1OCOB

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ocoB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ocoB02
5B1AB 1AACA 2YAQA 2LLNA 1PNDA 1SHWA 4HCIA 5F7AA 1BAWA 1GSKA 2FT8A 1VLXA 5I6KA 4YSOA 3NJIA 3MBWB 3BVDB 1KYAA 1SFDA 2PP9A 1AAJA 4HAKA 3EF4A 1NINA 5LDUA 4YSRA 4P5SA 1L9RA 1AZNA 5D4JA 4DP7X 3FSZA 3X2QB 2HRGA 2HX9A 1GW0A 3FS9A 3N2JA 2FQEA 2X87A 2BW4A 3SBRA 2XU9A 3TASA 2YEVB 3H56A 1HFUA 2IDFA 4QKTA 3FU7A 4P5RA 3EHBB 5D4IA 2CUAA 1W6WA 2AVFA 4KO9A 2Y69B 2UX6A 4GY4A 4YVUA 1ASQA 1NZRA 2FT7A 1ZPUA 1OCOB 3X1BA 3QPKA 4DP5X 1FWXA 4X4KA 4HIPA 4YSQA 3SBQA 3AY2A 3DKHA 4DP8X 2BWDA 3AW5A 3WNJA 1BQ5A 3CDZB 3NP4A 3U25A 1J9SA 5AZUA 3OMAB 2W8CA 4YSDA 4Q8BA 4JKNA 5PCYA 2GSMB 4KNSA 4E9RA 4A67A 3T6ZA 4GP4B 1YLBB 4HHWA 4DPCX 1GY2A 2PLTA 4GXFA 3IBOA 5B1JC 2H47C 4BDVA 2PPDA 4L0PB 2DY2A 3FT0A 1E67A 4BWWA 2N0MA 4HHGA 2IDUA 3NT0A 2PPFA 2YAFA 2R7EA 1L9OA 2B3IA 2XYBA 1V10A 3IN0A 4E9WA 2WSDA 1ZDQA 2QDWA 3ZDWA 4YVNA 4AX3A 3WKQA 3ABGA 2QPEB 4KO7A 4JHUA 2BZCA 2XVBA 2CBPA 1EHKB 3MX0B 4YSPA 1I53A 3SBPA 3CVDA 3AG2B 1OCRB 1A4BA 2P80D 1QHQA 6PCYA 3AG3B 2E86A 2MRYA 5I6NA 4A2GA 2GB2A 2CCWA 1AOZA 1ID2A 3OD3A 1ZDSA 2AZAA 1PZBA 3ASNB 3FPXA 4G7SB 3L45A 2VN3A 2BP0A 3X1NA 1JZJA 1TU2A 3NJLA 1JVLA 4KNUA 4E9YA 3GXUB 4E9SA 1BEXA 1ILSA 2I85A 3QJUB 2CAKA 1PNCA 2GI0A 3WNIA 2PPAA 1BXVA 4KO5A 3NJFA 3NJNA 1ADWA 4A2FA 1KCBA 2BW5A 2HXAA 5I5JA 2YXVA 4YSEA 4N4YB 3IN2A 3OQRA 5I6MA 1SNRA 3FSAA 3QJSB 1NIAA 2FQFA 4YSAA 2JKWA 1PAZA 3S3DB 3IEAA 4CSZA 1BYOA 4ENZA 1RZQA 2XWZA 1JOIA 3GYRA 2YAHA 3JT2A 4G7QB 3QJRB 4UAHA 5F7BA 3QJVB 1B3IA 3UAEA 3ABLB 3T6WA 1TEGA 2YAMA 1A3ZA 4DP4X 3ZIYA 3QJTB 3FU7B 2JXMA 4F7KA 3ASOB 1DYZA 1WA0X 2WO3B 1ZIAA 2YAEA 1X9RA 1GR7A 4W1TA 2FJSA 4ZK8A 4KOBA 1WA2X 1A4AA 4KNTA 1AS8A 3NJKA 4BK5C 5I26A 3GDCA 4KOCA 1ETJA 1SDDA 3SQRA 3T6XA 4DPAX 1W6LA 3NJMA 5B7MA 2BHFA 5I6OA 2YARA 3FYIB 4AKPA 4NB7A 1KV7A 2B08A 1QNIA 3EH4B 2IAAC 3OMIB 1N70A 3QQXA 2UXFA 4DP1X 4G72B 3FU9A 4Q89A 3ZX1A 1OF0A 2XX1A 3NYKA 1L9SA 3TA4D 1A65A 4HCGA 1N68A 4YL4A 4CSPA 2FWLB 1CURA 2YAPA 4F2EA 3CG8A 3QJQB 1GYCA 1KDJA 1PCSA 2XXGA 2I7SA 2FT6A 4G71B 1HAUA 2GC7C 4YSTA 4F2FA 2IH8A 4UF7C 5E9NA 2UXTA 1ET8A 5TK4A 4KO6A 2TSBA 2YQBA 9PCYA 2J5WA 3TBBA 2X88A 1W8EA 1OCZB 1EZLA 4AI7A 2FQDA 4N8UA 4EF3A 4NAJA 2DV6A 1JVOA 7PCYA 1ASPA 2VSKB 1GY1A 4DP6X 1BXAA 1NIEA 3T9WA 2BP8B 1NPNA 1AIZA 2GBAA 3H4HA 2JFCA 1SF5A 5FC9A 4BXVA 4TXVB 4M4RB 3V9EA 1DZ0A 2ZONA 4G7RB 4BXSV 1NDTA 2IWKA 4AKQA 1AZRA 3G5WA 1OOWA 1PLCA 1R1CA 2J57A 2NRDA 1SHXA 4FAAB 2XLLA 1NIDA 2FQGA 3NP3A 1UATA 4DPBX 4GP8B 1XB3A 1WS8A 1PZCA 1KDIA 4W9ZA 5I6PA 3FU8A 1PZAA 3FSWA 2PCYA 4DP9X 1ILUA 3FPYA 4HALA 2ZXWB 2ZOOA 4HZ1A 2BZ7A 2DWSA 2IDQA 4GP5B 5B7EA 2Q5BA 3NSDA 1JXFA 1JZFA 2XV2A 2OCCB 1J9QA 1SJMA 1NICA 1CYWA 1E65A 2VW4A 3HEIB 3TU6A 2FNWA 3UABA 1BXUA 4FA7B 3KW8A 3AG4B 4NERA 4E9XA 2HRHA 1RKRA 1OCCB 4BWTA 2Y1AA 3FQ2A 1JZHA 3WIAA 2UX7A 1BQKA 3ZBMA 1F56A 1AR1B 3NSYA 1CYXA 1MG2C 5B1KA 1A4CA 4A2HA 1FA4A 3PCYA 5I5MA 5D4HA 2I7OA 5A7EA 3ABKB 1M56B 1AG0A 2MTAA 2RACA 1MZYA 2OJ1A 2UXVA 2BO0A 1TEFA 3NJHA 4HCFA 3FQYA 1KGYE 2UXGA 3S3BB 1PF3A 4YSUA 2VW6A 4RH4A 1SDDB 2PP8A 2Q9OA 3PAVA 3X1FA 4E9TA 2YXWA 1GS8A 3TBCA 2PP7A 3PAUA 1NIBA 4PAZA 1WS7A 2BWIA 4QLWA 1MDAA 3UACA 1IC0A 3BQVA 2J55A 3OM3B 4BWUA 1KCWA 1J5CA 3CVBA 1NTDA 2QT6A 1AG6A 1ZIBA 2P80A 1PY0A 4JHVA 2HX7A 2CJ3A 3FYEB 4YSCA 4WTQA 5TK2A 2EINB 3D12B 1CC3A 2IDSA 3JTBA 4WKXA 4A2EA 1RZPA 1PLAA 3EH3B 1OE3A 3CVCA 2QDVA 1E5YA 3N55A 2YAOA 3NSFA 3PLYA 1OV8A 3UADA 1URIA 2XX0A 1NIFA 4BDVB 1V55B 1ET7A 1A8ZA 4G70B 3OMNB 4MFHA 2DYSB 5PAZA 1NWOA 1T5KA 1NPJA 3NSCA 1PMYA 1HAWA 1GS6X 1XMEB 1AZCA 2A3TA 2HX8A 2GHZA 2R7EB 1AZUA 3H4FA 2PCFA 3DTUB 5I5IA 1IBYA 2GC4C 4E9QA 2VSMB 4PCYA 1JERA 1JXGA 4A68A 2WO2B 2HZHA 3EH5B 3PXLA 3X1GA 1IKOP 5AFAA 2IWEA 3NJGA 3S3CB 1AS6A 1L9TA 1SF3A 2EILB 2IH9A 4AZUA 3ABMB 1E30A 3V9CA 1KBVA 3CDZA 1AANA 1J9RA 1NWPA 3PPSA 1L9QA 2GIMA 1XB8A 5B1JA 2DYRB 2XV3A 2ZWNA 3AG1B 1M57B 2FTAA 3WI9A 2AFNA 1ET5A 1L9PA 5B1BB 2AANA 1WAEA 1M9WA 1BYPA 4E9VA 2VM3A 4M3HA 2CALA 2BP0B 7PAZA 1X9UA 3ERXA 1JZIA 3IE9A 1IUZA 1BQRA 1MG3C 5EHFA 3WKPA 4DP0X 1JZEA 3FQ1A 4YSSA 2H5UA 2QPDB 1KBWA 4AKOA 3X1EA 5I6LA 1RCYA 3UGEA 2VM4A 2AZUA 8PAZA 2PPEA 1OE1A 3KW7A 2OV0A 1XB6A 1AQ8A 2DWTA 1AS7A 1SFHA 2EIJB 3HB3B 2J56A 5B3SB 4UANA 1PLBA 5I28A 2BP8A 4GYBA 2IWFA 4A2DA 1V54B 1FFTB 1J5DA 1E5ZA 1JXDA 1TKWA 1MZZA 3UAAA 1ZV2A 1QLEB 5AKRA 6PAZA 1WA1X 2XUWA 1GS7A 1IBZA 5ANHA 1AZBA 4A66A 2HLEB 3DIVA 3T71A 1JZGA 2EIKB 3WG7B 4K9JA 2XXFA 3FSVA 5B7FA 3CZUB 1CUOA 4DP2X 2PPCA 3S8GB 3NJJA 2IDTA 3S8FB 2EIMB 1J9TA 2VMJA 3PAZA 3T6VA 3C75A 2TSAA 2W88A 5IY5B 2XV0A 2VW7A 1ASOA 3RYMA 1OE2A 3AZUA 2H3XC
chains in the Genus database with same CATH superfamily
