1OCZB

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oczB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oczB02
1KBVA 2GI0A 1JXDA 4KOBA 1QHQA 1SFDA 1E30A 3EH5B 2JXMA 4DP6X 4YVUA 2BP0A 1PNCA 1BQKA 2IDTA 3DKHA 1AS8A 3S3BB 1J9SA 2EIJB 2EILB 3FU9A 1RZPA 3NYKA 3PXLA 2YEVB 1ASQA 1MDAA 1NIFA 3PLYA 3T9WA 4K9JA 3OMAB 2VW6A 3WG7B 4HIPA 1A4AA 3TBCA 2GHZA 4CSPA 3QJRB 3V9CA 1PF3A 3AG1B 3QJSB 2RACA 1M57B 2FQDA 2HX8A 4L0PB 3T6WA 2OJ1A 4Q8BA 1A65A 3ABMB 3IN2A 7PCYA 2Q9OA 5I6PA 1ZIAA 3TASA 2AZUA 1SNRA 2IH8A 3IE9A 1WS7A 1JZFA 3FYEB 1KCWA 4X4KA 4E9QA 9PCYA 3FU8A 5I6NA 1PLAA 5F7AA 5TK4A 2XV0A 3ASNB 4DP7X 1V54B 5LDUA 2HRHA 1IBYA 5B7MA 5ANHA 1ILUA 1SF5A 3QPKA 3X1GA 1AZBA 1OF0A 4NB7A 4A2FA 2H3XC 1A4BA 1TU2A 4AX3A 3N2JA 5PCYA 2FQEA 1HAUA 2ZWNA 3OMIB 1HFUA 2J56A 3N55A 3T6VA 1KV7A 2BW4A 5EHFA 2MTAA 1OOWA 1L9QA 3S3CB 5B7FA 2DWTA 2I7SA 3T6ZA 5I5IA 1OE2A 3MX0B 3S8FB 2DY2A 3WKPA 1J5DA 3ABKB 4DP8X 1NIAA 3KW7A 4AKQA 1BQRA 2HX7A 4DP2X 3S8GB 4E9VA 3NSYA 4UAHA 1AZUA 1NPNA 3FS9A 3ZBMA 1PLBA 3ABGA 2IDFA 2XVBA 1IBZA 3JTBA 1YLBB 1GY2A 1PNDA 1VLXA 4BK5C 4ENZA 1GSKA 1URIA 1PLCA 4YVNA 4HCGA 1JXFA 2PP8A 4NAJA 4YSRA 1A3ZA 3NJLA 4W9ZA 2P80D 4PAZA 3U25A 1E67A 2DYRB 1NDTA 1NINA 3NP4A 3X2QB 1ET8A 3NSFA 3NJFA 4JHUA 3HB3B 1AZRA 1A4CA 2EIKB 1ET7A 1L9RA 2YAOA 3NT0A 4GP4B 1DYZA 1AS7A 3ERXA 3T71A 3NJKA 3AG4B 1F56A 2PCFA 3H56A 1AZNA 3PAUA 2IDQA 2NRDA 2VW4A 1FFTB 2Y69B 1JZGA 2UXFA 3PAVA 1RKRA 2B3IA 3TA4D 2XX1A 1KBWA 4GP8B 3CVCA 1PZCA 2AFNA 4DP4X 2W88A 4YSTA 2H47C 2OV0A 2GBAA 1CC3A 3UAAA 2XX0A 3NP3A 4UF7C 1NIEA 1JERA 2YAMA 3WIAA 1BYOA 5B3SB 1JVOA 4UANA 2LLNA 4G7QB 5I6KA 3ABLB 1ZPUA 8PAZA 1BXAA 1GS8A 2IWFA 2YQBA 1KGYE 4DP5X 4WKXA 1GY1A 2TSAA 3L45A 1GR7A 2CBPA 3RYMA 2VSKB 1KCBA 2CUAA 3IEAA 5E9NA 2FWLB 2BZ7A 3NJHA 1BAWA 1BQ5A 5AKRA 3ZDWA 4G7SB 1SFHA 2FQFA 3FPYA 4N8UA 2CALA 4E9YA 1MG2C 3WNJA 6PCYA 1JZJA 2OCCB 3PPSA 4P5RA 2Q5BA 1AACA 4CSZA 2X87A 2GC7C 2UX7A 4FAAB 1ZV2A 3NJMA 1L9PA 3UACA 4MFHA 2IDUA 4DPAX 4M4RB 1BEXA 4A67A 4BWTA 2FQGA 3D12B 4BXSV 2BWIA 1PZBA 1IC0A 1ADWA 1JZHA 1QLEB 5I6LA 1PCSA 1ASPA 2BZCA 4RH4A 3NJJA 1TKWA 5I6OA 1AQ8A 2BWDA 7PAZA 1ID2A 3GDCA 3CG8A 2XV3A 4E9XA 2W8CA 4G71B 4BDVA 5I28A 1IUZA 3NJGA 1WS8A 3IBOA 1L9TA 2GSMB 2XXGA 1WA0X 2DYSB 3CDZA 3CVDA 1N70A 4KNSA 1AG6A 1KDIA 1NIBA 2UXGA 1E5YA 2N0MA 2BW5A 1L9OA 1XB8A 1OCZB 1M56B 3UADA 1TEGA 4HHGA 2VM4A 2VMJA 3NJNA 3FSAA 3QJVB 3CVBA 1OV8A 2AANA 1GYCA 2AVFA 2P80A 4A2EA 1NIDA 3JT2A 5B1KA 4QLWA 3H4FA 1AAJA 1CYWA 3FT0A 4G72B 1AANA 2PPFA 2TSBA 4YSUA 4F7KA 4KO7A 3AY2A 4KO5A 3FSWA 4HCIA 2HXAA 2IWKA 3X1NA 2Y1AA 2AZAA 2GC4C 3IN0A 4JHVA 4AI7A 1JOIA 2PPEA 4QKTA 1J5CA 1JXGA 1XB6A 2YAQA 2CJ3A 2EIMB 2PPDA 1NZRA 1JVLA 1J9RA 1W6LA 2XXFA 5D4HA 1CUOA 4TXVB 2PPAA 4HAKA 2XWZA 2PCYA 1EZLA 1WAEA 4HHWA 5TK2A 1J9QA 4KOCA 2GB2A 3BQVA 3QJTB 1KYAA 4HALA 3G5WA 4YSOA 1FA4A 5B1JC 3KW8A 4BWUA 4A66A 3SQRA 2UXVA 1OE1A 1JZIA 1SHXA 3V9EA 3SBQA 3OMNB 4GXFA 3SBPA 3NSDA 4F2FA 2MRYA 4AZUA 3OD3A 1QNIA 5F7BA 2WO3B 3FU7B 5IY5B 2FT7A 4DP0X 5I6MA 2YAHA 3UGEA 5AZUA 2FJSA 1AZCA 3EF4A 4YSSA 3AG3B 4BWWA 1J9TA 1HAWA 3EH4B 2YXVA 2PP9A 1ET5A 2PPCA 1ILSA 2X88A 1ZDSA 2QPDB 2UXTA 3GXUB 3ZX1A 1DZ0A 2IDSA 4GY4A 4DP1X 2YXWA 2FT6A 3WI9A 2WSDA 3MBWB 2A3TA 2BHFA 5B1AB 1AS6A 3UAEA 3C75A 2DWSA 2HX9A 2WO2B 4WTQA 2GIMA 2QPEB 3FU7A 1RZQA 5PAZA 1WA2X 4N4YB 1ASOA 3NSCA 4E9SA 1AR1B 3TU6A 3AZUA 2E86A 3AG2B 4M3HA 2FNWA 4YSQA 1GW0A 2VSMB 2BP8A 3PAZA 1UATA 4G70B 3TBBA 3FQ2A 2I85A 1A8ZA 1IKOP 1WA1X 2HZHA 1BYPA 1PZAA 4Q89A 2YAEA 2JFCA 3ASOB 1E65A 2B08A 3QJUB 2IAAC 4A2DA 4EF3A 1ZDQA 3WNIA 5AFAA 5B1JA 2VM3A 4DPBX 1I53A 2DV6A 3WKQA 1MZZA 2ZONA 3SBRA 5I5JA 3FPXA 3ZIYA 1W6WA 2I7OA 3UABA 1M9WA 5D4JA 1GS6X 4A68A 2VN3A 1TEFA 5FC9A 4E9RA 4BDVB 1SDDA 4YSDA 4YSCA 5I5MA 4NERA 2IH9A 3FSZA 2J55A 1MG3C 1NWPA 3EH3B 1EHKB 1ETJA 4HCFA 4KNUA 1W8EA 1BXVA 5I26A 5B1BB 2UX6A 1X9RA 2BO0A 2HRGA 5D4IA 4AKOA 2QDVA 1AG0A 4YSEA 2H5UA 4E9TA 1PMYA 2QDWA 2ZOOA 4F2EA 2JKWA 4G7RB 6PAZA 4DPCX 3H4HA 3QQXA 4KNTA 3PCYA 1NICA 4A2HA 3FQYA 4W1TA 4GP5B 1JZEA 1B3IA 1L9SA 3GYRA 1XMEB 1V55B 3CZUB 3HEIB 1RCYA 4PCYA 5B7EA 4FA7B 2FT8A 1E5ZA 3DIVA 4GYBA 3T6XA 3DTUB 1NTDA 2XLLA 2VW7A 1MZYA 1SJMA 1X9UA 3FQ1A 1KDJA 1NWOA 1PAZA 1OCCB 4JKNA 4KO9A 4YL4A 1N68A 2BP8B 1SHWA 1AIZA 2J57A 3X1FA 2XV2A 1OE3A 3BVDB 4YSAA 4YSPA 4KO6A 2QT6A 1SDDB 3X1EA 2R7EA 1T5KA 1SF3A 4ZK8A 2XU9A 2PP7A 1OCRB 2XUWA 3QJQB 3OQRA 2J5WA 1CYXA 4BXVA 5A7EA 2FTAA 4AKPA 2IWEA 2HLEB 2R7EB 1XB3A 4P5SA 2BP0B 1AOZA 1GS7A 1OCOB 1R1CA 1NPJA 2PLTA 1CURA 4HZ1A 2XYBA 3S3DB 2YAPA 1BXUA 3FSVA 3OM3B 1V10A 3FYIB 1FWXA 3EHBB 2CAKA 2CCWA 2YAFA 4E9WA 1PY0A 2EINB 3NJIA 4DP9X 1ZIBA 3X1BA 4A2GA 3AW5A 2YARA 2ZXWB 3CDZB
chains in the Genus database with same CATH superfamily
