1OCZB

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oczB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oczB02
2PP7A 3T6WA 1PZBA 3EH3B 1NTDA 4BK5C 4YSAA 1PNDA 1AZUA 3PXLA 6PAZA 4WKXA 1ZPUA 1E65A 2QDVA 4G71B 2UXTA 2ZONA 1IC0A 1MZYA 3DIVA 2CAKA 3IE9A 4WTQA 2XU9A 3QJUB 2UXFA 1FA4A 3GYRA 3ASOB 1OE2A 3ABKB 3FSZA 1A8ZA 3FU7A 4E9YA 3NYKA 1ZDSA 3T71A 1PLAA 3FU9A 2JKWA 3IN0A 2GC4C 1J9QA 3IBOA 1JZJA 3CVBA 1EHKB 3N55A 2BP8B 1HAWA 5D4JA 3OMIB 3ABGA 3WG7B 1PNCA 3NSCA 3TA4D 3AY2A 4GP8B 4F7KA 1TEGA 2YXWA 2HX9A 2IDQA 1X9UA 5D4HA 3QPKA 1L9OA 1F56A 2VSKB 1FFTB 1ASQA 1KGYE 1PLCA 1GS6X 3IN2A 1KBWA 3UGEA 4AX3A 7PCYA 4TXVB 4G7QB 4MFHA 2W8CA 1SHWA 2XLLA 1AZCA 4KNTA 4HAKA 1NWPA 5E9NA 1QHQA 2X87A 5A7EA 3QJRB 4YSRA 2ZXWB 1JZFA 1CYWA 2VM4A 3ZDWA 5I6NA 5PCYA 2VN3A 2BWDA 7PAZA 1ZIAA 2AZUA 1BQ5A 3WNIA 1JVLA 3OQRA 1M9WA 2CUAA 1GY2A 2RACA 1AIZA 1RZPA 4Q8BA 4YSDA 3WKPA 5B7MA 2PP8A 1PCSA 1JXGA 3NSDA 1OV8A 2VSMB 1URIA 3S8FB 1MDAA 3X1BA 3NJHA 1PZAA 2WSDA 8PAZA 4DP1X 1L9QA 4BDVA 1L9PA 1MG3C 3EH5B 4UF7C 2WO3B 2HX8A 2GB2A 2MRYA 2H5UA 3NJIA 1V55B 2VW4A 1RCYA 1SHXA 2VMJA 3NP4A 2BW4A 5B7EA 2CJ3A 4A2DA 2BWIA 3WNJA 5I5IA 3NSYA 4YL4A 4KO9A 4G72B 3N2JA 1BXVA 5I28A 2XX1A 2IWFA 5EHFA 1IBZA 1E30A 1J9SA 2NRDA 5I6PA 2UXVA 4A2FA 3ASNB 2WO2B 1ETJA 5B1BB 2XWZA 2XXFA 4GP5B 4BXVA 2XXGA 2XYBA 1ZIBA 5I6KA 5I5JA 1E5YA 4JHVA 4PCYA 1A4BA 1RKRA 2QDWA 2FTAA 3GXUB 4DPAX 4E9TA 2IAAC 2BP0A 3MX0B 2I85A 2Y1AA 4JKNA 2BZCA 1ASOA 1NPNA 3TBBA 3FT0A 3HB3B 3CVCA 1BQRA 1AS8A 3QJVB 4UANA 4CSZA 3SBPA 1V54B 5IY5B 2BZ7A 4A68A 4NAJA 1GS8A 1SF3A 3V9CA 4M4RB 3BQVA 4ZK8A 2YEVB 1AANA 1AAJA 1NINA 3KW8A 1KBVA 3WIAA 3U25A 3EHBB 2YAHA 1VLXA 1L9RA 4AI7A 4HCFA 4YSEA 3CVDA 4G70B 2UXGA 1AG0A 1PAZA 1PY0A 4BDVB 2PPCA 4YSSA 2JFCA 5B1AB 4YVNA 1ID2A 4N8UA 1JZEA 5ANHA 2PP9A 4K9JA 1OE3A 1TEFA 2IDTA 3FYEB 5B1KA 1KCBA 1A3ZA 1HFUA 3ZX1A 3H56A 1N70A 2YAEA 5I5MA 3NJJA 4HCIA 4YSTA 3FS9A 3WI9A 1IBYA 4E9XA 2TSBA 4YVUA 1WS7A 4DP8X 3UAEA 1XB3A 3FPXA 3L45A 3AW5A 1TKWA 4YSUA 1AZNA 2LLNA 1AQ8A 1FWXA 3QJQB 1A4AA 2DWSA 3AG4B 1W6WA 2GIMA 2FT7A 3CG8A 4G7SB 2GBAA 3AG1B 2H47C 2YAQA 1JZIA 2BP0B 2PCFA 1R1CA 2HZHA 3NJGA 5AZUA 2IH8A 3AZUA 3X1NA 1AZBA 4E9QA 2EIKB 3ABLB 4PAZA 4GXFA 2DYSB 1OCZB 3AG3B 4KO7A 1E5ZA 3NJNA 5D4IA 2GHZA 4CSPA 2XV3A 1OOWA 4N4YB 3OMAB 1IKOP 1NZRA 2DWTA 1ASPA 2FQDA 2OV0A 2HXAA 1GYCA 1OCCB 5I6OA 1JVOA 2B08A 3OD3A 2P80D 2ZWNA 1GR7A 4KNSA 3PPSA 3QQXA 4F2EA 2TSAA 1NIDA 4EF3A 2FQEA 1AACA 3H4HA 1NIEA 1NIAA 2YAOA 2OJ1A 3NJKA 3ERXA 3PAZA 2XVBA 3T6ZA 2ZOOA 6PCYA 2CBPA 4DP2X 4NB7A 3X1FA 4A2GA 1JERA 3S3DB 2CALA 2UX7A 4HIPA 4YSCA 3T9WA 2J56A 1BXAA 2VW6A 1W6LA 3ABMB 3TBCA 5B7FA 1AZRA 1NWOA 2MTAA 2AFNA 2EIMB 1DZ0A 3TASA 1L9SA 3OMNB 1OE1A 4AKOA 3RYMA 3CDZB 1J9TA 4HCGA 4A2EA 1EZLA 4UAHA 1ILSA 1AG6A 3FSWA 1XB8A 1BXUA 3FSAA 3SBQA 4DP0X 2IWKA 1MG2C 3UADA 5TK2A 3X2QB 2HX7A 