1OCWH

Free conformation ab2 of the ige spe-7
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
120
structure length
120
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN E
total genus 18
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ocwH00
1NBVL 2PN5A 4J3WA 4OM0H 2GYSA 4EI5D 2CR6A 4OD1L 1H3TA 4NZUL 1I1CA 1WC7B 4HEPG 3RKDC 1Z9MA 1AGDB 4J1UA 4I18C 3MR9A 2H9GB 2GJ6B 3DGGA 5DK0A 4U6HA 2HTLC 4JZNB 4PJFF 1JF6A 3V5DB 4L9DA 1XCQA 4EKXA 2H8PB 3IRPX 1G7IA 2OTUB 1N5YL 3HG1B 4M8VA 3FFDB 1CVRA 5KANG 5BVJB 2XPGB 1IBGL 2K9UA 4MZ2A 1IGIH 3T1FA 3QJHA 3V4PH 4P2CG 4YHIB 4NQXA 1BBDH 2XV6B 4JZJC 4UINL 5MEQB 4UT9L 4P5KB 3EGSA 3RWJB 4RGOL 1MY5A 5F7KC 2D31B 3VWKD 1G6RH 5FOBB 1DLFL 3GK8H 3RDTC 4PJXB 4NQEB 4JY6B 3MV7D 1DN2A 4UAOC 4BK5A 3S36L 3IJHA 2MOVA 2GTZB 4U1IB 4U7KA 1CF8L 3OXRB 4MX7A 2AJUL 1XF3A 3T0EA 2NY5L 3K2MC 5CWSB 4YWGH 2Q7NA 3KPOA 4KKAC 4TULH 1ZANL 1YECL 4PJBB 1CGSL 1N64L 3RY6C 3MV8A 5E1AB 2GW5A 3AREC 2IGFL 5IB3A 2DS4A 1HNFA 3VRLE 2C9AA 3QAZB 4DJMA 4L3CB 2C7UA 5DTFB 5I17B 1RZKL 2Z31A 1H3GA 2FL5B 3DURA 4QOKB 5DEGB 2KBGA 5T1KB 1CXFA 1QSFA 4K23L 3PV6B 2CDGA 5JQHC 2VE6A 1EFQA 2MQ0A 4KY1H 4KC3B 1FZOA 3HZKA 1IQWL 1KJ3L 5BQ7A 4JDZB 4EVNA 2ZPKH 2IH1A 4JFOA 2F8OA 5K9OB 5HY9B 1S9YA 5IVXA 3RVTD 1UENA 5E2VH 5A2IH 5BQ7B 1T89C 3UBXI 4TVSa 3VE0B 3UZQA 4HD9A 5GGRY 5KSBE 1QBLL 3RVXC 2CDGB 3VJ6B 5DZNA 2IQ9L 2P5EB 4NQDB 4MXVF 3PABB 1KACB 3CZFA 3MV9D 4M8QA 5J1TC 5DUPL 5GQBA 4APQC 5KVEH 1T20A 2A74A 4O9HH 4LSVH 4WCYH 4X0KB 3SDXA 2P7TA 3V0WL 1X4XA 3QDAA 5F1NB 3L5XL 1SMAA 1J1PL 2HH0L 2H6PA 2AJ3B 4NWTH 3H0TB 4A6YH 5EU5B 5B8CA 3SDXB 1FGVH 1Z5LB 4PP2A 4MXQC 1LGVA 5GZND 4TNVK 5B4MD 3NTCH 1TZHA 3A6CH 3RI5F 3MFGB 4D9LL 4LP4A 2B39A 2DQIL 2NY4B 3INUL 4EBQL 3QZWG 3GSVB 2W9DH 2VXUL 2A9NH 1A64A 3HI5L 4PBXA 3G9VA 3ZDXF 4I77L 4HUXB 1NC2D 4PJGB 4LPVA 3ZYJA 4X98A 1QSEB 4MQXC 3RWGA 3Q6GH 4F37K 4C54A 4PJCB 5KOMC 5KVGH 2NR6C 4JN1L 4WUUD 4N8VA 4FQXD 4J4PA 5C9JA 3QUZB 5F8RC 2NNAA 1UZ6F 3EDJA 2RGSA 4K9EL 3OZ9H 3L3OB 3CFKB 5I6XC 3CSGA 1UA6H 3VI3F 2X4UB 4KVNL 5HGAB 1WFTA 3OAUH 4OZIF 3V5DA 2ZG2A 4I9WD 3V6FA 4JFFB 1BVKA 1KEGH 1U3JA 4XC3H 4OFVA 5TGBB 3BHBB 2DLGA 4NQVA 3ZO0A 5JORB 2A6JB 2YUZA 5C0EA 3D48R 4E41E 1T21B 4TUKH 3UDWC 2GK0A 5I74C 3V0VA 5F96L 1LEIA 5TQ2H 1BFVH 5C6TH 1BPVA 2JB5H 3K4AA 2D0HA 4U3XA 2Y07H 5IGXH 2YD9A 4E5XA 3MGOB 3LKPA 3P0YH 4YHNB 5J7CC 2IWGA 2AV7A 1EA9C 1P4LB 1FPTH 4JO1L 4M6AA 2XI9A 3WHE0 3KLHD 4QCIA 4QTIH 1VFAA 1A1MB 3OKLA 43C9A 4O02H 1C12B 4NQXB 2CJUL 1CD8A 2FJGB 3QDJA 5L2JB 5F1IB 3G6DH 4BFBD 5DEFB 2R8SL 1LE5B 3LQZA 4ZUTB 1ZA3B 1WWCA 1EO5A 4U0RB 1GZQA 4YH6A 5D7JC 4PJIB 2W0FB 5T3XH 4PJ8D 5C0IA 2Y5EA 3P9MB 2ZJSH 3ARXA 1TENA 5I76A 3DVFA 1R5IB 5EORL 3OKYA 4DN3H 3MRBA 3OHXA 4U1MB 1J0YA 2XTLA 4QRRE 4BZ1L 3TWCH 2H9GA 1BVLB 3QDGE 4YGAB 3MOAH 4HQQH 2A83B 1H5BC 3MROB 3RPIA 4TRPH 1OAXL 3OHXB 4U1MA 2JLLA 4OZIA 1T1WB 3U6RB 4JHWL 1UB6B 4I3SL 3ARTA 3NMEA 2VLMD 1E4KC 4PRDA 4UOJA 4APQB 3MLSL 3THML 1TJGH 4ZPVA 3ZE2E 5CCKL 1LE5A 4N1EA 3SDXE 4IRSC 4LLWB 4G8FB 3JTTB 2HT4C 3B8SA 3BKJH 3IAGC 1DVFB 3I75B 1DANT 4Z7VB 4KWUA 3U30C 3GMOA 5MEPA 2ED8A 3MJ9L 4R2GB 3ROOA 2GY7B 3MACH 1CK0L 1E4XI 5EUKA 5B4MC 5GZNC 2R0LL 3D25B 1LK3L 3H3KA 3S4SA 3CZJA 3FRPA 5MERA 1W0VB 1JGVL 2W65A 4KK8D 1LEGB 3BX7C 3LS5L 5I1DB 1LP9A 1MQKH 5ICZB 2AGJH 3QSKB 1U3HB 2VLLB 4UINH 3GMPA 3QI9A 4E42A 4U1SB 2XA3A 4G6MH 4DGVL 1IAIH 3DJ9A 1S9VB 1I1AD 2NYYD 2KUTA 2OQJB 1HKLL 2FJHB 2XXMB 3BDBA 5M95B 5E7FA 1CFNB 3BEWA 4OI7A 4KPHL 4YK4C 3MRGA 5D7IB 4UIMA 5D7IA 3D0VB 1JWMB 4HWBL 4RISL 2FNBA 2ICWB 5ALCL 5CSGA 4Z7UF 1KC5L 3GMPB 3QI9B 3NFNA 2ARJB 1KLFA 3H3BC 4XBPA 2UZIH 1S9VA 1U92B 5A2LH 5L8LB 5ITFB 5L88L 3P11H 5DRWB 3MJ9A 4Y1AD 1DBKH 1P6AB 3O4LA 3FHQA 3WIFB 5JW4N 2KKQA 1FSKC 5MERB 2BZDA 4PGDA 3U7WL 5IMLB 5SWQB 4J7RA 2Z8WC 3LVEA 3DV4A 3IU3B 5DJ6B 4P46D 4B0MM 3RL1A 3QUYD 4NP4H 1EJ6A 2PTTB 3GO1H 5EU7E 4C56D 3S3PA 4Q58C 4ZO9A 2ZUSA 3TF7C 5I75B 3N1PC 5GGQL 1NGXA 1VDGA 5JXED 4KU1A 4Y16C 1U8KA 1FVEB 1TTFA 3UTQA 5IP4A 5JO5A 5DRNB 3HE7D 4JFQB 3DBXA 1U8LB 5DO2C 2BVQA 3F5WB 5F93C 3VXRE 4M7LH 3KYOB 1KULA 1IAII 3GMNB 2AJ3A 5C1MB 3ZHLA 5FIEA 2UY6A 4A2LA 4EUPA 1A6UH 2NY6C 2P8MA 2GK2A 4HJ0C 3QUYA 3OKNB 4R9HA 2F74B 2J6EL 5EO0A 4X8JA 3T0EE 2A74B 1TVBA 1INQA 3RDTA 2BVPB 3O9WD 4WFGD 3MXWH 4XB8A 3IRZA 2HKFH 1PY4A 1E6JH 1BX2B 2FIRT 1OHQA 1S5IL 1YY9D 1KCRH 2Y9RT 2DM4A 4HK3J 1NDGA 3WE6B 2XZAL 2MQ3A 3T0EC 4HIJA 4LCWA 5L2JA 4D9QE 5HGGS 3SKOB 4P3DA 3H3PH 5JPNB 1NLDH 5BXFA 1PLGH 3IETA 2WP3O 4Q0XH 1KCVL 3EW3B 4XC1H 4GS7B 4ISVB 2G2RB 5JUEL 2DAVA 4OFDA 5C08A 3KHOA 1HHIB 2P42B 1OPGL 1D9KA 4PJXE 5T3XE 4HK0A 3ZYIA 1EERB 4ERSH 2BSSA 5EN2A 4CL7A 3PV6A 2BJML 2IFFH 5BS0D 1MHCA 4PLJC 2FL5A 4GW4B 4M5ZH 2YBRA 4XX1E 3FFCE 1WBZA 2VISA 3PWUA 1EEYB 5HHME 3OKEA 3ZKND 1EK3A 4JPVL 1T0PB 2N7BA 2X44D 2DM7A 3TM6A 2GFBA 3CGTA 1JRHL 3DMMC 3QH3A 4ODWA 4ODSH 5TGBA 3VFTB 1PZ5B 4G6AD 5F7DA 3F6LA 3CJJA 4L8SA 1OQXA 4QRQB 2YD6A 5KVEL 4ZO7A 4OAWB 5DMIL 3QIWB 5HVFB 5GRYA 3QEQD 5HI3D 3MLWL 3BQUA 3P2TA 2XKNB 1I8KB 3VFWA 4XI5C 1U3YA 5JQ6H 5DO2D 3MRDB 