1CICA 4HUCA 4XODA 2VZOA 4M1CD 4OF7A 2Y9RT 2ZXQA 4LHQB 4PRIA 1PNCA 4TV8A 3PP4H 1PFOA 3N91A 3MA9L 2VMDA 1RZPA 2CIIA 4N6QA 2JE8A 4TUKL 4P5TA 3BFQG 4QJ5B 2NTFA 3HPLC 1UACH 4HWZA 5L0QC 4QXUH 1A3RH 3Q9QA 1H3PL 1AY1H 3QUZA 1AYOA 2C1OA 3RDTC 1YECL 5FA4B 5T33H 1FIGH 5JNYA 1JPXA 1U2CA 3V9CA 2QWQB 3SCMC 2GEEA 2XN2A 2AV7A 3QJSB 1R47A 1MRDH 4MDJA 4F5CA 5CBHA 3GZKA 1UYWL 4LLDA 3L3HB 4QCIB 4GUQA 3CRAA 1MPAH 4J3OH 2HVKC 1A21A 3MNDA 1WS7A 3SQBB 1JZFA 3I50H 1LUWA 1MCCA 2V37A 3EXJA 3QEQA 1QEWB 5EIQA 1PLAA 4PJHF 2EXYD 3GSNH 2Z0UA 4A1RA 1VZHA 5D1QE 4AE0A 4PG2A 3D18A 4KXZH 2MCPL 1Z3RA 1ZHBB 3VWKA 4PJXE 4TWKA 4A55A 1F58L 5BXFA 2PF4E 3QEHA 5DJXA 5F97E 3M7OA 1NT2B 4OD3L 4MAZA 2E3VA 2YEZB 3VFWA 1VENA 5M94B 2KT6A 5IROC 5CWSA 1E4XH 1RD6A 4MJID 5D7IE 4A7QA 4TNEA 4PIRF 4QY8A 3RILA 3JYBA 2O72A 4LCWA 4LRNH 4MNQB 4P2QE 4PRPE 4IGBB 1GCFA 1MXGA 4F15B 1IGCH 3C08L 4J41A 5G4MA 2QM8A 3LNFA 5D1ZB 1U36A 3LH8A 3OMIB 1I3RB 1U8LA 4LL4A 5H37G 3BA8A 1QACA 3IC7A 1BJ8A 4HIIB 4YBHA 5DS8A 3L3GA 1OTTD 4RAUB 5BJTA 2Q3ZA 5I1JL 3P3NA 3QR1A 4OCRL 3BVUA 1NVPB 1U97A 4PWFA 5E5LA 3MBEB 3WJJC 4DVRH 4OW6A 4OIIL 2P06A 4JKWA 4WKZA 3O4LD 5KYWA 5AYUL 3H2WA 4Q6IA 3INUH 4GB9A 1KZQA 4GLXA 2IDFA 5BMVB 3VG9B 4DN3H 4M1GL 4Y1AB 3JTBA 3WKMH 2TRYA 2XBDA 2Y5EA 3RGVC 5AUMB 3VFVA 1YMMD 5FYKH 1TYEB 4B5ZA 4JFFD 5EZLA 5LAPA 1CL7I 2OTWB 1QBAA 4LSDA 2EKJA 3UG4A 4BZYA 4G8GB 4JBSA 2ZKOA 4WW2F 1CLCA 4WEMB 4P49A 2XBZA 5BO0D 1AGFB 3QPQD 5IESL 2LU5A 1QSEB 1Z1WA 4ZMLA 2BOCB 1L0YA 2ETWA 2N7SA 1RJZB 2P80D 4PAZA 4TNFA 4HJSA 2H0EA 1S5JA 3P4OA 1LP9F 2OW6A 4TVPH 5DVNA 3UYPB 2CKBL 4ZX5A 4MW8A 1IAOB 5EU6B 3NSFA 4PRIE 2R9IA 2VL5A 2EIKC 2ZWKA 2IGTA 2OL3A 4ZBMA 3BP7B 3LRLA 4BFKA 3L3JA 5FGSA 3RY4A 4OFQA 3U7WH 4AQEB 4WO0A 4KGLA 3PGCA 3D3QA 1WWAX 4KK6D 5CD3B 1CBJA 3IVKB 1QBLH 2X40A 1G7HA 4MSWA 4QHMB 3SYQA 2VDRH 4I18B 1P4BH 3D3VB 5F88A 4I9XA 5ACLA 3ZHUA 2YO3A 1I1RA 2FJFB 3B2DC 4GPVA 4YK4B 2NLJA 1T03H 3CK0H 1I7UA 1IMHC 1FIEA 1I3RA 1KNOA 1BOYA 1U8LB 3FRPG 3MLSL 3TJHC 2HPTA 4P2ZA 4DV1O 4KVCL 4APQB 3VFGH 5A6LA 1N2RB 4LSUH 1I3VA 4UANA 1J0JA 5IJCC 4L4VA 3W0WE 4ILDA 8PAZA 1SQPH 1HR0O 4OD1H 2IPTL 5D2NC 5DMIL 1KGYE 3FUIA 2CO6A 4FP8H 4GBXD 2F53E 5F7NC 3US0A 1A22B 1E5AA 5CB4B 5CLWA 2ZG2A 4WI3A 5DZAA 1FFOB 2D8KA 1MUJA 1I9IH 4B9IA 4GG6E 2Y1ZA 3DX6A 2P5ED 3R18A 4YMPA 3GWJA 4D0CB 5FDYA 4NUMA 3WGUB 1IC7H 1D5BB 1MHCA 1Z5HA 2C3GA 3F7VC 1XEUA 3PHQA 4DR5B 3V5DA 1QLNA 3CFBA 4EI5D 3MLVH 1UB6A 4MMXB 3WELA 5MERA 2IIJA 5KANG 2JXMB 4UVCA 1KJ2L 3RVWD 5LGKA 1QABA 4FAAB 1I8MA 1YVLA 1HTYA 3QNXB 1RJZA 2DQ3A 3UACA 3E2HB 5JPNC 1DQQA 1BBDH 4Y19B 3QDGE 1XNQB 1C8QA 3WFDL 4J3TA 1X5HA 1E1RG 4DV6O 2C7UA 2AKRB 3FFCD 1XXFC 4LLWB 3S35L 1U91A 3KYMB 4UB0L 1QSED 4TNWK 3WTVA 3GRGA 2AXWA 4K07A 3U7YH 2YFOA 4RH4A 5KAQG 2DLFH 3PGCB 3DX7B 4M8RA 3RWDA 2AK4D 1AGEA 5AZEH 3QDMB 5KBDA 4NRXB 2CJUL 2WLJA 4HYTB 3LKNB 2X1XR 5TE6L 4MVZA 4QTFA 5HDQH 1N0XH 4XPGL 3HE7D 3FO0L 4N90E 1RUQL 1IAIM 1ACCA 1MAML 2VXVL 3DIDA 4KKAD 4N2DA 4ENEC 1A7OH 2VAJA 1W8NA 4KRNA 1NJIW 2NNUA 4Q56A 3NIGE 4P9PA 4V1DB 2ZXDA 2E56A 2Q2EB 3BPNB 3GIZL 4WI7A 3TA3D 4ZMYA 1E2WA 5GRJL 3L4TA 4NQVA 1LR1A 5FNVA 4P9MH 1BA9A 1W72A 3FSAA 3QJVB 4M5YH 5TDOB 1OV8A 2VC2B 4A38A 3BIKA 1DEDA 1HWGB 4ODSH 3RA7H 2J44A 1FCCA 2EH8H 5AWNL 1VGKB 1VQ6V 2E5LB 4JRLA 1Y6NR 3MLRH 1JAEA 1M6UA 2H1PH 2VDKB 1NEPA 3ARBA 1BV8A 5FYLL 3RNQB 1YNKH 3SSGA 4ONGL 5IUSA 4J1UA 3NMEA 1SDYA 2C4FU 1ACYL 3CFBB 3H7BA 3J80N 2CCLA 3OAYK 1QBZA 2ICWA 2A99A 4OSUL 3VXSA 4A37A 1J9RA 3D4ZA 1ENVA 1UKSA 2AEOA 3GNMH 3GMOA 4YLCA 4IBVA 4AGOA 4TSCH 1YEGL 4LSPH 3RVVC 4L9DA 1X4XA 3II2A 3IMTA 3FB5C 5C07B 3BWAB 2JCCB 3DVNA 1UKQA 1OAXH 1Z9PA 2EIDA 1MFCL 3IF1A 4HS6A 3CVHL 1FA4A 4GX0A 2FJGB 4BK8A 4XC3L 2P5OA 3H9SA 3AQYA 1XILA 2F8XC 3SQRA 2UXCO 5CBEA 1OP3H 2IBBA 3COOA 3IDMA 2HKFH 1MQKL 4NXMO 4MCMA 1DF5A 2YIDA 3HG1D 4EI0A 3H9HA 4MCZA 1R34A 5CO1A 4OGQB 3WS6A 5JH7A 3TIEA 5HVFB 3WO3B 4FK5C 1FJGO 1IM3D 1NBZA 2LU4A 1CPYA 1QQDA 1TJHL 1LO4L 3BP6A 2ZX8A 3S35X 2GTAA 4JZOB 2HFGL 4JFYB 4YSSA 1SYVB 4ODUB 3OKNA 3UZVB 1KLUB 4BWWA 3SZKC 4Z7VE 2E7DA 2PP9A 4Q97A 2ZE0A 4JL2A 3T0WA 2XZCL 3AJ7A 3H0TB 4HD5A 3TT3L 3QRFM 2QQLH 1ZDSA 3P0YH 3WFCH 5I16B 1MHHB 1D5IL 3O3AA 3EJRA 1TQWA 1HNWB 3VG9C 3APDA 3QIWA 1K73W 4JFXA 4XH2B 4PG9B 2A3TA 2BHFA 5GGUB 3W7UA 2X4UB 4JPVL 3NCYS 1TNNA 3IJYA 4JDZB 5CGYC 3V6OC 5IOPA 4M43H 2BS71 3KL3A 3H1HH 2YPVL 2DBJA 3ECUA 3O3DB 2LT9A 2ZPKL 5DO2D 4DGIL 2APWA 2FATL 5CU9A 3BVNA 1IEBA 3SJVD 5ESVA 4ELKB 2EDJA 4C56B 4NN6B 4F7EB 2BP8A 1TQSA 3M45A 2MQ3A 5IHZB 5C07A 2QVKA 5LMUO 3BPOB 1V9PA 3BWAA 4IRSD 2YIHA 4AEEA 4TKWA 2W9EH 4TLUA 3W0WA 1I85A 3NRPA 5TF1L 4Y4FB 3POHA 5LAXB 2BVTA 5IROA 3CMOH 2LHAA 4PRBB 2RHEA 1KJ2A 4GXUN 3RVVD 1LK2B 4YX2H 1KIQA 3BGFB 3SBRA 3L1OL 2GIYA 2B14A 4JHWL 5ESQA 2QSAA 3C60A 2HAZA 3UPAA 3QWRD 4IBSA 1XGQA 3IKCB 4UU9A 4IOSD 3BZEB 1G6UA 1G9NH 3F83A 2V7NB 2RQ8A 3MNZB 1CDUA 1OSPH 5KJ4A 4O4HA 1J8HD 1YEHH 2ZOTA 4KNUA 1XGZA 4LCCB 4NQED 1OM3L 1K8DA 4X0KB 4WI5A 2YC0A 3FUKA 4HFWA 4JFYA 2G4EA 3IRZA 5D4IA 2PF6A 4MAYD 4AKOA 3IFOA 4PJXB 3T1CA 3AG7A 1KLUA 2WXNA 2W65B 3J8F7 4PJDE 4YSEA 1H38A 3QORB 4E9TA 5DVOA 5MP6H 1CMOA 4X9FA 3BRFA 2DWYA 2FTKA 4OF3A 2DWEB 3WO4B 1ZUQA 4R5VA 5HDBF 4MNQE 3LDCA 1G7JB 4MA3A 2VN7A 4NTXA 1WB7A 2YI9A 3PWLB 3TBYA 4CVZB 3I50L 2WA3A 2JJTC 5BRQA 4X4ZA 3FFCB 1RSOA 2BHUA 3RVZA 1B3IA 1DK1A 2EAEA 