3NJFA 1M57B 2XX0A 2R7EB 1A4CA 3CZUB 2XUWA 2DY2A 1ET5A 1NIFA 3DKHA 3PAVA 4BWUA 2IDFA 4A66A 2IDSA 1AR1B 2PPDA 1E67A 2B3IA 3H4FA 1TU2A 4E9VA 4KNUA 3JT2A 1AS6A 2Q5BA 2I7OA 2QPDB 2UX6A 1JOIA 2A3TA 4DP9X 4DP4X 2Q9OA 4P5RA 1CUOA 2E86A 9PCYA 4RH4A 3NJLA 3QJSB 2HRGA 1BYPA 3PAUA 1RZQA 1KDIA 3S8GB 1CYXA 1GS7A 5F7BA 4DPBX 2AANA 2GC7C 1KV7A 3EF4A 4W1TA 2PCYA 1GY1A 2PPFA 3UABA 4FA7B 2YXVA 2J55A 1KDJA 2QT6A 2GSMB 2J57A 4M3HA 1N68A 3NT0A 3X1GA 1X9RA 3S3CB 4YSQA 1WA1X 3UAAA 4W9ZA 1B3IA 2IH9A 4HHGA 1SJMA 2DYRB 1JZHA 3FQ2A 3S3BB 2H3XC 1SF5A 1SFDA 1XMEB 2X88A 1J5CA 4KO6A 2GI0A 2YAFA 3CDZA 1J5DA 3NJMA 2BW5A 3AG2B 2DV6A 4BWWA 3IEAA 1CC3A 1A65A 4GYBA 3HEIB 2FWLB 4BXSV 3TU6A 2XV0A 2EILB 1QNIA 1OCOB 2YAPA 3KW7A 3PCYA 5FC9A 2R7EA 3MBWB 1QLEB 2FNWA 3FPYA 3T6VA 5PAZA 3ZBMA 2HRHA 1MZZA 2PLTA 2IWEA 1BEXA 1SDDA 5AKRA 1NIBA 4Q89A 1BAWA 2PPEA 3UACA 2OCCB 2Y69B 3EH4B 2FJSA 3FQYA 2BHFA 4A2HA 1WAEA 4GP4B 1BYOA 1WA2X 2AZAA 2N0MA 3FQ1A 3PLYA 1OCRB 3ZIYA 4AKQA 2CCWA 3QJTB 5LDUA 3BVDB 2FT6A 4NERA 4YSOA 3V9EA 2QPEB 3JTBA 1XB6A 1AOZA 1PMYA 2W88A 3NSFA 1L9TA 2VM3A 5AFAA 3OM3B 2FT8A 4A67A 5TK4A 1JZGA 1OF0A 1ZDQA 3SBRA 3DTUB 4JHUA 5I6LA 1PLBA 2FQFA 1NICA 1IUZA 3T6XA 4E9RA 4HZ1A 1SFHA 4E9SA 2VW7A 4KOBA 2YAMA 2XV2A 4E9WA 4F2FA 4ENZA 4BWTA 2P80A 2YQBA 3D12B 4DP5X 1YLBB 2YARA 3NP3A 5I6MA 1CURA 5B3SB 1ADWA 3G5WA 2JXMA 4G7RB 2HLEB 1ILUA 3WKQA 4HALA 2PPAA 1SNRA 3FU7B 1PZCA 4AZUA 4DP6X 2BO0A 4QKTA 4KOCA 4L0PB 2BP8A 2IDUA 1AS7A 4YSPA 1BQKA 2EIJB 4QLWA 4KO5A 3FU8A 2I7SA 1PF3A 1JXDA 1W8EA 3GDCA 1UATA 4DP7X 3FYIB 1I53A 1ET8A 4FAAB 1GSKA 1ET7A 1DYZA 1SDDB 3FSVA 4GY4A 1M56B 2EINB 1NPJA 1T5KA 1WA0X 4X4KA 2J5WA 1KCWA 5B1JA 4DPCX 4AKPA 1V10A 3X1EA 1KYAA 1WS8A 4HHWA 5I26A 1GW0A 5F7AA 5B1JC 4P5SA 1JXFA 2AVFA 1HAUA 3C75A 1ZV2A 1J9RA 1NDTA 3SQRA 2FQGA
chains in the Genus database with same CATH superfamily
1BLNB 3CFBB 4JJ5B 3IXTB 1MRCH 2NNAA 5T3ZL 2R9HC 4KHXL 3UC2A 3OLDA 1N33B 1PNDA 4QRQA 3SY6A 4ASUG 1MCNA 1YEHL 2OMTB 3WXWH 4AMWA 1B0RB 2X89A 3NFNB 2CRYA 3KMDA 5LYJB 5F7KC 4KKNA 3VA2C 1H2NA 2Y6SC 1MWAL 1U8NB 3V4PL 4Y4HA 1P1ZB 4JJOA 5IW6A 3T1YB 3FTUA 3MV8E 1SY6H 3IS1X 3C8HA 5A3IC 1K3ZA 4PRAA 2WCPA 3T2OA 3EO9L 1OZTG 2F7QA 2BNUB 3TEZA 2Q0ZX 2DQJH 3HN5A 3DECA 5D1ZC 4CVUA 4OUUB 2NY5L 2AXFA 3W7XA 3UYRH 1LE5A 1QFUL 5CMAA 5CP7B 3OKMA 4JY5H 5I1LA 3N27A 1B6DA 4OM0H 3WB2A 3BJLA 1WC7B 3TZVB 4RMVA 4XBGB 1C1EL 5MERA 3QW9A 1EUTA 3DX8B 2OAAA 1KXTB 3FU0A 1HZLA 4I1RA 3HB3D 5GS0L 3QUGA 3AQYA 2HT3D 4OLVH 4H0LB 4KXRA 1RUKH 4KP4A 1KYFA 4IBSA 3QO0B 5JW5B 2I60L 3K6OA 2YMTA 5L6YL 1M56C 1REIA 3RDTD 2Z4QA 3QAZC 5DFVD 3RG1C 3HG4A 5AVTB 2YLKA 3WIHA 2NY2B 3EDDA 4JGMA 2W8CA 4PJBF 4EB6B 2OMZB 2UZYB 2EDJA 4GMSH 2A83A 1RURH 3JWDC 2DQ3A 5E0QA 3FW6A 3PUCA 5SWZB 2VRAA 1NGZA 1U3HA 4PGEB 2X6MA 4QRUA 3TEWA 2VIRB 3MNWA 4UNUA 5EUOB 1S76D 2V37A 1U8IB 2X44D 1HHGA 4P2QE 4JKKA 4WENB 