFTB 1MFAH 4YX2H 3FD9A 3FT3A 4KV5F 4KHPB 4Z2WA 1FORL 3SYOA 4X1YB 1FAIH 3FN0L 4X6BB 1ZLSH 5CFHA 1NINA 3V0GA 1E4KC 4YGVA 2HKFH 5KANG 35C8H 3GPSA 2IFFL 3OR7A 5DZJA 5I18H 2ALAA 2H0EA 1YUHB 2ZE7A 1I3GH 2V8LA 3MJ8A 1NEZA 1OPGH 2QVMA 4I5BB 2OYKA 4B3RB 3SN6N 1H6FA 3MGTB 4DR5O 1NEUA 3ZCCA 1BDYA 2R1YB 5GGQH 1BQLH 5DFVC 3UTQA 4KAQL 3S48A 4ZOLA 1CDUA 4X65B 2CGNA 2F15A 3BO8A 1A7PL 4MCZA 5HP5A 3PGFL 1RURH 5L9DL 1GYAA 5LCVL 3HBZA 4LDOB 2FQGA 5BS0A 4XPGL 2HFGH 3WO3B 1M3IA 1U2HA 4RQFA 5IZ7A 1UHVA 3ZZSA 3QI9D 3ZDZF 5I6PA 2K4WA 3MLVH 5DI8A 1QW8A 2PKDA 1K5NA 3SDDC 1A4KA 3HHMA 3F3HA 4R4BB 2NNUA 4ABMA 4LOUD 2OYQA 3V4PL 1NFKA 2IXQA 2Q6AA 5F0LB 1E3ZA 3RDTB 4H5SA 2ZT9B 4G5ZL 3UGXA 4AGNA 4KQ3L 1RHHA 3P3PA 2GVYA 3T04D 2NY7H 3GMMB 3CYOA 4HUVB 4RDQF 3MCYA 1MXGA 2IWGA 4YHIA 2EDDA 5D6CA 3IWVA 4FNQA 2UXNA 5LGNA 1JGUH 3OGCA 3K6NA 3KS0H 1KXTA 5D7LE 3OMNB 4Z7WB 3GLDA 4Q9RL 3WHE0 4NBXB 3JATA 4IS6B 1IX2A 4QTIH 1R5VB 2AJUL 3TBSB 1K4CA 2FYUH 2NPLX 1KXHA 4XO5A 4DW1A 3FF8A 2ZG3A 2KG7B 4XNYH 3UTSD 2K9FB 2WOBA 4HOMA 2DQJL 4IBQA 4LFBB 2JI2A 3FT2B 3TPKA 5DTFB 2VE6A 2K4AA 5DMIL 2D7QA 1OCOC 3DYOA 4WW2A 2GT9A 4WI8A 3OD3A 5BO1H 3D39E 5DVLA 5I17A 4UCOA 2YAMA 4JKPL 1OAYH 1ZHKA 3L4VA 4IOIA 3EOBA 4X4MA 4BSVB 3V6FA 2RALA 4ZAKA 4U0RB 4PG2A 5I75B 2A9MH 2LFGA 5GISL 2Y7NA 4BFRA 1MNGA 4U49A 4L4TB 1JK8B 2CO7B 4LSRL 5C0JA 3K5RA 1IGTA 2OQJB 4KDTA 5C0AD 3OGCC 4LFHD 4WKZA 2WQVA 4HS6B 2O6DA 2WBJD 1L3NA 1NVPB 1IFHH 3QO0B 3QUZD 2Y6SD 1Y67A 3MAQA 3PHSA 3H1HH 3EOTL 3ZR6A 4GW1A 3GK8H 2PCXA 5C70A 1KEML 2XQYA 5EUKA 6FABL 1PL0A 1ZX3A 1EMTH 3QUML 4YFLI 5A6LA 3L6FA 5GRJL 2P22C 3VWKC 1ULVA 1N34O 1ETB1 3T0AA 2QPUA 4QLRA 3F7KA 5EULV 1JPGB 1J7VR 2XY2A 4EOWL 3GHBL 2HEPA 4B60A 3HZKA 5IHHA 2XWRA 3JD0A 1LYQA 1TVHA 3UTTA 1GGTA 3LH2L 1BLIA 1KC5L 1A5FL 3GMNB 4FP8H 3CVHA 4M61A 3SDCB 4GUNA 2WQAA 2B4CL 4NNPL 1U96A 3KJ4C 5D9SB 3T8VA 1SMDA 3CFEB 3KPOA 2V4DA 3DJ9A 1Q0YH 3JYBA 4FLUA 4J8RB 4LGPB 4GQZA 3VAEA 3QG7H 4Z95L 2G38A 3VQWA 1K8IA 2HTLD 4JUSA 5F72S 1PZCA 5FF6A 5EBMC 1EZVH 1CFQB 1MHEB 4LKCB 1M1KW 4FEMA 1S9WB 2X6UA 5FOBB 2KI6A 1MFMA 3FFDA 2F8IA 3TA3B 4J6RL 5LBQA 4L8BA 3MLUL 1TLKA 2D9QB 2PTTA 3H3KA 3OW2U 3N2JA 4LVOC 5C07A 4YHPA 5BS0E 1XXFC 3ULVF 3G5VA 3DA0A 3H85A 3CSTA 1JWSA 2A9HA 3Q48A 3K6SB 1FG2B 1QKZL 4K5PA 4WWPA 2K78A 2DM2A 4ZO9A 3WB1A 4HIHA 4TRPH 3RYHA 5BMVB 3HG3A 5L88H 2ENPA 1QBLH 4DPBX 2VDKL 1KCUL 2F6AA 4NAJA 5CR1A 1TQUA 2ARJA 2DW5A 2F5BL 4DERA 5AAPA 3NTCH 1KY6A 3VBBA 2QWNB 2BMKB 4NC2B 4GQ9H 2BVUA 1SKVA 1T4KB 3A23A 4OGAC 1EPFA 5DSCA 5CILH 1E8ZA 5HDBE 2C3VA 4D8PA 4MMXA 4DKTA 3L2NA 2ZOLB 5E5MA 1HCZA 1NDTA 2JMRA 3GJFB 3DTXA 