3IDGB 3K2UL 1OW0A 1FFRA 2XACC 3OXRA 5I30H 1TVDA 3P4OB 4M1DH 4MD0B 3SGJA 4AL8L 1QHPA 3FONB 2A73B 3BE1L 4UTBL 4WW1A 2D7PA 3I85A 4JQVA 2PETA 2OLDA 3BD5A 1OGTA 5B39A 3E6HA 1NMAH 2ADFL 1DQMH 2AJYL 5JW3L 1CI5A 1G7QA 1FV1B 1WWAX 1T4KA 4TYUA 2SEBB 5AAWA 1NJ9B 4H8WC 2XTJD 4M02A 1FFNA 3OR6A 5T1LB 1FP5A 3PWVB 1YMME 1IGFL 3LRHA 2J8UA 5TE4H 4M6NL 2X7LA 4NSKA 3QRFM 5CJXC 5F9WC 3V4VL 3LD8B 1T0MA 4WTWA 5ID0A 1MJ7H 2J5LC 1JZ6A 5JW4M 4CJ1A 3PHQA 1IQDB 3E0GA 1ORSB 3SDCD 3KPRA 4YNYB 2N56A 3VFPB 2AJXL 3O2WH 1LO3H 3CFCH 2LVEA 1BOGA 3ARVA 1KUMA 4Y16D 3WCYA 5C7XH 4XB7A 5EUOB 3H0TA 4JG1H 4Z77A 4CMMA 4XP5L 5E94B 5CJQH 2EXWC 3H42H 2MCPH 2R0ZH 5FM5M 1R3JB 2F19L 1YEKH 3MPCA 3VFRA 4NM8L 1MFEH 2X4RA 4LRNL 3VJ6A 1HSBA 3UZEA 4ODHL 1VGKA 1MCNA 2AEWA 4IOFC 1VB9A 4OSUL 3QR2A 1Z3GL 4FQIL 4PJ5B 1MFAH 1NKOA 3GMRA 3IDGA 3BQUC 1OT1A 1QSEE 4Y4FD 4CJ0A 4PRAA 2FX7H 4Q9QL 4HUUA 4EI5B 5HHNB 1MCLA 2IH1B 3QIBD 5FUOL 1C5CL 1CXLA 1KGCD 1MH5B 2XZCH 1S3KL 1VGKB 5FCUH 1UEYA 1K2DA 4QTIL 5MENE 2EYRA 3G6JF 1BM3L 3BPNC 2X4NA 2VE6B 4PYHA 5FXCH 2X2YA 2BHUA 4LVNB 1NL0L 4MNGB 4OCNC 3SJVD 3D3VD 5ANME 1UWXH 4OGAC 4FFYH 5FA4A 2VR5A 4KFZC 3ZMRA 5E2WL 3O8XD 1UJ3A 2Q8BL 3BYTA 5JMRA 2R1WA 3CMOH 4JHAL 3PP4H 1YDPB 4JG0H 4KVCH 5E1AA 3V7AE 4G9FB 1RHFA 1UZ8A 1INDL 7FABL 3BOVA 2Z31C 3FRPG 1BIIA 4EI6B 1RZJL 1JP5A 2HKFL 2IPTL 1T0MB 4IIQA 1TFHA 3MRFB 4HK0B 1R24B 4X9IA 1G84A 1UM4L 4LAQL 4YUEL 5F7NC 5JR1H 4FZ8L 2FX9H 1OAKL 1XIWC 3WL9B 1GC1L 3QQ4A 2N7AA 3SJVE 3P3YA 2EDKA 3R06A 2YZ1A 1U3HC 4XP1L 4HXAH 2AK4D 4KAQH 3R1GH 4R4BB 3L3JA 2PYED 2BSRA 4YX2L 4WFFD 1RK0B 1OSPL 2CDFA 5DD0H 1MY7A 3X12B 1KCKA 1L7IH 1BD2B 6CGTA 4YK4B 3IYLW 2X70A 2VZ3A 4ELKA 2G5RA 4OBRA 2X4SB 3SO3C 1RULL 5CBAB 1AD9B 1B2WH 5DYOA 1WZ1L 4MSWB 3SKMA 2WAHA 5T1LD 1CWVA 4XMPL 4WU7B 3MRMB 2XKNA 4H88L 2W0LA 1M4KA 3GJFK 2X89D 5AZ2H 5I8CB 4OIIL 1NC2A 3MRKB 5KW9H 1YMMB 3KPLA 3GI8H 1GGUA 4J1UB 3VA2C 4U1HB 4JFEE 1MRFH 1GL4B 1CIDA 3OF6A 4LMQE 1JGEA 4KUCF 5BOPA 4KTDH 5KG9B 1FNGB 4FQXA 3TJHC 4PUBH 4YGVB 3VFNA 1IAOA 3TJHD 2P44B 5J11C 2YRLA 2CXKA 1CFQA 1J8KA 4U1LB 3WEXA 1T2QL 1JE6A 2W0PA 3CVHB 2Q86B 4NKIL 1WEJL 4KQ4L 5IMLA 4HMEA 4TTDC 1AGBA 4TSAH 1HOCB 1B0RB 5C0DB 1W0WA 1YC7A 3VI3E 3FFCB 1DBKL 2FH6A 2FYYB 2UYLA 1KN2L 3GKZA 4DN4H 2XTJE 4K3EH 1A2YA 1G7HB 1CDYA 3SDDA 1A47A 1IC4H 1AXIB 3EDFA 3O6FA 5BXFB 3DNKA 1FSKB 2Y06L 3Q1SL 3HMWL 2VMFA 3H7LA 4LRNH 4ZQKA 3RWIB 5IW1B 1JWMA 1PQZA 1NEZG 1UM4H 4LQFH 1YEFL 4MD5B 4N0UA 6FABH 2HJLA 4URTB 2L7UA 5IR1B 2I9LB 4Z9KB 1OAYH 3GZKA 5GS3A 2Y72A 2ATPB 2OQJA 3TVMC 4E42B 3UX9B 5C09B 3VGAB 4MNGE 4XCFH 5F72S 5D2NC 4Q9RL 3K80A 4G9DB 2DYPB 3O6FD 5ALCH 3FT4B 5IWLA 4ZS7L 5DHVH 1A7PL 4HW6A 4NNPH 5KVDH 4U4BA 4OZHB 3MTRA 1MFEL 4JKLA 4Z8FL 1CG9B 3RX8A 1DL7H 1TDQA 4QF1A 1ZANH 1KTLB 5B38A 4GG6B 5T1DL 2FX8H 1C08B 4PY8J 4PJ9A 3KLSA 4HZAA 4AG4H 3LEYH 4G8FA 2P43B 5FM8A 5FB8B 1OARH 2AABL 5FYJD 4KRPB 3PP3H 3RVWD 1Q9LA 4CU7A 1EPFA 3HNTH 1AIFB 5KBNC 3WNKA 1AJ7H 1PFCA 5IEKB 1A9EB 3HE7B 3QG7L 3BUTA 1YZZA 1KB5L 3UJIL 3RZCB 1N0XH 2CRZA 1SM3L 4NDMB 4XPFL 4JEGB 5ISZD 1UXWB 3K8MA 3SBWC 4JFYB 1LO2H 4B53A 4FFYL 2X1WL 1LEKB 1SYVA 4ZTOL 3W9EB 5BZWA 1YQ2A 5IR1A 4MA7L 2AP2A 2BOCB 1TCRB 4WO4A 3ILQD 3PG2A 1MVUA 4WFGE 4HIIB 4NZRL 2BNRE 1MSPA 2ARWA 4X6CF 4GQPH 2F15A 2G9HA 4P4RB 5HVWA 5EIIB 5HI4D 3DROA 2UZIL 3BN9C 2OZ4H 4IRSA 3T0WA 4GBXA 3CSPA 5FYKH 5J89A 1UKSA 4WI7A 3BGMA 3ARPA 1BBJA 4PGCB 1KN4H 3QI9D 4HS3A 5CINL 2HWZL 3IAQA 1KPVA 1N6QH 2RBLA 1LMKA 2EC9U 2CKBH 2HFFB 4PS4L 1FJ1A 3OBAA 4HJGB 2YKLL 5C0NC 2YPKA 3KPSE 5FHAH 1QSVA 1RUAL 3LKPB 1G9NH 5KSVB 2X9WA 4MNQE 3BZFB 1KG0B 4ZFZB 2OSLB 4D0BB 3OXSB 2QV2A 1I1AB 3P30L 3UJTH 4DZ8A 2O5XL 5ACMA 4OUOA 1KCSH 2R1YB 3B6SB 3VMOA 1A7OL 1U3HD 1MFDH 4MJIA 4PJEA 4P2YA 5T5FH 1FVDB 1MJ8L 4HIIA 3MLVH 4NO5A 3HRZA 3VXNB 4U6XB 4Q2ZB 5L9DL 4XVUD 2HG5B 4FFVC 1EFXB 1HWGB 3TPKA 1QFWI 1XF4A 4EJ1C 1Q72H 3PF2A 4Y4HA 3UTOA 3WXWL 1PBYA 1I1FA 4XPHH 4C83B 3KNBA 4YDIL 1MRDL 1HKLH 2QSCL 4CMHC 3CFKA 4L9LC 4F7CB 4RAVA 4ORGA 3FKUS 3ES6A 2G5BA 1SBBA 3TBVB 3MLSH 3O2DL 5JNYB 3C87A 4C56A 4NO3A 2H2PC 4ZFGH 2DQJH 1GGIH 4EI5C 3TNNA 4MD4B 4Y19E 4FQQB 1ZLWK 1OAUL 4PJEE 1P7QA 2GEEA 1QFUH 5T3XD 2LU4A 1FCCA 1CD9B 1NSNH 4KUCD 4D8PB 5L0QB 1OM3L 1XIWD 2Q7YA 4NQCA 1RAMA 5DA0B 5C0RL 2WMPA 2G60H 4RX4D 4Z7WE 4J12A 5L7XH 5JHDD 1FORL 4KXZH 4G9FA 3Q1SH 1MJUL 5EC2B 3GSQB 4OIAA 5HGDA 5HI5C 5IHZB 4Q9QH 5JHDE 4OFKA 2WWKO 3NGBB 4P23D 5GRUL 1AP2A 4H0HB 1BZ7B 1IGJB 1ZT7B 4Q6IB 3EOTL 4F8QA 1J8HE 2A0LC 1LO5B 2W38A 4NO0D 2FR4A 4KDVA 2X4NB 1HCVA 2VIRB 2VWEE 2WBJA 3KYKH 4OGXL 3CD4A 3AS2A 5JPMA 4WWKA 3UTTD 4HKXB 4Z7VE 1GGBL 1A3RL 3MMEB 1JF5A 4FTVE 3FO9B 2VDQH 2CKBB 3L3OA 4HHAA 3OB0H 4NC1C 1Q0YL 5A2FA 3QIUB 1DBMH 4NNXA 4DOHE 1EAPB 1WUNT 1UWGH 2BOBB 2IADA 3HZMB 3JZ7A 2ADIB 4UILL 1ZT4B 2DM3A 4LCYB 4JGUA 4U1JB 3KR3L 5DJ8B 5E5UB 5JW4R 1QRNB 1HI6B 1MHPL 2EIZB 2AEQH 2ENYA 1HXMA 5EZLA 4HUXA 1BEYL 3QEQA 3V0WH 2IAMD 1AXTL 4HV8B 3SE3A 3AS0A 3REVA 1G9MH 4X5WA 4JPWL 1QFOA 4NQCE 3IFPB 3P73A 4GSDH 4L3CA 4G6ML 1NMBH 4DGVH 1GOGA 1S7WB 1MCCA 1SM3H 3RZCC 3G5YB 4XXDB 3MCLH 