4OZFG 3GRGA 3V6OE 2X12A 4YN3A 3RJOA 5TD4A 4YHLL 1NC4D 5B7MA 1PCSA 4X4YA 1UA7A 1ID5I 1TETL 1E27A 1P7HL 5LXTB 3EFFA 4M6OL 4YK4B 1EGJL 3VFMB 5ADPH 3QWOA 4XVUD 5DMJB 2OMXA 5DHDA 3FB8B 3UQ8A 1PD6A 4OLXH 1JOYA 3FTGB 3QS3A 5HHNB 3S3SA 1V55B 3T04D 2GTWB 3D52A 2FH8A 2EH8H 1RIHH 4Z7UA 3SKMA 3ZDXB 1DQDL 5M7QA 4H8PA 2QSCL 3S8WA 3RWGA 2QMJA 3BPOC 5C0ND 4P59H 4RUEA 5DMGC 5EHFA 2R29A 1VF5B 1J9SA 4AUJA 1WP7A 5ANMA 3W5MA 3IFLL 1BZ9B 4XRCB 4FEMA 3QQNA 4MZ3A 1K8IB 1QI4A 3RTLA 3UBGA 4UQIM 1DQTA 1A1OA 4MBRA 4G1EA 3SPGA 2YBRA 1MCHA 2VDKL 3P3NA 4YY3B 3H9VA 2XXFA 1BHGA 3HAEA 5AL8A 5IOPA 1KMIZ 2CE4A 2F53A 3QIBB 2ZNIA 4L4TB 2AEPL 4YQXH 3IFNH 3ZKND 3H3BC 1LO0L 1TQBC 3L3IA 5CSZA 2RQ8A 4OLYL 3SD5A 1A32A 1HHIB 3A5VA 2ZWYA 2VXSL 3MA7A 1DLBA 5D5MA 5AVRB 3SO3C 2BERA 3TN0A 4I0XB 2CGZA 3OJDB 5IFHL 2KHAA 3K2UH 1JVKA 3VXSB 3F6JA 3BUYA 1L7TH 4R7DB 1NKRA 2QGNA 5CINL 5D4QA 1OGAD 3ESOA 4LLDA 3TN0C 3HIZA 1ZJAA 1XGUB 1RVFH 5CBGA 2DQEL 3V6FB 1AGDA 2HEPA 2ARJB 3LNHA 3CSTA 4KKBC 4MX7A 4O4HB 4NAJA 2Z31D 4L3EB 2K4AA 1IMHC 1ZT1B 5AW1B 5FHBH 5I18L 2LR4A 3KJ4B 1FXKA 4Y19B 3LKNA 4CU7A 5HJ3B 5GGQL 1HR0B 2CH8A 3K03A 3WS6A 4ZBMA 3OTOO 3VCLB 4JAUA 2DH3A 4J4PD 1FXKC 4UCSA 4PR5B 4QF1B 4D0DA 4EZJA 2X0LA 3WLBA 1VQ7V 5GJTL 5I0ZA 5EU5B 3NGBC 1PZ5A 4N8UA 5CCKL 5KUMA 4HK3N 1G84A 1IBMB 1FFXB 2XQYG 3UP6A 3UTTA 2YGOA 1VP7A 5DHXB 2ZJSL 3WFHA 3SYQA 1T4KA 2DQMA 1CT8A 3S36L 3MV9D 4P4KD 5C0GB 1FIGH 3QORA 4UTBA 1IBDA 1A7QH 5E4OA 2W9LA 2Y5TA 4I85A 4F7CB 3MTRA 4GQQA 4GNKB 3WU1A 4A04A 2GTAA 4O2FA 4FZ8L 4LLYB 2Y7NA 1RMFL 4R6UA 1NTMH 4GYCB 3ZYIA 1NKOA 2KLTA 4FNRA 3EGXB 4WI5A 3WI9A 5L0QB 3GSVB 1QLFA 4XBMA 5DJDB 2K78A 2UWEF 4LNUA 3P4MB 3IGAB 1FL5A 4ZUWA 3RUGE 1UH4A 2AEQH 3L7EA 4GW5A 1YY9C 4PJGF 1QWUA 3TO2B 4XN4A 3T0AA 4XMKH 2Z0UA 4AIZB 3VOUA 5F71A 2ERJB 4PS8A 2NR5A 1FNFA 1GCYA 3FOMB 1U92B 2X1XR 1CLZH 4JGSA 2H47C 1GSMA 3CFUA 1ND0B 4RAVB 1NC2A 1SF9A 1TZOA 4P2AA 2B5IB 2FYYB 1LO4H 5F9WC 2ZUTA 3MUGB 2PF4E 5SWQA 4PLKC 4JO5A 1Q0YH 5DJXB 1NAML 1ZE3H 3TBWA 1Y76A 5IYCO 3L6FB 4ZRGA 4NX0A 3U6XA 4FQHB 5SV4A 3VFUB 1NANH 4I0KA 3IWUA 3UCQA 2CXGA 1PIGA 1WO2A 2Y07H 3MRDB 4WGVB 5K9OB 3D30A 3WFBL 1S78C 5GGSA 4NQCB 5E6IA 3R8BB 1I8KB 2FLRT 1LE9A 2X4QA 4NXNB 3Q9QA 4HMDA 4V11A 2UUCO 2TSAA 5DUPH 1W8OA 1WZAA 4YXHH 2QWQB 2B1HH 4PRNB 1NIAA 5E6IC 3IF1A 3NJKA 4ZI7A 2CBMA 1UM5H 2DPKA 4LOEA 2DYPB 2V5YA 1UCTA 3X12B 4GAJH 2DMXA 3SKOA 3QK0A 4F2ME 3DVGB 3NEXA 4MJ5A 4X7EC 4OCSH 1KELL 3GSXA 3KS0H 3CD4A 3DRQB 4P9MH 4YZFF 4BK8A 4NB7A 4YGVA 4CS4A 5I9QC 4PH8A 4N1EA 5IQMA 5EH1A 1K3EA 1JERA 1NOFA 1ZD6A 2F18A 4H8WC 3ZL4L 1UG9A 5ERWA 2YS8A 2Q2LA 2BVYA 1BD2D 3VJ6A 2BIOA 3HBZA 3KYMA 5FHAL 5DSCB 2VLKB 1A22B 1FYTB 1NWOA 3FB7A 4LO9A 1MCLA 2X4NB 2IU0A 1DZ0A 3FUDA 4PQXA 3U7AA 4FFTA 1OE1A 3HMWH 4L8BB 5EBLB 1Q94B 3LEXA 2WUCH 4C8XA 5D6DC 3FB7C 1FFQA 4XC1H 1OLZA 2XZAH 1QLRA 4X66O 3MTXA 4D7TA 3WIIL 3PIQA 