5AOKA 4R84A 2V4LA 3UBHA 1T5XA 1IARB 1BP3B 3CC5A 2AAVA 2WQ8A 3NCJH 2QLVB 1XWVA 2YD3A 3BN3B 2VQTA 3BGAA 4XMLH 1OP5K 4M8VA 5D4HA 2IANE 3AS1A 2EIZA 2YD7A 5HYQB 1AH1A 4TLKA 4EDXA 2DL2A 3WJLA 2A77L 4OZGA 5J8OA 3VTAA 5E8DL 3GIZH 2IFFH 1E4WL 5DK2A 2NCEA 5KOVC 4URTB 5FF6B 4B9CA 2PZSA 4QO1B 2DYSC 1TITA 2RCVA 3B6SB 3GMPA 2X4PA 4S1RL 5EZPA 1RZ8B 1DQLL 4RGND 2JKSA 1IBKB 5AEAA 1YN7B 4GSXA 1Z3GL 1ZUQA 2FH8A 1IFRA 1L9OA 5E2TL 2DQHL 1A1OA 5C7ZA 2HG5C 4P57B 3HR5B 4PS3A 2EUXA 3F83A 4EF3A 5FB8A 4KKZA 4PJIF 3QHZH 1KCSL 3VRLE 4NC0B 1JWMA 1JGEB 4OFVA 3CCUV 1CXFA 1DVUA 4P99A 3BT2L 3UTTD 4OCNC 2ORBH 1E4XI 4R50A 2EDOA 3MLVL 2I27N 3P2BA 2XVGA 3AS0A 4F9PC 2WVSA 5I0YA 2OIEA 2GBUA 4H4NA 1S5HA 3UGEA 1OHQA 3CRCA 1HZHH 1RJYA 4EZLA 3E9UA 2VSMB 2MK3A 1F4HA 4HWEH 2Z91B 4LEXH 1RZ7H 3O6MH 5D1QE 4ALAH 2MW2B 2DQDL 4UM9D 4B9YA 3BAYA 4EQ3A 3EOAB 1NT2B 1XNQO 2Q76B 3CFMA 2QQQA 2R0KH 3R06B 4KVNH 5GS0C 2FBRA 1E79G 5J2UB 2IANB 2JTDA 4LDLB 3TONA 1UG9A 4N0UE 4Q20A 3T0EE 4D9RE 4Y8AA 1IAKB 4N87A 4HWBL 4BIZA 2R56L 5ICZA 4FL4C 5C9JB 1RJCA 3HKEA 5JPMB 1Q9LA 5GRYA 1NGWA 1GM9A 1S8DB 4FNPA 2HFFA 3I3BA 1J9QA 2ZQKA 3MRNB 4M48H 1R1CA 4U7KA 4WHTB 2C9VA 4Y19E 1DF5A 1UFGA 5T1MB 4HBNA 1AQDA 4WU5B 5FA4A 4KI1A 5CZRA 3G08A 1KJ2L 3MZGB 5E2UL 5K9JH 4L87A 3HI1B 1JRHH 1O6SA 1ACXA 3FUMA 4R90L 3UYPA 1B2YA 1SLUA 5B1JA 4N2NA 2VR8A 2DJUA 3DX1A 3ETGA 1A47A 3O3UN 3CRMA 2EUWA 5KYUA 1K4DB 1E0OB 1Z5LA 2OR9H 1NEPA 2UX7A 2F1MA 1A9EB 3D3VA 3DX0A 1ET5A 1B4LA 4FXKC 3FCUB 4JQXA 3RJOA 2FJFA 3N40P 3IU3A 4N8CH 5I1IH 3GO1H 3A4DA 3WNJA 3MNDA 3SKJH 2YXLA 4UT9L 1MCOH 4QUOA 5D6CB 1TJMA 2EUVA 3KWWA 4KRNA 1ECYA 3CWBH 4XMVA 3OKYA 3VXRE 3NSDA 5E6IB 4G9FA 5DEGB 4LH6A 2R23B 3R7QA 4A55A 2TSBA 3GXMA 4AYBA 5DYFA 2IPTH 1F6AA 1HWYA 2ZTBA 3S35H 3X14A 4ELKB 1PKQA 4MQ7B 5ITZB 2QV4A 2DLTA 3CXHK 3UQ8A 5IG7B 5AW0B 4OFIA 1WH0A 3QRFM 4I1NB 1BXUA 4YSRA 1OQOA 5DD1L 3PWLB 5IQOA 1IM3B 5BJTA 1R3HB 4ZOEA 2FQDA 2R72A 2L04A 2PPCA 1TNMA 4Y5YC 1G5AA 3T1HB 3O11B 4QXGH 4J8RA 4Z7UF 1IE5A 4NYKA 2QGEA 2ZE0A 3F64A 3F7YB 3NACL 3QIBD 3KPOB 4KU1A 1SZXA 1NGYB 3AM8A 2IH3C 2ZP0T 3VI4B 4KRLB 4ADJA 1B6UA 2YUVA 4X9GA 2NNCA 3H9HB 1LUWA 4LSVH 4LL1A 1RUQH 2OMYA 3O4OB 3BPNB 4XMPL 4I8DA 1IC0A 2YA2A 2DTSA 1K6QL 3FUDA 1L7TH 4X7FC 3UTTB 5AB0A 3O65A 1DLFL 2X1OA 4U3JB 3IFPA 4HIJB 1A4CA 1BVLA 2ICWB 3REVB 1BF8A 4X6EB 2UWEE 4NZRH 5AFAA 2A83B 4MAYB 1WISA 2YO3A 2B5UA 3OJ2C 3SGKC 3CK0H 3AU1A 3A0RA 2X0LA 3T65A 3LVEA 1NMCB 5CBAB 1CICD 2E6PA 4PGZA 1JCVA 1Y18A 3BA8A 4ABVA 3H0TA 3FUFA 5C0RL 5E08H 4EB6A 5GRWA 5FUOL 4ODTH 3DO7A 2VB5A 2QTOA 3CFQA 4XXDA 3BUYA 4KUZL 3I3EA 1XB8A 3K4DA 4HP5A 3QBTB 2HLDG 