3T1WA 5IF0A 4QXTB 5GHWH 5BQ7B 3B2VL 5E4IA 1RZJH 3EOTH 5AVYB 5I6XC 1CICA 1J18A 1DZBA 1JFHA 1MPAL 1Z9MA 2DWEB 1P5UC 1GSKA 1NGXA 1R3JB 3TC9A 1S76D 4B5ZA 3HKBA 2AMUA 1CDUA 2XTJC 4ZT1A 5L2JA 4S1SL 4F6EA 3SEPA 2YPLA 4TV9A 1EFXB 4G7VH 1I1RA 3PAYA 1R5IB 2Q8AL 1C7TA 3GJFH 4P9HH 4F92B 4HBCH 2YI8A 2QPFA 3EF4A 3C60A 1NINA 3EOYG 4BCYA 4GQZA 1MI5B 3ZQWA 4M5YL 1L9RA 4OFIA 1CBVL 3FSZA 1AI5A 1FNSL 4KITB 1M1XB 3FS9A 1KBGL 2R1YA 2UXBB 4HJJH 4BELD 4I3GA 4XHJD 2FATL 1N9PA 5CMAA 4MSWB 4X4MA 2H9GA 2KPNA 4IKIA 2NXZD 4N0YH 1Q7YW 4RLDA 3OKMB 4XP4H 4Y2DA 3GT6A 2Y69B 3ABZA 5C0ND 1V05A 2J8HA 4P46A 5K9KA 3OZLA 3X1BA 4NPJA 1X5XA 1F4XH 1A0QH 3HNTL 5IFHL 1U8KB 3TN0D 5GZOA 5CA1A 4CJ0A 1Y1DA 2ITDA 5IKCB 1PG7L 2MH4A 3APQA 2BC4B 4IMLA 3C5ZC 3NP4A 5I16A 1SBBA 3PHQA 4V1DD 1ZLDA 3EO1B 3IGAC 1NAMA 1WAAF 2ZXEB 3VI3E 2B14A 4PJDE 3H53A 4GB9A 4ONOA 4N87A 4NQQA 5J4MA 1EUTA 3RY5A 4LFHG 4XNUH 5CSBA 2Y9RT 5T3ZH 4EZMA 4XGZA 3V4LA 4DCQA 4PJ7B 3BC9A 3E80A 4JPIB 1QR9A 1OCWH 3QS3A 4PJ5E 4ZOLA 2KBGA 5KVFH 3DO3A 1IBHA 1MZEA 3IBOA 5CZKA 3QWOA 4ZSOB 3H3PH 2YPKA 2PW1B 5KA6A 1E67A 3FRPG 4F7CA 3KLAA 1D7BA 4WFFD 3MI6A 3EH2A 1MXGA 5F1SA 2WQWA 5CJ5A 1IX9A 4UVBA 4PJEA 3V0FA 1NEZG 4N1CA 3CCUV 3AM8C 3DURA 5AVSB 1J12A 2FB5A 1PQZB 2UZYA 3Q3GA 5I74C 1L0XA 4DV7O 4JCLA 2QWPB 3ZZQA 2VN5A 3TTYA 1W0VA 4QGYA 4I2XA 4R2GD 3VSUA 1EHKB 2O1AA 3BAWA 1YY8B 2E7LC 3MX0B 1N0NA 2OLDA 3PL6D 2GYSA 3LEYL 4NZTL 3SBPA 1I9IL 1H2LA 3EFFB 3GRWA 1AE6L 4Y16D 2BFVL 1GRWA 4XR8C 5I1JL 4MZ2A 1R9FA 4KJQD 4HP5A 3T2NL 3ZKXC 3SJBC 2F7OA 2X38A 4WI6A 2WLIA 1B2YA 2ZWKA 3EO9L 4ALAC 1RZ8A 3H1JH 1YNLH 2BSED 1RIHH 2AZAA 2OKMA 3L4ZA 3JWOC 4X2UA 3ESMA 5ECJE 1F3RB 1T5XA 2B1HL 3P3SA 4ZFZB 5EZYA 2ZAGA 2RDCA 1WF5A 3A4AA 4I9QA 1TNNA 3AG3C 3L45A 4NPYA 1T0NA 3G6AB 4MMXB 4KVCL 1PX8A 2X4OB 3SPCA 4KHXL 4N3TA 1E5BA 4DV5B 3EF7A 4X1YB 1FZMA 3T1YO 4OJCA 3CVHB 3FO9B 4U4IA 2BPBA 4QRQB 3RTQB 4DJMA 1HOCB 3K5LA 4HKZB 4GXVL 1IQDB 4UDTB 3VFWA 2XZZA 4KKAD 1TJHL 1TZ8A 4FTVA 4MX7B 2BDNH 3CFJA 1KEML 4AGPA 2Y23A 1CICC 3C6LB 3HJEA 4UOW0 1FD9A 5FWQA 3QORD 1PAZA 1KXHA 4FMKA 4XPHL 2WMPB 4AYFB 2YWYA 2LE9A 1X4YA 5DUMH 2MPAL 1HXMB 1IM3D 4DV2O 5FYKL 3GYRA 2CM5A 4ZHQB 4OQTH 3U82B 2OR9H 3C60C 5HDWA 1CD1B 4K7FB 4XBEL 5CSZA 4QXGH 4GFXA 4I55B 3D0VA 1UXSA 2NTFA 1UC6A 4H0HB 4K7PY 4DK3A 1M4UA 4A39A 1WFMA 3CJHA 3TBSA 5ANMA 4YAQB 1X9LA 1TR7A 1Q6HA 3WKYA 3DROA 4JE4B 1A6VL 4WI0A 1JP5A 4QRPA 4OCSH 1YEEL 1N4CA 3BT2H 2OZNA 1L0YA 3MJ7B 3O9WD 4Y2DC 1HL4A 4YE0A 5CR8A 4P46C 5JHDB 3N9GL 3G67A 4DR1O 4YJZL 3LKPA 3BOVA 1MEXH 1KCUL 3DX4A 4MA3A 4O2BA 4LLVB 4UQDA 4WQOA 5D1QD 1A7PH 2ITDC 1E8XA 4J7KA 1UTDA 4OGQB 2D31A 2YARA 2VXTH 4WCEV 4TWKA 2NY4C 4G6AD 4G1EB 1GYWA 2Y3AA 3CZNA 1SBSL 4IT5A 5C0EA 2UXFA 3N42B 4JFPB 4WFED 3IGKA 2A6IB 2DQJH 1BEYL 3G71V 4WDIA 4WO0A 4QCIB 3V6OA 2CG9X 2WBWB 3ROLB 1IEHA 1SQQH 4LBEA 1HI6B 2ZCEA 3RN4A 4L2LA 3OD4A 1UWFA 1N68A 3W57A 2RA1A 4UBDD 3L5WB 3RNKA 2FX8H 3BPCA 4FDWA 1FCGA 2NUTA 2CE6A 2CMRH 2VDOL 1E42A 4F2EA 3QRLA 2KT6A 5D4QA 4FL4C 3TTSA 2FO8A 4JCWA 2ZXGA 2F8IA 5KJ4A 1TZAA 3UPCA 4OVVA 2G5UA 4H8QA 2X0WA 3E89A 3CVIL 1VKXA 4P5MA 3IDYC 2XETA 1ETB1 3ARDD 2R2HA 4JFEB 3TA3D 1IBBA 1QACA 4S1DC 2WD0A 3N3EA 3Q06A 1QZ1A 3BW9A 5I76A 4AJ0A 5KSBB 2FH8A 1DEEB 2NSMA 4QHKJ 4X5XA 1J1PL 1YO4A 3HZMB 1JVOA 4Z77A 1GY1A 1FNHA 1P2CA 4JZJB 1G9NC 1ETZB 2BP8B 4KROC 1K97A 2X70B 2WLMA 4NQSA 2M26A 4GQ9L 5E56A 4BZ1L 3TIEB 4M4RB 4PRDB 4H13C 1OPGL 2JCCE 3QFJA 4G80A 3AK3A 3IETB 4L4TE 3TFKC 3A6CL 3SGJA 2DEYX 3O3UN 4BK4A 5JORB 2EZ0D 5ECGA 4BFJA 43C9B 1DJIA 3HKCB 2FIRT 3G9AB 5E4EC 4UMSA 1N33O 2HT2C 4ALAH 5L7XH 3S4SB 1U8HA 3JWOH 2PCYA 4KKLC 3TN0A 4AV0A 2XNDG 1SMOA 5BMVB 2APVA 2Q3ZA 4A7GF 3OG4B 4V1DA 4OB5L 2JGDB 1MHHA 4LL4A 4CSTA 1S7RB 3IDNB 1Q0EA 2MOQA 4R26L 3T4YB 3OSVA 4UQ3A 4OD2B 5BZDA 3N1MC 3NQKA 4I4TB 2EE0A 4IBUA 3GSNL 3MLXL 4YO0B 4R6UA 4UM8B 2L8AA 3MOAH 4OLUH 4C4BA 5JHBA 2GI7A 1ZV5A 3KYNA 3FQ2A 1TTUA 1GZQB 3F01A 5CB4B 2EECA 1FN4B 1K2DB 3PWPE 3MFFA 2K1MA 3VG0L 4A2HA 1BT8A 1W72L 3QIUD 3QNYA 1MHCA 4WFFA 4NC0B 1QU7A 5EC2B 3LVEA 1F90H 3LSQA 5DXWA 2WWWA 3FCBA 1AG0A 3ZQXA 4X6BB 5GXBB 4X1KB 1IAKB 2CDEB 2V5TA 4G9DB 4DVRH 2JSFA 4GLRI 1ZJAA 2Q73A 5FPOA 1NC4D 3E0GA 4ONHB 3QDGD 5AW8B 4BZ2L 4PJIE 2N04A 4OZFB 1YEJL 2VIRA 4OF3A 1ZPLA 3EAKA 5LBSL 3DPDA 1IE4A 1U8PB 1BBJA 4YDKL 1QRNE 1ZX3A 1IC0A 4HIJA 4QF1A 3PL6A 5J6HA 2J55A 3ZRFC 4AG4H 1WZKA 5KW9H 3GSOA 4LCVA 4ODVL 4JZGA 5MP6L 4XX5A 1MAMH 1FORH 3X3GL 4TQDA 1DJWA 2LVCA 2XSKA 3NA9H 4WAFA 1FVDB 4F33B 1DVYA 2V5RA 3CPLA 5KZCD 2Y7MA 3WL9A 2ESVB 2QELA 5F6IC 3JXAA 4WKXA 2KG7B 4IGGA 3EH3B 2V7NA 4I0XA 2BSEA 3OX8B 3ML0A 4QYOA 1BA9A 3MV7D 4NZFA 3MD0A 5BS0E 1RAMA 4NUMA 3K74B 4ZOCA 1NAMH 4XPFH 1OV8A 3V6OC 2OSLB 3OLIA 2MW2B 1EMTL 4LCWB 4LBEC 1W0YT 2AEWA 4F5CE 4ZMAT 1RUPL 1KGIA 1AGFA 5F7EH 3W3BA 4TUOB 3IJ9A 1XF2B 1SLUA 2D73A 2LGNA 4HUXB 5HDQL 4NO3A 5LWYH 4PBVC 1PY4A 1HZHH 2BNQD 4NQED 3QAQA 4OZHA 4HYOA 3HE7D 4MVZA 1D5IL 3NCJH 2WQAA 4FXKA 3W1ZA 2E59A 5FLVA 1K3ZA 2PCFA 4JHZA 2E8ZA 2J8UA 1LD9A 3E35A 4CAGA 1IGIH 4XBPB 1WWCA 3PXLA 1ZHBA 1J88A 1NL0L 1OAZH 4MD4B 2M6YA 3QORA 2MK3A 2VQ1B 4ZUVA 1MJUL 3O11B 1QNZL 1AS6A 4MT8A 2OMVB 2K8QA 3ZKQD 3GMNA 2VM9A 5IK3B 2EZOA 1UT1A 4P5TA 1ZS8A 1RV6X 4NUQA 5AVQB 1HHJB 4W9HC 3RL1B 4X5LA 4G1MB 5HI3D 2AQRA 1G9NH 1K5WA 1HXKA 3ABMC 1OF2A 2P06A 3HKEA 1I1FB 1YPZF 4WGVB 3IMTA 3H9HB 4YXHL 