5MENE 1OCWL 1H6FA 1KY6A 5DVLA 2ETNA 1IL1A 3N1MC 4PJGF 1LM8V 5EK0A 5J57B 4PCKA 4LEOB 1EXGA 1AR1C 5KG9B 4EUPG 4GYBA 5GS0L 5AVUB 4TUKH 3WXWL 4MBOA 2BVPA 3KWUA 3HE6A 5ESVB 3X2QC 2RJMA 4QRBA 4XO4A 3KBFA 4L4TE 5K9JH 2BP8B 2LABA 3GRBA 2HFFA 3D2UD 3A6OA 3GB7C 3OFNG 2Y07H 2VR5A 4NTYA 4U33A 1QLEC 4BR6A 4HXBH 3LSOA 5T3XD 2VQ4A 4DCQA 5GS1C 1O6SB 1V3LA 4LSQL 1IGIH 1CVRA 4KUCF 3S37H 4TYUA 3LPFA 1FXHA 5HDBE 4MQTB 2ISDA 4BXVA 4PY8J 4BIUA 1N12A 3ATAA 3HR0A 2X4PA 3PXHA 4FQQA 3VTTA 3SCMD 5IJ0B 1MJJA 1VARA 4D8OA 1COBA 3KLAB 3JAMN 1YAIA 4LKXB 1YYLH 4GIPD 1CD1B 1JNNH 3QH3B 2J1ZA 3UZEC 5IB5B 1MCSA 1JGLL 5I0VA 2ESVB 3CZFA 1G9ML 2XZAH 3OR6B 3I9AA 4QRQB 1NMBL 2IANE 4JDTH 5J3HC 3KYNA 3ZN1A 4MTFA 4HUKB 1IDSA 1TXKA 1K97A 3BAEH 3TZVC 2FX8H 3A6CL 3GKWL 3B4SA 4GS7C 4NNPH 5EEUA 4P2RA 4OCLC 1WLEA 1JRHI 1K5NA 4LASL 2BIOA 2DQ6A 3ZO9A 4HIHA 4U1NB 2X2YA 1J1PL 4HGKC 1VACA 1YJWV 5DZNA 4WI8A 4FADA 4Y16B 4PJAE 1DBAL 4YGVB 5DVKA 4GMSH 5EULV 4DP6X 4BA0A 3E3QE 3FO9A 5DUBA 4CADB 3FU9A 1BD2D 4Z7WE 4MCNA 1MIMH 1WAZA 1PDKA 4G9FE 3WOVA 1NIFA 1OD7A 1MZFA 2GJ6A 2ZCHH 1KEMH 4ZTPH 4FCHA 3BGMB 3DSFH 1J0HA 3PLYA 4KVNL 3U48A 1MCFA 3OMAB 4Z2WA 4DJMA 1F4YH 1HNFA 3B83A 4MD4B 3UG5A 5A2JH 2GHZA 2JI3A 2VJ0A 2B16A 5AW0B 4IDLA 4TNWF 5B22A 5IW3A 3U4EA 4GSQA 3VXUA 1ZS8B 1LO5A 4I87A 4J9YB 4I3RL 3QQNA 3C2SA 4L0PB 2QSQA 5D7KE 4KVCH 3F7KA 2BSTA 3WFBH 4GRMB 4JB9H 3M7FB 1JHTB 1QG3A 3K2MC 1UENA 4XBFA 1H8LA 1O6SA 4HJIA 5IBUG 4DV3B 1KN4L 1QTSA 1XBDA 2N56A 3RYIB 2PYEE 2DL9A 2PWFA 3QUHA 4RIRA 4Y5VA 5E8PA 4H33A 4PV9B 1U8HB 1NOFA 3OXRB 4DZ8A 3DUHA 1MF2H 1KCWA 3AB0B 3ML8A 1V7ML 1EBOA 4WGWB 5E94B 5F7AA 2B1HL 4FLRA 1U8MB 5IV2B 4WUKL 2XZZA 1N6QH 3ETBF 1J8HE 4JS7A 2R2HA 3KLAA 1EZJA 3LKPB 1CD1A 4TL4A 4MRCA 3K5MA 1HXKA 2YUXA 5AVXB 4KZEH 1XMOB 3M88A 3O6FD 3CZFB 4I9WD 4OFYD 1AZBA 3KM1A 1JPFA 2IVFC 2NXZD 3CZNA 4UNVA 3LMJH 5J9PA 4HEPA 1QBLL 1BZ9B 5ABAA 1FHGA 1QTPA 1JDAA 3CFEB 1MJ7H 1UM4H 1DLFH 3RNKA 2IFFL 2GSIB 3QDME 4NQCD 3D85A 1KSRA 5TGBA 3FU5A 1UM5L 3TEXA 3GLAA 4WJG3 3GKZA 3VI4E 4F24A 5C0EB 3DIFB 3QVNA 3ZO0A 5DJDA 4ALAL 4NIYE 3UH8A 2H1LM 4U2YA 3VVVA 8CGTA 1YPZA 3L3HA 5GRUH 5BS0D 3II3A 4NQDB 5DN6G 1QOKA 3DETD 2K4AA 3B8MA 1PLBA 3F00A 3ABGA 5MEQA 1RSYA 1MW3A 1XCQA 4KWUA 4MD4A 5IKCB 4KJPD 4WDIB 1EWHA 3RX7A 5JPMB 1NCAH 1GZQB 2WLLA 1HHIA 2Y4SA 5HYSA 2GBUA 1UC6A 3ZRCC 2BZDA 4BH7B 3HKCA 2BSTB 2DMHA 4RESB 3I2CL 5EO1A 3IGLA 1JHTA 1R5VA 2EDRA 2P5WD 3HR5A 2JJVA 5F9OH 2AS5M 3OKKA 1G94A 5LHDA 3LAFA 3TH3T 1X5XA 1MI5A 1XVSA 3X2QB 3WNOA 1BW8A 1M90W 1MSPA 3FQ4A 3UTSE 4PV1B 1UWXH 4B3TO 2OQJA 3QAQA 3P30A 3B8SA 4KTDH 5KSVB 3AS1A 1TJXA 4JE4B 3FFQA 3L4UA 1NS1A 1KC5L 1IBFA 1NFDA 5E6ID 3RA7L 5ICYB 1S7QB 2Z8VC 4IHOB 2C8NA 2GUOA 4KXBA 1KYUA 2FZ3B 2Z7ZA 1AO7E 1HDMA 1DSFH 2Q6WA 5FPIA 5DJ2A 1D5ZA 1JZGA 4U1LA 3PAVA 3GXFA 1NCOA 3NCMA 1ZA3A 3RWIB 3GTTA 2QSCH 1FNHA 2AFNA 3T0XA 2R1XA 4OB5L 4OGXL 3VGAC 3WD5H 4Z7AA 1IJNA 5IR1A 5TF0A 5H5NA 4IM8A 5AW2B 5IYDO 1DVQA 2B2XL 2R0ZL 4OIAA 1MSWD 5JJEB 3JARB 4WJ5A 3BSHA 4XCEA 4TOIA 1MREL 1GS8A 5SV4A 2B1HH 3GBMH 4ANWA 3RY6A 1RV6X 3GJFA 3GMRA 4P23D 3JWNH 5DCCA 1SN2A 3U1PA 1SQXH 3UTOA 3VI3F 1G0YR 2O61A 4YWGL 5IMKA 3BJ91 1JJ2U 5H6RA 3GSRB 4MS6A 3VM5A 2A4EA 5FFOA 1SFHA 2QSVA 2VIRB 4WBNB 1A4JA 2DQEL 3MV8A 5D5MB 3SDXE 5J6GB 1L0QA 3WNJA 2WANA 3AABA 1K4CC 1N36B 1D5RA 5E5UB 2ZR2A 2RDCA 2KDYA 4A2MA 1LO4H 4D0BB 3T0DA 2O6PA 3HKCB 1Q3EA 4Z7UA 4HLZG 1ZV2A 4UQIM 1I8LA 2CG9X 4LU5H 4XVUC 5E1HB 5JOEA 4I18A 3D3VA 4BWTA 3FU6A 4E41B 2WWKO 2C3VB 4RGMB 3KDMA 1XH3B 4MNHA 1TVHB 4N5EC 3MA7B 3BN9C 4MJHA 5D7JA 1PCSA 1CFSB 4JI4B 3ARDB 5FB8A 1WO2A 2UUAB 3N27A 2AEPH 4RGOH 4APQA 2K8QA 5IMLB 4LWSB 3I74A 5GIRA 2NSXA 1BAFH 3V0IA 1U30A 3I56V 1XXDC 1E7UA 3QEHB 5DJXB 5JW3L 4HZ3A 3W0WD 2UV3A 1SETA 4QYAA 3NFSL 3ZTJH 5BVPL 4JM2D 1D5ZB 1CGYA 5F0LB 1NBQA 3MNWA 3BA9A 2FECI 1SMOA 4G9FB 4IGBA 1UUSA 3APNA 1SESA 3N3EA 5DD0H 3SO5A 4U3XA 4XCFH 4DKTA 4U7OA 1NAMB 1YC7A 3D39A 1O7DE 3DX6B 3JT0A 5D1ZA 3LIZH 4YHYB 2AAVA 4RMTA 4LF3B 1URLA 3PHQB 4OX9B 3RYFB 5F1IA 1N4XH 3JARA 4WJ5B 3SPVA 1OWWA 4XCEB 2CGZA 4UB8Z 2P80A 3F7VB 4FFYA 4JHAL 3G04B 3ENEA 4ZDHA 2DS4A 3MBEA 3P9LA 5I6XB 2AW9A 2NOYA 4YJ3B 5IE9A 4X5PA 3WMQA 4WKZB 3SODB 3R66A 2Y72A 4AENA 3JAWA 4HCIA 5J56B 4K7PY 2F1AA 4KKZA 5D70L 1E6JH 1Z3GH 3MUGA 2ZWLT 5CJOL 1J88A 3JVGC 5KVGL 1NBCA 4QKTA 1F4XL 1JXGA 2GJJA 4U6YA 1SZXA 2P5EE 1AHWC 2YAQA 3B9KC 2XTSA 4N26A 1JV2A 4D0BA 1G1YA 1H6UA 3DX7A 4NENB 2CU9A 2O5YH 3RWDB 5J11B 1J8HB 2VQFB 3O45A 2GTSA 1SM3H 3BABA 1NL0H 3WMSA 4HHWA 2XIBA 2R4RH 2IU3A 4PI0A 2M7WA 3EYQD 5GRVK 5C0AA 1OW0C 3F62A 1SJHA 2V0AA 5H37A 2SEBA 4Y4HB 2V17H 4K9EL 4U4IA 4K8RL 3W5MA 4MNHB 4O58L 1YNLH 3EJSA 3GMNA 1TTBA 5D7JB 3IJHB 4RFOL 4F2MB 2Q20A 3QRBA 1U93A 4FULA 4K2UH 5GS2D 5IEKA 1OE1A 1X5ZA 2V4LA 3SYAA 2DYPB 4V1DA 5HYIA 3ULUD 2F4VB 4C54A 4JCWA 4DGVH 4A04A 2NY1C 2BHZA 4MX7A 3RPIB 5I1EH 2GTQA 1R6VA 3FQTB 3FU7B 3QWOA 5EC2C 1AJ7L 2V8MA 5HGBA 1PLGH 1LDPL 2FJFA 4UCTA 1MNUL 2VUKA 3UTTD 1AZCA 1ZLEA 2FJHA 3FQWB 3VGGA 3H53A 3BLKA 3HLKA 4L9LC 4BSWA 1GRJA 1NJ9A 1DANT 1K6QL 