2IH3A 1CWVA 4N90D 1LK2A 4MD0A 3EFDH 4RFEB 3VG0L 1CBVL 2GFBB 3X13B 5I24A 3BPCB 4GKJB 5DJZA 3QNZB 1ZEAL 3PNRB 2YS8A 1DVZA 1RZIA 1S7WA 5BUGA 1BMGA 4J8QA 3BSZL 4HAKA 1BG1A 1JERA 1TQWA 2E4FA 3ZL4L 2X6AA 4JI2B 2KZWA 3GKWH 1J9CT 2BINA 5LGHL 2ZXWB 3CZJA 4HSAC 1NS1A 5TDOA 1ADQL 4FZEL 2ITFA 3VXUE 4PG9A 3VXNA 4X20B 3SOBL 2X4TA 4QHKI 4WI7A 4P46B 2J1ZA 2Y1ZA 3TV8A 4CN6A 3TV3H 4GS7C 2QSAA 1IAIL 1RLBA 3ULAB 5I73B 4F8NA 4NQEE 3PG2A 1IBLO 5FFOA 3HUJA 3RZCD 2APTA 3O6FB 5CD5D 2UZIL 3FQUA 4JAVA 4YS4A 1M9NA 3ATDA 4LSPL 5AD0B 5LHDA 1U6AL 3WIIH 1W0WB 4JCLA 4MKMA 3WL9B 3ZKQD 2HJDA 2YOAA 2IWFA 1Z2GA 3CFNA 5KMGB 1XDTT 3EG9A 4HISA 3FONA 2BIOA 1KTBA 1ZLWK 3GO1L 1O6VA 3BA9A 2HXAA 2E7LA 2QKAA 1GZPA 2IPUG 1RZ7L 1Y07A 1NJ9A 2JCCB 5HJGA 3GBDA 3QEHB 1SM3H 1PPIA 3ES6B 5EYPA 3QUMA 4PRIA 3C9NB 1NKGA 3ASNC 1WAZA 4LLAA 3VQ2C 4BQ9A 5DDHB 2OZNA 2ISDA 4N8UA 4G9FE 2B08A 2B20A 3BDYH 4DEPC 1N26A 4GX0A 4KX7A 4OF8A 3L8QA 2QZ5A 5KVGE 3OJMB 4QRPB 3ILPB 4HETA 2BSKA 2QKCA 1PYWB 1AXSA 2AABL 3B7RL 3F12B 4M6NL 4TTDD 3VRLF 1VQ9V 5A7EA 1MZFA 3O4LB 4ODSL 2RDCA 2F19H 5HDQH 3REWA 2YA0A 1MQKL 5JLZB 5E2VL 1BJ1J 3VXQA 3HA0A 1JNNL 3G5ZB 4A2LA 4PI0A 5EC1A 3BN9C 3N5AA 3L9RB 5TE7H 1SPDA 4TQEL 3O6LL 3UO2A 1VIWA 3OG6B 5LGYA 3I6KB 3ZT5A 4DV4O 3ULVE 4PJ9D 1Q1JL 3II1A 3NH7L 3UO8B 4RGMB 1XD1A 1TCRA 2PNDA 2XTAA 4X4KA 2AV7A 3U7YL 2HTKC 1HNWB 3MLWL 3UYOD 1E28B 3I56V 4WO4C 3L5IA 1T5WB 5C08E 5IBUG 5SV4A 3U7AA 2XASA 2E0PA 1AMXA 5FM4A 5L8LB 2HKHH 4IIQA 3B2VL 3DECA 5ESAB 1BHAA 4Q6IC 3IRPX 2IH8A 4Q74A 4OFDA 5F7YC 3A0BZ 2XA3A 5EZLA 4Q4IA 3A4FA 1FCGA 4HXBH 5DEDA 1CXHA 4HKXA 4F1ZA 2NYYD 1AO7D 3QDME 4CMHC 3B2VH 1RIHL 1XO8A 4J27A 2DN9A 2BSRB 2EYTA 4HFWA 2XFXA 3LN4B 3LHPL 4XI5D 2YGQA 4TV9B 1Q9OA 2EEAA 4PWFA 4QRTB 2P24B 1J0KA 3E2HC 3MV01 4PREB 3FDWA 1EN6A 3IDJB 5JVDA 1FQ9C 1VEOA 1USZA 3BP5B 4NCC2 3W39B 2VKXA 4PJAE 5LAPA 3EO0B 3GEWB 4JRXE 5DZNA 2O6PA 2ZOKA 3N41F 5LGJB 4OI7A 2JJ2G 4N22A 5CJ8A 2KKQA 5C09E 1E9QA 2IPKA 1BAFH 4K5OA 3VSQA 1VF5B 3D4YA 3B5TA 4AZUA 2VN5A 4I3GA 3STBA 2XBDA 3IFPB 4G71B 1AR4A 1SYSB 2XY1A 4LAQH 3GRGA 4HKBB 5IFAL 1MIEH 2GJRA 2OMYB 2DWEB 4B3SO 1UUNA 1QSFB 2XWJA 4GP5B 1QRNB 4J2QA 1FVDA 1KUQA 3RNQB 5JHLH 2IU0A 1NBYB 4NDMB 1UA7A 3ARBD 4X5XA 4DV5O 1RK7A 3U36B 5B1OA 5FLVA 2IVFC 4Q9QH 2L0DA 5IYZA 2CJUH 2Z92B 4HD5A 5DURD 4Z78B 5CGBA 4Z3JA 5H4YA 1YEKH 3VXOB 1EAQA 3U1QA 5FCUH 3UH8A 4AW4A 1CDCA 5IHBA 4QT5A 4FQJH 2GK0B 4OH2A 4GSRA 1AHWB 2NNFA 1JIBA 3OR7C 1MLBA 3L74H 3FO2B 3MC0A 3E22A 1G4MA 1PTZA 3APDA 3EH3B 1MABG 4O02L 1WN7A 1D5XB 3PWJB 3JASB 4ZFZB 3I6LE 3X14B 2B15A 2O1AA 5KBKA 4C83A 3GBNH 4AGOA 2PLTA 3L3HB 1A7PH 1E9OB 