1OCUA

Crystal structure of the yeast px-domain protein grd19p (sorting nexin 3) complexed to phosphatidylinosytol-3-phosphate.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
133
Chain Sequence
IYAEPENFLEIEVHNPKTHIPNGMDSKGMFTDYEIICRTNLPSFHKRVSKVRRRYSDFEFFRKLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQSVAGHPLLQSGSKVLVRFIEAEKFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORTING NEXIN
publication title Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
pubmed doi rcsb
source organism saccharomyces cerevisiae s288c
molecule tags Sorting protein
total genus 39
structure length 133
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 1ocuA00
4PQPA 1O7KA 2I4KA 4IKBB 2DYBA 2ETTA 3DYTA 1XTEA 2RAJA 2V14A 1GD5A 3IQ2A 4AZ9A 2V6VA 2YPSA 2WWEA 4AKVA 2REDA 1H6HA 2L73A 4BGJA 4OXWA 4PQOA 2CZOA 2RAKA 1KMDA 3HPCX 3LUIA 3FOGA 3P0CA 2RAIA 2IWLX 2REAA 3HPBA 4ON3A 2AR5A 2CSKA 4HASA 4PZGA 1OCSA 4P2JA 1KQ6A 1OCUA 4IKDA 4IKBA 1XTNA 4P2IA
chains in the Genus database with same CATH superfamily
4PQPA 1O7KA 2I4KA 4IKBB 2DYBA 2ETTA 3DYTA 1XTEA 2RAJA 2V14A 1GD5A 3IQ2A 4AZ9A 2V6VA 2YPSA 2WWEA 4AKVA 2REDA 1H6HA 2L73A 4BGJA 4OXWA 4PQOA 2CZOA 2RAKA 1KMDA 3HPCX 3LUIA 3FOGA 3P0CA 2RAIA 2IWLX 2REAA 3HPBA 4ON3A 2AR5A 2CSKA 4HASA 4PZGA 1OCSA 4P2JA 1KQ6A 1OCUA 4IKDA 4IKBA 1XTNA 4P2IA
chains in the Genus database with same CATH topology
4PQPA 1O7KA 2I4KA 4IKBB 2DYBA 2ETTA 3DYTA 1XTEA 2RAJA 2V14A 1GD5A 3IQ2A 4AZ9A 2V6VA 2YPSA 2WWEA 4AKVA 2REDA 1H6HA 2L73A 4BGJA 4OXWA 4PQOA 2CZOA 2RAKA 1KMDA 3HPCX 3LUIA 3FOGA 3P0CA 2RAIA 2IWLX 2REAA 3HPBA 4ON3A 2AR5A 2CSKA 4HASA 4PZGA 1OCSA 4P2JA 1KQ6A 1OCUA 4IKDA 4IKBA 1XTNA 4P2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQP A;  1O7K A;  2I4K A;  4IKB B;  2DYB A;  2ETT A;  3DYT A;  1XTE A;  2RAJ A;  2V14 A;  1GD5 A;  3IQ2 A;  4AZ9 A;  2V6V A;  2YPS A;  2WWE A;  4AKV A;  2RED A;  1H6H A;  2L73 A;  4BGJ A;  4OXW A;  4PQO A;  2CZO A;  2RAK A;  1KMD A;  3HPC X;  3LUI A;  3FOG A;  3P0C A;  2RAI A;  2IWL X;  2REA A;  3HPB A;  4ON3 A;  2AR5 A;  2CSK A;  4HAS A;  4PZG A;  1OCS A;  4P2J A;  1KQ6 A;  1OCU A;  4IKD A;  4IKB A;  1XTN A;  4P2I A; 
#chains in the Genus database with same CATH topology
 4PQP A;  1O7K A;  2I4K A;  4IKB B;  2DYB A;  2ETT A;  3DYT A;  1XTE A;  2RAJ A;  2V14 A;  1GD5 A;  3IQ2 A;  4AZ9 A;  2V6V A;  2YPS A;  2WWE A;  4AKV A;  2RED A;  1H6H A;  2L73 A;  4BGJ A;  4OXW A;  4PQO A;  2CZO A;  2RAK A;  1KMD A;  3HPC X;  3LUI A;  3FOG A;  3P0C A;  2RAI A;  2IWL X;  2REA A;  3HPB A;  4ON3 A;  2AR5 A;  2CSK A;  4HAS A;  4PZG A;  1OCS A;  4P2J A;  1KQ6 A;  1OCU A;  4IKD A;  4IKB A;  1XTN A;  4P2I A; 
#chains in the Genus database with same CATH homology
 4PQP A;  1O7K A;  2I4K A;  4IKB B;  2DYB A;  2ETT A;  3DYT A;  1XTE A;  2RAJ A;  2V14 A;  1GD5 A;  3IQ2 A;  4AZ9 A;  2V6V A;  2YPS A;  2WWE A;  4AKV A;  2RED A;  1H6H A;  2L73 A;  4BGJ A;  4OXW A;  4PQO A;  2CZO A;  2RAK A;  1KMD A;  3HPC X;  3LUI A;  3FOG A;  3P0C A;  2RAI A;  2IWL X;  2REA A;  3HPB A;  4ON3 A;  2AR5 A;  2CSK A;  4HAS A;  4PZG A;  1OCS A;  4P2J A;  1KQ6 A;  1OCU A;  4IKD A;  4IKB A;  1XTN A;  4P2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...