1AE6L 2E59A 1IGIL 3CDYA 4N8VB 3ZN0A 2DLHA 4JDVA 4XN4A 5F1IB 4ZMOA 1K8IA 2PCFB 1ZV5A 4KZDH 2ICWB 5DD1L 5LOVA 1R19A 5DLMH 3FB6C 3GMOB 3BWZA 5JDSA 4TOYH 5I1GH 1KIRA 3F7YC 5DJ8A 1IAMA 3F8UB 1BVLA 4L8DA 4F57H 4U7MA 4NDMB 1PZUB 1A32A 3FT1A 3HTLX 2E74B 1RI8A 5AAWC 4B96A 3QDJD 2XWEA 4NP4H 3T3PB 3WS6C 2OJEB 4ZOLA 1RZQA 1CL7L 5JXEA 3KXFE 1D5BA 1MHCB 3MV9E 3JD3A 3QORC 4MXWL 4TQHA 1N19A 4FFWC 5AAMC 4AQYB 4B9CA 4F8LA 5CBEB 1IKNC 1MABG 1SEBB 2P4KA 4F8PA 1W9XA 2NNCA 3CFKB 4PW4A 2VSMB 3H54A 3KD4A 2ZJSL 2V9RA 4X7FC 4IBUA 1A8ZA 2P22C 2G3NA 2ZYSA 2RMNA 5C0AB 3GJFH 1DQQB 1IKFL 2X1QA 3P4NA 4JLRB 4Z3EA 1J1PH 3MPCA 4MQ7B 2Q76A 2X09A 3T2OA 5GGVL 3C6SA 5IVZB 1N7ML 3QJFB 3BKMH 1U2YA 3WNIA 5JYLA 2XQYA 4L4TB 4X5WB 5AW9B 4L0ZA 3VRIB 2ZQMA 3MRFA 2PYLA 4NKOA 4FFYL 3QO5A 1BIIB 5KHKA 2A74B 2DV6A 5TH2B 5I74C 1PEWA 1Q6IA 1XGUA 1YDPA 1M7UA 3MDSA 5IFAL 1VRSA 1OB1B 5C3IA 4YBQD 1EQWA 2APTA 1DJGA 1AGEB 5SWSE 4G7VL 4U7KA 5CJOH 5SWZA 4NPJA 3WB0A 1YEKH 1NCCL 1SDDA 4MCYB 1HKLH 3CZJA 1NWPA 5C9JB 3DXRA 4LPUA 3ZMEA 2HSIA 4CVXA 1B0RB 5JHDE 1YDXA 4PJCE 2RTTA 4LLUB 2FBRA 2R4RL 5EOQH 2ZYIA 4NFDA 2H41A 1NJ9B 5SX4H 1MCLA 2OX5B 4W9EC 1ODUA 5GQBA 2HMIC 1RAMA 2FIRT 2PW1B 1WJ3A 1ZPLA 4NJ9H 3LRGA 5HHNA 4UCOA 2NNAB 2ZICA 1K4DA 3LKRB 2F66C 4DEUA 2OMZA 4QR7A 4XRCB 1UJTA 1FJGB 4PJEE 1OIOA 4XVJH 2QTOA 4K9EC 2E6JA 4PVLA 3UGXA 2H4EA 1A1MA 3LIUA 4HZLB 3VFMB 2OJEA 5BRPA 1ACZA 1R3LC 5HJ3A 4OX9O 3ARBB 3THML 4N0RA 4ZS7L 1XSIA 2QWNB 1GM8A 1PM9A 3FXIC 3N85L 1FNFA 3X3GH 3DTUB 2UWEA 2XAHA 5JIQA 2EO7A 4OV5B 4X1KB 3ZTJG 5C8YA 3WU1A 2CCVA 2C3XA 2P24B 1BLNA 2P8MA 2PW2B 3HOGA 4YN3A 5KMGA 4JI5O 1BXXA 2H1PL 3IKCA 2NNFA 4S0HA 1K4CB 4U1SA 5MEPA 1MLCA 4JF3A 2VC2L 4HHAB 2CK2A 4HJUA 2ZOLA 4X6CA 2G9KA 4IGBD 2KQXA 1RVFL 4L3EE 4QXWA 3SOTA 5FYKD 3OKLA 3VRIA 3IRCA 2FRGP 1SKVA 1QRND 5IVXB 4NRYB 2EDBA 1OY3B 2P1YA 3NR7A 2A74A 1TZGH 5TH2A 4K23H 3SGJC 3X3FL 1WFUA 3WXVH 3TO4B 4C56D 5BOZG 1TITA 3FOLB 5DRNB 3KPOA 3OSKA 4ABVA 1TQBB 2FHFA 3SKJL 3CFNA 4B3EA 1SYSB 4MMYB 5F3HB 2COVD 2YOAA 2VZSA 4PI2A 2G9HA 3F5WB 2XIDA 4UILL 2F08A 1Z0MA 4YHKL 3VGAB 2B9AA 4ZMZA 1IGMH 3R4RA 4YUEL 5AKVA 5DQ9B 5D1XC 2DQTH 3LZQA 3FNKA 2JV6A 1ZL8B 2AF2A 2AXFB 2VLLB 2OMNA 4GQZA 5E6IB 3HI6H 1MW2A 1XGRA 2DEXX 5KZCD 3ZY7A 5CHNA 3V7MA 3HPLB 5L0QB 4KXZI 1WCQA 4YNYA 3SO3B 3GXPA 2WZPA 3O3AB 2XN9E 3LZLA 4OZGE 5FYKU 2EIJB 2HFFB 3DX0A 2EDDA 3FAVA 3SJCC 2XG4A 2YEVB 3QIWB 4KNQA 3BGFC 2DKMA 1S9WA 4KJWD 4NLHA 5E9DA 3LSQA 1YQVL 4G43A 3QC6X 1JCHA 3RL1A 4G8AC 4Y9CA 3QHFL 2VLRD 3CWBH 3OGCB 3ZDZE 2XY1A 4L5FH 3UZEA 4OV5A 4O51B 3O2DH 1ZVYA 4HPYL 4JJOA 5IP4A 3L6FB 2P24A 2ZUYA 1FSKC 4LZKA 2OMTB 4KL1A 3CCRV 2HX8A 4F7EA 3NCEB 4PWJA 4N2CA 2B77A 5AG2A 1NH2D 4LKXA 4NN7B 3G5XA 5ITZB 2X6CA 3RTQA 3WN5C 4M43L 2BIMA 2WUBH 3FQRA 3D07A 1TT6A 4JVPA 4X6CB 3TASA 3P3RA 2DJMA 2Z8WC 3ARGA 4AQ1C 3KYKH 1FVEA 2RFXB 2IBZY 3OHXA 4FQ2L 2QV4A 3NN8B 1NLDL 5JOPE 1R0AH 4Y4FA 1PL4A 5LAXA 4YDMA 3Q2LA 3T77B 4NRYA 2QEXV 2VDNB 3FU8A 4PRBA 1XI1A 1JGUH 4G8IB 1BP3B 1NBVL 3AU1A 4IK7A 5DZVA 1I8AA 3LRKA 2EDQA 2W80C 3T4AC 4P2RB 3ASNC 4ZUVB 1NPUA 4GUPA 4ZMNA 1A6PA 4EFEA 2HG5A 2ITCB 4UYPA 1SYSA 2HRHA 1CGUA 4XNZC 4N5UA 1IZ3A 3KCPA 1L8DA 4XHQA 3ASOC 4KTYA 2R0KL 5DC4B 3B5GA 1FXKB 2NY2C 3V6FA 5KBPA 1ZGLP 4LCCA 1EAOA 4FLQA 3UTTE 2GITB 1K8DB 3HPJB 4LDCA 4X0KA 1CGSH 2CO1A 4PY7A 1FO0H 3VGDA 2W07A 3QEQE 3QNZA 4YXLH 3RDTA 2MKLC 4IJTA 1G6VK 2AXFA 3A3YB 2ADQB 4LF7B 5CP3H 4Z7OF 2BW4A 3JATA 1NOLA 2IWGA 3CB2A 2MH4A 3VSQA 3WFDH 3GHBL 4JPWL 2HG5C 2V5MA 3PABB 4P5KA 2BS9A 1AR5A 2P46B 2XN1A 2DL2A 3ASWA 4JYAB 3S8FB 3ZE1E 3G6BA 4F80A 5K1NA 1LO5B 3REWB 4GG8B 1RM1C 2R69L 5I74B 4QNPE 4DUZB 4ZAKA 3DWTA 1PCXA 1K34A 5FM4A 1E4WL 1CFVL 3N40P 1M71A 5AG9A 1K33A 3W57A 3RL1B 4LEOA 3VD2A 4GBXC 1YEFH 4PJCA 4XNYH 2Q4PA 3VFUB 2GJRA 2ADFH 4J3VA 1Y4MA 4PREA 1SN5A 3OHMB 4XPGH 3VFTB 5CEXA 1XGYH 3QDGD 3WJMA 1U8MA 5KSAB 1GGBH 3LZPA 3RX8A 3FUEA 5FO7B 3RU8H 3SE9H 5D96C 1E5CA 1V3JA 4LO9A 3K6SA 4OGAC 1EN4A 1IGTB 4ZFGH 4OCNC 1W0WA 5DSCB 3CXDL 5A43C 5KVDH 1ZSPA 4KI5E 2JCWA 3GZPA 5AW6B 2P4VA 4WW1A 3DSNB 4Y16D 3KPRD 4AVJA 2CD0A 2FB4H 1P5UA 2PYED 1EPFA 5BY1A 4LK4A 4ZUVA 5DJAB 5E9DE 2AJVL 3PE9A 1EGJL 1JF1A 2HG5B 1MJJB 2ITCA 4E41E 4LSQH 3H56A 4LLMA 5I8CB 1N64H 5TE4L 3SD2A 1G9NC 4GINA 3G6JF 3GMQB 3AAZA 2VN6A 4FQXD 5L2JB 2UXFA 3ARXA 4ZUSB 3UAJD 3OMZA 5BUGA 3CN3A 3E8FA 2W07B 1D6EA 4F7TA 2H47C 3I6GA 3RGVB 1ZLWH 1PAMA 3RUGA 1YYLL 3ES6A 4WDIA 2CK0L 4I5SA 1DFBH 4RO2A 4HIHB 4AGMA 4BELD 2C9UA 3CC2V 3RWJB 3IMBA 3SE3A 2J1WA 4LNUB 1HOCB 3IGFA 1RUKH 4GRWE 4B9FA 1T4KB 1CTMA 1EMTL 2TSAA 2YA1A 3C6LD 4WKXA 1K9MW 3QPXL 2Y7MA 3HKZA 1O5PA 3QEGL 3L8QA 4NO0B 2D0FA 3RYMA 4X99B 1P5UC 4XBPA 1RIHH 3RFZC 35C8L 5E2TH 5AKRA 1VQ4V 1DR9A 3QAZC 3SQOH 5HPMA 1MW1A 5C0DA 4GMSL 4E9YA 3LDBB 3WJMB 2YXFA 4BUGA 5KSAA 3WB1A 4BFGA 3ULUC 4PJEA 3OB0K 1UJ3B 3MREA 4NN5C 5F7UA 1KEML 1E6JL 4LKCB 4U1KB 4UBDD 4FQCH 1OT2A 1L9PA 3OR7A 4IHOA 3OGCC 4S2SB 5EZIL 3K1KC 3MU3A 3QJHB 5J6HB 1U8QA 4EIGB 3RWHA 3GVMA 1TQTA 2Z6FA 1T3FB 1BECA 1UD3A 3DSNA 2L3BA 1JZHA 1SY6L 1ASPA 