4DUYO 1KNOA 1CPUA 1QLEL 2FWLB 1SVBA 4X4YB 1P9MC 4WWKA 1OW0A 2DI7A 5DFVD 1AVAA 2ZOKB 3IAQA 1KD1W 4Y2DA 3LPWA 5TGBA 3C8KA 1G7HB 2PXYB 4FZEH 4NLHA 1HCFX 5AOLA 4LF5O 2VLJB 3S5LB 1RQ5A 4AG4L 3NEOA 2APSA 2ZICA 4ZODA 1B0RA 4M6OL 3QEUA 1U8CA 2XAHA 1O5PA 2O57A 3QQ4B 4BIUA 2DTML 4BH7B 2AEWA 3MLRL 4Y88A 3CXFA 1A3QA 4H0LC 4N20A 1N67A 3BH8A 1OHZA 5GTIZ 5IFHH 2FQEA 1PCSA 4JRXB 3QVAA 5H94A 5LB1A 1INDH 3I84A 5T8IA 5JQ6H 2EIKC 3JV0A 4QRUB 3RVWC 4QTHA 2O93L 3BX7C 3CLFH 3NAAL 4IKLA 4RGNB 3U48A 4MJ5A 4IBSA 1FI8C 2FT7A 3NCYS 3J7AU 2VRKA 1HXMB 2Z6FA 2ZKXA 2ZXBA 2XT1B 2DM3A 3EDEA 1KLFA 5K9KB 5IWAO 1A3RL 3BKJL 3P30L 5FKAB 2XPGA 3EFDL 2W92A 1CBVH 3FB6B 2Y22A 1V7NH 1JPSH 2VC2L 5DLMH 1FVEA 3OKLB 2V2TB 2ENSA 3ZE2B 3O6FC 3NZ8B 3DHMA 2V8MA 1ZKAA 1NCUA 3UCRA 3ZIYA 1BYNA 3OKKA 1FIEA 1P4UA 4NQSB 3PDDA 4BA0A 3DOSA 2TRYA 4OLXH 1KCVL 3WFHA 1RIUL 1GS6X 4UTAH 1F13A 2HCZX 3FRPG 4XNXH 1NL0L 5CCHE 2CR6A 4AVJA 4NYLA 2VXTH 3Q9QA 4BIOA 2ALWA 2VDKB 4MJIE 4OZFA 4PGBA 2GIXA 1JGEA 2UUDK 5H5NA 4XO8A 5SWSB 1KBPA 5TQ2L 3RYFB 3ZTEA 3I3DA 2ESVD 3KE0A 1CL7H 2KLSA 3OAYH 3QJVB 1AI5A 4J2XA 1AYOA 2CBMA 4PRPE 2H3KA 2DRUA 1I0HA 3K5LA 4LNUB 4XCEA 5LMNB 3VX0A 1BA9A 3ROOB 2YZ8A 4PY8I 2R2BB 4OIFA 1WBXB 4J3OF 2WJ5A 1KKDA 2WBJB 1CF8L 2CLRB 1DJWA 4XN4A 1DEDA 2DWYA 3MXWL 3MV7E 3PWPB 2QGCA 2H1PH 3HB3B 4LFBO 1IVLA 2X4NB 4FCHA 4AJ0A 1TJXA 4MVBD 4ZZFA 5I5RA 1GGCL 3P69A 3NSFA 4G6FD 1G0DA 5HY9A 2WAHA 1UZ8A 1BIHA 3HG1D 4WWKD 4Z0XA 1T2XA 5KZCD 1YF2A 4MAYD 4LLQB 5DVKA 3TWCH 4CSPA 1XF3B 1JK9B 3WTWA 3JQOB 5DRNA 4RH4A 4HUXB 1UZGA 1DUYA 3FO9B 4L29A 4AC4A 4NUGL 43C9B 2XXMB 1MAML 2ZSVA 3BVUA 1N18A 3K2KA 2LLLA 1OTSD 4TYUA 5DVMA 1WVZA 1SETA 1GH7A 3CDFA 3HS8A 4TSAL 2P9RA 5C0BE 1HNXO 2OAAA 3TK1A 5I1JH 3A6CH 4FQHB 3ZKSD 2WQWA 3R1GL 2PTVA 5CP3A 5C0DB 1FZKA 3Q8FA 1XT5A 2WD0A 5DZ9A 2L6LA 3ECWA 1NANI 4CAGA 4JO2H 4LHUB 1MI5A 2Q3ZA 3D6GA 3CB2A 2H26B 2JJUA 3QZOA 4I50A 4UAHA 1RIVL 1WIUA 3ZY7A 4CVWA 5IIEA 3T6QC 3ASNB 1X5XA 2VM9A 4AIEA 1A2YB 4JFZH 2YEVB 4I0PB 4FFWD 5IFAH 1G0XA 1P7KB 4EI5D 2V7QG 1WPBA 3D0VA 3P9LA 1EJOL 1EIBA 3DV4A 3BFRA 1XGYL 3AROA 5DS1A 3QDMA 1Q43A 1YEGL 4RMWA 4JKLA 3CVDA 3MV7D 3NIDF 4M4RB 3T0XA 4UIKL 1UPGA 4AK2A 4ELMF 4L05A 5DHMC 3KXFA 4BWAA 3LD8B 1FLTX 2OJ1A 3MNVA 2FZ3A 2Y06L 2A6JA 2EVGA 4G8GA 2Q7YB 1VFUA 4I4WB 3C5JB 1R3IH 3MROA 3U25A 3NJJA 5IB5A 3W57A 3U2IA 3L4WA 4A7GF 4DKEL 2PTUA 1SQPH 4L5FL 3VQ1C 5LNDA 1I75A 5IEHB 2H3OA 3DRQA 3K5SA 1ERNA 2OL3L 5FM5O 3EYSL 3TJEH 3ZQ9A 4NXNO 4HIJA 2QADD 4LP8A 2GBTA 3RYMA 1QFWL 5I16B 2UZYB 1HNZO 4JY6B 2FWUA 2E5EA 2IJHA 5L4FA 2ILLA 2VZOA 2WMPA 4NCC1 3GBMH 2OI9B 2OSLB 3PIQB 4B0MB 4ZNEA 