5HSFA 1FNGA 4FQXB 2PO6D 4UQ3A 4KJQC 2QQNL 4K71C 3FN9A 3R4DA 4HAGA 4YDKL 1F6AB 1VCAA 1QSED 4RISH 4MS8C 5JW5A 1ZHNA 1H8SA 3UYRH 2A9NL 2QSQA 4J2XA 4GG8B 4H1LG 3PGDB 3BWAA 3QEHB 2VZ1A 3HRPA 15C8H 1XT5A 4OLXL 1A9BB 1IM9D 3L3IB 3NZHH 1DVFC 4ELKB 4M1GH 2J8UF 4U1GB 4XHQA 3DX7A 3MBED 1CLZL 3B2UD 2F19H 3RTQC 4M8QB 5AG9A 1INDH 2CPCA 1CGUA 3X12A 5DURD 2DM2A 3WHXA 2P5EA 3DO7A 5GZOD 4HX1B 2ZJSL 4DEPB 4M48H 4FQCL 5ETUB 2Z93A 1U6AH 1JGUH 5J8OA 4PRNB 4HF5H 2UUDH 5GS2D 1SVCP 4FN0A 2BERA 2RB8A 4JM4L 2BVUA 3WFEH 3ZSSA 2IMMA 1U8OA 2IEPA 5KOVC 4XVSH 2DOCA 4O2CB 3WNLA 5C8JA 4JFXA 3MV9B 3HCVB 3FOMA 4NQDD 2AJSH 2P5ED 5EC1B 4YHYB 1CR9L 2DBLL 1FL3B 5IBLD 4WFHD 4S0SD 2CRMA 3O3EB 5HDOA 3LKOA 1AR1D 3HC4L 4ZDHA 3ZKMC 5I1EL 2BNQB 2BNQA 2BRQA 1NKRA 5E8DH 4KROB 5KVMC 2VC2H 1CICA 2A77L 3T2PA 2H2PD 5D1ZB 5HHMD 4BUHA 1AJ7L 1TETH 4UV4H 1YEIL 4YC2B 2BVYA 3BVNA 4H26A 3V4UH 1U41A 5GRWA 3TIDB 1BQHG 3HC3H 4NKDA 1U8OB 2VAAA 5CGMA 1DEEA 1OD7A 3CXDH 4PRAB 4Z76B 2OMBA 4UV7L 5CLWA 5E70A 5JOFB 1CVSC 3D3VA 4AIZA 1BJ8A 3BN9D 4O4YL 2NY1B 4FABH 1T3FA 2CDEB 4HBQA 2JTDA 2ZG1A 2QHRH 2NXZB 4M5ZL 5HDQH 3T3ME 4UDTB 5D1QD 1T03L 4L4VA 4XC3L 4TSAL 2BX5A 2DQCH 4LSUL 5HHMB 4NYLA 2DI8A 4BSWB 3O3DA 1FRGL 1KFAH 2R0KL 4PJ7B 1T2JA 4O5LL 3L9RA 3BMVA 2VXUH 3QEHA 4O51B 1I8MB 5EIQA 2PTUA 3QA3B 4R90H 2EDEA 3U0WH 2GY5A 2IALB 3CDYA 3O4LE 4K8RD 1BOGB 4DTGL 4DVBA 5JZ7C 4N5EC 1R3HA 1N8ZB 4AQOA 1EX0A 4JRXA 3P4NA 3LRSB 3QUKB 1AGEB 1OGAB 1QZ1A 2AV1B 2NW2A 3C6SB 3RBSA 3U9PL 1NGXB 3CVIL 4O2EB 4XZUB 5F3BA 3MNVA 4O9HL 5CD5C 4P5TD 3OAUL 4LARL 4LIQL 4I18B 2C26A 3E3QC 2VH5H 2XKSA 2W59A 4ZOCA 3VFGL 5SV3A 4X6BA 1MFNA 1J0JA 1VENA 2EYSB 4PGEA 4HWZB 4WY7H 3RZWA 1IGCL 4NKIH 4Q7DA 2VDPL 1U95A 1XF5A 1A1NA 5EOTB 4AH2A 2EDYA 4L8BB 1I8IB 4CN4A 2OTWB 3DX9A 5AUMB 1FYTE 5EO9B 4MXWH 2GJ6D 1IAIL 5HJ3B 4PJ9C 1QLRA 4OKDA 3UCRA 4BSJA 3P4OA 2VQUA 3DVNB 4F58L 4CVXB 5HHPA 4FOMA 2DN7A 2ESVB 4M3KB 5I1KH 1GPOL 4RQQA 2OJZH 3F12A 3KPNB 1AO7A 1A6ZB 5SX4I 1TMCB 4PTTA 2ZKHL 1A7RL 4BK4A 4NN5C 3L5WA 3EFDL 3G5VA 2ZZUT 2OCFD 4JM2B 3MV9E 1NC4A 5DJCA 5GPRA 1E4XH 3JSSA 1MUJB 4PLNC 3TH4T 3QCVH 1H0DA 2C4XA 2I24N 5D71H 5EC2A 4P57A 3EYQC 4DOHB 5I1DA 3W5MA 1H3VA 3CLEH 4MA3B 1JGVH 1XGUA 3VGEA 2E7MA 5ID1B 1ONQA 1U58B 5BOZG 4D0CA 3TZVA 3FZUD 5TE4L 3INUH 4JFHD 2QL1A 3L7EA 3EYUH 3S97C 4WV1A 3H7BB 1F5WA 2Q8AH 5KZCD 5L2KA 4HT1H 2R4RH 3KAAA 1ES0A 2ZSVA 3EDEA 5I0ZA 3V52L 5ISZE 2OXHA 2R2EB 3G6JB 3HAEG 1XFPA 5CZXD 4C58B 2R15A 3LH2L 1NFDB 2GIYA 2OMNA 3T2QA 3T0VA 4NPYA 5GS0L 1NDMB 1D5BA 4LLUA 1S9KC 1C1EL 5HVGB 2WZPD 4ELMA 4O02L 4QHLB 1I9IL 4GRLA 3ZT6A 3MJ9H 5J4MA 5I30L 4BELD 3OKNA 3VXMB 3EFFA 5D7SL 4EUPB 1FIGH 1KEML 2Y4SA 5DJAB 3TVMA 4BFIA 4Z7QE 3AROA 2DIBA 3MA9H 3VXQA 3KYNA 1D5IL 2HJFB 1C5DA 4K2UH 4HWBA 2L4OA 4QHNB 5T3XL 5HDBE 3ARZA 2X1OA 3T1WA 3C5ZC 3EOAB 5JLZB 4HKZA 4RGMC 1JWSB 3S37X 1FO0H 2C5DC 5IW6A 4L5FH 5F96H 3DLQR 5IG7B 4YQXL 4XAKD 5AYQA 5IB4B 1KELH 1ZMYA 4GRLD 1YNTA 2QQLL 5FGSA 5IB2A 3FZUC 2AXFA 3MLXL 4BQ6A 4G6FB 1YEHL 4MDJB 4PV8A 4X6DE 3DGCR 4YEEA 2A1WH 3BEVA 3OG6B 2EDQA 5E1HB 1DLFH 3GK8L 4FQLL 4WFFE 3ARDD 1BZ9A 1BBJB 4PGCA 3S5LB 4XMKL 4FQJH 5CHNB 3SCMC 1CFSA 3MOBL 4U6VH 4XP5H 1PZUB 4D9QD 2JB6B 4NZUH 8FABB 4JVUA 2ICES 3O45A 4JY5L 1DJSA 2LTQC 1EFXD 5KVGL 1FNAA 2CD0A 2VDPH 1FYTA 3KXFB 4IRZH 1ERNA 5EBMB 3RBGA 3K4ZA 4CVWA 5HYSA 3A0OA 3G5ZA 4J23A 1MCOL 4A2MA 4YPGA 4MA8H 1T2QH 2O61A 5LKNA 3P4MB 4LCCB 1ZGLP 2DDQH 3N50A 4JM2D 4PRPD 1RVFH 1I8LC 1KPRA 3NFSH 4P2RE 5ICZA 4NRYA 4M7LL 1YEDA 1A3RH 4UQ2B 5LGHH 5SX5H 3OR7B 4WHTB 5E6IB 3OG4B 4TSCH 4H20H 5J3HD 1CLCA 3HR5A 1IGYB 5TQ2L 5GS0C 3IDIA 1NBYB 2VL5B 4BH8A 2LAAA 3Q6FA 4NCDA 3MLTB 3CFDA 1EUTA 3PHOB 2BXYA 3TT1L 3KLAA 4P4KC 4AZ8A 2FHBA 5I18H 1DQTA 4Y4HD 4WU5A 4P5MB 1MLCA 2X6MA 3PNWB 1U8NB 3OJDB 1PKOA 3UBXA 3BKMH 1DQQA 3OKDB 1HYSD 3QUZC 1ZEAL 2H45A 3FO1B 4M5YL 1A6AA 1UZ6E 2PW1A 3TIEB 1I8LA 3C2AL 3TPUA 3TYFB 2LABA 3IT8D 3BQUD 4L8DA 4OQ1A 4L4VE 4OZIB 4R96B 5F7EL 4P2RA 4OZIE 3LAFA 3QNYA 3QUXB 2O5XH 2DDQL 2VDRH 5ISZB 4G43A 4LMQI 3RZCD 4ONGL 3TBSA 2FIKB 2EH7H 4XTRD 3IFNL 3F8UB 1R5VB 2RR3A 3IGAA 3CZFB 3V79C 5HD8D 4DFHA 4EDWH 3MV7A 1A02N 1KNOA 2HLFD 3LKNB 4PJBE 5FM5O 4ORZC 5E8DL 5BS0A 1U8IB 5IGXL 4TUKL 2C1PA 5C0AA 1KXQE 2JB5L 4K94L 1BJ1H 1JGLH 5ELIA 5F1OB 5FYJL 3GHBL 5D9SB 4GH7B 2DQJL 1D6VH 3LIZL 4F7EA 2P45B 3Q3GB 5CUSH 1OF2A 1S5IH 4I3RH 3AMLA 1S7RA 2H32A 1LVEA 1QFWM 1ZKAA 4LCWD 3WD5L 2NXZD 3IFOA 4LU5L 4LIQH 3WEXB 3DO3A 3SQOL 4X4XA 1A7OH 5KN5B 3BPCA 2VXVH 3T2OA 2P46B 3NOIA 4Y4KA 1EJOH 5CBEB 3T0XA 4DK3A 4DUXA 1VACB 3UPCA 2D03H 1FORH 3RJDA 4PJBF 1JYWA 5IFHH 2A1WL 3MJ7B 4ONHA 3GDBA 3MFFB 4OD2B 1D5IH 1FZMA 2NY7H 1GC1H 5B21A 3VDAA 4FNLL 4QRTA 2DL9A 5DQ9A 4F9LC 4JHBA 3O2VL 5CWSA 3AC0A 3M45A 4NO2B 4KKAD 5GRJL 1UM5H 5HI3C 5I8EB 43CAA 2RFXB 5B22A 2LTQB 3VD7A 2J88L 3EZJB 1GGCH 3GRWA 3IJHB 4PJHF 4RIRA 4WUKL 4DKEL 3ARDB 4FFWC 2IH3B 2JIXA 5DRZA 3GJEB 5CP7B 1QA9B 5JDSA 1IKNA 1TQCB 3CDGB 4TSBL 5FO7A 1ADQL 1XGRA 4P46A 4XNMB 3VA6A 3VGGA 2V2TA 1JHTA 5D72L 2AXHA 3V5KB 3WIIH 4XNUL 5TH2B 2CIKB 5I1AB 5KJRL 4PGJA 3TCLB 3MQIA 