5FKPA 2UWEE 4NT6A 4I50A 2WTOA 3F65A 3HG3A 5E94A 1PSKH 3P73B 5DJAA 1E4KC 3LZOA 4QOKB 2VQ1A 1ID2A 5I66B 5E08L 3CG8A 1TG8A 5HHOA 1RZKL 2MNUA 4XPTL 2YGOA 3NA9L 3Q2NA 3V5KB 3G5VB 5H8DA 4N2MA 3WKYA 1HXMA 5JO5A 3BSGA 3VXSE 1GN4A 5J9PB 3WTSA 3D25B 2Y5TB 3D6GA 1V27A 1JRHL 3CFEA 2PI4A 5EC1B 5KHHA 5K39B 3QFGA 5IMKB 4DUWA 2QADD 1T1YB 4I0CC 1OJHA 1YUKB 4YO0A 5AD0B 4XPFL 2VM4A 5FW6A 2XQYK 3FT9A 5IMOB 4PA7A 4FQXC 4TSBH 3HUJF 1M4KA 5DEZA 2FO1A 2FUQA 1OPGH 2CH8A 2FH6A 1T4KA 4YX2L 1LTXA 5SX5K 4ZG1A 3S36L 5FCUH 3CX5K 1BYNA 3ARDC 1TZHA 4P48A 3L5XL 3MSPA 4NQDA 1JQ0A 3GK8L 4B3RB 4F7KA 3FO1A 2EYTB 4OZFA 5BZBA 2G3MA 4AI7A 2CDEB 4YBQC 4I2XB 4J2QA 4J3UA 5JPMA 4YZFE 2NX5D 4FZ8H 3QARA 3GGWA 5CA0A 2NY7L 1J1XL 3B40A 4LFBO 4BH7A 5JIIA 4OPAA 3B2EE 1ZXQA 3DURB 1F86A 4QGPA 4ORGA 2JIZG 3CBJB 3QISA 4PJ7A 4TS6A 1ZLVH 1ED3A 4JY4B 3U4BL 1LEKB 2V8LA 2L0DA 3OAZK 3WFEL 2JDIG 4B95C 3D39B 4XVJL 2DJVA 2XPYA 4FIPC 3PQYE 2IEPA 3OMNB 4U1JB 3SBQA 5ISZE 4U6VL 5I73C 3DBSA 4PJIB 4ZS7H 3QUXA 4WHTA 1DN2A 4XB8A 5KVEE 5BZXA 3RVUC 4UV4H 4KROB 4AZUA 4X9HA 1YZZA 1MXDA 4DHLA 2CPCA 1AGCB 4WFED 5F7BA 1FC1A 1FGVL 1HXMB 3BUTA 3VD0A 2Q8AH 5FPRA 2Y22A 4MW3A 4QRPE 1KFAH 1UOLA 3DA0A 4JDEB 4APQD 2HFEC 2FJSA 4YEFA 1BSIA 3INOA 1S2EA 1LNQA 2WWWA 4L5FE 4NX0A 5E5MA 3V6OA 1HKLL 2NR5A 2PUQT 3D52A 5FS5A 3HMXL 4HJ0C 4NHCH 3AVEA 3R4DA 4Y2OB 1IEAB 1M7XA 2YJLA 3BAYA 2COQA 4TUYB 4Y7OC 4DNLA 3H6AA 5LXGL 3GXUB 5KBMA 5CS7A 4NENA 5C6TL 4DP1X 3BESR 1YIJV 4TUUA 3PHOA 4X9QA 2GQHA 4KFZC 3AFLA 3MBWB 2EO9A 5ETUA 5I9QC 4QCIA 1RPUA 1FG2B 1NLBH 1T6WA 3MROB 3DXAA 4K23L 2H7WA 3SHSA 5CFHA 1SVBA 3K0WA 3ZDYE 1BHAA 4AYGA 2FGWL 2O61B 2CGOA 2DQDH 3GSRA 2QVFB 3K2KA 3GMNB 4YEEA 4I2XA 2WQ8A 2H8PB 4ODWB 3UC0H 1HCZA 2WMPA 3U79A 2LQRA 3WHXB 5IQNA 2DYPA 3FB7A 3VSUA 5MEOB 5D7LB 4OI8A 2FUTA 1Q9LA 5DYFA 4JYYA 2VKXA 1TVBA 4R7LA 3RUGE 2A9NL 2M83A 2OJZL 3KJ6H 3A0BZ 2PTUA 3B3BA 4ELMA 1B4TA 4GAJL 3PV6B 2V3EA 5F9WC 3CZSA 3NEOA 3WE6B 3AT0A 3GS0A 2YQ3A 4KHPO 4X4XB 3KLKA 3V0DA 4OLXH 3WKQA 3SD5A 3RWRD 3O2WL 2F2HA 5E8OB 5DS8B 3WHE1 3PWJB 5D71H 3UABA 4OUUA 2KPNA 4RAUA 2A0LA 4J8QA 2WYTA 4K0KO 3LZFH 3VX0A 1PX3A 4BINA 3MV7E 1ADQA 4JI7O 4QWWC 3ZSSA 1CBVL 1RERA 4NERA 3MJ9A 2WIIA 2D7OA 3FSZA 1MG3C 3GBNH 5AVWB 5BO1H 1J5OH 1E5BA 4EOWL 2JMRA 3CRCA 3Q48A 2WZAA 2AEPL 3QFDA 5I26A 3AQZA 2BO0A 5DQDH 3CPLB 3X17A 2FYVA 2EABA 4P3WA 4IYIA 2B59B 1BVOA 5CBAB 3QDMD 3UTSA 3GD1C 3P3UA 4W68A 1EHLH 1Y76A 3BH8A 2ZOOA 4HULB 4PDRA 3U2JA 1SEBA 2DDQL 1ZHLA 3QQXA 3CFKA 2F8OA 1T21B 1AGFA 3EJZC 1KV3A 1I3UA 1QSEA 4UQ3A 3VXRE 1TJGH 1MFBL 4YJ3A 2DF3A 3L7EA 2DH2A 1IGJB 5I8OL 1FLTX 1R75A 5CBFA 2F7PA 1CI3M 1NMCB 5HYEA 4IHJA 1VQMV 4KDVA 4AMKH 1QR4A 3HZYB 4P59H 4DUYO 1FBIL 3NEEA 1SEQL 3VB8A 3L3JB 2YUWA 5I30H 4UQ2B 5L3BA 3JV0A 1RZFH 1TLMA 2P42B 4ODTH 4PH8A 2P43B 3ZOAA 3A0HZ 1SXSA 1N5YL 1SDDB 1ZT7B 2HWZL 4WRLA 4JRXD 1X6NA 2J1KA 2NZIA 3OVUB 4J28A 2NLJB 3ESNA 2K0RA 4WFGE 4X4XA 1RHFA 4NI3A 4OTXH 4MQXC 1F6AB 1U93B 1UZ6F 2V7HB 4FTVE 1T66D 2Z65C 4GSRA 2XDHA 4LOFA 4MVBC 4X9IA 4NTWA 2EDFA 4LF6B 4ZQKA 2XAQA 1E4WH 2AERT 1CURA 3P11H 3IJ4A 3U9PH 5D1QA 3LNNA 2AZ0A 1DN0A 3R06B 2VDLB 1IBKB 2D0GA 3S34H 4DQOH 3K1DA 5BZDA 4XMXA 3RW0A 3GXDA 3VQMA 4UTBH 1DQLL 1M57C 2PO6D 1HEHC 3CDGA 4W9DC 4TL5A 3UYRH 2PYEA 1M1KW 1XGYL 2EINB 3JSLA 2GVYA 2IAMA 2QV2A 4ZFGL 3K2IA 3IGAC 2ZXWC 4NSKB 3IJ8A 1CU4L 1NQBA 2WSPA 2IANB 1JPGB 2OYKA 4AEFA 4K71C 2ZDIA 4IBWA 4MMXA 5MERB 5CR8A 2VB5A 1VFMA 4JL1A 5EIBD 2JXMA 4XDKA 1S76D 1IGFL 2AGJL 2BP0A 2M8XA 2OL3L 3S2AA 4M02A 3UTTB 3V7AG 4E2OA 5I1KL 1KIRB 1I8UA 2JELL 3EGDB 1GOHA 3F7PC 3P30L 3ZVVA 3DC6A 2XNAA 3VXOB 4A6YB 2R59A 1Z5YD 2Y7QB 1BQLL 3K9SA 5JHLA 3QJXA 3F7LA 3N0PB 4LLWA 5T1KB 4Q9CA 1H8HG 3KS0J 1J5OL 1IM9A 2H6PA 4FC3E 5EZOH 3U0TA 2UXNA 5FA3B 4TPRL 2WQXA 3UIYA 1AY1L 2QKIA 4XO5A 1OTUC 2OAAA 2NYKA 4XGZA 3TO4A 5LGNA 1DQMH 3PN1A 4PJIE 2WCGA 4DO2A 1EFXD 4NM8H 5HGGS 2KLRA 3KGRA 4Y1AD 1U8IA 2E75C 2OTUB 1HCYA 2X4OB 5DHVA 4HP5A 2ADYA 4HAFA 3SE4C 2FATH 3CE2A 1K3EA 1AVAA 1THAA 3O4LB 1AHWA 1JV5B 4M48L 4XN2A 4EAEA 1SUJA 5DEGA 2F54D 4QRPB 5HHPB 1BIHA 5L4IA 2JI1A 1I7RA 3CLFH 3QUZD 1T5WB 4P4RA 5IFHL 3QJFA 3ZT5A 3QG6A 4N24A 4GRWH 5F89A 1VEOA 1NTZH 1WVZA 4LSVH 3FF7A 4LF5B 5CXPA 3EYUH 1S46A 1O9VA 4FYTA 4KTEL 1A7QL 5LCVH 5M7QA 5EORL 4IT5A 3FAWA 1UXLA 5D1QB 2EICA 2YFNA 4KX8A 2VR4A 5L4JA 5C0IA 3MV9A 4LAQH 4D9LH 2ERJB 3BKML 3EOAB 2PCXA 3MJWA 4PPTA 5E8NA 1YYMH 1OF0A 3V2AR 1Q6HA 1E9PA 3IS1X 5C9JA 4GW1A 2YEVA 2UU9O 2IO5A 2JQAA 3BP5B 3ILQD 4RGNB 5D7IA 3WFHA 1E2ZA 4FQCL 4Z3IA 5KA5A 2EYRA 1VQLV 1K2DB 1G9NL 1AI6A 1TZIA 2FQEA 4RDQG 1N34O 5E9DB 4X20B 3LNDA 3O8XC 2ZOKB 3O0RH 1VCBC 4M9OA 3BDBA 3FQNA 2G5BA 5D5MF 5JMRA 1WPCA 5DFVD 4Y19D 3L6FA 1A2YB 4CU6A 4TQFA 1TEYA 1SY6H 1DO5A 4RWYL 1J5DA 3W9EB 3HNTH 1FDLL 2H26B 3LKRA 1HQ4B 4DR6O 3QCUL 3QZWG 3ZMSA 3VFOB 3ZL2A 1NGXA 1HL9A 4Q4EA 4FXTA 4LCVA 4DKAA 3FTSA 1LWHA 4Z7OB 3SJVE 5FF6B 1F45A 3HLAB 2Q87A 4EN3A 3LQAL 4PLNC 4YJZL 4A7TA 3VOUA 2XKUA 4TSFG 4OIIH 4AV5A 3F12B 4GJTB 2JK5A 4YXWG 1QHTA 3JZYA 2QELA 3IFNH 4BK5C 1IC4H 1RK0A 5FOBB 