4X66B 2HH0H 3NFSH 3R18A 3PJSK 3D33A 1HJBC 4MLSA 5F1OB 4A63A 2XWBA 1CDJA 5EOCL 1F3JB 4Q6GA 2GEEA 2H2SD 2VLRD 3V5HA 4E0RA 4LMQE 3IYLW 4NKDB 1FF5A 2AS5M 1DQDH 3LOWA 3VFMB 3IAYA 5J6HA 5B39A 4M6MH 2LGWA 4HX1A 5C0JB 1CGSL 1OAZH 5JYLA 3LNHA 2XIDA 1PPJH 4X5PA 1BYPA 4PJXB 4R7NB 4Y16A 4TLSA 4U1NB 4NNPH 4RZCA 2VZVA 2WJ7A 3AQDA 4KVNL 2CSPA 4LSQH 1FGNH 3DRTA 4I89A 4OCXH 3BPZA 2H26A 4K2UH 1K9MW 4JHAL 2XN1A 3LZRA 2EKJA 2ZE6A 4HZLA 1TUEB 2X12A 4QD2E 5T1JA 3HOGA 5K1VA 1FNSH 1RZGB 3WUWA 5AVWB 4XNZB 1YECH 2JE8A 5G55A 1JI1A 4N26A 1P6AB 2AC0A 4N1EA 1QNIA 4AM0B 2VUKA 3GSOB 3N2KA 1O5DT 3HG5A 4U1LB 5TF0A 4L8JA 3BKCH 4JASA 1UVQB 2DIEA 3KNBB 3QZBA 1P53A 1PZ3A 4KNQA 4QRSA 1XL4A 1K4DA 2DMHA 4CC6A 4P59L 2NY3D 3A2FA 1WT5C 4FM0A 2JCCF 5BW7A 2ZAIA 5KYYA 4PS4H 4KGLA 4Y9BA 5A3IC 1FXKC 1F4AA 4R4FL 2NDFA 1YYLH 4NO5A 5IT2H 1RJLB 2ZE5A 4NQDB 3BE1H 1OO2A 1XAKA 2FIKB 3EHBB 1JZ8A 3VM5A 3G08B 3SBWC 5A2CA 1AVMA 5FPRA 1WTGT 3B8NA 2XJLA 3QDGA 4G83A 4UV7H 2DWEC 3VFWB 3AK2A 1PLAA 1GMEA 1SXNA 3MVSA 1MIEL 1ZLVH 5KAQF 1QHOA 2R4RL 3MLUH 2M26A 2X3BA 1DDHA 5EO1B 3Q06A 4BQCA 2ZWZA 4NAQA 2HKAA 2ED8A 1BW8A 3N06B 5E70A 1D5ZB 2XN0A 3WIHH 4HAMA 4LBEB 5GONB 5CCGE 2WIIB 1KXQA 3VXMA 3V5HB 4DAGL 1FA4A 2VXQL 5TE6L 4XHJD 5CMAA 3QG7L 1T7XA 4X89A 3AT9A 1BT8A 4RFOH 3VRJB 3NIGF 2F53E 4NN6B 3B7SA 3KWVA 4L9LB 4NRZA 4OIAA 5AW8B 1PNDA 2R4SL 5IR1A 1U92A 3B2PA 4H8WH 5ACZB 1WEJH 2R4RH 2DW4A 1RUAL 4QHUB 5K69A 1NR7A 3TBYB 4YWGL 4DGVH 1E4KA 4P30A 1MCEA 2CBOA 5DVPA 4NO2B 3FXIC 4TNGA 3QGVA 4WJ5A 3CC7V 4X65O 1W0YT 3O3DB 1F45A 4AV4A 3BQUB 1BBJA 3EOTH 3OBAA 5CBFA 4X9YA 4O00A 2CBPA 5I5MA 2GCYB 1W0JG 4N8PA 1ANUA 3T6XA 4J7RA 5C09D 5F3BB 1LUVA 3ET9F 1BIIB 4K8RL 4AT6B 1GZHA 5I1CH 4HXAH 4UDTA 2EC8A 2EVJA 4KRPB 2XUMA 3M7FB 1TMCB 2P5WB 3TJEL 1AQKL 2XG4B 1DTOA 2HPTA 2Y2TA 4HLZH 3RVVC 2H32A 2G0KA 2L7QA 3LKRB 3OJDB 5A9GA 2ZNXA 5D70L 3U1SH 3W38A 2J6WA 3T4AC 3UKMA 2BIIA 4P9PA 3AK3A 4PHZA 1JPFB 3C5ZA 3D0VB 2XVKA 3AXIA 4WI6A 3LHAA 3RVXC 4N9GB 3WNLA 3H53A 4MAZA 4NN7C 4ZMPA 1OXYA 2GIMA 1KBGH 3FFCE 1JGVH 4U6XA 4XPAH 2DEYX 4PJDE 5CBEB 1ASOA 4QOKD 3ZE1E 3U0PB 2GJ6D 4FX5A 2CMRL 2BRQA 1US6A 3BDBA 4EEQA 2VLRE 5JORA 5JWPA 3D12B 1Q94B 5AL8A 3OFNG 4K5NA 5F1SA 4H25B 2WZPA 2D4FA 1BREA 1WO2A 2V7HA 4JREB 3EFFB 4NENA 1YSCA 3ALXA 4BDVA 1RZFL 5DJ0A 1JTTA 1LEGB 1SYVA 2BVTA 5DSCB 4L4JA 2NYKA 2IH1C 3LN5B 1FVCA 3VWKB 2XKNB 2YMXH 4XPAL 1WGOA 1XBRA 5B3SB 5IYBO 3U4AA 2X6MA 3G6DH 2J8UF 2DD8H 4KTDL 4PV9A 1DBBH 4P8QA 3S97C 2DS4A 2IOMA 4TSBH 5JHAA 1CFNA 2ITDB 1FAIL 2FEJA 4XNAA 4OLEA 4J80A 4LLQA 2WWKT 4JDZB 4V11A 3TNMA 5JOPE 1T1XA 4WHDA 1JMZA 4Q9CA 5KSBF 3KW8A 4O9HH 