4I0PB 4RFNC 4ETQA 3GSVA 4HGWA 4PLJD 2L0DA 4IHOA 4RAUB 1P2CA 4ZSOA 4N0YL 2V5MA 4HH9A 2AEQL 4OLUL 4O58H 5IF0A 1YMMD 3IXAA 2DQFA 5AG8A 4OCSH 5KSBA 4YXHL 2GUOA 2R1XB 4WHYG 4NNPL 3VWKA 2DTML 1ITBB 4KJQD 1DQDL 1YN7B 3MJ6A 4TVPD 4MAYC 2FX7L 3MBEB 4NGHL 3PL6D 3MRPA 1X44A 3HC4H 2HLFC 2P4AB 4JQIH 2F54B 3T0ED 3VFUA 3V52H 4LSSL 4Z7UB 2OK0L 1PD6A 3EZ8A 4OZ4B 1U8PA 5A1AA 4DW2H 1Q0XH 3CH8A 1MCKA 1FNEB 3KYMB 5C0ND 3FMGH 2H26B 5C0CA 3N85L 1KLUA 1BJ1J 1T7XA 1FG2A 3NCJL 3DARA 4HXBH 1C7SA 3QCVL 4JQXA 1BFOB 1DN0B 5CJQL 2ZCKH 3D2UA 1WICA 5CILH 2Z8SA 5C07E 3CLEL 3EDKA 2ZOKA 1CGVA 3GSXB 1D5MB 3F7VB 5TDOA 1N64H 1BVZA 4X7DC 5L7XL 2PW2A 3GI8L 2D0FA 4G9FD 5I71C 2X4RB 4KKCD 5AZEH 1QYGL 5KSUA 5IJKA 2H32H 3GSOA 5IFJA 1YEJL 5E2JA 3SKNB 2WQRA 3DWTA 1JN6A 5J13C 4QRRA 2YD2A 1S7SA 5I1KL 4JLRA 1B0GA 4RFOH 4XTRC 1SEQL 3IJSB 2DWDB 1T83A 3QO0A 3JV0A 5BV7C 1A1OA 3A6CL 3KWWB 3FQWB 3KJ6L 4YX2H 2ESVD 1AD0B 4OCWL 4Y5VA 1AGFA 4Y4FB 4OUUA 4RGNE 2NXYC 5AD0A 1MF2H 4N9GA 1G9NC 2HRPL 4OZGB 3WFBH 3MYJB 4M7LT 4B5EA 4F2MA 3T0EB 3UTZB 2F54D 5HGHB 3JTSB 3T3MF 2WBKA 2VH5L 5KSUB 2HT4D 3QEUB 4PJ8A 1EUUA 2WIMA 4ZPTB 4J3TA 1N5AB 3KR3H 1UVQA 4I2XB 3BP7A 2AI0L 3RNKA 4IOSD 5JHDB 3DRTB 5J3HC 2GITB 2YUWA 4PY7A 1DFBH 3RQ3A 3TYGH 4NRZA 5IVZA 4FABL 4LKCA 3HI1B 1J1OH 2JK5A 4X4MA 2AK1L 1J8HB 2C1OA 3OX8B 1QG3A 3C5SA 4WI8A 1S5HA 2Q1EA 4I0PD 4UZGA 2UWEF 1I7RB 2DBJA 1KLUB 3QO1A 1CU4L 4YDLB 5BJTA 4LCCC 4GUPA 5J1AB 3I02B 3VXUA 2R2BB 5I1IH 3ARBC 2A6KB 2OBGA 5CILL 5GS2H 1E28B 1NGWB 4NZTL 3SPVA 5DA4A 1ZWIB 4HGKC 4MJ5A 2XTJB 4LHUA 5I1LA 5CKGA 3MNZB 2ICWJ 3K8KA 4P59H 5DXWA 3BPOB 5D2NA 5D7KD 1E6JL 4X99A 5FGBA 4LSPL 2X89A 2F54E 1F3RB 4RMTA 4OZFB 4D9RD 1OWRM 5CEXB 1CGXA 4S2SA 4FZ8H 4UIKL 4U05A 4IOIA 1I85C 1EEQA 1MIEL 4FXKB 4WO4C 2AXGB 4MWFA 3WFHA 1UB5B 4XNZB 1QKZL 4JRXE 1W72H 2LVCA 1YQVH 4LCWB 4X5XA 1PVHA 5CD3A 4LCWE 1NLBH 3C5ZD 1Z6JT 4Y5YB 1YUHA 1UJ3C 5DJZA 5D1ZD 1N3NA 2NX5B 2ZNXA 1PAMA 1H8NA 4OM1H 4RRPG 3UTSD 5IIEA 2FBOJ 2BNQD 1F58H 2NW3A 3RIFK 4OJFH 2D9CA 5TQ0L 3T4AB 1F02I 1J05A 1FAIL 4Y5VC 1ETZA 1QTYT 2AQ3A 2K7PA 5DDHA 4IRZL 4JFDA 3TCXA 2QKIB 4L4TE 3THMH 5DHVB 5C0FA 1HIML 3KPRE 4XX1G 1J9CT 4U3HA 5BRZA 3C5ZA 5C3TA 4QRPA 3ZTJG 4KROC 1DDHB 3BZEA 4IJ3C 3OAYH 3UTSA 4DGIL 1OP5K 3OV6A 5LGJB 1I7TA 2M26A 1AQDB 3ZHKA 3ARBD 4ZNEE 1EBPA 2QADB 4YIQA 2WINA 4ODXB 4WEMB 5ANMA 3B9KD 4NM8H 1H15A 3KJ4B 4ZAKC 4OM1L 4CNIB 5FDWB 3SKUD 5L9DH 5CMAA 3I6KA 5FKPB 3O9WB 5FKAB 2P1YA 3B8YA 5I1CL 1M71B 1FVCA 2R2HB 5EO1B 4I0PC 4RFNB 2O93L 4BH7A 4H25B 1N2RA 5D9SA 3SO5A 4KUZL 2VLKA 2NLJA 5HHQA 5F9WB 3D18A 1OQOA 1RUPH 2ZSWB 1YEGH 2DQEH 3MV8E 3NPSC 3QFDA 3U9UB 3VGDA 3PQYE 3FQTA 5MENA 3WLBA 2A6DA 1KIQA 2IBGA 2VZVA 1FO0A 1PYWB 5A16A 1JPGB 3L3KA 5J6GB 3MBEC 2VQ1A 4DVRL 5EBWA 5HPMB 4MB3A 2Y6SD 1XR8A 2HLAB 3BZ4B 4M03A 5IQ7L 2Z8VC 1MCPL 5H2BA 3UXFA 4XBGB 3VFGH 2I9TB 2MPAL 4DKFH 3DXAA 5C09D 5FF6A 5HTSA 2IAMB 1YA5A 4XCFL 4Y4FC 1ZXQA 4NUJB 3DIFA 4Y8AA 3VXPA 5JZ7D 4PP1D 3VFVB 1QLFA 2WV3A 2VSDA 4KQ3H 1L9NA 3C09B 1W0VA 5CJOL 2OL3H 4YR6A 4OCRL 2HT3D 3BP6A 1OT2A 5FYLD 4OFYD 2YUXA 4W6YB 4XCEA 3OJDA 2XZZA 4EXKA 4G6JL 5FGBC 1IGIL 3QXVA 3UTTE 3LY6A 3FHAA 4L1HA 3IDJA 3UTTB 1UWEL 4N8PA 4HBCL 1X5XA 2Q76A 3FFCD 4XC1L 2BK8A 2IPUG 5GRVL 4G8EB 1CQYA 3C2AH 1S7QB 1FDLH 4JE4B 1GGIL 3MGTB 1IC7L 5DD0L 1HSAB 5KVFH 3VXPB 3LN5A 1EAJA 5IHBA 4LPYA 2DQHH 3VXRB 4QKXB 5J57B 5DZOA 1BWMA 2O5YH 2ERJC 4AENB 4RDQF 3QEQE 4GQ9H 1HWHB 4MYWB 1F2XK 1JUFB 4KI1A 2G60L 1R5IA 3M17B 4N68A 4MB5A 1HHHB 4HUMB 4LLYA 1F4WL 1RZJH 5A2KH 1SY6H 4YHKL 1XIWB 3P0YL 4WWKC 3ULSB 2UWEA 4H5SB 4PJCE 1I4FB 3FB6B 3RUGA 5ACZA 4HS6B 3HA0A 1OTTD 2ICEA 1IGMH 3KPPA 5IB1A 1G9MC 4JPIA 3T0AA 1J0ZA 2NCMA 3OGCB 4F9PA 4G7VH 3NABL 2YC1B 2WWKT 3V6OA 3X3FH 4QRUB 3STZA 3JWNC 1KXTB 1IC4L 2YMXL 5KZCB 1QSZA 2NMSA 5IB4A 1RULH 5C2BL 4DAGL 3MA7A 1UQSA 4DN4L 5J9PB 4HLZH 2AVGA 3DMMD 3LS4L 4QRPB 3JV4A 5C0EB 2CLRB 3SGKC 3QNZA 4QXUH 3LHPH 4PBWD 1ZAGA 2I5YL 3U7YH 3O9WC 2C3WA 2NTFB 2Y5TB 1YY8B 2XRAH 5D4QA 4JY4A 5EA0L 5C08E 4K8RL 3PWLA 4KTEH 4Z18A 3U2SA 1U3ZA 5IKCA 1I7ZB 1J11A 3WUWG 5CIPA 3LSOA 4XNXH 4S1SL 1IL1A 4WW2F 4LNRA 4JCLA 4B7IA 1EMTH 2VXSL 5LXGH 4W4NA 2VZTA 4JFZH 1FGVL 3ARGB 4FQ1H 4NZRH 1V3KA 4IOFD 1B88A 1LNUB 1CFVL 2E8YA 3ZDYE 2O5ZL 4YDKH 2JJTA 3BZDA 2DQGH 4XT1C 3O8XA 3U48A 4WFED 2ZCKL 1TQBC 1KYOJ 1MCPH 3QIBB 4O2FA 5GRXG 3W0WE 3MA9L 4PRHB 3RIFF 4NN6C 4S2SB 5JDJA 3A67L 5D7SH 2QBWA 3VWJA 3D69A 1S7VB 4GMSH 3WDIA 4GAYA 3SY0A 4PJ5D 2Z8RA 4LF3A 4Y4KC 5T3ZE 4MJ6B 3KXFE 4MQ7B 2EZ0C 4KJPC 4FA8A 4MA3A 3SCMB 1D6EA 1IAKB 1ZHKA 1KLGA 2YSSA 1FZJB 4CN6A 2VERN 3QUZD 3HC0B 4FMKA 3WN5B 4PTUA 1OTUC 4NFBA 3G5VB 5DJXB 2ZPKL 4QGTA 4YDJB 3BKJL 4HKBA 5SWZE 3VWJD 5J1AA 4Y16B 3GIVB 4FQLH 3WJJC 2P48B 2Q6WB 2FSEB 4OZGE 1NAML 3B9EA 3GM0A 1I7RA 3FQTB 4N5UA 2XNAB 1G6RB 5C07A 3UYOD 1I3VA 4G8GA 1CN4A 3EYSL 4W6WB 2A77H 3RKPA 1U8HA 1J8HA 5HGBB 3PL6A 1BFVL 1F97A 1QLRB 4PP1C 4ZOBA 5K9OA 4EN3B 3S35X 5EOCL 3WNOA 5C86A 3IDNA 1VADB 4QHMA 5JHDA 1CDBA 3B5GA 1FZOB 1GYAA 2FO4A 1ZGLM 3WBDA 3R0MA 1LD9A 1LP9E 1MCJA 1N4XL 3FN3A 3LZFH 6FABL 1CD1A 