3GHPA 1JGLH 3AU1B 1BHGA 4X6EA 2GKIA 3ABLC 1URIA 2B39A 1LK3L 2AHYA 2OMYB 2IJIA 1OGAA 1DJSA 1PKOA 2PP8A 2XTLA 4KDWA 4JFEE 5CZXC 2OTUA 1BJ1H 2EZ0D 5JPMC 2E27L 3CN1A 1EUUA 1YN6A 3O4LA 4GNKB 5JH7B 1UGKA 4PGDB 1D9KB 1EJOH 3SGKA 1MLCB 2BERA 4GCZA 1FXKA 4GT1A 4E41D 4HEPG 1YA5A 4LLQA 3MA9H 4WHCA 3VBBA 2DBLH 2QR4A 4HXBL 1MLBB 5E1QA 4OCMC 1QLFA 3LKOB 4EFBA 1UACL 5T5NF 3MRQA 3OC8A 3UTPD 2NN4A 4PDMA 1LO0L 3HJEA 4QRPD 1NUFA 5ITFA 5A2AA 2J12B 4WI6A 5F7KC 3FOLA 5DRNA 4Q6GA 3PJLA 4W4NA 4XNXL 1FQ9C 1AR2A 3NCBB 4DUVA 4ZMAT 3U0WH 1JMXA 4MJ6B 3REWA 1XV8A 2PI5A 5JW4Q 4QXTA 1IE4A 1K3ZA 1EDQA 5D2LA 1G9EA 4YBLC 2B3IA 1EAPA 2XX1A 4KVPA 3X12A 3SDYL 1OK0A 5E1AA 2F95B 4X20A 3S3WA 1E3XA 1JHKL 2ZOKA 4ADJA 1IT9H 3QUXD 1JMKC 4R83A 4AT6A 2CUIA 4ZX6A 1NCGA 1ZK9A 3UAAA 1ZL8A 1GYWA 2XX0A 3VFUA 5JJJB 1BYOA 2O6CA 1XGRB 2OMXB 4XMPL 3BO8B 2UY6B 4NQQA 2ZSVB 3ZL4L 3B2XA 4EUPB 3P3YA 2ZKMX 5FYLD 2Y6TE 1EAJA 1T1WA 5FM8A 3ATFA 3QDHA 2NT0A 3OTOB 1YEEH 3VQXA 3QUKA 4FX5A 4ZMVA 2RMKB 2P26A 3EDKA 5CGYD 3TV8A 3HLAA 1D5MB 4EN3B 1QZ1A 1N8ZA 2HEPA 1B0GA 1WAAF 4J3BA 4FFKA 1IGTA 2VZ1A 1W0WB 3NJHA 3OR6C 4UM9B 5K69A 4FF9A 4JJHA 4AC4A 4Y1AE 3NPSC 3LHAA 1AILA 4I5BA 3ARRA 3U6XS 4P8QA 1EHLL 2YJQA 3PPSA 2NY4B 1J9CT 2BTQB 2WVSA 3OPZL 1KIQB 1UA6H 1OGAB 3IJ7A 4I55A 1F4YL 5F7EL 2HT3C 4JZJB 1I8KB 3C2AH 1DL7L 5FYLH 5I8CA 4DPAX 1L6ZA 4R97B 4K71B 4PJXF 1T2QH 3G5XB 2X4TB 4P46C 2BSSB 4Z77A 1UM5H 2NMSA 5ICXA 4LCUB 2BFVL 2WXRA 4PLJD 4LHJB 4PRDB 1MHPH 1WZAA 4WSKA 4XXCA 1QLEB 4HJ1A 4U0RB 5IWAO 3VW3L 1NM4A 3HAEB 3MCG1 1NCBH 4KKRA 2VWEC 3OZKA 4HS8L 4JPKL 3RUGB 3NSJA 4Y5YA 4FM1A 1RZ7H 3L1GA 2IU0A 2WV3A 5DZLA 1GPOL 5IB4A 3B77A 1NLDH 2YPVA 4MB4A 4ZUTB 3TBYB 1DJIA 1T22B 1G7MB 4MB1A 4QYOA 2NW2A 1BAGA 1WS8A 4U6HA 5LN8A 1KMGA 1KF9B 2HLAA 2XXGA 3FFCA 1N6QL 3BKYL 3UC0L 5FLXN 3CPUA 2GITA 1YSOA 4HWBH 5C08D 5T5FH 2VERN 4EVNA 4JK0D 1OXYA 1WE5A 1NDMA 4TVPL 3KLLA 3NCXA 2PNDA 3PJSB 3TBVA 4AVHA 2VMJA 3JV5A 1QVOA 4URKA 3ESMA 4OF0A 2APFA 1UADC 4AL8H 2OR7A 5F7DA 2K6YA 4JQXA 1T1WB 2JSFA 2YRBA 1TCMA 5GGSA 1R24A 5LA6B 1RP8A 1AROP 1U95B 3QUKB 4ZAKB 1YMME 3OX8B 4NHCL 2H2PC 3H42H 4U3FH 4EZMA 2F53B 5KVFH 4CN1A 5KLVH 3AC0A 4MHHI 1KTJA 3JWNG 4ZODA 4WNQB 2AZAA 1DBKL 1ONQA 2PPEA 1A6TB 5KSBB 4PSRA 3CPWU 1A6WH 3QZPA 2BTQA 4O9HH 4I55B 3EOTH 4JFPB 4MAUH 1HCFX 1SY6A 5AQ0A 5AW1B 4LARL 4PJ8B 2EDYA 3U11A 4Z78B 4H8WL 2W60A 5HHOB 1MRCH 1O0VA 3OW2U 1T20B 5IW6A 4OLVL 1C1EH 2PN5A 2ZOWA 4JMXA 2BJML 5ICXB 5IK3B 1JZ4A 3K81A 2XZQH 3LKSA 3L72H 2DKUA 4IRSC 4JY5L 4Z7NE 4X8JA 5DSCA 2WYHA 7TAAA 3D25A 4H40A 4YQXH 4WW1B 4HWZB 2PYJA 1UZ8B 1KB5B 2IQ9H 3I9GL 4JKPH 1T1YA 4M93B 3TFKD 4NS0A 3KR3H 3VQVA 1T5XA 2J6WA 2XN9B 3MJ6A 1DHKA 2FX9L 4NUPA 2DEYX 2JB6B 3EJUA 3NPZB 1U8KA 1UXSB 4G9DA 3U6XA 3CE1A 3D48R 4LBEB 4LNRA 3S4SG 3TO4D 4AL8L 5L2JA 3L3OB 4FFZL 4JFOB 5SWQB 3NFNB 1R3JB 1ZSDB 4KXAA 4X7DC 1PVHA 3SGDH 2GK0A 4U3CA 2PWHA 1QR8A 1ET5A 1KGJA 1QVOB 3O6LH 4GKJB 2QPDB 3CMEV 1ND0B 5CA0B 1A7RH 4J4PC 3SDDC 3WD5L 1BL8A 4FYSA 2XAFA 4IOFD 3VUAA 2YXWA 4LNUA 5HDBB 4TMPA 4DF9A 3DURA 2BVOA 1BFVL 3WN5B 3IFPB 4JG0H 3VXNB 3PWVA 1YEDB 4WNQA 2KZKA 5I15H 3VI3A 3RYIA 4WI9A 1DVXA 2HTKC 1ONQB 1ASOA 3LD8C 4RIRB 4Y5VB 5TQ2L 3W11C 4EMZA 3ARBD 3RTQC 1XDCA 1SMAA 1A6TA 5HPMB 5KSBA 2ZD0A 3NZHH 3TBSB 5EIIA 5C0DB 2Z5UA 2XSKA 5C09A 1Q9WA 2YKKA 3QUMH 1A6ZA 3AG2C 1DVFD 3CCJV 1OCZC 4U1JA 3VXRB 4OQTH 3GPEA 5DD0L 4P9HH 3QG5A 3V4PB 2R2HB 4OM0L 3I9GH 1IKOP 2VE6A 1XREA 1F00I 1XF5A 4K35A 2OR8A 4P9ML 3TXQA 1VJSA 1A1OA 1MSDA 4WQOA 1F1AA 3EYSL 1H2GA 4A2DA 4FLWA 3HRZA 4FQXB 1JHLH 1KUQA 3VD7A 2E7BA 4XP6H 4ZD3H 1AVMA 2IADB 3GSQB 4FXGB 4K7PH 4DPBX 1T7WA 1XH2A 3E80A 1QKZL 2X9ZA 3ZE1B 1GW6A 2VDOL 4XDJA 4TULH 3ZZ1A 4OVVA 4TUYA 1KKDA 1KGCE 3ZT6A 4I4WA 4U7SA 1F1DA 4BKTC 5I1AA 1F3JA 2VITB 5DDHA 1JP5A 3LDEA 3UT5A 1TO5A 3G5VA 1U21A 5BW7C 2IG2L 2BMKA 3CCEV 2PR4L 4HCFA 4WO4D 1BXVA 2WVTA 4W9CC 4JFOA 5SWQA 4F6RA 1NEZB 3C5SA 4B3MO 4UV7H 1CFTB 1SGKA 2NQ3A 3Q3GB 4DZBB 4LFAB 4XNBA 3BW9A 3T8XB 3QZMA 4BQBA 1IAOA 1W2KT 5EU6A 4JFEA 5CZXD 1J48A 4OZIA 4YZWA 1TZOA 4GKKB 1G7LB 3K0DA 3TA3C 4M4RA 4U1IB 5SX4I 3TVMD 1H3GA 3FUFA 4OFDA 1Y74A 3EADA 3PJNA 4Y1TA 1L9SA 4OM1H 1KBHA 3OQ3B 5EO1B 4CMHC 1TZHB 2W9LA 3HEIB 4AXWA 4O2EB 1KENH 3M8OH 5F88B 4M8QB 3U9WA 4CDGC 1E5ZA 3D9AL 3W2DL 3QQ4A 4DR7O 1DBAH 1PKQA 2IBZH 4JHBA 2WINB 3S5YA 43C9A 3FQ1A 4QXVA 3EYSH 5KSVA 2RH0A 3HZ3A 4CDHA 1UD6A 1KTKE 5CD5D 1WN7A 4G7YL 2Y7OA 3ROLB 4FFZA 1ZY9A 3ZKMC 4LSSH 2Q0AA 2HRPL 4XNUL 3MRBB 4AGPA 4WSGA 1AKJB 5HI5C 4L3CB 1ED3B 4JY4A 5IHLB 2QQLL 1LVEA 1XCTB 5JVDB 3ZMTA 1WISA 1VGEH 3Q7JA 3D0AA 4ZK8A 3WUWB 5L88L 3DHUA 5FO2A 1KPVA 4U1LB 5D6DC 3DV4A 5D2LF 3ZQWA 3CYOA 4U3SB 3RWIA 3ISYA 2WWMC 4HEMA 4GZRB 2FTAA 4AKPA 1QSFE 3FONB 2BY0A 4FXGA 5AL8A 3HE6D 4JQVA 4D0CA 5A2CA 4POUB 3CLFL 5JQHC 1MKFA 1P6FA 3F3HA 4F7PB 3ZMNA 5B39B 3QUXB 3H9YA 5T1MB 2IPKA 1WV7T 3CC5A 2BCCH 1KPUB 1T83C 1FGNH 2J8HA 3ARFA 1M5IA 5EORH 1AC0A 1TMCB 3S88H 1V10A 2Z4TA 3A24A 3BD5A 1XO8A 4FLUA 3Q05A 4ZTEA 2ZG1A 2JIXD 2JVUA 4OGQC 1KXQA 2AKRA 4GKJO 1A9EA 1P84J 2C7UB 3OJ2C 