1L0YA 3PL6A 4P2AA 5TDNB 2WKGA 3RTQA 1D5XA 1GTNA 4M8RA 1MW3A 2XU9A 3IRZA 3C2AH 1W72A 4BIKA 4JN1H 4TOIA 1NFAA 4YE0A 2DQDH 4E9XA 3L9EA 1ZVSB 4PWIA 2G60H 2NW3A 5EOTB 1EHNA 4EKJA 1F42A 1BGXH 4U31A 4DP4X 3ZUCA 4C56E 1Q38A 1H3TA 1QZNA 2QLYA 3MRJB 1XV8A 4ONOA 3WFDH 5T33H 4LASH 3VGFA 1EVUA 1HJCA 3JCZA 3DVFA 5DC0A 4ELME 4OCMC 2EP6A 3SBQA 3AMKA 3FRUB 3W9DB 3K74B 1WLEA 2QEXV 1NH2B 5BQDA 4JKPH 1EJOH 2XT9A 1OALA 3AWFA 4URKA 4GFXA 1S7VA 4NZUL 2C4FU 2TSAA 4UAOB 4LVNB 3W56A 1WC7B 4DP9X 1JRHL 2PWHA 4DVRL 3O3BA 1T22A 4B3EA 1KTKE 4L1BA 5D7IA 4AQ1C 3FB6C 1T20A 4A67A 4NXKA 4JLRA 2WLZA 1QTYT 4IYHA 1OM3H 1UCTA 1A22B 5FGRA 4PLKD 3FQTA 2V2TA 2OCHA 2WLLA 3LB6C 4IKIA 3CXHF 4AQ1A 3DUUB 4HUNB 3DETC 3T6VA 2UUCO 1CFTB 2ZWLT 3TBWB 2C26A 1VKXA 1JD7A 2RFXA 4QWWD 3PWPD 5I1JL 3BZEB 4ZS6C 4ZTOL 2C9RA 4P3DB 2DQGL 3ZEDA 3C87A 2BTOA 2ENJA 3B2XA 2R0KL 2Q86B 4K0KO 4Z1VA 3V7AE 2ZWKA 2AAAA 4PR5A 1NC2D 4N23A 1JF1B 1JXKA 2DWSA 4PJAB 5E5UB 1W0VA 5E99L 4ZUSB 3RVTC 4HSQA 4ZXBC 2IM9A 1UACL 3UGUA 3P3UA 4JFYA 4L4TE 5CSBA 4P3CL 2PCYA 3GI8L 3FFQA 3H9YA 3RWCB 4EDWL 3HE6C 2OR9L 4PJIB 1KECA 3TBTA 3DX9B 5DRZB 1MJJA 1OAUL 3TBSA 3I9GL 2L7UA 3BZ5A 1P1ZB 4QXVA 1KEMH 2VXUL 2GSIB 4E4EA 1Q90A 1SQGA 5EEVA 1KJ2H 3FJTA 5E2UH 5K9JL 4JQIL 3X1GA 3QIBC 3UCSC 1VFBA 4MSWC 2JQAA 4XN7A 1HDMB 3PL6D 4NZFA 1MLCB 4P3CH 5IWLA 3R66A 3KR3L 3C90A 2NOYA 3H9SD 3ZE0F 3OSVA 4P5MB 3FU7B 2O5ZL 4YO0B 3LQZB 3WXWH 2UZPA 3KJ6L 3E22B 4DP7X 5D96B 1W72L 4ONFH 1OSPL 1MF2H 1GGBH 5LGTA 2HRPL 4YIQB 1BOYA 4XCFL 2Y1YA 2APVA 1AMYA 3RDJA 1P7QA 3PHQA 3ZRCC 4F27A 4GLRI 1D5NA 1DN0A 5DT1L 5B7EA 3RGVB 4K9JA 4PW9A 2IPTL 1MI5E 1FNGB 4EZKA 3FQ1A 4XN2A 2CH8A 2HB0A 2GTSA 2CPCA 1JUFB 4RUFA 4PW4A 4HGKC 4FNSA 5F71A 2JF1A 1LMKA 1G6UA 4YJ2B 5L3BA 5C3TA 4LF3B 1FIGH 1L9SA 4PRAB 4ESKA 3G5XB 1RMFL 3PDOA 4UBDD 5C0BA 4FQXC 2YUXA 1PAZA 1SQQH 5KX5A 1I8AA 1QHTA 2BNUA 3CVBA 3TGXA 2UXBO 2QHLA 4ZSOA 1DJGA 4YPGB 1GVIA 1D2OA 1DP0A 3JZ7A 3IKKA 4ODBD 5DJ8B 5FDYA 3NPZB 3KYOA 1IGCH 3MSPA 4ERSL 5C0GB 3L16A 2ZCKL 3FUEA 3MLZL 3M8OH 3ILEA 4PV9B 3NOIA 1T20B 1XH3A 4Q8BA 4WSJA 1XGQA 3S5YA 1VADB 4NQTA 2Z34A 3DC5A 3BFWA 3PABB 3VDAA 2OL3A 3QUKA 3QG5A 5BZWA 4AI8A 2XKNA 2R27A 1DVXA 4X20A 5EU3B 1BXVA 5F0MB 2Q5BA 5IDJA 1KCRH 5FEBA 1VF6C 1U3HB 2DN7A 4WFAV 3N27A 4X6FB 5AZUA 2R9RB 4JZGA 1AO7B 5C2UB 3NP4A 3V6OC 2BCCH 2YIAA 1MVFA 3A6BH 4JPIA 2GDSA 1EX0A 3CFDA 1RZJL 4PJ5B 1NIEA 5H37A 1FXKB 1NAMH 1RK1B 3GB7C 3GSXB 5KJRH 1MMMA 2EQDA 1YYLL 2QVKA 3A6BL 4R4ND 3E6HB 4YDKH 3JARA 3VB9A 5IT2L 3QNZA 3O6ML 4ALAL 3FO1A 4TUKL 2FSEB 1MHHB 2GJZA 3JCUZ 3QCUH 2C8NA 4XC1L 4JFYB 3VXUB 1ZVSA 3SKMB 4ADGA 4K5LA 4HWZA 