4JO1H 1M7IB 5D1QB 5LVEA 4RNRB 5DUBA 3AAZB 2IMNA 4K7FB 2V2WA 3L5HA 3QHZL 1Q9WB 4OZGA 3ZKXB 2FECI 1LO2L 2CJUH 4E0RA 1JNLL 1IM3A 1K5NA 5E9DA 5H35A 4PGBB 5I1CH 2IANE 2QQNH 2RHEA 3PIQB 2CIIA 3EO1A 5EU4B 5E4EC 2Z4QA 2ARJQ 4JZOB 3QEGL 4RZCB 5D70L 2IPKB 2FD6L 4KK8C 3PGCB 5DMKB 2J88H 4UUJA 1NCCL 4BZ2H 5HPOA 1XF3B 3KGRA 3SN6N 3BW9B 2PYFB 3CPLA 3HNVH 2XQBL 2AXJA 3TT3L 1T0NA 2GAZA 3OTTA 4OZFH 3U7YL 4HKJA 2DIJA 1KJ2A 4LVEA 1Q9KB 3F7VA 1D5XA 3VRJB 4KZDH 5SWSA 4OKVB 3DSFL 4WGWB 3KS0J 1JYXA 1EJOL 5E9DE 1MIEH 4P5TA 4FXKA 1OCWL 4DKDC 4R4ND 1WBXA 5BCAA 2XA8H 3L3GB 1GZPA 4AT6A 3O41A 4LGPB 1EEUA 5BO1H 2NY6B 1F4XH 4LQ1A 2NX5E 4PRBB 2PUQT 2H3NA 5DHXB 4GKNB 3HG1A 3VRIB 4F33A 3ISWA 4ZXBA 4X6FB 2P5WA 2E8ZA 1S7UB 1ACYL 4TOYL 3WFCH 4LLQB 2F5AL 2Y1VA 5FDYA 1IZJA 4EN3D 3QPXH 3FRUA 1NGZB 2Y06H 4ESKA 4DK6A 1CXHA 2D7QA 2JELH 3FQNB 3TEUA 4XGZB 1IM9B 1IC5H 2E9IA 2EDFA 5L2KD 2NY3C 2LE9A 3NPSB 5D96C 3U36B 2PYEB 4M5YH 3HCVA 1OVZA 3NCYP 1Z2KA 2AK4B 5AYUH 4D0DA 2ITCB 4CRPA 4NNYA 4H8WL 5KTEL 2EE2A 3RAJL 5LBSL 4X7SH 3IDNB 4BFEA 1ZHLB 3PHSA 2PO6B 4AT6B 3BN3B 3C5SB 1UADC 2WBWB 2V5YA 5CGTA 4LARH 3HI1A 1KTDB 5E2TH 1UGNA 1F4WH 1RIVH 2XZQH 4G42B 3G04B 2RIKA 2DMKA 4FP8L 3MLVL 5TJWK 4MA1C 4NWUL 4H0IA 4U1KB 2YRZA 5LWYH 4ODVH 1ODAA 1X7QA 4V1DB 4HKBB 3JUZA 4J3OC 1TVHA 3WLWC 1JZ2A 4JM4H 3I50L 3TO4A 5I8EA 3Q5OA 2F53A 4OLEA 4GLRH 3MYJA 3V7MA 4RZCA 1MEXH 4OUUB 4OCWH 5JW5B 1R5WB 2DQHL 1N4XH 3ARGD 4HIXH 1F90H 3VFMB 2EDHA 4TUOB 3CSYB 4PD4K 1QOKA 3M1BA 2DTSA 2B2XH 3DYPA 4LVNC 2ZCHL 4GAJH 4MCYA 4X9FA 3I3DA 3QHZH 1B0GB 3ARFA 4OI9A 2J6EH 2P24B 3KPSA 2K7QA 3VH8A 4P23B 5EFIA 4ELME 5IVNA 1J0HA 4PV9B 5GRVK 5FK9A 5ITBL 3S8WA 5DJ8A 2HJKA 3UJIH 1BREA 3D85D 5H94A 1NCUA 1RURH 4F7EB 4P3CL 4RDQG 4QRPD 3L95A 3IDMB 3DMMB 3PJSB 4JDVB 4JQXC 1F6LL 3IDUA 4JGMA 4MNHA 5BZDB 1MJ7L 2FATH 1PX4A 2DD8L 3L7FA 3MUHL 4MA8L 1QBBA 4RWYL 1VFBA 4LNVA 1U8IA 2VXQH 3ZHDA 4LEOA 4UNVA 4HAFA 1F8TL 3TA3A 3SDCB 3I9GH 1BD2E 4JRWA 5C0GB 3QXTA 4APQD 1LE9A 4H0GA 4E41A 3D85A 2V2XB 2J6EA 3QXAB 1CE6B 3A67H 3GHBH 1TJHH 4XNUH 4IMKC 3U46B 2O5YL 1X4ZA 1JMXA 3D0LB 1A7BA 3BE1H 3OL2A 4UTBH 4Y0GA 1K6QH 1E4XL 5FOJA 3T4YB 4OSUH 4UDUB 4L8DB 3RNQB 1A6TA 2G75B 4NIKB 2VITB 4OCSL 4K8RH 1AY1H 3S5LG 1UXSB 4BSVB 2VSCA 1M7DA 3EDDA 1S7VA 5CZVH 1JPTL 1F6FB 5D7LD 5F1SA 1FBIH 5J11B 2C4FU 4Q9BA 4HDIA 2VXTL 5ENWA 2CR3A 3MCKB 1GAFL 2UWEB 3ZTNL 2WBJD 3FT3A 4XPGH 3BGAA 3HNSH 2BY2A 1R3LA 3O2WL 1KPUB 4ZS6C 4Z78B 1T1YA 4KKBC 5T1MB 5EU3A 4GW1B 4JZJB 3QAZC 1LDPH 5EU6E 3VCLB 3X11B 3VFOB 1GGCL 2C3XA 4RIRB 1WWWX 3DPBA 3T08A 5T1DH 4LL9A 1HHKB 2LV4A 2XXCB 3IFLH 3PWLB 3VFOA 4F57L 3BDYH 3MGAA 5JR1L 4PJEF 1YY8A 1A7NH 3FT2B 5T1MA 1HSAA 3PXJA 4FP8H 1Q9OB 1RZ8A 4YHPB 4X9BA 1SJXA 3E8UL 4ODVL 3VW3H 3DI3B 1U91B 1U8JA 1F2QA 2Y7QA 3S35L 4HDIB 1VACA 3V5HA 1YMHA 4ZUVA 4IBLT 3ULVC 2HTKC 3BD3A 3MCKA 4G80A 3MJGX 3B2UC 3O3UN 2DQUL 5EPMA 4JRYD 1QO3B 3WMSA 3SGJC 4OF0A 3MLUL 3NZ8A 4M7KL 4NBZB 4GKZB 4EDWL 4MHHG 2C4FT 3BIAX 2EIEA 1FL6B 1WSST 1IGCH 3QULA 4IMLA 3JVGA 1CT8A 2G75A 2VLJD 4KTYA 3K1KC 3MNWB 4ODSL 3UTPE 2ICEB 5DHYB 4YDVA 3HLAA 4F58H 1S7TB 3DXAE 3H6JA 3IF1A 3I6LE 4G3YL 5E8OB 4QWWD 1X5KA 5C0JA 3NPZB 3EYOA 3V8CA 1FCGA 2GJZA 4C55A 2VLJB 3WO3B 3AS1A 1T89A 4XRCB 5E00A 1D9KD 1GSMA 1NEUA 4JVPA 2VLME 1XCTB 1LE9B 2CKBL 1B0WA 1NMCC 5LAXA 3GGWB 3P9LB 4ERSL 2EECA 3K8LA 3GSNB 1LEKA 1F3JB 4JRYB 3M8OH 4RA3A 4M61A 4JAMB 2D4FA 3OQ3B 4LLVA 1HH6A 1RZKH 3G5XB 3QQ3A 3EOBA 2J1KA 4ZNEA 1UH2A 3I6GB 1ZLUH 3QDGD 1TZGL 2YN5A 2DJSA 1N7MH 1CLYL 4GLRI 3QWRD 3U83A 1F4HA 1NAKL 1OSPH 4OCRH 2FZ3A 5DVNA 3U0PB 2OI9C 1RJYA 4NKOA 3QXWA 3C08L 1CFTB 5EBLB 1QHOA 2FCBA 1TZIB 4WHYH 4Y1AB 2VLKE 4JDTL 3UTTA 4WV1B 3F7RA 2UY7A 5IQ9A 2A9ML 1AHWB 3ECBA 3NZ8B 1T1XB 5FFLA 4M7JL 3UTSE 3BH8A 5I15H 5DD6B 4MCYB 3UTSB 3BIBX 1ONQB 3V5HB 5HYJE 1EEZA 1N0XL 1QSFD 2GQHA 2I07B 4HG4K 2FGZA 3E3QE 4HIEB 4LCUA 3BP5A 5GS0H 4FQJL 5IB5B 3S7GA 2W60B 5I66B 5IEHB 4A6YL 2I27N 1VFOA 2XN9E 2J8UE 4PJAA 3VMNA 5HYIA 5GGTL 1WLHA 5I1GH 4F3FA 1J1PH 3P4MA 4LCCA 1BZQK 3ZT5A 3BAEH 1FBIL 3QJFA 4PJDE 4KRMB 3RX7A 1YJDL 4XAKE 3FOLB 4U7MA 2GTWB 1IBGH 2NX5A 3K4DA 3EYVA 1RJZB 4J3SA 5A16B 3QFJA 1AI1H 5FECA 3PDOB 4OB5H 5GGRA 3RX5A 4UOW1 4NKMA 3GSRB 5KSBF 1TETL 4YQXH 1MHHB 5F7LB 4L1DA 1YJDC 2Y07L 1K8DB 2A38A 4WI9A 2ZCLL 3ARQA 3EJZC 4Y19D 1EVUA 1CFSB 3CX5J 1LO3L 3CFCL 5CZVL 3C09C 2IF7A 2A6IA 1MCFA 1XZ0A 3QUMH 1IE5A 1CF8H 4X6DA 4NQED 1L0YA 1CLOH 3MRLA 2WM0A 2HFGH 2EKSB 4Z0XB 1YECH 4KVNH 3MRCB 3RUGF 1OB1A 4P4KB 3C8DA 3LDBB 5KJRH 4X7TB 1I9IH 3RHWF 1ZWIA 2EYTA 5IT2L 4X8XA 4G9FE 4XCCL 5JIPA 1AGEA 1OGAA 2AV1A 2VJXA 1DE4B 1YY9C 1URLA 3D85B 4OLWL 4RMUA 1DQLL 3S6CA 4F7PA 2BNRA 5F1KC 3O2DA 3AU1A 3VRIA 4DZBB 5INDA 2PR4L 5CAYB 3SDCA 1IGFH 1XR9A 2JCCA 4RFOL 4GKNA 4F33B 3IXTA 3Q0HA 4PRIE 1LP9F 4POYA 4PJ7A 2X70B 1FFPB 4K3DL 2XY1A 3VGAC 4FQPA 3RNKB 4CDGC 2XWTA 4QRSA 1FGNH 3CX5K 1CDGA 1LILA 1NC4D 3WFDH 2H2SC 4G5ZH 3W39A 3ZE1F 1U8MB 3M8OL 3RL2B 5KW9L 4F37F 1OAQH 5ICYA 1KJMB 3H9HB 5TDNB 5AWNH 1JMZA 3JWOC 3NIFE 5HYQA 1G7MA 1V3JA 3MJ8A 4R7NA 4NP4L 4XH2B 4OZFA 2YXMA 