5GRYA 4NUJA 3QEUA 3QI9D 1LK2B 1BQHG 4N2MA 4PJCE 1FBIL 3CZLA 1FJGO 5AB2A 1XNRB 1T3FB 4RRPA 5KN5A 3QYNA 3RBGA 5IMLB 3KBFA 1JGLH 1VSCA 2A9ML 3JQOB 1ZHBA 1WD8A 3NCJH 4JHWL 3QHFH 5GRUL 5H8DA 1ZHNA 1DJIA 4X88A 1LO2H 4X1YA 2OQJB 4RGOH 5FGCE 2Z8VC 3MLUL 4BFOA 4WTWA 1ZT7B 2CO1A 4MQXC 1HILA 2BY1A 3QDJE 2VRQA 3ZUCA 3SHSA 5EO1B 2UX6A 2V5MA 4PJIE 3ZDZB 4UB0H 1BECA 4KXAA 1FGVH 2XNDG 3LN9A 3HUJF 3U1SL 2ZKHL 3GIZL 1EUUA 3D2UB 5FM5M 3LN4B 4XVOA 3RDJA 5J06A 3IFXA 1HNFA 4RIRA 1JA8A 1NFIB 3LQZB 5CBAA 3U36B 3NCWA 4NZUL 2DKMA 4HLJA 3QULB 4LOFA 4MQ7A 1RIUL 3ULVE 3I5DA 3F7PC 1FZJB 5FO8A 2AEWA 5ID0A 4LARH 2GSMB 2J57A 3FTYA 1U30A 1X4XA 2LLGA 4L29B 4AM0B 3X1GA 3MRJB 2WW8A 2GHYA 1YPZB 3SSGA 4OZ4A 3SDXF 3JV6B 3UAAA 4Y8AA 2OW6A 5TDPB 3ULSA 2WJ5A 4B27A 1PLGL 1KCSL 3MRKB 3MJWA 1MFUA 3PWUA 3OJMB 4IIQA 2Z7ZA 2OL3H 2FCBA 4O9HL 3RVWC 1G9NL 2D03L 4BWWA 3FCBA 3FUEA 2UV3A 3PJNA 1T03L 2G9HA 1YMMD 4CH3A 5AENA 3RNQA 2F93B 1OCOB 1YEIH 4WAFA 5DD5L 3QQDB 3JYCA 2A79B 3BZDA 4JZNB 1JGUH 2Y0SA 4Y4KB 4IRSD 5PAZA 5I76A 3BP4B 2WVVB 3N85H 1T21A 2P28B 4GSUA 4DGVL 4Q56A 2PPEA 1RZGB 3IRZA 1CXKA 3UAJC 3V0JA 3RYCA 1TU2B 3CN2A 3O8XC 1WA2X 2PO6D 3FQ1A 3S5LB 3RZCB 5LDUA 3GWKC 5IROD 3QJTB 1HXYB 1IV8A 1SQPH 3BVDB 2BCMA 3GM8A 3PPEA 2JKNA 4D9RE 5DDHA 1AOZA 2PWEA 2AJYH 1HIML 2W0FA 2Y3NA 4IYHA 3UZVA 4D9QE 3NK4A 2DWDB 1O9HA 4WHTB 4XPTH 4JHUA 4K73A 4LRIA 2EO9A 1Z9MA 1U6AH 2W0FC 2FL5A 2YUVA 5DXWA 4FTVD 2EECA 4YUEL 4FG4A 4HS6B 5GHWL 2H1LM 1E9PB 1U8MB 5E8OB 1SY6A 3VW3H 1V05A 7FABL 3H9ZA 4XNDA 1MUJB 5F1IA 2AQNA 1NGQL 3GEFA 3E22B 5JPMB 2PXYC 4DGYH 3MMEA 3IMUA 4OCRH 3H0TB 4Q9QL 3PNWA 4YNYA 3LH9A 5D70H 1BMZA 2AKRA 5CGYD 4XHJD 2TRYA 2A06H 5AOMA 5FXCH 1YJDH 3NP3A 4MJ6B 3EGSB 5FUOH 3WO4B 1KEML 4OFIA 5MP6H 2VWKA 5I1CL 3ZMSA 4NLAA 4JI1B 4JFOA 1DEEA 1T2XA 1ZJBA 4X98A 3N3EA 3AROA 4NKIH 4GT1A 3JD1A 4ONFL 4RMRA 1RAMA 4LEXH 2YPLB 3CC2V 4JO8A 1J87A 3KJ6L 1C5BH 3KCWA 1KBPA 3NFPB 4HLEA 1SDAB 2ICWI 2X4TA 4P23B 4ABVA 1P4IH 4LSUH 3B7TA 3NR7A 2EILC 5M95B 3BJ91 2BHYA 4XMZA 3TTYA 4IOSA 3SDYL 2H8PB 3GPSA 4LHUG 4LMQE 2OP4L 4MRCA 3ESUF 2VXTL 5C9KA 2YSSB 4DUYO 5B1JA 2XWBB 1MCBA 3IRCA 1I75A 5D7JB 3CX5K 3FOLA 1MI5B 2Y3AA 1A9EB 2HRLA 5B1JC 5CJQL 3S35H 2VNCA 1M7DA 2F5AL 4HQQL 4U1HB 2EIBA 3MNVB 2D9CA 1S0VA 5B4MC 4R50A 3CHQA 5I75B 1KEGH 2VERA 3D0AA 2PR4L 3VXRA 5F6IB 3AQDA 4XBFA 3C6LD 4WFFD 3L1OL 3ENEA 2BSRB 1DSWA 5H94A 3U7YH 2RR3A 4F24A 2DQUL 5E8NB 5F7YC 4UUJC 2FB5A 3TWCL 4G71B 2G2PA 3WUZA 4AUYA 2DQ0A 3DX3A 4KJWC 2IPTL 3WBDA 4IK7A 1B4TA 4PJBA 3ROOB 3H9SE 2NY0C 3BP5A 2CAKA 4YAQB 4Y16B 4M6NL 2F7OA 3ES6B 4PWGA 3NJXA 3QUMH 2QHRL 2LW1A 4X62B 4ZAKB 4NM8H 1TZGH 3FU7A 3TYGL 3PGFL 1BREA 2YUAA 2Q2EB 1P7GA 2XAFA 3TLRA 1AHWB 1PW3A 3P4NA 4GRLA 5A2JH 1PNMA 3I6LD 3IBOA 2WINA 4WWKA 5E0FA 5GJSL 5DFWH 2BOLA 3D85A 2W81C 2BP8B 3BZFB 3F7VB 1HAWA 5CMUA 1VFBB 3OZ9L 2NY7L 3WY4A 4WWKC 3WG7B 2E5LO 3NJVA 