3KAAA 5JR1H 4XHJC 4X7SL 3GRWH 3SGJC 4TUYA 5CEZL 3B2DC 4RWYH 1JVKA 1BYPA 5D7KD 4NYLB 5INCB 4PVLA 1W59A 4J2XA 4MTFA 5DHVA 1WPBA 4XVTL 2KUTA 3FZUD 1HCFX 1J5EO 3ARQA 5C0NC 1BZDA 4JFVA 3MXVH 3DARA 1MELA 3TWCL 4DP0X 5E0QA 1G7PA 3TN0C 4X65B 1N26A 3X1EA 4HU2A 4PJ8B 4X99A 2QLYA 3SJAC 4ZS7L 4NQCE 2VM4A 2BVPB 3KZIZ 3LNFA 5C09E 5E1AA 2OV0A 2F4VB 1ZTXE 3AJ7A 4Y5XA 3OKEB 1AGBA 4RISH 4Z7VE 3MRJA 4ZYKA 4NQCD 1QLFA 3RBZA 4OLWH 4U1NB 2EE6A 1OP3K 4GT0A 4MDRA 4ZUTA 4HMEA 1UVQA 4MNQB 4X6EB 3OZ9H 1FFTB 4DOHE 2FJGA 5A6IA 1DN0A 5F89B 1W0WB 4OKDA 1Y4MA 4OJEH 3MO1B 4NIKB 1Y18A 4JLRB 4Y8DC 4Z7NB 1WZLA 5B66Z 1A7NL 3OPUA 1L9MA 5CA0A 1NVPB 1WBXB 1F1AA 5DWUH 1CFQB 3L71H 5C6TH 5HJ3A 3ETBF 1ERNA 1CTOA 4FZ0A 3BP6B 3C2AL 1Y6NR 1NBYA 3TA3A 5JA8B 1IVLA 3G9VA 1CGTA 1WAZA 3IMSA 4IS6B 4XCYB 4KU1A 3LZPA 1BHBA 1SOXA 2F5AH 4DKEL 1SHSA 4J3TA 5B1AB 2P8MB 2A9ML 3J8F7 3VAEA 3LKNA 4YJ2A 2VDRL 5J11B 1TZOA 2D7TL 3PL6C 5FGRA 2ZJSL 2R4RL 3FQRA 4YX2L 4LK4A 4DR3O 4OW6A 3MV01 4Y16C 3SZKC 4E42B 2EDBA 2W0FA 1ZLVH 3BFRA 3QG6B 4X66B 4HAKA 2GSGA 2ADFL 3QDHA 4RCAA 1SGKA 4F9PA 2PCXA 3U46A 4JYCA 1XTLA 3SBWA 1T1ZA 5ICZA 2R0WH 3ZMRA 3FFDA 1FIGL 1JV5B 3MUGA 3TP4A 1UGNA 1P5VA 1U8CA 2RMKB 2X87A 5JXED 3K81A 1WFNA 2VDNH 3IS1X 5B39G 3B3IB 4K7PH 4YVUA 1ASQA 4NC2B 2NDGA 4FXKC 4WO4A 1AI7A 1IKFL 1HIML 2X2YA 3FONA 1DVQA 4OFQA 1E4XH 4KKAC 4NENA 4DV0O 1KNOA 1CFVH 1MLCB 2IH1B 5GONA 3DUSB 1FXHA 2B2XL 5TDNA 3V4UL 1BREA 1XMOB 3HRZA 5IUCA 3CDZB 2X6AA 4K3AA 5FKAA 1SY6L 1JNNH 2C1PB 3QORC 3A67L 1UM5H 2PTUA 5F9OH 4MLSA 4JFOA 1TNMA 2ED8A 2V8MA 3KCYA 3KG5A 3QIUA 2CHXA 4NKMB 2QE7G 1JE6A 1L9NA 3BE1H 4QGTA 5C6PB 4GYCB 2ZKYA 3DRTB 4LKXB 5CBAA 3S4SG 2Q7EA 2F54B 1WAPA 1T7ZA 1EZSA 5ID1A 4HJIA 1QAWA 4BDVA 4HSAC 1N5AB 2QR0A 3H55A 1JRHL 1NC4A 3BJLA 1MFNA 3ZBHA 5ABZA 3ULUE 4N2LA 3ZL4H 5FM5M 2KQMA 5EULV 3UDWC 2P8LA 2XZQH 5DHDA 4BFRA 3TM6A 5BRPA 3Q1SL 4O58H 3O9WC 1G1YA 1WE5A 4EUPA 2CRIA 4IYHA 4IRZL 1NLDH 1HZLA 4ODHH 3CCHB 1INEH 4NKDB 2ZE8A 5KMGB 1MVUA 5AL8A 3ZDZB 5K9QI 3NFNB 2QPEB 1U95B 1UKQA 2X3BA 2A9NH 2XNAB 3B7RL 4IIZA 4KO7A 3FCSB 5D1QC 5GSRA 2AK4A 2EDKA 4G6AC 3VQMA 1KLUA 3HC0B 2JWYA 3BLPX 1OT1A 3R4DA 5CZRA 1E9OB 3SOBH 1WTLA 4L8BB 4Y5XC 3ARYA 5E03A 3VFOA 4MQ7B 3RA7L 3MLYH 1QFPA 4DN3L 2NTSP 3H2WA 3FH7A 4X7TB 2IC2A 3EG9A 3N1FC 3FT1A 3V10A 3RLSA 1S9WA 3CQFA 6PCYA 3QZOA 3WN5B 4BM7A 2A74B 4ZOAA 3VWKB 1B4JL 4LP5A 2BNQA 4NQEA 5HPMA 5DJ6B 4OZFG 4WBNB 3HE7A 1J10A 1NSNH 1LK3L 3OXRB 3IJHB 4GW4A 1TTGA 1ZVHA 1CL7I 4FYSA 4WFHE 4I85A 1RZKC 2BP0A 2FDBP 3FUJA 3CUPB 1S7VA 2LGWA 4G27B 2BVYA 3CXDL 4FJCC 5E1GA 4Y2NA 4JO8A 5ILTL 3T8VA 3IMUA 3TA3C 1TQCC 4Z7WE 1G7MB 2I85A 3HI1B 3NPSC 4BSWA 5GJTH 4WFHD 1ZY9A 3RWCB 4GMSL 3HPLB 2WCGA 3T3PE 4JHWH 1N36B 2IOIA 3N2GB 3WFBL 1ADWA 2BSKB 2JQZA 3BSZL 3PQYA 2VLLA 5AZ2L 4FI7A 1S9KC 4YSEA 5L4IA 5BXFB 4ZO8A 4B3SO 1IU1A 2AC0A 4JDEA 5DQJA 3NN8A 3MCKB 4HT1L 5CKAA 2QVMA 2QPSA 3MOQA 1RHHA 4OV6F 4YE4L 2W0FC 1FE8L 3EFOB 1JRHI 1FL5A 4PTTA 1JOIA 3T4ZA 1CDYA 2YAHA 4AQ1B 5AL0A 2X05A 4YQXL 3WB0A 4F9PC 1E6JH 3TEYA 2EZ0C 4HAMA 1F2QA 5D93C 3QJVB 4LCYA 5AB9A 1MIEL 1NFDF 2EXYD 1KIUA 2VDOB 3F83A 3H9YA 1XGQA 3OG6B 2OCFD 2ZUQC 4FHJA 1XREA 1RLBA 5C0CA 5KVMC 1NFDB 3ARVA 1J9CT 4GKKO 1KEGH 4PEEA 2Y1YA 5DRNB 2NXYC 4FG2A 3SDYL 2X09A 3WFCL 3O3EB 3WELA 2NY2B 1VSCA 3D85D 4PGBA 5J7CC 5JOEA 3QUZA 2X44D 3VXUD 1S7SB 2YJQA 1OAYL 5BRQA 1UCBH 2PABA 5AYQA 1DDTA 2VLJD 4WO4C 5JDSA 5E4AA 2WPGA 2G75B 3QULA 1GM7A 3QIBA 3W7TA 4YZFF 3T04D 4DYLA 4UNUA 3V6ZA 2B39A 3HRZC 5DFAA 2CKBA 1IC7H 3GBDA 4X4YA 1KT2B 5A2JH 5ID0A 2N74A 3NEXA 4JGSA 3QIUC 4OGZA 3CRQA 4YHLH 1NDGA 4TQFA 3H1IH 1SYVA 3KLQA 3S0PA 3UFIA 4HGKC 3TA4D 1DFBH 3D07A 4JO1L 4RAVB 3DVGB 4N26A 4Q52A 2DE0X 1LO2H 3UPRA 3NJVA 3HW7A 5E24E 1WTGT 2AJ3B 4GBXD 4PREA 3WV0A 1KTLB 1T1WA 1Z1WA 4J8RB 1ZVSB 4OLXL 4D94A 3RHWK 3VTMA 2ICES 2QGNA 1CB4A 2XA8L 4UIKH 3QR0A 3B37A 1CLCA 3MBXH 1HAUA 4KV5F 1BSIA 4Y9BA 5C0IB 4X80H 1SOSA 4L8SB 1CVSC 2V9UA 1KJ3L 1U3JA 2EXSA 3AC0A 3L5HA 4XE5B 3ZE2E 5DHVH 3GLAA 5ICYB 2W07A 4KO6A 4FABH 4O4IB 4YEFA 4U31A 2V4LA 4QTFA 1CF1A 1BDYA 4RDQG 3NCWA 2EUWA 1LWHA 3TFBA 3GSNB 1XIWB 3GUTB 3ZRXA 2ADPA 2WBXA 3JQOB 2AW9A 1XBLA 4YJ3A 4FQ1H 1QI4A 5FNVB 5HJDA 3TZVD 5KYYA 4NRYB 2IDCA 1ICTA 4YN3A 3S96A 1W72B 1IL1B 3J80N 3PIQA 1YEIL 2KL6A 4HWBL 1US6A 3DPBA 4YY3B 5JXEA 4N0UB 2V2TA 4RIRA 3RWGA 5C0GB 5J2TB 1G6RA 4JV5B 4EE2A 2FQGA 3V2AR 3KLHD 4DR5O 5C71A 4NXMO 1Y6KR 3HE7C 2UXDO 1LNUB 1WS8A 2OJEA 2OTWB 4RMSA 3D3VB 2W95A 2D7NA 3AACA 1F86A 4HUWB 5LP6B 4HPOL 4AH2A 3WDHA 2NY0B 2ZUTA 3NCYP 1C8PA 5D7JB 4MNHB 2EKJA 1CF8L 4CC5A 2J3SA 3MLRH 1CE6B 4JFDE 3THOA 3VI4B 1BAFL 4KVPA 4C4KT 2PO6B 4UMGA 5C07A 5TPWL 2ZQMA 4W9CC 5BZXA 4WW1A 4ZO6A 1B90A 2CDFA 4R7NB 2YGNA 2DLFL 5HI3C 4YUEH 3NR7A 1YECH 3OXSB 3ZHRA 3PWNA 2WLZA 1KB5L 1X59A 3WIAA 5FOBA 1MSPA 4HFWB 3AB0B 3NSYA 4F8OA 4U6YA 4KAQL 1ZSDB 1GGYA 2CHZA 2P52A 2OX5A 2XFXA 4OIIH 2I7OA 3QJFA 1K34A 1TUEB 2CH7A 4ZMOA 1S72V 3FZUC 1VCBC 1U3ZA 3LPOA 1CIUA 5HHQB 3E6FB 4P2RD 1H3TA 3P3UA 5JHLA 3NA4A 5IV2B 1SXNA 4BUQA 2OJZL 1SDDB 2FYYA 2YIAA 