4DZBB 1GYUA 3VA2C 1A1NA 1D2PA 2V17H 4JMXA 1WUZA 2DKSA 1GSMA 1OL0A 3LRSA 1EJFA 1MPAH 1PSKL 2WLNA 2XAJA 1I4FA 3FU5A 5KN5B 2KDYA 3M45A 1NAMA 4PJHF 4BBWA 3CPLB 3K6DA 1WAAA 3OKDA 4M8QB 4TM9A 3NZSA 1KCKA 1FHNA 4FLTA 3QUYD 4QNPE 3O3DA 2EVFA 2AXWA 4AYMC 3ZDZE 4HHGA 5GS3A 1KGCD 5D1QD 4WUUB 2JRIA 2QWRB 4U3JA 2BIQA 4KRPC 3B09A 3OTOB 3QC6X 1MN4A 3MUUA 1XGRB 4QHUA 4FFWC 2FGWL 4XRCA 3F7PC 4RISL 3LKNB 1NGXA 3B5HA 4NM4L 1LEGA 4LSSL 2VSKB 4CSZA 3QRGL 1OW0C 3MOBL 2CXGA 3EYVA 2H8PC 4LCUB 2RHEA 4OPHA 2FECL 3IMWA 4NM4H 1OE3A 3OHXA 1I8UA 3VXMB 1TUBB 3CVIL 1F18A 3GMLA 1AE6H 1S7QA 4ALAC 3SDAC 4ONHA 1BVOA 5I1CL 3SD5A 3UAAA 3TS8A 1FS0G 4S10A 2NXYB 1I53A 2ZUWA 2G3ZA 4ONFL 4ZUVB 3A67H 2OMTB 3AITA 2H6OA 3F6IA 1I9JL 1PLCA 1RXLA 2WTRA 3MUJA 4YIPA 3KYKH 3PWNB 3SDYL 2K8QA 4BK5C 5CEYB 2OCCC 2EEXA 3P1VA 3GK8L 3KPRE 1EMTL 1KJ2A 1DVFD 1A9BB 4WI0B 1AGCB 5EOTA 4Q7DA 4X66O 3NP3A 2XWCA 2WN3A 4HC1H 4MAYC 3L17A 5DJAA 1N0XH 3FSOA 4N0FB 4UQ2A 4YY3B 4WSKA 4CA4A 5DYOB 4NPYB 3FRPA 3UP1A 5D7JC 5HJ3A 4Z7WF 4AVIA 3GBLA 2YC1B 5HJBA 1I9JH 5ABZA 4JO5A 1A6TA 2RD0A 2ESVB 3HFML 5DZLA 1XSIA 1Q1JH 1SOQA 5IQ7L 4X4XB 1OCRC 3S36L 3BCFA 3S7GA 3ZQWA 4PJ8B 2EH8H 1HNFA 3QJSB 4B5EA 1NBVL 3KPMB 1QTPA 4AQEB 3RYCA 5I6XC 2ZDIC 1JOIA 1LEIA 3CCHB 2OJEB 4JL1A 1JNNH 3BAXA 4JY5H 4LEEA 2IQ9H 2NUTB 2VJXA 4BGLA 1ZA6B 4ZFGH 4MMYB 4PY7A 4OCLC 3KM1A 1NH6A 4IRJB 4UQIM 3MV8A 2XYBA 4XH2A 5C0AA 4AGMA 5LWYL 1KDIA 5IOPA 3IU4L 4KITB 4OR1A 1SQVH 4XBEH 5B38A 3BN9D 1YPZE 1AGBB 3K4AA 3EO9L 4X7CC 3V0JA 4DJMA 3QQXA 3UJJH 2FDBP 2K9PA 5F70A 2WBKA 1ND0B 3NCEB 3ZKMD 1SRDA 1ZPLA 3RKDD 3PV6A 1YEFL 1M7IA 4YDIL 5I1LB 5FHBH 3AB0B 3BEHA 1X4TA 2EJ1A 3T1FB 3CSFA 4O2EB 3R06A 1V3JA 4FI8A 2Y6SC 1HE8A 3AG2B 4TPRH 3BEVA 4FVMA 3HVDA 3NYKA 3L7FB 2HPOA 1HOCB 1TKWB 3NRQA 2ZDIA 1X4ZA 2MSPA 1R3IL 1BEYL 2NSQA 4X6EA 2W9LA 3QSKB 3HTLX 1FWXA 1XF5B 3O6KL 1NM9A 1ZANL 5FL7G 4XPFL 1XCQA 4MAUH 3DURB 4P9HL 2VDPH 5KS9A 2AQSA 3HBGA 3BQUA 2AQ1A 3LPOA 5HHXH 3WIIL 1BQLL 5K59F 1K3ZA 2YPVH 2R9AA 4J39A 4DV1B 1A3LL 3V4UH 1RZGA 3STZB 3WLWD 5J3HD 4WHCA 5GS2D 3TBYA 3KPRB 4WO4A 4ZUWB 1Q7YW 3AWEA 3F04A 3KXFB 4GEJA 4TVPH 2BOCA 2EIDA 2UXTA 1OP3K 3RAJH 5LXTB 2OW6A 3W7SA 3EGDA 4M4RA 1X9LA 2NCMA 4RMRA 4J6IA 3QNXA 2R1WA 3MR9A 2IJKA 5KSVA 3OKNB 1NCBL 1OVZA 4F7MB 2R2EB 5I73C 1R3KB 5L7XL 4M00A 4KKBD 1QFOA 2IPUK 3KL3A 3V4VH 4DN4H 1VQNV 2WKOF 2DL9A 1IDSA 1M42A 1Q1PA 1Z7JA 5I0DA 5KSVB 2NQCA 2OK0H 4RGMC 1EBPA 4KHXH 4XNDA 4HX1B 4PJ7F 4UILL 2E9IA 3C6LD 2E47A 2JELL 3OKOB 3QG6A 4MX7A 3E8FA 4MRCA 2P90A 1X5IA 4GI6A 5T5FH 3QTCA 2QZQA 2VO5A 4H0GA 1F11B 1RPUA 4MA8L 1R17A 1IZJA 3MRRA 4PVBA 5C2BL 3NA4A 