3TA4D 2IAMD 3NG5A 5JDJA 1CE6A 2G60L 5DECA 3RFZC 3UEZA 7CGTA 2JIXD 4BZ2H 4ZPVA 2C3WA 4LLMB 5DA0B 1QEWA 1S7TA 5ALCL 2FBRA 4J7JA 1U8CA 3VRJA 4Z7WB 2Z8SA 2WXPA 3KVPA 2VERN 4JZJB 2C9SA 3G6JE 4G7QB 4Z7QF 3VFRB 2QADB 2WBJA 4KKQA 4FM2A 3ECWA 4YHHO 3Q5TA 1IIKA 3QF7A 2YPKB 1JGEB 3MRHB 4MDIB 4XWOD 2WBJC 3QO5A 3E35A 4X65O 3HRZA 4NC1C 3V0GA 2LTQB 3CFKB 4KXDA 3BT0A 1ZIAA 2OYKA 2AZUA 3WNIA 3OQRA 1OVZA 3HRZC 3CC7V 4QRQB 4LH7A 4RX4D 1PKQA 3BX7C 3WEAA 4YSDA 3WB1A 1SRYA 4XN7A 4F8PA 2WLLA 1RD6A 3NSDA 4M3JA 2J1WA 3JD4A 4FQXB 2VDNB 2VABB 4G8FB 3SKJL 4AK2A 4M7ZB 1VKXA 3CCEV 4QRRA 3J80N 1CZ8L 2X9ZA 1ZK5A 4LDLB 3I3BA 3W38A 2WO3B 5FNVB 4DR6B 5E2TH 1AXTL 3P4OA 2MRYA 4AMXA 3E2EA 1LJMA 3IRPX 4OGYH 1RCYA 4DETA 4UVCA 3QCTL 1Q43A 4HUNB 4KZCA 3PQYE 2BWIA 3OKMB 5EMYA 1AQMA 3O9WB 5I1LB 5H4YA 2ADQB 1AIFA 4NLHA 3FFCB 1AB3A 4UT6H 3B2PA 3VI4E 4KTEH 2JVUA 1S9XA 5FYKH 5C6PB 5DFAA 1KCLA 4O4LA 2YSTA 4TUYA 3GXIA 4FQ2L 5KX5A 1WSST 4LU5H 4QWWC 2ILMA 3RVUC 4ABUA 1JPEA 4RBPK 5HI4C 1A4KB 2Q4PA 3C5ZD 4DR7B 2FE0A 5K33A 1A7PH 3ZR6A 4DHLA 3EDFA 3CLEH 4L3FA 4GP5B 2QVKA 4Q52A 4JFDA 4BXVA 2X42A 3KPPB 5E4EC 3LY6A 2Z4QB 2MPVA 1WNSA 2K7PA 4WCYH 4Y5XB 3BVUA 4JNXA 5D1QE 5HHPA 2ZUQB 1X5AA 5AB0A 2FKXA 1ZLZA 1FO0L 2IXQB 1GOGA 4JKNA 5KW9L 1NPNA 3G6DL 5IT2L 2EJ7A 1ZE3C 3CCMV 3PV7A 1JHKH 1NGZB 5LMUB 1U3HB 1KN4H 3GBMH 3HRPA 1A9VA 3MLWH 2ZUYA 2NUTA 4YHYC 3M1BB 2UWEA 3O6FA 2W59A 3W2DL 1FLRL 4U3JB 1KJMA 2WLIB 4X7TA 5FCSH 5AZEH 3H42L 1MXGA 4PJGA 5GISH 3PGDA 1L9NA 3TJEH 3O6FC 1AAJA 2NTFB 2GJPA 2XJLA 3TX4A 4HIQA 4I2XE 2DLFH 2FTKA 2YA0A 4FQ1L 1L9RA 1IC5L 4X4YB 1RZ7L 1E27B 2FWSA 1SLXA 4YSEA 5HDBB 1SDYA 4D8OA 2E6JA 1JGVH 4ZOCA 1Y6XA 3RPIB 2DOSA 1MFBH 2ICEC 2Q86A 1CB4A 3V7AG 4YHNB 1PYWA 2HT4C 2FNBA 1LEKB 5DMKA 5F7HA 4XO3A 1K8DA 2XTJB 5IOKA 2Q68A 2XWTA 3MCKB 2Z0AA 1HFUA 2WBKA 1U8QB 1A7OL 5GXBB 4C55A 1J5OH 1CICA 3GRWA 2EIJC 2XA8H 3ELAT 5EU6D 1DZBA 3GUTA 3I75B 3WKML 5I5MA 5ANMB 2NLJB 4L87A 1BOGA 1CFQB 1F5WA 3JBG7 3BDXA 1A0QL 2WCSA 1RH8A 4HFWA 4G1EB 2YBRB 4XXDB 1QUPA 3IDJA 3SPVB 1WV7T 1YYLH 3MFGB 2VZTA 3HAEB 2HVBA 2EKSA 3K1KC 1ORSA 5I2IA 2F53B 5L2KD 1SERA 2XQYA 3GKZA 3LIZH 4FHBD 4KTGA 4CGTA 1NLDH 2BP5M 1G7QA 5DJAB 3OKNB 1MLCA 3X13A 1EZVY 3JAKA 5HFMA 3S4SG 1N5AB 4A7GF 4B53A 5D1ZI 5B1NA 4JFYA 1QR4A 1S9WB 3SE9H 1MHCB 3BPNC 1YNLH 1K5WA 2J2ZB 4LFHD 3K7UA 5AZUA 4GQZA 1US6A 1AZBA 4DR4O 2HN7A 3A0OA 4LLDB 3TYFB 4GXFA 5DUMH 3Q1SH 1QBLL 3MRBA 1IQWL 1N6VA 1M5IA 3QDME 4ZTEA 4DZBA 1HE8A 2CPUA 4FTDA 4H8QA 4YHZL 3GSUA 3WIFA 2DWTA 4XCFL 3T77B 2OSYA 3LKNB 3F85A 1MJJA 1OCCB 3ZHSA 2Y36L 5B1CA 1T0MB 2AJ3A 3T2LA 3PPSA 4AOFA 4JCMA 1OK8A 5F9JA 2X2HA 3S34L 4D0DB 1DF4A 1NIEA 4RGNC 1DN0B 3A4AA 2VUOA 1EO8L 2VE6A 2O6CA 2V9RA 3NIGF 4FQIH 4LLQB 4M1DL 3SJVE 3C2AL 5CO1A 3O4LB 5B1AC 4JDTL 2R4RL 1J1XH 3GXTA 4NKMB 1RZFH 4NS0A 4IKNA 1NM9A 1X7QA 1CT8B 2BNQA 4R4ND 4NCC2 4JRYB 2VAJA 3QORB 