4X8JA 3WCYA 1YAZA 3S35H 1GS8A 5DD5H 3GS4A 2CA3A 4Z5RA 1C16A 3C87A 4O51B 2EE3A 4BW5A 2I5YL 3QUZC 1MHEB 5DJYA 3EDDA 4WLCA 2AZ0A 4WY7H 3SPVB 4G8EA 5JQGA 1GKEA 4GSRA 5DUBB 2L7JA 1MWAA 1NTKH 3ECBB 5JJEB 3LPGA 1NTDA 1LP9F 4JHVA 1T22A 5DMIL 5DT1L 2P45B 1LP9B 4L4VE 4NDMA 4JHBA 5IWLA 2IADB 1FDLH 3O3BB 5L3DA 1ZEAL 2DN7A 1HH6B 1TJGH 3CSBA 4PVNA 4P3CH 3EADA 4GSDL 4P99A 5F1NB 3FB7A 2QDVA 3RY4A 4X0KA 1I1AD 2VAAB 1E9QA 4L4VD 3OPZL 1VENA 5DK2A 5BO0D 5TJWK 4G70B 1IE5A 4O4YL 1HOEA 4U1JA 5ISZD 1IEAB 3O6LL 3WY3A 5GHWL 4YGVB 3B9KA 3NABH 1AZCA 3OKNA 3EOTL 4NCC2 4AITA 2GHZA 4DGIH 1JGEA 1V9PA 1XTMA 1KLGA 5E4OA 1IGFH 1JXGA 4KJYB 5J9PA 1I1YA 4P9HL 1H2KA 3QI9D 4HBCL 2MJWA 1SN5A 4P05A 4CBZA 1W0KG 3KXFD 1SF3A 4HIHB 5T1KA 1XF3A 3VXSE 1R6KA 4LARH 2G3NA 1V8HA 1MABG 4R7DA 4HJJL 2DWXA 5L3EA 3LDBC 4Z1PA 1A21A 3U2SB 4Y88A 1WB7A 1J9RA 1KJMB 1KN4H 1XF5B 4PJ9D 5C0BB 4E2OA 5KVGE 4ICXA 1KIPA 1BZ7A 5B1JA 5IB3B 1XFPA 2ICWA 3VXSD 4N0YL 2F8VA 4AGQA 4B7IA 3WTYA 4YIOA 4FHKA 4FNQA 5K33A 5EO9B 5B1BB 5JXEC 5E2VH 2AANA 1H8HG 5D1ZD 5FLXN 4HK0A 1F4XL 1A0QL 4AIZA 4E9VA 3D85A 4KZEH 4ETQB 4PA3A 3PWUA 3RFRA 1BD2B 2ODMA 2G3ZA 3BSGA 2KB1A 5CO1A 1EAJA 2YBRA 5FM4A 3F58L 3U4BH 3NJXA 2EUZA 2PWFA 4NUPA 2VLJA 4H8WC 2GIXA 3I6KA 5DECA 4KRNA 2VXSH 3HMXA 3WIFB 2YD6A 1KBWA 3GSWB 4OSUH 2VDRB 5DJ0B 2QFPA 5I0XA 4XNUL 2X4SA 4LAQH 2V2XA 2WXJA 5T3ZL 4FQQA 4TLTA 3VGBA 1JPTH 4YFDB 4Z7UE 2EIJB 1OCWL 3LKSA 4GKSB 5TDPB 5KVFL 1LE9B 1J5HA 3DC5A 3H3PL 1HKLH 3FT9A 3AEIA 3OAUH 1IVTA 4JI6B 1R5VA 1K72A 3UTTB 3ICXA 3KPQA 3ESPA 4OBSA 1YJWV 1P6AB 4YHMH 5JW4Q 1XAUA 4LSSH 1R73A 3JD2A 2OTJV 2ICEA 4LAJH 3T77B 4U7NA 1KOAA 1R3KB 2NNUA 4P2OD 4TSAH 4LHUD 2QVIA 3PG2A 4HCRA 5DGQA 1MCWM 1FZJB 4GAJH 1S7WA 4DV4O 4I89A 4FPPA 3QXUA 5EBWA 2KKQA 1WYJA 1AHWA 4E0RA 2P44B 3K4AA 2C4FT 1OE2A 3AZUA 3EBGA 3V5HB 3O3AB 4O4JB 1M2VB 4XDLA 4N9GB 4GAYB 4UNIA 5GJSH 3K5OA 4P2CG 5D7IF 5IR1B 1NCNA 3ETBJ 1YNLL 4ONFH 1RIHL 5CHNB 1QSEB 1BF8A 2L7EA 1YCSA 2FL5B 2AQQA 3BVUA 3HZ3A 1FNAA 5IWLC 1QOKA 2VLKE 1G7JB 5C8YB 2CKBH 3FB7C 2WBKA 1RJZB 1CDBA 2LU5A 2H6PA 4FGMA 3IGFA 1T0MB 2N05A 4PJXA 2P28B 4QKTA 1DUZB 4B3MO 3RIAF 4Q9QH 2BDNL 3EHBB 1X44A 2HVBA 5ETUA 3CCVV 4CVXA 2ATPA 3B9KC 3NDZE 2AVFA 1B3JA 2XAFA 3CX2A 3IKCA 4MJIA 3W7SA 1NZRA 5MHSD 2B5IC 2CU9A 4MJ6A 1GVIA 1ZXQA 3FTGA 2R56H 3GMPB 5HJGA 2V0AA 1HKFA 4TTGA 1MNNA 1KC5H 1XGTB 1ZA6A 5DUML 4NPKA 2UY6A 5J9PC 3D36C 5IYZA 1U93A 3BX7C 3HPJB 3KYAA 5AG9A 2XKSA 1ZTMA 2ZSWA 2JKNA 2OR9L 1G4MA 1X3DA 2X28A 3GBLA 4JQIA 4OQTL 4QXGL 5CGTA 4ANVA 1NZ6A 1I8UA 3I3BA 5PCYA 1GOFA 3O65A 3LEXB 4A63A 4B41A 3IMBA 3CMGA 4WJ5A 4DEPB 5FKPA 1YVWA 1FFOA 3K5NA 4ZDHB 1DVFD 3IYLW 3T0BA 4H26B 2CDGA 2EXYC 3DETC 4KX8A 5B1JC 1QVGU 2H47C 2OTUA 4OCSL 4P2RA 4PJAF 4BH8B 2J43A 2ZNXA 2XIBA 2DD8L 4LHQB 3A4EA 4JDVB 5LA6A 4NZJA 1MEXL 4UILH 3QHTC 6FABH 3BLBA 1A7PL 2JQMA 3HFMH 3ZL2A 1QNMA 2VXTL 1E4KA 5ICXA 1ZDQA 4LF4B 1YJ9V 2WQUA 5CBEA 3BEVA 5D1XA 1XGPA 5IBUB 4H8WH 5IEHB 4X4ME 3FQNB 3UKMA 1J8KA 1VHPA 2QTVA 2IWGA 1ZLEA 2BZCA 2Y72A 4WUUB 3T3ME 1N32O 4H1LB 2JK5C 4DR4O 3T4AB 4LLYA 5I1KH 5K9OB 3PHAA 4IKNA 3ZHNA 1U3HB 2X1OA 2FX8L 1U8LB 1JMKC 3GSUA 2ZUWA 2X42A 4HULB 1KECA 2CMRL 4JKMA 1BJ8A 1YN6A 4HKXA 3K1KC 3DWTA 4X6FB 2XUMA 3WEOA 5D9SA 5ISZA 5KHKA 2OW6A 1I94B 2GB2A 4QXUH 4H37A 4LF7O 2NUPA 3FU5A 1H6FA 2G9HB 1PZBA 2XA3A 2ICEC 2MCAA 2GCYA 4URTB 5GGUA 4FQXB 4RX4A 5IEKA 3WE6A 5I30H 2VN3A 3K6SB 1SZXA 2Y7QA 1JR9A 3ZTJG 1QLRA 4ZPTB 5EEWA 3T1HO 4YR6A 1UD3A 2CHDA 4BFOA 3GXUB 3QRFM 4HOXA 3VNZA 2XWXA 1WNSA 3I85A 5D5MA 1A4KA 5EBWC 2HLAB 2ZKHH 3MODH 3VXTB 1HHIB 3KXFA 5IVOA 4X7DC 2C34A 4PJEE 2A73B 5LAPA 3U7YH 5B8CB 4WSJA 3Q9PA 5KHHA 3MRQB 2YXVA 3KPPB 1H3PH 1ZCRA 4HH9A 5DEGB 2X2IA 1DJXA 4PJ9A 4PRPA 3L72H 1OPOA 4MJ5B 1WISA 1ID5I 3F65A 5FW8A 1PFCA 1TQTA 2AJYH 5LHDA 2NY3D 4LMQE 5FF6B 3S3DB 5GGQH 3KPSD 4ALAL 3GFUA 1AO7E 3L1FA 3TCXA 5L7XL 1G7IA 3JWOL 4BSVA 3PJSA 1MNUH 5KN5B 1YY9D 2PYED 4OF0A 5E9DD 4XO8A 5K1PA 1B3IA 4Y9GA 3LNNA 4UVAA 4LF6O 3S97C 5I1IH 3KLHC 1NCJA 5F7WC 5LXTA 3MAWA 3RL2A 2EEDA 1S5HC 3WE1A 3B7TA 2JEUA 2G2RA 3IF1B 3B8NA 4DZ8A 1I8IB 3OV6A 4J11A 1VGEH 2JKJA 3FTSA 5J12C 1Q9OA 1EGJA 3ZIAG 3CMOH 3MNMA 4KNTA 1IIKA 3QHFH 3NJKA 2AV7A 4LLWA 3MOAL 4OLUL 4XMXA 4HZ3A 2YKKA 3ZTNL 1KXTB 1WPCA 4R84A 2F95B 5GS2D 4MAYD 3BP4B 1TZIA 5T1LD 3E9UA 5I17B 3W82A 3ELQA 4P4KA 4PJGF 3VXRE 2JCWA 3N1PC 3GF8A 5ACLA 1OWRM 2EEXA 3D1MC 3EH4B 3MRKA 1F90L 4KH9A 4TF4A 4PJGB 5A16B 2J12B 1UT2A 1R4XA 4B0MB 3QF7A 5DZLA 1BZQK 4YBLC 4NS0A 2EINC 3VWJD 3ZJAA 3VXRD 5KG9A 2H1LM 2P43B 4JDZB 3GEWB 1DQJA 4LHUA 4Y4FD 2BOBB 1N67A 3BKCH 5T3XE 3SDAB 3IDXL 4CKVX 3RPKA 4MA8H 3IDJB 3MRCB 1KLFA 4DRXB 4CW1A 5IP4A 3CHXA 1MCDA 1QASA 4OI8A 2W65B 4FK5C 4AG4L 5FAAA 4HJEA 1CYGA 5K9QG 3O8XD 2A1WH 2FT6A 1FORL 3SKMA 1L4IA 4F6RB 2QGBA 4YSTA 4HXBH 1F6AA 1IM9B 5EIIB 3SQOH 1Q4NX 2F53D 2OYLA 4AZ8B 3V52H 4N90D 2E7MA 1E4KC 4CH5A 2X1PA 1B6DA 3O6LH 4IJ3B 5FUCC 3FO2A 1PSKH 3CFEA 4I48B 5D1XC 1CR9H 3GGWA 2RQ6A 4NC1E 5I8EA 3HMXH 5DO2D 1NAML 4XPFL 2FJHA 2DV6A 3A0RA 1YUHA 3CSFA 4GKNA 4NM4H 1UD6A 