3E7JA 4AK1A 3DTUB 1T1YB 3KH4A 4QKTA 4B5ZA 2VOTA 1IVSA 2X10A 3QIWA 2V3FA 1J5CA 2DB8A 3DURA 1G7PA 2XYCA 5EEXA 5FIEA 5D5PA 2EINC 1HKLL 4XX1G 2P8LB 3NJGA 1IKFL 4P23D 5B4MC 1Z2KA 2XQYG 1ZVHA 3WV0A 3QZWB 1XMOB 2GC4C 5GGUA 4AE1A 1FNFA 4WCYL 4YQXH 1T3FA 4GKNB 4QRBA 4UAOC 3V4VA 1ZT4A 1ICTA 2WB7A 3BWZA 1WA0X 2XBTA 3U9UB 4HVBA 1BFVL 3GIVB 2QKIA 1SLXA 4DK6A 4P2OC 2Y3NA 2P8MA 4FQ1L 4NPYA 3UC0L 2IFGA 2DJMA 2ERJC 5HGDB 5E2VH 2EYRA 3KJ6H 1PFCA 4H13C 2BC4B 1NAKL 4OGYL 4GY4A 3MLRH 2VDQH 3UABA 2HFFB 2NT0A 5IOPB 2PI4A 2GK2A 3UAEA 4M5YL 5FGSA 2BVPA 4ZMVA 1X7QA 1AR2A 1U95A 4DR2O 2BY3A 4HOXA 5DD3L 4MDIA 3FB8B 4NFDA 2XWTA 1KJMA 1S9YA 5HHQB 2MQGA 1AKJD 3GB7B 3GSQA 5LKNA 1TENA 5JOFA 1NI8A 2OXHA 3NSCA 5CP3H 4U1JB 3QRBA 1IXBA 1KPVB 5I1HL 3NEEA 4FQXB 1KYUA 2DIJA 1GC1C 3FCTA 1NAKH 3GMLB 4G9DB 4OGYH 5KJ4A 4CGUB 5KANI 3RL2B 2APFA 2EIEA 1S5HB 4E68A 2Q7EA 3UZEC 1CJYA 2P7TA 3MBEC 4JY4A 4R5XA 3ZRVA 1VFAA 4RGOH 1O9VA 2VL5B 2EX3A 1PG7W 5GS1A 4QTFA 2Y7OA 1J87A 4PVLA 1E50A 2D7PA 5DYOA 4I2XB 3FULA 4HZAA 1A6WL 2OIGA 2FTKA 5EUKB 2OMBA 1H8SA 4OM1H 1UURA 5BXFB 1A9BA 4LFCO 2H6PA 4OAWB 4X0KB 3ME0B 2AEPH 5JH7B 4NUJB 4PJ5D 3SODB 1UXSB 4DP6X 5B8CB 3KGUA 5ETUB 4GRLB 3QJRB 4MVOA 4L3AA 5FKAA 1AHKA 4LBAA 3RWFA 2I32A 4PJFB 4MB4A 4HXAL 1D9KA 3POCA 5JO5A 2KPNA 4R7DB 4A2EA 2UXCO 5IJVB 1Z0NA 5JIHA 4YDMA 2GIYA 1T7WA 3PNWA 2AKRB 2AVFA 4AW7A 5MENE 2H4EA 4TQDA 1NTDA 5EF0A 3TIDA 1SRYA 2PN5A 3GPEA 2MCMA 2VLKA 4LEOB 4Q4EA 3JT0A 2HKOA 2XXFA 5D72H 1A1NB 4Z18A 4JFDB 5CNHA 3OT7A 3IMUA 5G5DA 1TTBA 2FWOB 3CC5B 2WSSG 1FNHA 3FKSG 1ASQA 1KENL 2A73A 4J4PC 4JM2D 5DTFA 3EW3B 3IMVA 2PF6A 3LKSA 3T3ME 5A1AA 3OQ3B 5EDXA 5D93C 3HMWH 3RZWA 5JOPD 1ACCA 4CBPA 5IIEB 1YZZA 3NUKA 2VLJA 3VGAC 4XNUL 2PO6A 4GX1A 4JI3B 5LJYH 1MRFL 5F7UA 1DF4A 3BAAA 3OAZH 1IBMO 2QDOA 2CDEB 4H0LB 4IRZA 3US0A 4FMVA 3GMMA 1U3HD 2KPWA 3M6DA 5BV7H 4F37K 3QQ3A 5DQJB 3GMRB 1FGVH 4M8UA 1HEZB 3ARUA 4RGNC 3PABA 3FRPB 2WXRA 1S7XA 2J1WA 2Z0BA 4WFGA 4L29B 2WQSA 4JI8B 1YYML 1EHAA 5T5NG 1Z5HA 4KK5C 3FYEB 5AW4B 4V33A 1G1OA 4E42A 4L3EE 4RAVB 4ADIA 4JG0H 5FUZH 2QR0A 3AB0C 2DWXA 1JX9A 1HH6B 1ZE3H 4UTCA 1UZ8B 2VQFB 4X7TA 5FUCC 5KSUA 1F6LL 3SD2A 2Z92A 5EOCH 1WB8A 2EZ0D 2QQNH 2ZAHA 2WTRB 3OLEA 1D6EB 3CSGA 3C5SB 1HKFA 1E1QG 1CDBA 1NUDA 1QWHA 3ULVH 1KCSH 3C5ZC 3ZRXA 1K73W 4LCWD 2ICES 2R8SH 3KVDD 4JPIB 4YJ2A 2Y07L 3QWOB 3QYCA 4NX0A 1P84F 1QR4A 3Q5OA 4FFZH 4JJOA 4DN4L 1BD2B 2NY2C 3KYNA 1FCCA 3KVQA 4HMCA 3IFOB 4PGCB 3EYSH 3O2DL 4WNQA 4S1RH 4BUGA 2XC8A 3WNKA 1WFIA 3G5YA 5EUOA 3ZQXA 1KU9A 3HZKB 2A3QA 4JHAH 5DUML 5SWSA 1MJUH 1KYOJ 1UQSB 2FECI 2P80D 4IHOA 4PJ8C 5H35A 4RRPM 1YEIH