4Y4HD 5DMGC 4QJ4B 5J6GA 4RWUA 3OZ9H 3CDFA 1QHQA 4J12A 4K94H 5TE7L 3V79C 2HT4D 4RGNE 1Y74B 1IBGL 3HNVH 3PXLA 5B8CC 1U3HD 1KCUL 4NRXA 4ZXBB 4PCSA 1F6LL 1JDCA 2ED8A 2N59A 1FG2A 3FFCE 1ZT7A 1KELL 5AB0A 4HMDA 4JQXC 1S5HC 4R4BB 3DJSA 1ZTEA 4I48B 2CGRH 3HMWH 3APOA 1PU0A 2BVQA 1TVHA 3EYFA 4KMQA 1LO3H 4CSPA 3QXVA 3QJRB 2X53A 3ARDA 3U0WL 4C59B 3HG1B 2AK4E 2F4VO 2XXMB 2K9FB 3VJ6A 4XP9H 4HNAA 4ZQKB 2QQNL 4GMTL 4PJAA 1JNHA 1UCBH 2JKXA 2A73B 3ML9A 4FD0A 4M5ZH 5DA4A 3WUWA 5CR1A 5CF3A 4P9OA 1D2OA 1NC2A 1I0HA 3GWOA 5FW7A 1XIWD 1F51A 2O5ZH 4JN1H 1EMTH 2PYEB 3LZRA 2XNDG 4ETYA 3WE6A 4DV6B 1VGKA 3IDGB 4XN9A 9PCYA 1KN4H 2HT3D 2VKWA 3QIUB 4K8RD 5L3DA 4XP5H 4TV9B 2CKBH 5CU5A 1NGWB 3LX9A 4PJHE 4MQSB 4G6ML 5C09E 1SXAA 5DQJA 1E9OB 1KGIA 1D7DA 3GMPA 1J7VR 4DV5O 2JKTM 1L5GA 3X1GA 3F7VA 3ARFB 1J1OH 4OPHA 3S0PA 3DV6A 4P2QA 1U3ZA 5EBLB 4OT1H 4EDWH 3F64A 2VDKL 4EI6B 3V4PH 3QFDB 4MA8H 4X5LA 4G8GD 3EJCA 1Z5LA 4PJ5D 4QMEA 5J2UA 2EXTA 5I2IA 3KPPA 1OAUH 4U31A 3OGIB 4H1LA 3MUGB 1ROPA 3EVKA 4JM0A 5DHMC 1QR1A 1E5UI 1TR7A 4U6YB 2QKIB 2YD6A 5DI8A 5LDSA 1CLYL 4BFIB 4AKQA 1BQRA 2CLVB 3S8GB 2PUSA 3KPLA 4UAHA 2HJFC 3O3EA 4OLYL 2X4QB 3ZBMA 1XF4A 4P3DB 2Q1EA 1NCBL 3DDFA 1EO8H 3ZHTA 3LNHA 4FI7A 4YHPB 4R4BA 4X98B 4CUCA 5FFLA 3OE7G 1IGJA 1FNSH 3EYFB 1UD8A 1LQBC 4KH9A 3KLHD 4H4NA 5F89B 3O4OC 2ZX7A 1I9IL 1IZJA 5F3FA 3OKNB 2VLKB 3UZVA 5JHBA 3O8XA 4UDTB 3ATDA 3EZJB 2BINA 1G7PA 4IMLA 1HNGA 4J4PA 4YWGH 1URFA 1JNHB 1X9LA 1TZAA 1KCSL 2WGXA 1RIVH 1MHHA 2EIJC 3ML0A 1TCRB 1WBYB 3L2LA 2HKHH 5C0RL 1J10A 1LE5A 4ZBJA 4TF4A 1FBIH 1KXQE 5CLZA 4F92B 4DK0A 4JHUA 5DEFB 1PKXA 5GGUA 2H0JA 2Y48A 1JTPA 5TPWH 4BSWB 5ISZD 3MAQA 1IBLO 2AEWA 1RUPH 4ZW6A 1JA8A 4M61B 4NGHL 1DQIA 2EUZA 2PCFA 3BVNB 4PJFE 3T3PF 4EXPX 4Q9RL 3MLWL 3QEQD 2YSSB 3R06A 3S36X 3W9EA 5JTWA 4C56A 1FFPA 1S7XA 3KWWB 3P0GB 3NQKA 2FMLA 2NUTB 4OFYA 3AT9A 5C08E 1LNUB 3WTTA 2YUZA 1KBWA 4AEIH 3CZEA 5J13C 3M8AA 1XEDA 4ZFOB 3QO1B 3ZKSD 2UZIH 4HPOL 5CM1A 1MFDH 2XPGA 4G59C 1AP5A 2IANA 1KJ2B 1THCA 2DMCA 3VH8B 1LK2A 5I6KA 4XCCH 2VQFO 1R6TA 5FGCB 4ICXA 1BXAA 2X42A 2DQTL 3KZ8A 4PJ9B 4KJPC 2CQVA 3BPCB 5DD5L 2CLVA 5DMJB 4AUYA 1XF4B 4P3DA 1IAIL 3EFOA 3GTNA 3CSBA 3P4NB 5JUEL 4PCTA 2FWLB 2IQAB 4X7SL 3MNZA 5BS0A 4X83A 1TFHA 4M7ZB 2W6IG 1SLVA 4NNYB 4G7SB 2PZSA 3W38A 4Y88A 3FPYA 4WHYH 2FX9H 1NCJA 4PVMA 2CR6A 3GSNB 2F19H 3FB8A 3MRFB 4UINL 2OCCB 4TQEH 1S9KC 1Q81W 4DK1A 2HTLC 3HKEB 2IFFH 4Y0GA 5F6HJ 1QSEE 2XVGA 3D0LB 4CSZA 4IMLB 4OXSA 2PYFB 2WXPA 2DWEA 1U8IB 2NQCA 2GYSA 2KMWA 2X4OA 2ZAHA 3MRJA 2F1MA 4P4KC 1S9YB 5BXZA 2K7QA 2Q10A 4MA3B 2QPFA 4MJ6A 3VGBA 4CVZA 4IRZL 1EO5A 3OJDB 4G6AD 1UPGA 1VKXA 4P2AA 3VXME 5EU6E 3BZFA 1A7PH 3DPDA 3O6LL 1BSMA 3E8GA 1KMIZ 1B0RA 3NQIA 3P0YL 2YMOA 4NYLA 2QMKA 5GGTL 3V4VH 3MBEC 4LSPL 1KN2L 3MRMB 4IDJL 1DBML 1F41A 4X6FB 3KPTA 4XC3H 1KGXA 2Q68A 1MRFL 2JJ2G 1KBKA 2NZ9C 2OMXA 1F7YA 2W8CA 4PJ6A 3T3PE 4G71B 4AYEC 4KHTL 5G55A 1MIEH 2ENYA 3DUSB 3QUML 3VCLA 2WCSA 4DGIH 4GUNA 2DYSB 4LMQI 1E9PB 5AVRB 5C71A 3NACH 3JD0A 3FZUC 2HMID 2OULB 5SWZE 4DCQB 3OEEG 5HFMA 3B3IB 2EJRA 1ZLSL 2ARHA 2Z35A 3FC8A 2IXQA 4GXVL 1K3IA 2AJXL 5L2KB 1OCZB 2P45B 2AGAA 3QW9A 4P46A 2IOOA 5C8YB 4ZW7A 1LO2H 1KEGH 2HJFA 4JRWA 2X6BA 2NXYC 3IFLH 4QXUL 4A7GF 4BK5A 4OZHF 5HGAA 4PS4H 2LW7A 4ZMTA 4MS8C 1NGXB 4NYKA 4G72B 1JYXA 2PTVA 3QH3A 4KK6C 3PP4L 1Y07A 1N36O 3SY0A 2AVGA 4P23A 5ESAA 2VLJE 2VXTL 1FAIH 1I8LC 4I3GA 1OO2A 3ETDA 5F6HI 5FOBA 4O4LB 1X9QA 3GZOA 4FLSA 1W6LA 3CXHF 3RGBA 2BH0A 4N1HB 4TXVB 1K5NB 4OB5H 3UBXI 4IRJA 4BCYA 3MNMA 5DHYB 2V33A 5DRXB 4L9LA 1WAEA 5IB3A 3K91A 2V2TB 4FI6A 1J9QA 4NWTL 3E22B 2QM4A 3OJDA 1UOWA 2DMKA 4F7MB 2O1AA 3IPBA 4N90D 4A66A 1VF6C 4LLQB 4M00A 2Y0PA 2AI0H 2KUTA 2Y1VA 3GMLB 4LFHG 5E9DD 4BZ2A 1P0SE 2EIZB 2E9IA 2FAUA 3TT1H 3VI3E 1MG1A 3PJSA 1EXUA 3IE4A 2VYRE 3TBVB 5F7YC 1L6XA 3E8UL 2DD8H 4EKXA 3CU7A 2ZCLH 3TOPA 5C0AD 5E2TL 3I3BA 3RRQA 5EC2B 2DM3A 1HS6A 3VCLB 4DGVL 3H85A 3BCDA 2NY6C 5DR5L 1YEJH 2Y0SA 1EAPB 1RZFL 3GSOB 1MCKA 3MYZA 4NC1E 4Y2DC 2Z31C 3V4VB 3P40A 2RQEA 3MHZA 4G7VH 2XHBA 5DK3A 3KNBB 3IDNA 4NKQB 4P46B 1L3NA 1J95A 1F4MA 3KL0A 2AZ2A 4B3MB 4PTUB 4JFPA 5E03A 2VR3A 5J13B 3E9TA 5IV2A 1JNLL 3STZC 4G6KL 4N2FA 3N2KB 3EBIA 3BVWA 4HLJA 4R0LA 5KSUB 4M1DH 3ESOA 3LHPH 3UBGA 5L9DH 4YHIB 1HI6B 1G1CA 3KPRB 4MMZA 1DJHA 1ZVHA 4YZFF 4P23B 4D9RE 1FVEB 5L4MA 2OTJV 4E9SA 2FLRT 3OAUH 1BZ9A 5CA1A 1MEXH 3OTTA 3ZRWB 4NM4L 5E4EC 2R8SL 2N1TE 4YPJA 3MMEB 4X89A 4X8GA 2CSPA 4PV8B 3Q1EA 1HL4A 4GUPB 1GN2A 2R0LH 3VM7A 2YMXL 3Q2CA 5C0ND 5EZPA 5LB1A 3RIKA 3QDGB 1BYPA 5KSAD 5EA0H 1BOGB 4K94L 3PQYD 1A7NL 1EZVH 2BSSA 4Z77B 4LBEA 4LNRB 3THMH 4EF3A 1YPZB 3U7WL 2NY5L 3WE1A 1W2BU 4QHNA 4UQ9A 4CNIB 4MDRA 2H94A 3C6EA 1IFRA 3EKCA 4MA7H 2EECA 1JJOA 1MHEB 3KHOA 5D9SA 2AHIA 2OP4H 4PA4A 2ZONA 2FGZA 3TGXA 2N7BA 4P5KB 5C86A 2I60L 2ATPB 3BY6A 3OAWA 3T2MA 1XHXA 4HWNA 2Y06L 5IB4B 1IB5A 1X4ZA 4Y9EA 2YC1A 3NIDB 4YK4C 1VQ9V 1Q1JL 2UX6A 2D4DA 4NBZB 4ADGA 2HRGA 1M71B 4FFBB 1MCDA 1FFXA 2IW5A 1MW0A 1PD3A 4I3RH 1H2NA 1UCBL 4NZ8A 3V4VA 4EVNB 3B8YA 3APCA 1X4YA 