2Y25A 5F7EL 1KB5B 3LDEA 1H8SA 4WV1B 5LWYL 3DYOA 3STBA 3Q8EA 2NQ3A 1PEZA 2VDPH 4W9KC 3CFKA 5IB2A 2G38A 4JFHE 4N2MA 1M7IB 5JOFA 3NCJL 1I7RA 3B5HA 2E46A 2XKNA 2APTA 2OP4H 4DPBX 4CADA 4UU9A 5HDLA 1I8KA 4DO4A 4ZAKB 4JFHD 2XXMB 5DLLA 3ZIMA 5ESVA 1IBKB 2Q6WA 4C8XA 3MRDA 4X6DA 4MYWB 3QDMB 3TPUA 2GFBA 2DWSA 5F8QC 5JYMA 2C9UA 4HCRH 3QI9C 3MRGA 5IE9A 1A1NA 2WVVA 1IC4H 3IJ8A 1JZ6A 1FL3B 1J9QA 3DSFH 2P4KA 1WP7A 1J1XH 1G9NL 2FNWA 1JTOA 3QUXB 5IW6B 2AAAA 1LM8V 2OYKA 1DVFA 5JR1L 4E9XA 3GRWL 3HBPA 4PJ9C 2Q7GA 3SY0A 4RWYL 4DUZB 3TOPA 4PG9B 1M7DA 4MHHI 4RUFA 1N0XL 1U92A 5HGDA 1ZLUK 4G6JH 1ZWIA 2G5BA 3UEZA 4F1SA 2YD1A 3MXVL 2G4GA 1JI1A 5EU5B 1QWNA 4X9FA 2EYSB 4RBPH 3TCLA 1S9YB 2UXVA 4FULA 2TRYA 3KBFA 4HCFA 4QEGA 3CFIC 5EFIA 2EE9A 2F5BH 5DJZB 3PAVA 4L3EB 3RIAK 3BLKA 1V7NH 3IFOA 1EX0A 5E2WL 4HJ1A 1NGWB 3PAUA 4OLWL 5DMYA 1JNJA 4E5XB 4FLWA 5AZEH 3ZUNC 1FV1B 2K6WA 4YMPA 3GJFB 1QSVA 5C1MB 2KDGA 3MDSA 3OZ9L 5T5NF 2WB1A 4Y9EA 5LOVB 2VR3A 3O4LB 4XO4A 2HT3D 1OIOA 4PJBF 3CVBA 4XPGH 1H2MA 1ZIBA 1TSRA 3GZOA 1RSOB 4KI5E 4L8CB 1MFEH 4P4KC 2HX7A 3BWAB 5FYLD 5ADOH 3NFSH 3QQ3A 4EXKA 3V0AC 3I84A 5D7LD 4M43H 5BJTA 2W80C 3JTBA 5DWUL 5HDBE 4R5TA 4NSKA 5C6TL 3U4AA 1E7VA 4RSYA 3QA3B 3L5XH 1SKVA 1WLEA 4EJ1C 2ATKB 4DERA 3MGOA 4LFCB 2GTQA 4BFEA 4NT6A 3JASA 4Y9CA 1N3NB 3UO2A 2N0KA 3WNNA 1KYOK 4XCNA 4U6XA 1YJDC 1IJ9A 1PBYA 2F5AL 4GQRA 1ES0B 2WTPA 5IBUG 3GVMA 4LF9B 1K8DA 3MA9H 4I50B 1Q8MA 3BD5A 2ZE7A 4JL2A 3SCMD 4BQ8A 5DTFA 3LRKA 4P23D 5CLXA 1GTOA 5D5QA 1M6UA 2MQCA 2ZD9A 2WLYA 1F11A 2HVJA 2CBTA 1AZUA 2Y24A 1FS0G 2CJTA 1UWXH 4G5AA 3VJ6A 5LG6A 3UTPD 5AW1B 4JM4H 3QP3A 2VSMB 3N40F 3LX9A 4PCYA 2BNRB 3SPJA 4KQ0A 1MCNA 1X5FA 3PRZA 3OJDA 3QDAA 3DJZA 4XPTH 2NT0A 1PKQB 5TD4A 5AFAA 5GS0D 5CGMA 4YLQT 5MEND 3KPSA 3RWFA 4DR7O 2R0WL 5ELIA 4KK5D 1S3KL 2PYEA 2YS8A 5E9DA 2X2JA 5FO8A 1R34A 5D55A 2FR4B 3K9AA 2XWBA 2QBWA 3D39E 1UYWH 3EXAA 2C7FA 2CCLA 1EIBA 2VDNL 3UC0H 2V2WB 2E5LB 3L7FB 2B1IA 1WBYA 4MD5B 1IBDA 2YKLH 4FM0A 4P9PA 3EGXA 4RGNE 1DJYA 3D39D 4J4PD 1E4XL 4UDUB 4F15B 4RMBA 3U36A 2I9TB 3GMLB 4M3HA 1QFWM 4TRPH 1E3FA 1RZIA 2O6DA 3RUGE 3E2HC 4IOIA 1MDTA 4MAYA 2HYMA 1UM5L 5F9OL 5I1EH 5T1LA 2F68X 2H26A 4K0OA 5CP3A 4AKOA 4AVIA 5BRZD 5GTHZ 2BNUA 4QRRB 3VXMB 2DQGH 2OMTA 2VL5A 3BE1L 3PV7A 1DJGA 4R96B 4UTCA 3JATB 4WJG3 5FX3A 5HYJB 1SJEB 2DJUA 2NSXA 1VQPV 2FBJH 2HTKC 5DMJB 5ALBH 1S9VB 1FYTB 4X9QA 3EBIA 4PB0H 5EYPB 4YDJA 4Y4FA 3Q8AA 1FF5A 3U4EB 1DVFC 2C3VA 2GY7B 1J5DA 4F7EA 3ZL4L 5LQBH 4KXZH 3UO1H 2XZQL 1OCRC 5H6RA 3I56V 2ENQA 4O58L 3IK2A 1HQRB 4Q6IA 5C0JA 4Y7MA 2CBMA 4TV3A 2VXVH 2EIKB 1NLDL 1EAQA 3D6GA 2VXUH 3BZ5A 1H3XA 4MCZA 1INEL 4ODHL 3O8XA 4GUCA 2JKLA 3IXTB 3CZUB 4BQBA 3WU1A 4N24A 1VQMV 2A9NL 2R4SH 2IDTA 1RJYA 5A7BA 2XQBH 4XCEA 5KVEE 4AWJC 5HYSB 3QWQB 1JOYA 5CZVH 5ITZB 1WFUA 5I6XB 2HJDA 1A6UH 3FUDA 1P5UB 4HS3A 4N0FB 4OM0H 4X5WA 3MLYL 2VMCA 3DXAE 2XTJB 3QUGA 5EUKB 4QHNA 4HISA 2XN9E 1H5BA 4JEGB 3BIBX 3LQZA 4Z1VA 3TYGH 2DLTA 1QHOA 1RULH 2WTOA 4WNJA 4GZRB 2QQQA 2ZXBA 2XN9D 4AVHA 4I0PA 4DR2B 1NSNL 1SFDA 2A4EA 3MBED 4ZFFB 3T0EA 3BHPA 3D2UD 4W9LC 2FX9H 1LLAA 4NO0A 1E4XI 2F7QA 3M7OA 1YTFB 3GTVA 3FUFA 3SDXA 1ZJBA 3ML8A 3FH5A 1SYSA 4YHZH 1Z0MA 5EIIG 2YOAA 2F61A 2PYFB 1AVAA 1GW0A 2AXJA 3IDGB 4I0CC 5GJTL 4AUJA 4F2ME 1KWKA 3L2NA 2DTMH 4OLYH 2XU9A 1F2XK 1OQOA 4JHWL 3EJJX 5E5UB 1YJDH 3L95B 5IQLA 3GM0A 3BPOB 3IFNH 4UB0H 2AERT 3BPNB 3QH3A 3C5ZB 4B60A 3CBRA 2P5WB 2HVJC 5IVZB 1TETH 1F1DA 3IGAB 3BGMB 2BXYA 3QUML 2YD7A 1L7IH 4W9EC 3V0DA 1MCPH 3MV9B 4A7VA 2D3NA 1AMYA 2ZX5A 4YHNB 3KZ8A 1E6JL 4WNSA 2AVGA 2NY3C 3ZRCC 1EAPB 2XZAH 3G5XA 4PBXA 2E3VA 4A67A 1CD8A 2FHFA 1Q0YH 1Z9NA 3U1PA 4JW3A 2JEXA 1BVZA 4PW4A 1YY9C 1YRKA 4JRXB 4Z0BH 1KEGL 3H7BA 5T1DH 1JXKA 4ELME 3Q8BA 1CEZA 3C8KA 1UCBL 3LD8C 3EOBA 1SRYA 2OMWA 4C54A 1NOFA 1X5JA 2HN7B 2A7WA 5I74B 2QHRH 3RI5F 2XWCA 5EU4B 1ZL8B 1VQ6V 1L9OA 3ZOAA 2UZIH 1KD1W 1PY9A 1QUNA 2V7HA 3FTWA 1IC7L 4G11A 4DHLA 2Y2YA 3WTXA 4MAYC 4LPCA 5LYJA 3JSSA 1L5GB 1IGCH 2EYRB 3BDXA 1L8DA 4PJFE 5FM5O 4IM8A 4YHLL 1MJJB 5EUOA 4FEIA 4LF3A 3ULSB 1DFBL 2CLRB 1ND0A 3F7PC 3IMRA 3QJHB 2AV1B 3D50A 1OGAB 5F93C 1LO2L 4Z6AT 2VZTA 3IC7A 3VWJC 4WFGD 4OBRA 5TDOA 4QE9A 5E23A 4JFUA 3VRJA 4BQCA 4UVCA 4CJ1A 1FJ1B 4Y4FC 4LLMB 2H4EA 2P80D 4PJCE 5DHYB 1JZ3A 4HLEA 4UIKL 4JASA 2ZXQA 3AG3B 2R2BA 3WMPA 2A83B 2HJFA 3I75A 3MBXL 5E7BA 3SCMA 2R1XB 5GGTA 4YFEA 4P23A 4Q6IC 1KPVA 4X80L 1NGPH 5DVNA 3EW3B 3NDYE 4E5XG 4PYGA 3QT2A 1U8OA 4LRNH 1FG2A 4NNPH 5DD6B 2QM4A 2O5XH 2R0KH 3O8XC 4FABL 1PZUB 3BUBA 3HN5A 3KLLA 2FE0A 3M46A 4CN6A 4M6AA 1P1VA 4PV9A 1NKOA 2JIXB 4POUB 5T5NG 4EMZA 3ZN0A 1CFMA 5IF0B 1G87A 1QEWA 1OZ0A 4YHHO 5EN3A 5DA4A 2A06H 1VQ7V 2VLRB 5MENA 4HFUH 3EBHA 4XMUA 4FQ1L 1CICB 1DJZA 1BZKA 5DO2C 3GRBA 3MA7A 4X5RA 5JOPD 2A4CA 1NGXB 2WNWA 1UUNA 2CTWA 3LPPA 2V17H 5ABDE 2O6EA 5L2JB 4QY8A 1MOEA 4BEIA 1H5BC 3I6SA 4R4ND 1HQ4A 4IJTA 4JM2F 4UINH 1MOFA 3C60B 3L4XA 2YMTA 4EI0A 5DD1H 2GK2A 4R97C 2E74C 1UOLA 2VQ4A 4GRLA 1NCWL 1QA9A 1RUAH 3LEVH 3RQ3A 2BMKA 4GQQA 4J4PA 3U0ZA 2SEBB 4XMLL 2Z4QA 5AOIA 