2OTUB 4IKKA 4M7KH 5K9QI 3M99B 4YSCA 3O6LL 2YI8A 2WMPA 4FZEL 3T9WA 1E3FA 5C86A 2DI8A 3LZOA 5GGVL 3HUJA 1BP3B 4YOKA 3ZY7A 4KMTL 4N22A 1JCKA 3AITA 4URTB 4BQ6A 4ZI8A 4Z95H 4X5LA 3U30B 4H0LC 1JPFB 3VXUA 5T1MA 4H88L 1S46A 1F02I 1E6OL 3D07A 4M7JH 4LPVA 2R7EB 3K72B 2Z91B 1YC7A 1WWWX 3SDXA 4IIZA 3HNTL 1T2QH 4UQ2A 2UXCO 3E1F1 1ZS8A 5IB4B 1SKVA 4QE9A 4LPWA 1SQQH 5SWQB 4C83B 3UTSA 5ACZA 3PJSK 3BUTA 1TJMA 2NSXA 1Y76B 3AB0B 3LD8B 4Y1AA 3RJQB 3BYTA 3SBWA 2DJMA 3WFCL 5LCVL 4Y7MA 1YAZA 2YGNA 3LRHA 4OGZA 5TE7L 1BJ1H 2YA1A 3KPOA 5C07A 3SBWC 2JJ2G 1BGYH 5B1OA 4HKXA 4KKCC 4CGUB 3NIFB 4B0MB 2Y4SA 4XOEA 2X4QB 1DLHA 2CE6A 2QVMA 2V2XA 1D6VH 3WJMB 3S8GB 1I7TB 1J95A 4P48A 5J1AA 3IF1B 4M4PA 2WQUA 3ZMEA 1QG3A 4LSTH 3BEVB 4I9WA 4Y2OB 1MJ8H 2ZP0T 2V17L 1MFCH 1NH2D 4DVRL 4W9JC 1YJDC 4FULA 1A9BB 2K9UA 3GSXB 5IK3B 1JRHI 2YMOA 3PGCA 4D6TH 3F3HA 4CBCA 2FHBA 4U1SB 3ILPB 3FJTA 1CR9H 4V1DD 5CUSL 3HKFA 1XL6A 5E03A 4LF6B 5DC9B 1B3IA 5ICYB 2IH9A 5DHYA 1YEGH 5EIBD 3FQ2A 4IRJD 2HB0A 3S3BB 5CILH 3ESPA 5FA3A 3SGDH 1KJ2B 5GS1C 3NZHL 1KLUA 4TUJA 1B9ZA 3AG2B 3H3KA 1IXMA 3K6IA 2VC2H 4AITA 1DUZB 3DDFA 4J3XA 5J4MA 2APSA 3B77A 4ZQKA 3FUKA 3QIBC 3K5NA 2PWGA 4WUUA 2QWRB 3QEUB 4KQ4H 3K6FA 2VDPB 3E6HA 4YX2L 2FNWA 1BX2B 3CDFA 3DTXA 2DWYA 1F51A 3BWUF 2GK0B 1B0WA 3Q8FA 2PLTA 1FQ9C 3A67H 3W56A 3UC0L 1XF3B 3PLYA 3F5TA 1AR1C 4NQVB 3LH2H 2X4OB 4Y9FA 1HYSD 5T1LA 1T5XA 3KEDA 1G9HA 5ESVA 3K3QA 4PJ5A 3VGAB 4LCWA 3FZUC 1EHAA 3GXDA 2QPEB 5E1IA 3V5KB 3RJDA 5CN1A 3VQWA 3GDBA 1SA0B 3OVUB 5G5DB 4XWGL 3UDWC 4ANKA 1UZ6E 3UM7A 1PX8A 5CN2A 5I0YA 1Z0MA 5I16A 2WY3B 1NGPH 1F42A 2FEEI 3TL5A 2ZWSA 5BZWB 4BZ1H 3ULUC 5FYJH 4HCRH 5HDQH 4JN2B 3QO7A 4RIRB 4KTDL 4XC3L 1BF5A 3IDIA 1EN6A 3H1KH 2LFGA 2BFVH 4L5FH 3SGIA 1PPIA 4E5XA 3EOBA 4UQ3B 2XV2A 5FV2A 4TN9A 4X80H 3T4YA 1QRNE 2ZG1A 1MLBA 1KXVA 2DMKA 5IESL 4YXWG 5T33L 1IEHA 1ADWA 1IBBA 5TDNA 2PI4A 3C09C 1IT9L 3VGFA 3QNZA 3QWNA 3X11A 1CE1H 2D0GA 3IKCB 4OCWH 4ZUUA 4AQYO 2ZKMX 4UOQA 1L0YA 3OHXA 2ITDB 4IIQB 4DP6X 3F12B 2WOBA 3IFPB 2IBZH 3C6EA 4BGLA 3L5XH 1RZIB 3OHXC 4NT6B 3LUTB 2V7HB 3PJSB 2G9HB 4PV8B 4NAQA 3VX0A 1TYRA 4IYKA 5D71L 3RNQB 4D7BA 5ACLA 5I73B 3KYOB 4OZGE 1QEXA 3RWFB 2Q6AA 3D3VA 3WB0A 2ERJC 4ALAH 4JPKL 4JHZA 4JZGA 4UAOB 4X4ZA 3SDDA 3GJFK 2Y25A 3VFSA 5C7XL 5TGBA 2E6QA 1QNZL 1NPJA 2E7BA 2ZNJA 2VITA 4PCSA 3SDDC 4ZS7L 1DTOA 1A1MA 1AY1H 1E4HA 2DIAA 4Y0GA 3VAEA 3VYOA 5CD5D 3PS6A 1HL9A 4JFED 5EK0A 1K5NA 4PJ0Z 1RPRA 5LXGH 4X64B 2FMLA 1I9IH 1GC1H 3PXHA 4FP8L 1U0QA 2CO7B 5C0CA 3CK0H 2G5UA 4YHPA 4QD2E 1BAFH 4PYGA 1EFXA 2J1KA 3O3BB 3OW2U 2UZIH 3T6WA 5IVOA 2FL5B 5ECJE 3TIEA 3CH8A 1N0NA 3VMOA 3OAZH 5EU7E 1XQ4A 1AZUA 1U3NA 3TT3H 1YJWV 1QU7A 2BSSA 5BS0E 4JS7A 2GJRA 1JP5A 4QLRA 1MSWD 1L0NH 2ATPA 3RHWF 4RISL 4U2ZA 1MSDA 4FN0A 3PNWB 1GN3A 1AJQA 4GG6F 3AAZA 4NQDD 3RIFF 5AAWA 4UT6A 4WTQA 1UD2A 4FCAA 2YD4A 4KWUA 4CSTA 4CILA 