2BVYA 3QNFA 4C83B 1JNNL 1A66A 1DCLA 2OS7A 4NQTA 1PMYA 2PR9A 4Y5XC 4WWKC 4G7RB 2BNQA 1DVUA 2QL1A 1G8MA 3IRPX 3K04A 2KPWA 4M6OL 4UTAH 3BCCH 1H15B 1XCXA 2VLRE 4W9IC 3PCYA 4Z1PA 3ZXAC 3ABMC 3BZ4A 5T5FL 5KSUA 3VFPB 1IKNA 3D4GA 4NNPL 4PY8I 4XZUA 4YHIA 5D1ZI 1RCYA 3ZX6A 1SRDA 2FDBP 1UWXK 4FA7B 2FZ3A 1UJWB 1WPBA 3HI1A 1FAFA 2GSGB 2F5BH 4HJGA 2VW7A 4MJ2A 4Q52A 1SJMA 5BUPA 1PAZA 2B0SL 2Y2YA 4TUJB 2B7DT 1H8SA 4YL4A 1GOFA 5SX5H 2V1DA 4FZEH 4KHPB 4RAVB 4JUTA 4R7DB 1GJUA 3ULUL 1S9XA 4JV5O 3HHMA 3WIIH 2MPAH 3LN9A 2IGLA 4PJ8A 4Z78A 2Z7UA 2BXZA 1W80A 4LGSB 5I1AB 4N2KA 3X1EA 4UNTA 2R7EA 4G6AC 4OFVA 4Y2NA 5EPMB 5CN0A 4O5LH 3SPHA 3HG1E 4ZUSA 5C2BL 1I75A 1S7SA 2DOCA 4ZOCA 4FRWA 2BRQA 3U46B 5IB2B 1PG7L 1JWUA 1D6EB 3MV7D 4F7TB 2JJTA 3QF7A 3IB4A 3SE8H 4YHHO 3ARPA 2VGLM 4X62B 1NPJA 4CC4C 4OZIB 2R1YA 4EIBA 4UYQA 1TQBC 1J18A 2GTZA 1X3DA 2FWOB 4P57B 1UH4A 3M6DA 1DQJB 2N01B 1AD0A 4JTAB 1ZTMA 4K4KA 5BPPA 3FSVA 3R1GH 5GSVA 3T0AA 3OM3B 1CD0A 5IT2H 3ZEDA 1VEPA 4NO0A 4UV4L 2LW3A 1PX8A 2PXYC 3JZ7A 4AXWB 2A9AA 3L4VA 4E41A 5CEYA 3W9DA 5C0GB 5TD4A 4NVPA 3CU1A 3QZBA 4XHJD 4Y1SA 3WDHA 3HKBB 2YARA 5CCGE 2A6IA 2UUBO 4H8UA 4HGWB 3C08H 4NEHB 4F4LA 5EU4A 4YXHL 4CU7A 2GK2A 3IDIA 3VXTB 3QYMA 4CSSA 4ATTA 7FABH 2MKWA 3BZ4B 1EJ8A 4IYHA 2E4FA 1OKEA 2OP4L 3NYKA 1AKJA 4JO3L 5EU3B 3RIAF 2OMUA 3WEXA 5TPWL 3WN5A 2VL4A 5DMYA 3RB5A 4GI8A 4NQXB 3HS0C 4K9JA 4O2BA 1P4BL 5D1XD 4O2AB 4PGEB 1F1GA 4TSCL 3A8TA 1QFPA 5EIIB 3TBSA 3CFTA 3K9AA 4Z7VF 3JD4A 4RNRA 3SJVA 2K8MA 1EBPA 1PF3A 1QWNA 1F5WA 3SDDB 1LHZA 1ACYH 2RJZA 4P5TD 2AJYH 4GKKO 2UZIL 3OL2A 4HPOH 3ISRA 4LFCB 3BGAA 4RMSA 5HI4C 5A3ID 2VN5A 5T1DL 4OFPA 3V5KA 5F3BB 1J8KA 1T2JA 3BAKA 4ES9A 4QHLA 1QA9A 1T7VA 1A3LL 3HRZB 4NHUA 2EINC 2QR0A 3HA0A 1YQ2A 1RFDL 5G4NA 1KCSH 1BLIA 4H20L 4JG1L 4ZS6D 5GJTL 2IADA 3JAWB 4QTIH 1DUYB 3O11B 4I4TB 5F0PB 1FPTL 2CHXA 4HMCA 5FA4A 5AVQB 3N9GL 5K9KB 4DW1A 1LMIA 2J8OA 2R39A 1DQJA 3W37A 2HKFL 1SF5A 4FKKA 2X1OA 3P77B 1ZSHA 1J8HA 3X14B 5HYJD 4LDLB 4FZEL 5EF2A 4ZXBA 1UD4A 5DWUH 5C92A 3SKUD 5JA8B 3O6FC 5LGYA 4Z76B 2UXXA 1Q43A 5I8KH 1B4JH 3HKBA 3SQBA 5FECA 4LT7A 4HGWA 4YL9A 5EU4B 2EVHA 1P5VB 4X1IB 5TTRA 2I7SA 2QSCL 5ECGA 2IG2H 4HLEA 1G7LA 4RA3A 5IEKB 2IPUG 4A5UB 4JM2F 4HNAB 1NIAA 5DJ6A 3ATEA 4IYKA 3E3QC 1QBBA 5IM7A 3HN5A 5D6CB 1WT5C 1LEKA 4JG9A 4XCYB 2EEBA 3L1FA 4OD1L 4N1EA 3STZB 4FQ1H 4PGEA 1PNDA 1VLXA 5K1XA 3PDOA 1NAKL 4PGZA 2FJHB 5EU7E 3WTYA 4YVNA 1SERA 1WG3A 3KPSE 4PYHA 4HIIA 1P7HL 1ZLSH 3VWJA 3ZMRA 2YMTA 2DQHH 1VADA 2J8UB 5FPOA 1IURA 2EC9T 4JAMB 5EZJB 5F3BA 2YD1A 2BNQE 3A2FA 1EJ6A 5JVDA 1RU9H 1XCTA 2BSBA 3AROA 4KGJA 3UJIH 5EBLA 4E5XG 3A4DA 3LEVH 4HKBA 4J3OF 2HLFD 3QVAA 5LYJB 3JSNA 3NJVA 1ET7A 1U8NA 4GW4B 4YXKL 3ZYZA 4K3HA 2ZE8A 1KQSU 1DUYA 3O11A 8FABA 2P7TC 5HGHB 3II1A 4JRXA 2WPGA 3VFVB 5DEDA 3ERXA 1E4HA 3T4YB 2NY4D 3IAYA 1RZJC 1P4UA 2WYZA 4L48A 4QXGL 5CZKA 4FFVD 2XRAH 3SYOA 4O4IB 3ARWA 1A6WL 1P1ZA 1HJBC 2DI9A 2E7CA 5BNXD 3C9NA 2I9LB 2CO7B 4QOKD 4LARH 5E2JA 2CDYA 4DP4X 2WOBA 2E7LC 2V2XA 1RURL 3MGTA 4PWIA 5HHMD 3C6SB 5ALCL 5IVZA 3GBLA 1A9EB 4X5WA 5CINH 4G7QB 3Q01A 2ZXAA 5KSAC 3P9MA 3FTUA 4H0LC 1B2YA 1QUNA 3C3SA 2C4XA 1YNLL 4M03A 1CB4A 1Q9LB 2VXUH 4AQEA 5HDRA 3D39E 5F1KC 2IC2A 4MVOA 3RVYA 3LZNA 5IM7B 1NC2D 2AMGA 1KCBA 3PGDA 1YSCA 1OT4A 1WBYA 4JO5A 3P0VL 4JFDE 3NZSA 4FMVA 4I48A 3DXRB 1UH2A 5CP7A 4CVXB 3UTSD 4L8BA 3HG2A 5BZWA 1UT1A 4N8UA 2Q5ZA 2G60H 3BH9B 3LEVL 5IEHB 1KNOB 5DT1L 2E0PA 3NOIA 2ARWA 1QASA 4FG2A 1SF9A 4PJEF 2GJZB 4QPJA 3K06A 1FL5A 1H5BA 3D69B 3FFOA 3HMWL 4G1MA 5A2KH 2ZE6A 2NNAA 2WK2A 2YSSA 4A67A 2FQGA 2EIBA 1XR9A 2FX7L 5E7BA 5IYZB 1GZPB 2MTPA 3PY9A 4N85A 2N7AA 4J3OD 5FEBA 1PZBA 1NL0L 3FB6A 4FXKB 3CRQA 3KGSA 1MUJB 2D3OW 2Q8VA 4X65B 8FABB 2WKOA 5HJ3B 4XX1E 3SGJA 1QUPA 3BC9A 2DLGA 2UWEB 4K8RH 4JFHE 3N44B 1S7VB 4LIQL 4MHHG 3IM1A 4E9XA 1XF2B 1R5IB 3PQYA 5JQ6L 1NCNA 5I28A 1QNZL 5DRZA 3K5OA 1TIUA 3TLRA 5M95B 3ZHDA 3AQXA 5JCOC 3MJ8A 1L9TA 2GSMB 1ZLZA 2L7QA 1S9VA 1GC1H 2A0LC 2DTMH 3QNXA 2Q3AA 3GHEH 5ISZA 3TC9A 1N70A 1E4XL 1B6QA 1SQBH 4G6MH 3QXUA 2WLIA 4Z1MG 4BZ1A 5BS0B 4FNRA 5DK0A 5SWZD 5MI0B 1C12A 3RGHA 4JGMA 3LB6D 1FNAA 1GJWA 3BAEL 4NQCB 5FM5O 4LRNL 4CW1B 4UCUA 4JN2A 1PLGL 2NX5B 1KFAL 1B4RA 1L7TH 1M4UA 4N2HA 2ICEC 5KJ7E 4UQ2A 5IQ7H 1BT8A 2PYFA 2Q86B 4I9QA 1JUFA 2DBLL 2VDOH 2YN3A 2JJWA 3MRJB 5IWLC 3O3EB 4MMYA 3CQPA 2GHYA 4KO5A 4KK5D 3RZCC 1ERNA 5CCKL 3ME0B 4JHVA 2W5PA 4N28A 1NCDH 3LEXB 1HIMH 5JPNA 1HZKA 1FLRH 3FMGH 4J7RA 4AYID 4EB6B 2EXSA 3LCYA 4M62H 5CSZA 4RQEA 2C9RA 2PPDA 5EH1A 1F3DH 4X6FA 3V0WL 4I2XE 2X0LA 4D9RD 4XBGB 3O8XB 1UWGH 4JFWA 3LNEA 1NA8A 4F3FA 1OZUA 2LFSA 3RL2B 4RQQB 1IT9L 5TDOA 3MRPA 1ZS2A 1P7KB 3CCHB 3GXTA 1KYAA 4DW0A 1GZPA 2OXHB 1XOUA 4H13C 2JS5A 2E76C 3KLHC 4H25B 1KB9J 4N68A 4OUOA 2N1KA 5K1JA 4S1DD 1QCEA 1TMQA 1TTUA 3I2CH 5L2KA 1TFPA 2MRYA 4ZSOB 5H35A 4BWAA 4X64B 3D9AH 4XR8C 1R5IA 1M2VB 2ZXBA 3PQYB 3GEWB 3G71V 2VDPH 1QAWA 2AK1H 1G7QB 2VN4A 3VD1A 3VA6A 4N5ED 5L3EA 4DR6B 4EN3C 1UVQA 1D9KC 3BKJL 3CC1A 3EGXB 5HGAB 2EVIA 1XGPA 2YOCA 3NUKA 1JXJA 5I6MA