1CGXA 2D7QA 1OGTB 5JPMA 3C8DA 5TQ0H 3O6MH 1JFFB 1AD0A 1M4KA 2IANE 1XV8A 3FQWB 3MVSA 4F3FB 3MLRL 3X17A 2W0XA 3QZWA 5L3GA 1P6WA 4OZIF 3LOWA 4HUMB 4Y2DB 4HDIB 1MRFH 2F7IA 5FR3A 3MKKA 5BRZA 4P46B 5K9KB 4OZIB 3MRMA 3BAAA 2CPUA 2X4NA 2W0LA 2ITDB 3ETGA 5I16B 2NY4B 4YUEL 5DZNA 1YECL 2NW3A 3PV6A 3T6XA 4BKLB 2IFGA 4QXTA 2E75C 5BQ7A 1NAMB 1IARB 2VGLM 2EKSA 3PABA 3T2LA 1EEZB 4YWGH 1MREH 1F4MA 4C58B 2QZ5A 4LCIH 3ZHSA 4AC2A 1XQ8A 4JJHA 4UOQA 4XGZB 4ZMZA 4OIIL 5E08H 1EFXA 1XL6A 3ARXA 1V3LA 2YR3A 1UZ6F 1CGUA 5H94A 3ATDA 2CDYA 5KBPA 4K0KB 4L2YA 5EZJA 2MQ3A 3JBG7 2YPKB 3BXNB 1MI5A 4KXBA 1XD0A 4FL4B 2WLLB 3X3FH 3SPHA 4F7CB 5I0YA 4YXWG 4NTXA 5DD5L 4E41E 2FK9A 1JX9A 1G7QB 3EDJA 2HFGH 3HC3H 1G5AA 1O75A 3TJTA 5T33H 3BH4A 3IDYB 3KWWB 3DURB 4WY7L 1M7XA 3SDLA 2UZYB 4DGVH 5TK4A 1C7SA 3F5TA 4HKBB 4PGEB 3U7WH 4NR1A 2DJSA 2KDYA 4PRHD 3V0VA 1U8KA 1WJ3A 1FDLL 2HT3C 3H9ZA 3DX2A 5KOMC 2D2CC 4KROB 4G8GE 4P3CL 2J5WA 5IKCA 4AI8A 4RAIA 5GS2H 2BC4A 2D2OA 5CP3H 1MG1A 4H13B 3D2UA 3NOIA 1JIBA 1ASPA 1B04A 4C56D 1R1BA 5AB0A 3T1CA 2H94A 1WAAA 1F4NA 5CD5D 4XWOD 2WLIB 3ZXAC 1RZ8B 4BXSV 4JPIA 3ILQD 2ADJA 1JK9B 1OSEA 3NABL 2JKSA 5E4EB 4AKQA 1R1CA 3TF7C 2WVUA 4DGIL 5HYSG 3BA9A 3ISYA 2UYLA 4ZSOA 4NPYB 5DVOA 1T0NB 3K71A 2R51A 4FLSA 3SCMC 5FHBH 3NP3A 1E79G 4P23C 2B77A 4KKRA 1IIIA 1LDPH 4IHJA 1IGFL 3GI8L 1VMGA 1YZBA 1FZMB 2OR8A 3FFCE 4W4OC 1KDIA 2ZP9A 2NW2B 1CN4A 2DI8A 4IQHA 4RRPM 4PA6A 4A7UA 3B8SA 4W9DC 3RGHA 3BUYA 3BRFA 2AJZA 1E43A 4FTVB 1IXMA 2O5ZL 2WYHA 4LARL 5GS3A 3CFJB 5GS0C 2ADGB 5LXVA 5IROD 1KN4L 3K6DA 5GZND 5L0QC 2QQKL 4KK5C 1NCOA 1N7MH 4MTOA 3K1DA 3MX0A 4BAYA 2WXNA 3OFNG 1CLZH 2DQ6A 3PFUA 1JL8A 1PX3A 1X5KA 5CILH 4KGLA 1X7TA 4KZEL 3CGTA 1O7DC 3FKUS 4JZNB 5DC9B 3RRQA 3D0VB 1LMKA 4GRLC 3U4BL 2DEXX 2NTFB 1FGNH 1QW9A 4FKHA 3CJHB 3H8NA 4QIWF 4J4PC 2VXSL 3D4CA 3TBSB 1AOHA 3RIFF 2F74B 2BCCH 1EVTC 3NFPB 1RM1C 4QMEA 4OSUL 4MQSB 4OCXH 2C9AA 3DROB 3Q8FA 2L35A 1N6UA 4WI0B 5IHBA 5E2TH 4NTYA 4MNGE 4MMXA 2X4OA 4JBSA 3CH1A 4F8PA 1N8ZA 1JPTL 2K4AA 1N19A 1FUNA 4X1YA 5CBFA 4XOEA 3TURA 1GYAA 2VWEC 1YVLA 5IY5C 1NBMG 1VP7A 3LKPB 4IBWA 4MA3B 1HKLL 4O2BB 3RTQA 4P57A 1HOCA 4HKZA 1Q90D 2WO4A 5CIPB 5F6IB 1DSWA 4WK2B 4WFGA 3GKZA 4Q0XL 1U91A 4ZQTA 4X64O 3JAWB 3KL5A 4X6CF 4Z7OE 1ORSA 3I9IA 4LSSL 5BV7C 4YHML 2P80A 4NN5C 3B56A 4X6CB 4YSCA 2F15A 4LBEB 3E86A 4DV7B 2PZSA 2IDSA 2WMPA 4WWKB 2VDNB 5MEPB 4AYFA 1PLAA 2Q3AA 2X4RB 1Q0XH 3LJ3A 1HXMA 4BGDA 4GAJL 1WZ1H 3BPCB 2YAOA 3NSFA 4I1NB 5C7ZA 5JUEH 3OJ2C 1CD1A 4K7FA 2NUTB 1DVSA 1OTTC 3VA6A 2PCPB 3CBKB 4M9OA 3TIDA 1U33A 4X20A 3JD0A 1INDL 1FSKB 4MVQA 3KNBA 4JFYA 5F0PB 2DYSB 1L3NA 1A6AA 1T5KA 4MJHA 5FOJA 3U9PH 1W8NA 4RMVA 5JIQA 4YAQA 1VKXB 1MQKH 1OAUH 3FK3A 4UIMA 3CC2V 3RI5K 4AJVA 1KXQA 4XCCL 1EN6A 4NWUH 3MJ7A 4ONFL 5I5IA 2HHHO 2Y69C 1MJ8H 4OI9A 4PU2A 2CGZA 2CLZB 4X5XB 1KGJA 5HGAB 5BCAA 3TXSA 2LR4A 4DQAA 4LLVA 5IJ0B 1R46A 2CKBL 3OE7G 3T1YB 1I7UA 4A6YA 3JUYA 1TXKA 4NQSB 4G1EA 1NBZB 3HNVH 3ABMB 1AQDA 2ZOTA 3VVWA 4N2EA 1WLHA 2Y0SA 4JTDB 4FFBB 3E1F1 1VEMA 5FYLH 4AM0Q 4JI5O 4EIGB 5IMLB 3IWUA 4WTXA 4X4ZA 4KTYA 4JPWH 4N85A 4Q9QL 4XC3H 2NXZB 3WD5H 4GEIA 2FTAA 1AP2B 1M1SA 3REVB 1Y74B 3L5WA 4W4KA 1S3JA 1NGQH 1SUJA 1U8HB 1OLZA 4NQDD 2R56L 3TN0B 4DV2B 3B7UX 4AJWA 2UUBO 1KC5L 3ZMVA 2VITB 5GGTH 4V1DB 4UQCA 2CJSA 1QBZA 1JAEA 5L2KE 2DF3A 3FRUA 5KS9E 3ZE1B 1UH2A 1V7ML 5FO2A 1BCIA 3CIAA 4UQ3B 1KENH 3GXTA 3J7HA 3Q4HA 4P48A 4ERSH 4M7ZB 5BZDB 2AZUA 3GXNA 3KPOB 4QTHB 3UJJH 3VI3F 4PJDF 5B39A 4JI0O 3KVPA 2B1OA 5IYCO 1DBBL 4JI8O 5GS0H 3HZMA 4GXUN 1RFDH 3FQUB 4ESKA 2HLFD 1XHXA 2F9BT 2Q9LA 4KDTA 4JZJA 4MHHG 2BP8A 1ETZA 3MFFB 2PF4E 4O4HA 2X70A 1E28A 5DF0A 3HC4L 1BQ0A 3G6DH 1E5ZA 4DR1B 3IJEB 3QNYB 3TIEA 4Z7AA 3JVFC 3OTOO 4PRDA 4Z3EA 3IETA 3AITA 5EBLB 4UILL 5ANHA 2LLGA 3ECUA 3OLGA 3BGAA 3L3GA 6FABL 3HFML 2FVNA 3GSXB 1MUJA 2JLLA 2Q6AA 4PRNA 3GJEB 5F1KC 3CHQA 3EJZD 4H0LB 3OGIB 2V3DA 2ZG3A 5B7FA 1Q9LA 3HKCA 1YIJV 4AILC 2Q7YB 3G5VB 4KJPD 1N10A 3S4SA 4R2GB 4PRHA 5HJBA 1BBJB 5F9DC 2ADIA 3L17A 4QF1B 3PL6B 2X7LA 3BESR 5BMVA 2AW2A 2JGDA 2EQDA 4NQTA 2DMXA 5M95B 4XDJA 4ZQKA 4Y16B 1S7RA 4A7GA 4C56A 3IDNA 3ZDYB 5AVZB 3JARB 5F7DB 3WIHA 3VXOA 3CPLB 3B7YA 4OD2A 4S0SD 3WENA 3QDJD 4XBGA 5F7AA 1QSZA 3QE5A 2V7NB 4YO0A 4QYOB 2RTTA 4QXUL 5I6KA 3V79C 4R90L 1EERB 3RBGA 5DMGD 3S5LG 3WNPA 2H1PH 1KYAA 5BV7H 4I1RA 1BZOA 3CX5F 4MDJB 4J9YB 4UT6A 1G9EA 2CGNA 1WCQA 5I30L 1AGFB 3O6FD 2PWGA 3HR0A 2YDEA 5EC2A 1ZE3C 2WJ5A 2CR6A 1WFTA 4FLVA 3DX8B 5C97A 1QYGH 2ZKHL 1QZNA 5DJ2A 5AVVB 2B1GA 3MODL 2X6UA 4OZHB 4FXKB 1IZJA 1IAKA 1PCXA 1NI8A 2PCFB 2XCMC 5GRVL 4ZI7A 3TH4T 3FU7A 3U7YL 3RPBA 4ONHA 1H3PL 1LD9B 1E4WH 4GY4A 4OZFA 3GKWH 2O72A 3QORB 1U8PA 2OFQA 2AJYL 1N33B 2FEEL 3U79A 4TOYH 4YDVA 5GGQL 4GUPB 3GMNB 2VDMH 4R4NC 1IM3B 4WI8A 1BOYA 4A1RA 1ZS8B 2VR6A 3CFMA 5KVEH 1MNUL 1BPLB 1A02N 1EA9C 4F33A 1G1KA 3GSQB 4ABMA 2K3TA 4O02H 4YSDA 2K8MA 2ESVA 3DX3A 4KK9C 3Q48A 4P30A 1SJHB 2VMFA 1OALA 2KG7A 4JI4O 1Q72H 4KKBD 1OF2B 2NN4A 3HKEB 1WP6A 4IIJA 2PXYD 3MJGX 3CCJV 3MREA 4TUYB 3ARRA 4XN9A 1A6TA 