4JV5B 4LKXA 3WN5B 2EC9T 5AAWC 3MRIB 4ZW5A 3K71A 2FWOB 4LH6A 2A9DA 4LDOB 4AQEA 4MWFB 1ANUA 4ZYKB 5BZDA 3GMLA 1NC4B 1NCDH 1OXYA 4KK9C 2HHHB 3DIDA 2C9XA 5I8OH 1PNCA 2HFFB 2X4TB 2QMKA 1TEGA 2EYSA 4UT7H 1IFHH 5DEZA 1LHZA 5KSUA 2VLRE 4P3DB 5E6UB 1FFTB 1ASQA 3NCMA 4ODWA 3WSQH 2X53A 2ITEA 4X7CC 1JFFA 1GS6X 2FX9L 3TO4A 1VCAA 3MUZ1 4UQAA 2EINC 1S77D 4AK1A 1O75A 4PJEF 4Y1TA 4HV8A 3KZIZ 4MFHA 3FOLB 1NKGA 2LU5A 1SHWA 4JRXD 3JWNH 5IVZB 3DVIA 2OMYA 4X8CA 1Q9LA 2X7RB 4J3BA 5DD1L 2OMWA 2C9VA 4YO0A 2E76C 2YEQA 2BSTB 1M7DB 2NSMA 4G6AC 4XBEH 4QPEA 4HNAA 4HUUA 2AGJH 3Q6GL 3NZSA 4LFAO 1PKOA 5DLLA 1KC8W 1XIWA 2GBTA 3MLYH 4Y7OC 3V0WH 5E8DL 4JK0D 4I3SH 4CKQA 2O57A 3FQ4A 4M4RA 1T5WA 3P30H 3T3PF 2ZOUA 3UGUA 3UTQA 2EKJA 1KENH 3QZWB 1XIWC 4RDQF 1DANT 5ALBH 4N0UB 5F44A 1K73W 1URIA 4IMLA 4PJBB 3X1BA 4AT6A 4FABH 1PZAA 5CP3H 3D4CA 1JN6A 4MCNA 4DP1X 4PY7B 1ZHKA 1OGAB 3E7JA 1YMHA 3GJFB 4X9BA 5GS3A 4M9OA 3W0WD 3FUNA 2GIYA 3VRLF 1SHXA 2AJUL 4XP1H 1H5BA 1HKLH 4NZRH 4Q6KA 1BF8A 1D5IL 3UEQA 2APBA 3P4NB 3ZHRA 2CZNA 3HZKB 2WINB 3KPLA 4NB5A 3HI1B 2W65A 3JTSB 2CR3A 4PJAF 4X9QA 1J05A 2IWFA 3OAYH 2VUYA 2Q1EA 5FCUH 4KZDL 2YFNA 1N0XH 3LIZA 2OMBA 5KOVC 4GT0A 4DV1O 3ASNB 2A3QA 1DBAH 1JNJA 4HF5L 4PRPE 3LZQA 4QRBA 4F37F 1Q8IA 2DQ6A 1UXMA 5FA4A 2AHZA 3WMPA 4PJXE 3UJIL 3RTQD 3BE1L 3OB0K 5L3GA 1HH6B 4J10A 5CCHE 2AK4E 1FZMB 1QFPA 4P5TA 1ETZA 1L0PA 3MV9B 5KBKA 2GUOA 4JHVA 4G6KH 5L3FA 4ZMVA 3V4VB 3ZDYE 1I94O 2YXHA 2R2EA 4XP4H 4CBZA 3HKEB 1JMZA 1SJEA 2BZCA 1ASOA 2BVPB 3A8TA 3SE8L 3UPRA 1A1NA 3QJVB 5E95B 1XD0A 3MOAL 4NUGH 5E2UL 4CSZA 2BMKA 4PMFA 4WNQA 2BZ7A 4UWQB 4X7DC 1Q81W 5JQIB 2OMNA 2DQIH 3K8KA 3N5AA 3MU3A 5C0AD 3L7FB 2V2WA 2RCVA 1F23A 1Q9WA 2XQYK 1JHLL 3FBKA 5IV2A 3LRKA 3TH3T 3C8DA 1NINA 1XCQA 2A6KA 2RJZA 2YJQA 1RUAH 2OM5A 4KRPC 4A7GA 5C0DB 1IVLA 3FB6B 5MEQA 4Z7NE 4YHMH 3CZJA 3DTDA 1FCCA 1S7SB 1HSBA 5IEHB 2D7TH 5HYJE 1MIML 1SYSA 1KC5L 3VH8A 5INDB 1G1OA 2VN5A 4BFEA 5FFGA 4QRPD 4LPTA 2PP9A 4QXVA 4M48H 1OE3A 1TUEB 5DO2C 2I5YL 1FZKB 3MNDA 4BFNA 4IIJA 2YKLH 3KAAA 1LO3H 3AXLB 4OZFB 2GFBB 2IQ9H 3MO1B 1RK0A 3F7QA 2W94A 4MAUH 1NFDF 4PPTA 4AMKL 4WFGA 4ONGH 5E9DD 1I8UA 3QFDB 4MCYA 3CQFA 3LSOA 4KI5F 3S37L 1UB5B 2KI6A 1X4ZA 5HJDA 4GRWH 5IBLC 3TIDA 2CKNA 3TJHD 3PWPE 4JFDB 1FV1B 4UXNA 3QWRD 4F33A 4FQQA 5I1GL 3HE6C 2AK1H 4HXAH 2QZQA 5D7JC 3MX0A 5F1OB 2BNRD 4ZDHA 4KKPA 4M62L 1K4CB 5HHPB 5LBSL 1BD2B 1IAOA 2F5BL 5KHIA 1N32O 1IGCH 2BC4B 4BIUA 2D0HA 2W95A 4JKPH 3CPLB 3AZUA 3LJ3A 3DARA 4NWTH 2AEOA 2DWEC 1Q1PA 5LGKA 4B0MM 3HC4L 1N3NB 1OCZB 1RSYA 2K0RA 5F6IC 2WQXA 1BCCH 1V54C 3CYOA 3II1A 1KCUH 2YEVA 4NEHB 1TTAA 3MV01 1KCKA 3HHSB 4UU9B 1KGUA 3EW3B 4YDKH 3AS1A 1F58L 4ZKIA 2Y7QA 1D3CA 3L3DA 4TQDA 1BFSA 3I2CH 3M1OA 1TENA 2IANA 2LHAA 3VM7A 2FQEA 3NFSH 4N0FA 1ESOA 1I3GH 3R0NA 5HVHC 4IBUA 3RA7H 4FQLH 5C70A 5ICZA 3N2GA 4AC2A 3L4WA 1G6VK 1PYWB 3A2FA 3BY6A 