2CIIB 2GTWA 4LSPH 3BPLC 3QI9C 5I73B 2ZUXA 5CEZD 3RVUC 4UT9H 1CIUA 1IT9L 3IVKA 1RIUH 4MDIB 5IV2A 3GBMH 3RGVD 4IRJD 1P4BH 3CCHB 3QRGL 3ZDZE 1IQWH 4RGNC 4KHXH 2HFGL 4KY1L 1A6UL 1OP3H 2VKWA 4DUVA 1SEBA 4OZHE 5D70H 3QIWC 1AC6A 1I1AC 2NYYC 3G9AB 1XAUA 5EH1A 1UWGL 4LDEB 1WIPA 2VDKH 4MZ3A 5BV7L 3BKYH 3DVGB 2OR7A 4RSVA 3OKMA 1YN6B 1IAIM 1DQJB 1DQJA 5FAAA 3RIAK 5IBUG 3ARWA 3O6KL 3MO1B 3E8UH 4LHUD 5C0CE 3TBWA 4LSVL 3GUTA 2Q6WA 1FNEA 3KYMA 2D7TH 1F4YH 3DETD 2E27L 4AY0A 1CZ8H 1P9MC 3DHMA 3MXVL 1U2CA 1T6WA 5K59E 1KB5B 3CCHA 3VFUB 5E6ZA 3CMGA 3QDMA 1F11B 1FNFA 2XFXA 5I1GL 2YSSB 3MBEA 1WBYB 2CXGA 1L0XA 5F7HA 2P8LB 3NCFB 1G6RL 4WENB 2VOTA 4XVJL 1NGYB 3SCMA 3RVVC 5CCKH 1IQDA 2GJZB 5FO9A 3IXAB 5D7IF 3PXHA 3B2VL 1EHAA 2W0KA 1NUNB 3GNMH 4HIEA 4LCUB 1AI1L 2ED9A 4XPAL 2DL2A 5F21B 2W9DL 2AJZA 3NCYS 3V6OE 4U1GC 1HNGA 5IJVA 3HI5H 1S7SB 3EO0A 4LF3B 3PGFH 3CFEB 4KK9D 3TO4D 2AJVL 3QIBA 1I9JH 4XPBL 1Y0LB 3SDYL 2EKJA 3UP1A 5D2LF 3L6FB 2E3VA 1QQDB 5T1KD 4PG9A 1K85A 2DLEA 1AY1L 3CDGA 5FO7B 1HHJA 5CD5D 1FNLA 4NWTL 2RCSH 1QRKA 1RUQL 2GAZB 3L5XH 3ARGA 4ZUVB 3DRQB 3C6LD 4AIZB 1K8IB 4KGJA 3QISA 3FQXB 1CL7H 1I7ZA 2WANA 4P2QD 2PYFA 2AJSL 3E2HC 4N5ED 3SEPA 5A3ID 4M61B 2LFGA 3R8BB 3CAFA 1G0DA 3BPNB 1GC1C 1LDPL 3VDCA 3EIFA 4OZ4A 3QNZB 5C92A 3GM8A 5FUOH 5F8QC 4N8VG 4S0TD 2V7HA 3MLRL 5CBEA 2YPLA 3OJ2C 3VCLA 1N59A 5C0JB 4K94H 1JYVA 2XOTA 1MRCH 1T22A 5EZOL 3NA9L 2EDDA 4HZLB 2QQKH 3VWKB 1MCWM 3VXUE 4RNRA 4QEGA 5DUML 1YYLL 2J3SA 5JW4Q 4EN3C 4JFDD 3OGCA 4HH9B 3QULB 5F97E 3EBAA 1MWAH 3ROLB 1HDMA 4U2YA 1A7QH 4UI2A 2VDNH 1HHGB 3QUXD 1I4FA 1H3UA 2C1PB 1N5YH 1K8DA 1CBVL 2PKDA 4R4FH 2VABB 4D3CH 2XKUA 3MZTA 4MQXD 4Z7WB 5SWSE 1T2XA 5CJOH 2GT9B 3AUVA 4JPVH 4P46B 3KPMA 2YPLE 1W72A 3ORJA 3O3AB 4FQHB 4YXHH 3MRQB 3MRNB 3GSRA 1AKJA 1ZA6B 2VZSA 3REWB 8CGTA 2V5RA 4BZYA 5CLTA 3ES6B 4AIXA 4PRHD 1JTPA 4PTUB 5E24E 5GRJH 3LKRA 2DKMA 3EO9H 5ERWB 5I73C 3UO1H 3ULUF 2CLVA 1I1FB 3B9AA 2W9LA 1AE6L 4ZXBC 1U9KA 2GSIA 1TJGL 4FQCH 4OQTL 1KGCE 3UROR 1N6UA 2D7TL 4FFZL 3ARYA 5DRNA 1WT5A 4S1RH 2OL3B 2B1HH 1V7MH 4XNQB 4JKMA 4H1LA 1R3LB 1DBBL 4LASH 1CBVH 1JNJA 3E6FA 5MEOA 4ZYKB 1ULVA 2YMXH 1FFOB 4MNHB 2XWBB 3OXSA 3IFPA 3P73B 1JWUB 4BJLA 4C4KO 2DI9A 5D1XD 3BH8B 1MCIA 2GSGA 5DJ6A 5GIRB 1DUZA 3S37H 1T04A 1MRDH 1QRNE 4YHZH 2HVJB 3BO8A 4DN3L 3PWPA 4JDTH 3S98A 4XNQA 3EOTH 1LNUA 5EBGA 4UBDC 5J6HB 1ZT4A 3DSNA 4PJGE 2XWBA 4NZJA 1JRHH 4GOSA 2HN7A 5E5MA 1IKNC 4EIZC 4P4RA 3V6ZB 1FFQA 2EZ0D 2WIIB 4M7ZC 5FHAL 3OKKA 4JKWA 1NGYA 4LLVB 5JPMB 5CEZE 5IM7A 4NQCD 35C8L 4Z5RB 3NIDF 5JOPD 2UVEA 5BZWB 1LO5A 3MRQA 3G6AA 4PJDB 4OCXL 2WK2A 1BFTA 3DUHA 4NFDA 2FIKA 3ARFD 1UFUA 4KKCC 4JHAH 4G6KL 4JO3L 4AEIL 3EYOB 1KCVH 4WFEE 3SDCC 3MUJA 5FKPA 1HDMB 1RHHA 2IBBA 2XWJB 2R56H 4FRWA 4ZFOL 4PG2A 2VABA 3N9GL 1DQQB 1S78D 2OR8A 1BAFH 5KANI 3C5JB 2DI7A 3SDAA 4UIKH 4R6UA 4YXKL 5IG7A 1OW0C 4PJXF 2VXQL 1HN1A 3LCYA 4KXZI 4GXVH 3X13A 4DGYL 1P7QB 4HS8L 5BRZE 1FFOA 4ETYA 3DTXA 5GSRA 3PQYD 1MCRA 4H1LB 1XH3B 4PRDB 1HEZA 5IBLC 3V8OA 1Q9OA 1T22B 5IESH 4P99A 1YNLH 2D9QB 4I77H 4XGZA 3UPRB 1ED3B 4GBXD 2GSIB 4HUVA 2OR9H 1VPOL 1BHGA 1JV5A 4CU8A 2VWEC 1FH5H 1EXUA 3NACL 5DQJB 5ERWA 3U82B 4BQ8A 4UB0L 1L6ZA 1N3NB 1IMHC 2NW3B 5I9QB 5F9AC 3B9VA 4CVUA 3HMXL 2CSPA 3SGEH 4BKLA 3FO2A 4PB9H 4JFFD 1OLLA 2X1QA 3G6JE 1WJ3A 3OKOA 3VXSE 1HZHH 3ZTNH 5FGCB 3QP3A 4YBQD 3NCJH 4YHOH 5ESVA 4LLMA 4I0KA 3UBXG 3VMPA 1H3PH 2NY3B 4QXWA 4B41A 1R3KB 3BESR 1MQ8A 2BNUB 3RNQA 3T0BA 3D1MC 3BJLA 5K9KA 5IB2B 2AEPH 2NY5H 3FQUB 4I1NB 3LKSA 3HMWH 4YWGL 4FMFA 1RUPL 4EUPG 1NCCH 4LDOB 1DBML 3QCTH 5D2NB 5C70A 1QLEL 5HI4C 5H37G 1M6OB 4KMQA 1HK6A 1WIOA 3D0LA 2GCYB 1JVKA 4X5LA 1KJ2H 1DQLH 4U1HA 1UH4A 3RP1A 4Z7NE 1RUKL 3KPLB 3MLWH 3ILPA 3B9KB 5ICXB 4U1NB 1H3WM 3KYNB 4LVHC 1NUGA 4LLQA 4LSTH 2QADD 3HPLB 2MCPL 3MLXH 5TF1L 4XVSL 4ZODA 4AJ0A 4AQ1B 4GKOA 5MHSD 4NN5B 4HJ0D 1UACH 5D93C 1JHLL 3UC0L 5JXEA 5C08D 5IMKB 3HE6D 4JFFE 5ESAA 4ZAKB 2EH8L 5LWYL 3IDMA 4OT1H 3LH2H 3RY4A 3ALPA 3ZT7A 1J0IA 5H37H 1YQVL 5SWSB 4HWUA 4UBDD 5ESAB 3VG0L 3W9DA 3GBNL 1QVOB 2MJWA 2EYSA 2ZOLB 3H9SB 1AH1A 2BNRD 4OLXH 2OX5A 2EDXA 5BW7C 3UTZA 2FECL 4BZ2L 1HQ4B 5DZLA 3ILQC 4OJFL 1CDUA 3HPLA 3QUYC 5B38G 4NOBA 4N1HB 3EO0B 5DMIH 3GJFB 2UV3A 1MHPH 5IV2B 3CSYA 1X9QA 4K7PL 3C5ZB 3ZE0F 4HCRA 4JZOA 1ZLSH 1IZKA 1HIMH 1YNKL 1KSRA 3WO4B 4L4TA 2APVA 2D3VA 2NY1D 4QOKD 5B8CB 3JV5A 4P3WA 1NMBL 3IJSA 5C0AD 1FZJA 4L4VD 3TN0A 3FQUA 1CL7I 5F1NA 3LKQB 4N0CC 4NQUA 4YXKH 5K9KB 5K9JL 3RVWC 3FCTA 3I6LD 5I1IL 3VDBA 3HB3D 1FE8L 4MXWL 2ATPA 2KQMA 5DT1H 1Q94A 1F11A 5D7JA 4XPHL 5CGYC 5JW3H 5I75C 5EZIL 4NWUH 1D5ZA 4JB9L 5SX5K 5GS1B 2VDOH 3C08H 3W9DB 1JFQL 3RWIA 1CGTA 5ESVB 4HC1L 1BQSA 3NIFF 1HQ4A 2YEZB 1JNNL 2EDNA 1UB5A 3SE8H 5GS0D 3G04A 1ZLVH 3WUWA 5JOFA 3MLZL 4N8CL 4ZAKA 1J5OL 1NANH 1LQSR 3OB8A 5IVXB 4HMCA 5IK3B 1TTGA 3DV6B 5DMJB 1GOFA 1D3CA 2QEJA 3T8XB 1X3DA 3SQBA 1OAYL 1HKFA 1IL1B 2H26A 4QLRA 3MUZ1 2BMKB 3QQ3B 1T5WB 4H88H 5K9JH 3BI9X 3AGVA 4E9LA 1K4DB 1EDQA 1YJDH 2Q3AA 1JGDB 2QHRL 4KKBD 1TTUA 1M6OA 2NY7L 4XRCA 3O6LL 4QRPE 1MJUH 1YN7A 2IG2H 