5IOKA 2OSLA 4LCWA 4NKGB 3V0EA 3HUJE 2N4IA 3CMOL 2ZOUA 4GMTH 4XMTA 2ZXDA 5IJKA 5EO1A 5DHVB 3O9WB 3QHFL 1DDHB 4HUXA 3MRBB 1AQMA 1A3LH 1S0VA 1NCCH 3N6YA 3RWJB 3UBXA 1GGIH 1OTUD 4J8QA 4ABUA 1G7PB 1ACCA 4OF5A 4M3JA 5D1QB 5J0BA 5AW7B 3T2QA 5LQBL 4YFLI 3CU7A 4DZBA 4I9WE 3ZDWA 5JZ7D 1Z5VA 4Y5XB 2I24N 3U83A 1AGBB 4XBPA 2KQXA 2Q76A 3DVNA 3MRJB 1QLFB 1X4XA 3C08H 4PA7A 3CSXA 3LH2H 2VRZA 1K8IA 4AUUA 2G0KA 4ZUTB 5IK3A 1ZGLB 1DN0B 3F3HA 3L54A 2H45A 2LTQC 4XP9H 4HPYH 4MA8L 1KWGA 1SVBA 4TQEH 4PTUB 4JVWA 4GO8A 4JZJC 4G1MA 2MTPA 1YEHH 4YDNA 3SYPA 4YH6A 5DJCA 1TFHA 1KPUA 1JPEA 3HR6A 2GG1A 2CUMA 2ZKMX 1OL0A 1I1FA 2A1WL 3NAAH 2MRYA 3HKFA 1KB9F 4UQ9A 3H9HA 5HJ3B 4EIBA 1ID2A 4HXBL 3SQOL 3ARDB 1YPZA 3V52L 4PJHE 3TA3B 1NBYB 1TQCB 4MRCA 4NYLA 1G9HA 3NPSB 3RIFK 5INCA 1BM3H 3E8UL 1CR9L 3H9SD 5HFMA 1JZJA 5MEOA 4Y19D 3HMXL 3HVDA 4K5PA 4LPWA 3RX7A 4R7VA 5C0AE 4ABQA 2FWUA 4YJ2B 3LKNB 3VACA 1XH0A 4NM4L 2BRQA 2CNYA 2HAZA 4KO5A 4W70A 2VDPL 3OKEA 2W0FB 2D03H 4WJKB 1NR1A 3UAJA 1T4KA 4R0LC 4D2NA 4IMKA 2GSGB 4N0RA 5CD5C 2OP4L 4XWOC 1I0HA 2VR9A 5GGRY 1UASA 5D93B 3ZHDA 2B0SH 3P30H 2EDWA 3ILQC 2FNBA 2QTOA 4KUMA 5IQNA 4FQPA 1T1ZB 2E7CA 2ZUQB 4NHCH 4G7YH 4WI9A 4A7TA 3MUGB 4NQDA 5JVDA 4QLRA 3VGDA 1N6QL 4JLRA 1CCZA 3QJRB 4UAHA 4DKDC 1U8CB 4G42A 1OP3H 5EC2C 2Q7AA 4WWNA 3B8MA 1WD9A 1USQA 3PWLA 5A2AA 1ZE3H 1CFQA 4HCRL 2FECL 1YNTF 1DYZA 1VFOA 5C7XH 1IC4L 3U9WA 4HC1H 3BP6A 4HXAL 3Q2VA 2XOTA 2FJSA 3DSFL 3FONB 2R9RB 1A6WH 1J1XL 4QRUA 4TS6A 1CK0H 1F3JA 5EU6D 4GT7A 1KNOB 4LLDB 2I27N 5HGGS 4BFGA 4DUYO 5GONB 1R47A 4IS6A 3WGVB 4XCYA 5EZPA 4PUBL 4X7FC 1RFYA 5TDNB 3H2PA 3HRZB 4EDWH 5GZNC 4QNHB 1A64A 5FKAB 3SE4A 1VQOV 5AW9B 1J5EB 3IDMA 4FOMA 4JFOB 5HI4C 5I8CA 2XPZA 2GK0A 3FC8A 3LYRA 3SHSA 1T4WA 5I75C 1EZVX 3AQDA 3QIUB 4G6JL 4YZWA 5GGRA 5I1DB 1HYSD 1CFBA 1URLA 2E7HA 2YD3A 4AGOA 3WU2Z 4EDXB 5CBAB 2J25A 2BFGA 1A9BB 4UCOA 1MCJA 3QG6A 1N4XH 5LGUA 4HK3J 2XX1A 5ID1B 4A6YH 4JYAB 2NX5D 3HHSB 1SETA 1L9SA 5KLVH 3FN0H 1NC4B 1RK0A 2NNRA 3KYMA 5G4OA 3QDGB 4GINA 3R4RA 1V7NL 4DT2A 2HJKB 1GGUA 2NR6A 4WI4A 5AZEL 4R7LA 1AY1H 4PJIF 3ZYJA 2BSRA 5F0MB 3RFZB 1KIRB 4LSRL 1MVUB 3ASWA 4Y7OC 4XPGL 1T7XA 4PLNC 5H2FZ 5KZCB 3HS0B 7FABL 1VZIA 1HCZA 1MFEL 5ADOL 3NFSL 3QDJA 1KLUB 4M43L 1MLCA 2IH1A 5ENWB 3CPUA 2QV2A 3VFOB 3QEUB 1QQCA 1S7XB 3MV7B 4L23A 3BD3A 5FYKU 3L5XL 3DHUA 1EZLA 2DPKA 2VZSA 4CZZA 3D8MA 4NFBA 3DGEA 1XAKA 3VD2A 5KX5A 1BXAA 4K8ZA 3EG9B 2XVGA 1BFTA 1S9WB 4TNEA 4D7BA 1JCVA 2JFCA 1SF5A 5C0RL 3MA9L 2FHCA 4CU7A 3QWRD 3AK2A 2IWKA 2BNQB 4MB5A 4NQEB 2FECI 4JI2O 3VFUA 2UZXB 3D7PA 3HE7B 2A5UA 1OOWA 1PLCA 4DR3B 3HN8A 4GW4B 1SHXA 2JTDA 1S7VB 5LGYA 4JM4L 4UM9D 3MGTB 3AFLA 4W9ZA 2CBQA 1UOWA 3FSWA 4BSWB 3OB8A 4XPTL 2C26A 5BZWB 4HZ1A 4CMMA 4IYKA 2IDQA 3CCHA 2FBRA 2K70A 5E1IA 5KMGA 2UXNA 2K0RA 32C2A 4ZTPH 3WEXB 4AQZA 1VF5C 5FL7G 3UGXA 3ZHFA 4FZ8H 1VIBA 1JZFA 3FCSA 2G60L 5DS1A 3QCTH 5DQJB 3NN8B 3UC0L 2EJ1A 2XIIA 4ODUA 2YKLL 5CGYD 1RHHB 1G0YR 5B3JE 1F8TH 3VFTB 1IAIL 4ZX6A 3JCUZ 3QEGH 1FL5B 4PTTB 4DV0B 3UAJC 4IMKC 3ZO9A 5FEBA 1LJMA 3X11A 4PG2A 2R72A 5SWSE 4X7TA 1LNQA 2LW7A 5E79Z 1TENA 5B4MD 2WZPD 4TRPL 4HNAA 3PNWB 3US0A 3G6BA 2FEDD 2VL4A 1VF6A 3CFCH 4S0TD 4XHQA 3WN5A 5I5MA 3M7MX 2NY7H 1YDXA 5I1EL 2XAGA 1EFRG 3GMOA 5SWSD 4ZX5A 3IJHA 4AIXA 4FVMA 2XYCA 3GK8H 2DQGL 5SWZD 1E2ZA 4DXWA 3VFGH 4LIQH 4XNQB 1CXZB 2DQMA 4AGMA 4Q4EA 1MFUA 2FBJL 5JDSB 5ALBL 4NQCB 1G7MA 1IZKA 3HI1A 4PB0L 5EPMA 1VEPA 1INQA 3N91A 4Z7VF 3RWCA 5KBMA 3UACA 3BQVA 3HPLA 2UUCO 4YY3O 2CKBB 3N2GA 2LQRA 4MCMA 4RWHA 5GIRA 2HLFC 4Z7VB 2BSKA 1DBAH 3SE4C 3UO1L 3ME0A 1YN7A 3BSHA 4RFEA 4ILDA 1FJGO 2WA4A 2UWEE 5EF2A 4DOHB 3QXAB 1NDGB 2VXUL 3UTSD 5H4ZA 3L4TA 1PZ5A 1KP2A 4NB5A 2DM4A 4WWPA 3W5MA 1WRFA 2J71A 3EFOA 2ZXCA 4HA1A 2Z8SA 4UT9H 3UPRB 2R4SL 2CIIA 4UNVA 1MW3A 2XQBL 4PREB 1Z66A 4X42A 1NJ9A 4GG6E 3H9SA 5CZVL 3J27A 3AS0A 2WXHA 4IIQA 3ZHUA 4Y19A 2YXLA 1OAKH 4KJPC 3OMNB 4GRMA 3VFSA 1A6UL 5HHXL 5FXCH 1NFDA 1NPJA 4G28B 1KY7A 4HX1A 1XH3A 3FF7A 4MBOA 1NMBH 1M2OA 4IOFD 4X5QA 3TGXA 2A3TA 4FXGB 4LBAA 4FA6A 3O3EA 5DR5H 3TYGL 3G4SV 1RULL 5IW3A 2WVSA 3NEEA 1S7SA 2R27A 2G0LA 5C9KA 2PWHA 4D7PA 1I3VA 5D70H 5BR8O 1OB1B 3EYFA 3NCMA 3NTCH 5E7FA 2BRRH 3ZT7A 2FX9L 2IH1C 3CRCA 4YJ3B 1S78D 3K8MA 1IKOP 3LDBB 2EO1A 1D5ZA 1BXXA 2EABA 4TTDD 5DMGC 3O6KH 5DK0B 3GB7C 1XD1A 1KT2A 1KBVA 2ZX6A 4TYUA 4BZ1A 2EDEA 3O6FC 1EXGA 4U0RC 3IU4H 4OLYL 4G9FE 1YXBA 4PW9A 4RIRB 3RWGB 3F7YB 1B9ZA 1YJDL 2GVYA 4RA3A 3W9EB 1CE1L 4B3SB 3IFNL 4RAVA 4UB0L 5CJBA 3CXFA 1G6VK 4JKLA 2RN9A 2CRZA 1CLVA 1L9PA 4WTWA 4ANUA 2H32H 5EU6A 1KTLA 3V9FA 4J8RA 3EDKA 4ANKA 3T0XA 1JGLH 1MCCA 2OL3A 1X7QA 1TYEB 4TT3G 1L7IL 2WWOA 3SKOB 2Q8BH 1MCPL 5HHME 1CGWA 2GT9B 4IKLA 5C08D 3IJ4A 1SESA 2ALWA 2WNGA 4N8CH 1RVFH 5KYWB 2NLJA 4KXZI 3KR3H 5C0IA 3GPSA 4L8SA 3BFWA 4YFLF 4PSPA 2XZAL 3LIUA 5I6LA 4LP4A 1Q0YL 4GKKB 4O4IA 1GIGH 1GA2A 2NCMA 4Q74A 4WW1B 4QNPE 2CDFB 1VCAA 1JDAA 3MCYA 2N3JA 5F1IB 5D1ZI 3LZOA 4Z0BL 1XCWA 3GUTA 5FCSH 5T1DL 3LN9A 1WJZA 4KKBC 4UV4L 1E3XA 3B2VH 3NCBB 2PXYC 3HFFA 5FOBB 2Q5ZA 4B96A 