5DI8A 1VPOH 4LBEB 2HT2D 5JA9A 5DVKA 5DS8A 2DLFH 3ULVE 4X80H 4QNPE 5C07D 2ADJA 4OLZH 5GGQH 1X5JA 4R90L 2DQFB 3EJYC 5FGRA 2DRUA 4K3GA 4HMDA 4PLKC 3PWVA 4DUWA 4MSWA 1Q1JL 5E8EB 1Y18B 4UV4L 1I3GH 1MPAH 5I15L 3DV6A 1S7XB 5DD5H 1LHZA 5HYQB 1RUML 3HAEH 4GAFB 1N6QL 4JPKL 5ETUA 4J4PD 3AM8A 3UAJC 4K9EC 1WTGT 5ILTL 1TLKA 3VRJA 4CGTA 1R6VA 1JJUA 4UT6L 2CK0H 4UT7L 1G1YA 3PDOA 3RUGB 5ACZB 2Z0BA 5D93B 3FO0L 1RFDH 4XMPH 3FOLA 4NO2A 3LN9A 3WIHL 5GGUB 1H8OA 4XCYA 5DMKA 3WXWH 1EVTC 4M93B 3BD4A 5C71A 3QJFB 2DLIA 1NAMB 3GSWB 2AJYH 1VEPA 3TN0B 3UPRA 3EYVB 4LAJH 2Z31D 4ACPA 4CU6A 4F3FB 4OZFG 3WNMA 2D4DA 4JZNA 4LPWA 1WK0A 3L5IA 4L4TB 1MAMH 1DCLA 3SOBL 3C6LA 3VFSA 3ULUC 4LSDA 4ELMF 2D0GA 1UCBH 1NCDL 2AQ2A 2DD8H 4RWYH 3EAKA 4ZUWA 1JN6B 3B5HA 3SBWA 3NH7L 5MHSE 2X9XA 3JWOH 3GSOB 4Z78A 2E7LC 4X7TA 3O0RL 4K23H 3SDAB 3EOYG 1CLOL 3ULUE 5E2UL 4HWBH 1I9EA 1T04B 1GGBH 4NO0B 4Y2DD 2CRYA 3H9SA 3HUJB 1MH5A 4RA0C 1JWUA 2NXYD 2R39A 3N1GC 1X5HA 3C5JA 3U0PA 1Z0MA 2OS7A 5HBBA 1OLZA 1AHWA 3Q3GA 3AB0B 1FC2D 4QHMB 5EOCH 1MELA 3PL6B 4CVZA 1M7DB 4LIQE 4P9HC 2OP4H 3CFJA 2XWJA 3LDBC 4NKOB 4CDHA 2BVEA 3VW3L 5F7MC 4HIJB 4HCRH 2IGFH 3TNMB 1MREH 1S8DA 4M62L 4JRXD 3P0VH 2IANA 4NKMB 5FYJU 3EOBB 3RDTB 4DKFL 3P77B 3L3IA 4Q6IA 4RGND 3ME0A 4BQBA 5T3ZH 3L1OL 5LAXB 1AHWC 3LB6D 4P2RB 1VGEL 2E7HA 3ETBF 4QGYA 4Z5RA 3DETC 3O3AA 4FQHA 2EDRA 2BVQB 3WKML 2VDQL 2IANB 4FG6C 4LCIL 3PWNA 1DBAH 3TA3B 3VGBA 4DEPC 3IKCA 4XWOC 4OF8A 1CDIA 3O4OC 1TNMA 1VFBB 2VLRB 4FQ2H 3LEYL 2NY1C 1EGJL 5E8OA 3V4VH 1KN2H 1CLZH 2APBA 1QR1B 1RU9H 1FYTD 2HVJA 3BO8B 1MLCB 1N2RB 3NZHL 1P5VA 1R3KA 3KVQA 4KK6D 4AG4L 4MQTB 1AKJD 3UBXB 3MXWL 1UM5L 5T1LA 3TWCL 5J6HA 3KG5A 3MNWA 3ULVL 2X1XR 2X4PB 3AS3A 1NJ9A 4PRHA 4KDTC 4AM0B 4H8WH 5C0BB 3HUJA 2EIZA 3WLWD 5DLML 3E6HB 4TSBH 4MLIA 4NO3B 2ADIA 1TQCC 5JNYA 1BFSA 5T5FL 1WAAE 2FZ3B 4ZYKA 3JWOL 3D3VE 4M1DL 3O81A 4NC2B 5F89B 1NBVH 1LO0L 5DR5H 3FO9A 1ZVSB 1PG7X 4XAWL 3CK0H 3CH1A 1MLBB 4YHPA 5H2BB 4L8SC 3GSNA 3OAZK 1IFHL 3C60C 1ED3A 1ACYH 1KT2A 4TOYH 4U6XA 1ETZB 2F58L 4DQOL 1SMOA 2OL3L 1ZHBA 3LIZH 5AAMA 3NIGF 4AEEA 5F9JB 3BRFA 2I5YH 5DC0A 5FO8B 3I3BA 3FT3B 2EDWA 1RI8A 3UJJL 5D1QC 5TPWH 3JV4B 3RTQA 4QXGH 4QRUA 4X4XB 4U1KA 4EEEA 5KSVA 3TYGL 3F7YB 1FNSH 1L6XA 1Y6MR 2APTA 1MCOH 4WRLA 2DICA 2HFFA 1BQHB 1CE1L 1WAAF 3O9WA 5EOCJ 1EO8L 4LVHB 3QZWA 3QZWB 3KPRD 1FLRL 4XI5D 4YE4H 3L1OH 3S3SA 1H15B 1BQHA 4YHOL 4D9RE 5DD3H 3GBML 1I9RL 3ULUL 2IPTH 3IS0X 3NIDE 4EXPX 4WW2A 4OV5B 3LKNA 2Y7QB 4XVJH 3A6OA 3CVHL 2D7NA 1ND0B 2DQDL 1B6UA 2P8LA 2QR0A 4G8GD 5B3JF 1AR1C 4PJHE 1JPSL 1L0QA 1RZFL 2HKHL 3GJFH 5SWZA 4B50A 5DI8B 3SPVB 2QKIA 4POZC 1KIPA 1KB9J 3NFPB 4AENA 5I16B 2AERT 1NFIA 1I3UA 1W8NA 4M3JA 4MNQD 3TESA 1AO7E 2XG4A 5F7EH 1BM3H 2P5WB 5F89A 2X40A 1BGXL 2AAVA 5D7LE 5I76B 3PQYA 3HPJA 3TBWB 1FN4B 5C09E 1W2KT 3O0RH 4X83A 4WTXA 3B3IA 4JREB 2PO6C 4Y5YA 1HHJB 1IC7H 2UVFA 2PW1B 3TIEA 4AMKH 3CMOL 2X09A 5CSBA 1LO0H 5DR5L 5JXEC 2AK1H 1MIMH 4G8EA 3WUWB 4WDIB 5C0BA 3X17A 1A7QL 4L3ED 3V2AR 1CDCA 1YPZB 4WWKD 2DQIH 1QFWH 1D5XB 2WUBL 3IU4H 3DX6A 2QSTA 3Q6FB 5FA3A 4Z95H 2L7JA 2YPKB 4YZFF 4V2BA 4FXGA 1Q72L 1Q94B 2JJWA 1NH6A 2YZ8A 3V6BR 3K0WA 3BIKA 2NY2D 3QPQD 4UQ2A 2QQLH 5D96B 2DYPA 5DK3A 2DQEL 1CQKA 5DWUH 3MGOA 1K3IA 4NQTA 1MFCH 2VITA 1WITA 3ZLQC 4P59L 5IUSA 5AD0B 2P47B 2EO9A 4O00A 5EZOH 2JKXA 4OFIA 4P57B 3C60A 1AE6H 5ITFA 1QUNA 2O61B 3EO1B 3U1SL 5KS9A 3VXSB 1RV6X 1X5FA 1CDJA 1WTLA 2LU3A 3V6OC 3MV7E 3PP3K 3GMQB 3QXAA 1NAMA 3VRLF 3TJEH 1WBYA 3REWA 1PSKH 4YDLC 1C16A 2X4QB 4K7PY 1RZ7H 4YBLB 5AWNL 2AJUH 5CEYB 4LRIC 4LLDA 3MACL 3W39B 4PG2C 1RIHL 4LHUG 3MO1A 2W9EL 2ZUVA 3QUZA 4JO2L 1JZ5A 4M48L 5HHXL 3LQAH 4M1CD 1KJ3H 1YN6A 3I2CH 3HE7A 4JM2C 1T03H 4KUZH 2VLKB 4PJCA 2V6HA 3LPFA 4HGMA 5CMAB 2EO1A 1A1NB 1IKFL 1QBMH 2R69L 5EOTA 3LN4B 1JFQH 4WUKH 2Q86A 4D0DB 5FDWA 1Y18A 3VXMD 4PJ9B 3RY5A 2VZUA 1CFQB 2R9HD 3K74B 2PO6A 4R8WL 1IRAY 3ROOB 4F7TA 1TIUA 32C2A 2VDMH 4G6AC 5F3BB 3AVEA 4ZOEA 3U79A 5IOPB 4NC0B 5D1XC 3U4AA 1LK2A 1N26A 4LLWA 3TZVC 4PJ7F 1T66C 1PSKL 1HQRB 4S1RL 3VFSB 3GNML 2M1KA 1YYLH 1RJLB 1AGFB 5DJ0B 5DS8B 4FFZH 2BXZA 1LO4H 1N6VA 4PJFE 5C6PB 3DHJA 2ERJB 1X6LA 4QWWC 3FQWA 3QA3A 1TPXB 3FQNA 3O6LH 3RWFA 2DJ4A 4LHQB 1K4DA 4EOWL 4Y5XB 4N0YH 5HDLA 5I19L 3L9RB 2DKUA 3BYYA 4M9OA 3O3DB 3F58L 3MUGB 5K9QG 1BD2A 3BIKB 4NYLB 4CBPA 3N9GH 4LSTL 5IF0B 2FJFA 4PJ8C 4GRLC 3G6JA 5L8KB 4R4BA 3BT2H 4QNPF 5FA3B 2CDEA 2ITDB 5CZKA 3STLA 4FTVD 1N7ML 2FJGA 3QDJB 2B0SH 3GI9L 1KTDA 4OM0L 3SDDC 3D3VB 5CEXA 1B0RA 1PDKA 4IM8A 3QFJB 2QHLA 4XXCC 2ZKHH 5IJVB 3EJJX 4UUJB 4I4WB 1S78C 3GJEA 3BVNB 4H26B 5HHOA 3N0PB 5EU4A 3I84A 3LHPL 3TA3C 1WZ1H 1UH3A 3CU7A 5I16A 5D6DC 4HUNB 2DMBA 4WTZA 3T77B 1K4CA 2R29L 4TVPL 1FL5A 3BRGC 1QFPA 5KG9A 2Z9TA 1PKQA 2B4CC 5E6IC 3SQOH 2XZAH 4LRIA 1WZLA 4PGBA 1MI5E 3PDGA 2A6KA 1T5WA 1NGPH 5DUBB 3MUY1 1EEZB 4Z0XA 1RJLA 1T7YA 5DJ0A 4WW2B 5LG1A 1IARB 4OV5A 2EYTB 1HQRA 1YC8A 1S9WA 2ESVA 4GSDL 1YEKL 3X13B 5HHPB 4DGYH 1W8OA 2OI9B 2QQQA 4ZSOB 1OCWH 1RSFA 4D94A 1GZPB 1TZIA 5F6HJ 2FBJH 4Z7OE 3EYQD 3EHBD 1WFUA 5FOBA 3WXVL 1JNNH 1Q38A 2YEZA 4G8GB 1CR9H 4AH2B 5ILTH 5CZXC 4X9GA 5MEQA 5IMKA 5GGRB 3LQMA 1BF2A 1R3JA 4QXGL 3HHRB 5LCVH 3HG1E 4LPCA 1FLTX 4Y16A 5ABDE 4M6NH 3PGFL 3ULVF 3GO1L 3T1FB 1C16B 1FH5L 5DFTA 5EUOA 3HC0A 1NL0H 4AYFA 5FCSH 1ZHBB 5IM7B 4PJDA 4G7YH 3GMQA 5K9QI 1OY3B 1T7ZA 4S10A 4ZUSA 4WWID 1AD0A 3KPRB 1KT2B 2QTEA 1QNZL 2R56L 2WIIA 2Z4QB 1FDLL 1SBSH 1JK8B 3R1GL 2EH7L 5IB5A 1KCSL 1QACA 3ARGC 4PBVC 4S1DC 2BDNL 2J8UB 5KS9B 1GH7A 4Z7OF 4YDVB 4AL8H 4XXDA 4ZFOB 4BUGA 5IFJB 3ZKXC 3MGTA 3DUSB 3D9AL 5FA4B 1T20B 4X6CB 4NFCA 4X5WB 4LAQH 4N1CA 4YUEH 5EZLB 3PUCA 4K7FA 2DQCL 1UC6A 2X42A 5E56A 2Y6SC 4P9HH 3PWPB 5F9OL 3W2DH 3VG0H 3D69B 5E6YA 4XHJC 4WNQB 3KS0H 3RGVC 1D6VL 1EAPA 3AREA 4JO4H 4K71B 2ZOKB 4QHKJ 5I18L 4KROD 1UCTA 2OR9L 1FZKA 2XQYK 3ULUD 3RA7H 1CTNA 5KSAD 3BP6B 5IFAL 4NKQB 4HLJA 25C8H 4RMSA 4K8RC 5E9DD 5F70A 2EIBA 3VFVA 2OL3A 3HPJB 1XR9B 3PWNB 2FR4B 4QOKA 4HEME 4U1NA 1NFIB 5DQJA 3AU1B 1F00I 5CKAA 3BZ4A 5D1ZC 3GGWA 5IJKC 1A6VL 5E94A 5ADOH 4M6ML 4Z7UA 1AKJB 2QJDA 3O6ML 5C6TL 2J8HA 5GJTL 1A6WH 1ZGLB 5F9DC 1FYTB 4OQTA 3OSKA 1T1ZB 3BWUC 5DWUL 3STZB 5DURB 1A4JB 2ID5A 3DTXB 5ID0B 5D5MB 4XVTL 3TA3D 3RWCB 2BSSB 5EN2B 1L7TL 1UWEH 2IAND 3H9ZA 4O2CA 2LAGB 2NLJB 4X6EA 4CN1A 5HHQB 3EHBC 3EYUL 1A6AB 4PREA 4U6TA 4GXVL 4P48A 4CVZB 4F8TA 5A43C 4PRIA 3QQ9D 4PRIB 1CTOA 4PRNA 1C5BL 2GTZA 4K9EH 4PREB 1UXSA 3C8KB 3RDTD 1V3LA 3BJ91 4MD4A 2WINB 2UUDK 4IDLA 1SY6A 4MAUL 4ODXA 1V8HA 2X05A 3DECA 2FDBP 4FQQA 5D72H 2EC9T 4UDUA 1UT9A 1U91A 3WHXB 1F90L 1MHHA 1P84K 4QT5B 1A7PH 5DD1H 1N59B 4P5KA 2KL6A 4NJ9L 3F7YA 3ARDA 4NRYB 3BZEB 3FB6A 5EIVA 1CCZA 1B90A 4C56B 3BGFC 4UB0H 3DYMA 1U8JB 1ZV5A 4G6KH 4JO3H 4WO4D 4AEIH 4ZMAT 3QJHB 1KJVA 1L4IA 4ORGB 5F9JA 1KB9K 3O2VH 3KNBB 3QIWA 4LFHD 4KI5F 5DDHB 4QHUA 3X11A 4Q2ZA 4Y2DB 1ZVSA 3ZYZA 3KXFA 1PY9A 1WCQA 3EJYD 4RGOH 1FVEA 1MLBA 3QIUD 1K8IA 1AGDA 5DC4B 3NH7H 3A6BH 5FYJH 4JQIL 3ZE2F 1KCRL 2Q8AL 3C9NA 3B6SA 1VERA 3L95B 1FZKB 3Q48A 3WS6A 1NLDL 3MC0A 4KV5F 3AREB 5DJYB 5CHNA 1QQDA 5FK9B 3ECBB 5CJBA 2JJSC 1QNZH 1J12A 1NCWL 2AEPL 5IW3A 1XF2B 1DUZB 4Y1AA 4U1JA 3LMJH 4PV8B 1REIA 1QFWL 2IADB 2CUIA 1RHHB 1QLFB 1VFMA 2AXFB 1Q0YH 5E8EA 4JY5H 2VAJA 4NUJA 4YBHA 4AIOA 1P84J 4ZOAA 4OTXL 1KIRA 4R7DB 3G5XA 3RWCA 2B4CL 5F7YC 2ICWA 3IDXL 2MQCA 4R3SA 4F7MA 1MAML 1ZTXL 3ESVF 1JTOA 3G6AB 1T1ZA 2XFXB 3HMXH 2E7BA 1ZGLA 1E0OB 2A6DB 3F7PC 3VWJC 3QHFH 1X5YA 1CE6A 2EXWD 2XQYG 1DVFD 2R2BA 3KPSD 4G43B 3SO3B 1JHKH 5KS9F 4M43L 3RZCA 2BRRH 5GGTH 5DJDB 3GUTB 5E2UH 4BFGA 4G42A 4UT6H 2EDLA 3HNSL 3TYFA 4Z7VF 3U9UA 2P49B 4RFEB 1BOYA 4YC2C 5JO5B 4Z7WA 3BFOA 3S4SB 3HKFA 5TFSL 3I6KB 3G6DL 1IEHA 3TPUB 4IMLB 1C08A 4OTXH 1VFUA 2AW2A 5B8CC 4JDVA 3SDYH 1FIGL 1KEMH 1ZHLA 4NN7B 2QSCH 5ADPH 4WI2A 1CG9A 2YKLH 3VG9B 4L8BA 3IU3A 3WD5H 4WJ5A 1SEBB 1S9WB 1EO8H 1IGYA 3C8HA 4PJ8B 4PGEB 5MEOB 3HC3L 3L5JA 4YHZL 1D5ZB 1DSFL 1OOAA 1RZJC 4KJYB 1X6NA 5HYSG 1IC5L 1RZ8B 1MCHA 4MJIE 3QB7C 5FGCE 1CGYA 4XBPB 5DJCB 3KJ6H 3O4LD 3T4AA 4DQOH 3VXME 5FYJE 3U4EA 3LMJL 2E9BA 3CFIC 5AZ2L 4PJ7E 4OFYA 4ZQKB 3D39E 4ZUSB 1I8MA 2EDOA 4LGSB 4TULL 2ZP0T 5EBMA 3WS6C 4U0QB 2HJLB 4Y4HC 3AMKA 3VWKC 1KCUH 1HH9B 3L3DB 5JXAL 2UYLB 4V2CB 4WEBH 5IIEB 4F80A 2VLLA 1U3HA 3MREB 3KPQB 3DVNA 4TQEH 3STLB 4L4VB 3ZYOA 2ZOLA 4U33A 5C0AE 5HI5D 4CKVX 4MJID 4FFWD 4PS4H 5DLMH 2EEBA 3TBTA 5C2UB 3CVHA 4MAUH 1XF5B 4TRPL 3WDHA 5E99H 4HWZA 1XGYH 3BGMB 3VH8G 2FHFA 4R8WH 5IHUL 3BAEL 2B0SL 5JTWA 3HE6A 5E4IA 1GXEA 2ITCA 2IBZX 4HKZB 4POZD 5MP6L 4WUUB 2DWEB 4K3EL 4Y19A 5FO9B 1JGEB 4ZS6D 4H20L 1MVUB 4MVBC 1DBAL 1K5NB 3EOAA 4LBEA 1IM3B 1A3QA 1NC2B 4E41B 1CICB 3I02A 1PKQB 4C57C 3FQRB 2YD3A 4WUUA 3MRPB 3LPGA 4ZXBB 2EE6A 2EDTA 4YHLH 1CGSH 5EWIL 4OF5A 3HE6B 5IOPA 4TNVF 4Y5YC 5FM4A 3QCTL 32C2B 1NCNA 1KBGH 4P4KA 3UO1L 3VXMA 2I25N 2C1OB 4KRPC 3K7UA 3HFMH 2BMKA 2A6IB 3T8XA 2FO4B 1A5FH 4WEUD 4IDJL 1BECA 3H8NA 4OKVA 3HE7C 1RUKH 3AB0C 4I4WA 5CS7A 1QPPA 2UWEE 1RQ5A 1Q9KA 2DF3A 4YXLH 1QR4A 5HGBA 2ZSVB 3OKMB 5HHXH 1A6WL 4Q6YA 1R3IL 4S1QL 2VDNL 4C56E 4MWFB 1KTRL 5IBTH 4UTAH 3L3DA 4PB0H 4Y89A 1G6RA 4P46C 3JTSA 2ITDA 3DO7B 4Z76A 5F9OH 3W2DL 1B6DA 4N9GB 2JIXB 1P4LA 4YDJA 3D2UD 4HFUH 4DKEH 3ZDZF 2N4IA 1WGOA 1MFBH 2H1PL 1NQBA 1H0DB 4PY8I 4KKNA 4WV1C 3FCTB 2PTVA 4LSSH 1YDPA 1SYSB 1SYSA 3RWFB 1IAKA 3SE4A 4XPTL 4LSRH 4B7LA 4ONHB 4Y5VB 3TO2A 3QDJD 4ZDHB 3BP5B 4P0DA 4P9ML 1A6PA 4YXLL 2W60A 5I66A 5IEHA 3L5WB 3TFKD 1Q8MA 4LOUC 1S7WA 4UU9B 2IQAB 2I07A 4WIQA 3S9DB 4ONFH 2VXVL 2GKIA 3WIHH 4W81A 1B2WL 3SKNA 3NACH 3D9AH 1U8MA 3RL2A 3AAZA 4EN3A 2BY0A 3W5NA 1ZLWH 4MCZA 1UJTA 4WDIA 5C9JB 5FUCC 3O6FC 3U4BL 3VI4F 4JFED 5TE7L 1F4YL 1LD9B 1F42A 4PJ5A 1I3RA 1MRFL 1JL8A 4PB9L 1VADA 3CVHH 3HZMA 4JO4L 1PEWA 5E08H 3DRTA 4Z7QF 2VDOL 2J4WH 1V3MA 3LSOB 3DURB 2F9BT 5LJYH 3ELAT 2IPUK 3QWQB 4HSQA 1JTTA 4F57H 1IAMA 2C7UB 4GFTB 1XCTA 4FHBD 4Z77B 1BWWA 3GIZL 1KIPB 3RAJH 3MV7B 4MMXC 4PJIF 5DUPH 3ILPB 2VIRA 3BWAB 1QP1A 3QNXA 5SWZB 3B2VH 5E00B 3B9KA 5ICXA 2BSED 4H1LH 1G0YR 4TN9A 5EU5A 1NAKH 5I1HH 4QXUL 1GHFH 5GISL 2FB4L 3D5OF 4X6FA 4BQCA 2FRGP 1SVZA 3MJ8B 4P2OC 4GG6E 4O5LH 5CFHA 1A