1BG9A 1TYRA 5FNVA 4NUGH 3TVMD 5LBQA 4NRYA 5E8NB 4PVBA 1B4RA 4ZUWB 2OX5B 1IL1A 3IGUA 4PIBA 4JTCB 2XFXB 4S1SH 1TQSA 2QHRL 3QJFB 2BS9A 4N0UA 1V54C 2UZIL 4M6MH 1J0IA 4A55A 5C0GA 5J2TA 5F97E 3WN5C 3D25B 2BOCA 5DHXB 1OTUC 1R0AH 3IXAA 4M5YH 2IF7A 4X8JB 1LNUA 1TOXA 2OTWA 3D3VA 1IGCL 3NJJA 4HUWA 4P2QE 1C16B 3LS5H 3BEWA 4Z5RB 5LP6A 1TZHA 4BZ2A 4LL9A 3DO4A 2GJ6E 2VZ3A 5JZ7C 3S5YA 4AK1A 5LBSA 5D7JA 4YLCA 2EYTA 3TL5A 1KF9B 3EJUA 2XI9A 4MNHA 4OFVA 5JQGB 1CE6A 2CAZC 4ZNEE 4GAFB 4KRLB 4HLJA 1JZ2A 3Q5TA 3V4PA 1T22B 2YLKA 2DBJA 3HPLC 1SHWA 4WW2F 4TUKH 1P7GA 1IRAY 4NDMB 3HNTH 5H6QA 3MOBH 3QWRA 5IJVA 3BZFA 4NBZB 1NGPL 3P2TA 4UTBL 4NNPL 1ACZA 4LRNL 1E9QB 2H8PB 5IB1B 5SV4A 2R0KL 2O5XL 1X6NA 2J21A 5K1NA 4XBFA 5LDUA 4CS4A 2YEQA 1ZSDA 1GYVA 2DMGA 4U1JB 5LGJA 5AW0B 3M8AA 1AGCB 3X2QB 1NJIW 3F8UB 5AOMA 4FFWD 2KPWA 4N68A 4HFUL 4IIQC 3ELAT 4L3CB 2B5IB 4Z7WF 1R6VA 1WBZA 2EVIA 1OM3L 1ULVA 5IV2A 2V17L 4QJ5B 1A8JH 4XVOA 3CZJA 1KLGB 3TJEH 3T3PF 3WNKA 3CX5J 3CWBH 1T21B 1W6WA 1F3DH 2M83A 2JNZA 5J9PB 3WDJA 4UINL 1I1YB 2EX3A 1X7SA 3K46A 3BDYH 4DR5B 4S1RH 1MHEA 4NXMB 3MUY1 5DD1L 4YSQA 4U3FH 4DUWA 1UFIA 1RUAL 1XF3B 3LEVL 1H8OA 1OHQA 3DI2B 3JV6B 2AK1H 3B34A 3WNJA 1JZ5A 4H5SA 3OMAB 2W8CA 4RFNC 2WZPA 3TXQA 3O6ML 3FN9A 1LP9A 5D6CA 1TITA 3R0NA 3T6ZA 2IADA 3STLC 1BZ7B 1HH6A 1IB5A 4JUSA 3KBPA 4NZTH 5AVRB 1MRFL 3QVAA 3VDAA 3P11H 1RMFL 4J12A 3G6JE 4HK0B 5I71C 1AE6H 5H5NA 5KHGA 4ZZKA 4LOVA 3D85B 4XPAH 3VXUB 1XCQA 1QVFU 5JO5B 3T0EE 4PJ0Z 3AUWB 3LNEA 1TFPA 2DQIH 3QO8A 1IEAA 2VLJB 2J7LA 2X3CA 4OH2A 4YGVA 3SDCD 4K3GA 5DM6V 3L3HB 4MLIA 2EVGA 3X13A 2YIDA 1J95A 2Y07H 4OJDH 4LT7A 1IMHC 4N0CD 3NCCB 1MREL 1UWEH 2JK5B 3H3BC 4LCIL 5E08L 2NLJC 3UZEA 4L8SC 1CBJA 4KJYA 3LKSB 2NY6D 2VDPB 1F58H 1HYSC 3UCSC 3OTFA 4JJOA 5EIBD 3CCMV 1XSJA 4HIHA 2YFOA 4JG0H 3X3FL 3KPQB 1R6NA 3U2JA 5E99H 4A2MA 4BSJA 5FB8A 4M48H 2QSVA 2HFGL 3HC3L 4FQHA 4FQLH 4GBXB 5K5YA 1NTZH 2A6DB 3U2SA 5T33L 4UFZA 1BOGA 1KJMA 2ICEB 1COWG 2P9RA 5C0BA 1BPVA 2EEFA 2XN1A 1I4FA 3LMJL 1AKJD 5I6NA 4DGVL 4CL7A 3WMQA 5D6DA 2Z5UA 3OD3A 4H44C 3AG2C 5EO9A 4ZTOH 4V11A 1I1CA 2LVEA 4XB8A 4ELKA 3U7WL 2BOCC 5EBWB 4NRXB 2EDNA 3W81A 1BD2A 1ZVYA 3Q0HA 4E0RB 3ZE2F 2A99A 4E2LA 3AY4A 3L74H 2ZP0T 1WZAA 2MCG1 1EJ8A 3BN9D 1BEXA 2VH5H 3WIFA 2APBA 2B1AL 3KPRE 1T6VN 3GSWA 2F7PA 3QJUB 3BDBA 2OMUA 4ZXBD 2GI0A 2DIEA 3FHAA 2EIDA 3TZVB 1KB9J 4TVPE 1THCA 5GGSY 1JZ8A 1LE9A 2ENJA 3L9YA 4JO4H 2KZWA 3W0WE 2FB4H 1SNRA 4N22A 1NIAA 3D30A 2R15A 5FHBL 1VQKV 3UTTA 4PY7B 4ENZA 2WXFA 3PDGA 3VBBA 1AFVH 1RZQA 4GX5A 1S5HB 3EBAA 1T04B 1PJWA 5H35B 2A77H 1XNRB 4JL1A 2OCJA 3T77A 4PJXB 2BHUA 1R3KA 5C08A 3ZO0A 5J12B 4IBTA 4F7KA 5KHIA 1BSMA 1M93A 3EOAB 1Y66A 3MZGB 1FZJA 3OQ3B 1OO2A 5D2NA 3I3DA 3ES6A 4CDGC 5G5DB 3FTGB 1N7ML 1AS8A 1CLZL 1ZA6B 2FYUH 4N2DA 1GGBH 4KC3B 3V5HA 4O4JA 3AABA 3QQNA 2ZSWB 5CILL 4N9GA 1FAKT 1SY6A 4GAYA 5B7MA 4YBLB 4D0BB 1D2DA 1OZUA 1FGNL 1FFOB 1OD9A 2Z31D 3GD1C 3MV8E 1FXKC 4AGNA 5D7IA 1ZT1A 5B4MC 2FL5A 1BQSA 3NIDE 4OCXL 2EC9U 2FEDC 5AYUH 1CXIA 4TULH 2AJVL 2OTUB 4P2RB 5E2TL 3NYKA 5C8YA 3E8VA 3L08A 4M9PA 4QHKI 4TM9A 2OYPA 4JAUA 1A65A 1YC8A 3S48A 4PI2A 1JNHB 4J42A 1N8RW 2AEIT 2WKLA 3WS6A 4IYIA 2QMKA 5K1XA 3VCLA 4OCNC 1SA0A 4NXNB 4N6RB 3PU7A 5IOPB 4JRYE 4CH6A 1KDJA 2W0PA 5GSVA 5ICXB 4N2BA 3G04A 4IRZA 4M8VA 5CBEB 1XGPB 1S7QB 3V7AE 2AHYA 4PD4F 3OKLB 1PJ9A 3L13A 1K3IA 1ZVNA 4B95C 2OL3H 2N7BA 4CN1A 3RY6C 1Z9PA 4U1GB 3FT4A 2BSTA 4QOKD 3LPWA 3UZEC 1Q0XL 3RURA 3HPJA 1I1AB 1WZ1L 3GSUB 4XNYH 2VJXA 5FYJU 4L4VB 4TOIA 3LEXA 1NIEA 3N2KB 3OWEA 4HKXB 5HHOD 1BZEA 3AXHA 4LSTH 3V0IA 1AIZA 1Q1JH 2ERJB 3U9PL 5ISZB 2QSTA 1PG7W 4LSVH 3ROOA 2MNWA 5FC9A 4ZDHA 4CS2A 3CSPA 4U1MA 4HIQA 2GJZB 1T83A 5IVNA 2NUPB 4HEME 4NNXA 3DO7A 3DYPA 4H26A 1A7QH 1OAUL 1CI5A 5F9JA 5GGUB 5IEKB 3WE6B 4NWUL 3F7LA 2Y7QB 3K2IA 1QLRB 1QQDB 5D6DC 2WXPA 4PJAA 5B1BC 4YR6B 4IOFC 3T8XB 1FLRL 4TSCH 1NTMH 2EACA 3MRLA 3QI9B 5D5MB 1A4KB 2BY1A 3L7EB 4DP9X 4L8DA 5IVXE 2D7MA 4J2QA 1ILUA 5K1VA 3CFQA 3KXFB 3E3QC 2L6LA 3AY4C 3HNVL 4JY6A 2CO7A 1E0OB 2ARHA 3GSRA 3ZMUA 3PE9A 2DL2A 5FYLL 1S78C 4Y5YB 4WIQA 3FQNA 1N34O 8CGTA 3BSZA 2XV2A 4B3MB 4PJ9B 4PRPB 4TTDC 4YOKA 3L9BA 3OW2U 1VDGA 4JPWL 4KUCD 1DQQB 5AQ0A 5LBSH 1G0XA 2OMXB 4XC3L 5TE4H 3VXSB 4O5LH 2EIJC 3IJSB 5AW2B 1NGQL 1IGML 2HRHA 5D1ZB 2JKXA 4PWHA 3V4PH 3B9EA 2P5EE 2ILLA 2N1KA 4F8LA 4Y8AA 4F8QA 5B1KA 5GGTL 2K9FB 5LXTB 1Q82W 4ZMTA 3GHBH 1KFAH 4PRAB 3RL2B 3ZKND 3WLBB 3P3RA 4YHYC 2G2RB 4DZ8B 2P5ED 3QEHA 4NFDA 3WNOA 4MTMA 1KENL 4ERSL 2JKRM 3PGCB 4PJ7E 3UJJL 1JS4A 1UACH 2AV7B 2CHWA 4LNRA 1PKOA 3I02B 5D2NC 1KXVA 5KUKA 4GRWE 4ZSOE 5GS0L 4JF3A 1JTPA 1RFDL 2YXWA 3G80A 3SDDD 2IEPA 1TZIB 3MXWH 4Z7UF 3IKKA 1X5LA 1HHIA 1MDAA 2CGOA 3G6DL 4OJYA 4XAKD 2ITCA 3I9PA 2KSDA 4PWGA 5T5FA 3A24A 2DWYA 1I5XA 3FOLA 3MRQA 3KPPA 3APNA 5JW3H 3R65A 1P4LB 2CCVA 3K72A 5DEGA 3ULVE 4PY8J 3TVMC 1QSFE 3FYEB 3EGSA 1DQJB 4LHUB 5D5PA 5FF6A 2C4FU 3GMRA 1N32B 1KLFB 4CW1B 4Z7QB 2X7RB 5IB5A 1G1XB 1QSFD 1URIA 4JRFA 2JB6A 5K39B 4BFNA 3CSTA 4FLYA 2F8XC 3T0VA 4GUNA 2XACC 2ZUVA 1NWOA