2VDLB 3MNZA 4K3EL 4UILH 1Q0XL 4IBYA 4KDWA 5DMKB 2KS0A 3W81A 4CC5A 5KJRL 2VDNL 5EC2C 1K8DB 2B4CH 3NABH 2X6AA 5CGTA 1SUJA 4KQ3L 5BUPA 1T7VA 3DXRB 1E8YA 1KGXA 2UX7A 4ZNEE 3F7VC 5JHDD 1S7VB 1XSOA 5IJ9A 4U1NA 4BJLA 2F0CA 3GUTB 1ZUQA 3P54A 2AJZA 2WANA 1R75A 3GUFA 1BOGB 4L9DA 4X42A 4ERSL 5J2TB 5D1XA 5AOZA 5JA8B 4AKOA 3ZMVA 3D48R 1CL7I 1GVIA 3OXSA 4MNGB 5GGRY 2CO3A 4RWYL 4MA3A 2AQRA 4X99B 2D2CB 1G7QB 3IDYC 4G8GD 1MLCB 1CF8L 3X13B 5KVMC 3JAKB 3RQ3A 3ZE0E 1SZTA 1R1BA 1NIFA 3S97C 3T65A 3RFRA 1QASA 4DR3O 4LF9O 1F6AA 2Y23A 3WY1A 3SYOA 4TQHA 3EJCA 1AR2A 3B6SA 2XWXA 5AW6B 2LTQC 1QPXA 1N59A 3MRBB 3E80A 3JT2A 3QCUH 3FHQA 2ICCA 3A22A 5LA6A 2XYCA 1FNLA 3R4RA 4HCRA 5EULV 3WIHL 1RZKL 1UCBH 3OXRB 4F8LA 1BMGA 2I7OA 5D2LB 2EVJA 5AB9A 4JY6A 5BV7B 1CD8A 1EV2E 4E36A 5JA9A 1DBMH 4IRSB 3CAFA 2JGDA 2HRGA 5CJXC 1VEMA 3EGDA 4M7ZC 5HI3D 3F2LA 1DVFD 4L0YA 4IOIB 1WD9A 5EEZA 4NUMA 3BWUC 4Z3HA 2AANA 2XRAH 2PO6B 4B96A 1M05B 1GY1A 1H8OA 3OLEA 1HCVA 3OTOB 2CJSA 4Q4EA 5AVZB 4MS8C 2R0WH 1N68A 2BNQB 1Q6IA 3O9WC 2K7QA 2R69A 5L4IA 1Y6KR 3GHEH 3PP4L 1NANI 2QTEA 1E6JL 1U8KB 5FYLD 4C4KT 3ECBA 3K3WA 2VL4A 1XD1A 3HUJB 3ARED 4FTVB 2A4ZA 4XVJL 1SF5A 1XMEB 3VQ2C 4DGIH 5EF2A 1QVGU 3NJMA 2HKHL 2N7BA 1BLIA 3IU3A 2EADA 5GZNA 4HUXA 4WO4A 2MEJB 3B40A 4ALAC 3VXUB 3BAAA 1NCOA 3FFDA 2WTRA 1TT6A 5C6TH 5IUCA 4JBSA 1MW0A 2R29L 3KW7A 1BFOA 5GZNC 2VSDA 3MRMA 5LWYH 1KT2A 2XDHA 4ZG1A 3ZT6A 5J9PB 4J1UA 5F7EL 1FN4B 4NI3A 1L7IH 3SDCA 4M8RA 3SDXB 3OF6D 4K71C 4RFEA 4N24A 1UFIA 1OL0A 4AJVA 1S6NA 2K6ZA 1GC1C 3BUQA 1DQJB 5T8IA 5AAMA 3ZIYA 2A7WA 4PV9A 3UTSB 4BRVA 2R0KL 4Y1AB 2KZBA 5C0BE 3RWJA 3B56A 2EJRA 3WDIA 4PJFF 4YIOA 3TBTA 1G1CA 4ZUSA 3OM3B 3DVFA 1TJGL 5HGBB 1YJ9V 4KX9A 5TH2B 4PLNC 1JSYA 1YC8A 4HKXB 4NIKB 5TQ2H 1BQHB 4DN3H 2XN0A 5FWQA 5HGHA 3W82A 4PDVA 4HFUL 1AGBB 2V2XB 4K7PH 2H6OA 3TVMC 3L1EA 2YD7A 1JV5A 5C8JB 2I26N 2A9NL 4MSWA 2C3VB 5KVGE 2PTTA 2R8SL 2E4FA 2IJIA 3FTSA 2V9QA 4FZ0A 2VW7A 4GXVL 4Y5YA 2ADFH 2QWOB 4KOBA 3QAQA 1YN7B 2WZPA 2UUCB 4PY8J 3WAKA 3ZZ1A 4RFNB 3GB7A 2JQMA 4Y5YC 3ATEA 1DR9A 3VTTA 3VD7A 2X70A 1ZLWH 3M7OA 3MV7A 5I6MA 3D4ZA 5B3SB 1QWHA 4PGDA 3DHJA 3BKYH 3DC0A 3GB7C 3C6LB 4TNEA 3WKQA 1RV6X 5FA3B 1HINH 2NLJC 2FSDA 4ODXB 1PZCA 3KPSE 4JFHD 2HJKA 3PABA 3ZU8A 3GHBH 4FHKA 4UTBL 4NJ9L 3E2HC 3MBXH 4OIFA 3CNKA 3S36X 3LQAH 3OGCB 1AS7A 3ZRVA 3CVIH 5AZ2H 4N90E 2J3SA 4ZQKB 2HG5A 3LN5A 4JHBA 1A21A 5J5EA 3G6AA 4GG6A 3OX8A 2X2YA 2Z93A 4POZD 5KS9F 2I7SA 5C0IB 1I8IA 1JXDA 5FB8A 3CC5A 1XMQO 1QSED 3DTXB 4YC2B 5K39A 2J72A 4IOFD 3BXNA 4GX1A 1PDKB 2C3XA 2MWCA 3LS5L 1KZYA 4PP1D 2X1WL 2CO6A 4Z0BH 3MGAA 4EMZA 3ZTJG 3LZPA 3JWNC 4NBXB 1IAMA 3EZ8A 5SWSE 1S9KC 2BVQA 1FJGB 2JIZG 2IW5A 1V10A 4DUWA 3ZMZA 5ESVB 4LF7O 3QQ3B 4JX0A 1N67A 1Z7JA 3F6IA 3B8YA 4J3WA 1ZSDA 2WPDG 4LLWA 3LNFA 1A7RH 4PJ7F 1ORQB 2IAMB 3P73B 1W80A 3TBYB 1E7UA 3CFQA 1N64L 1R3JA 2HJFA 4NO2A 5DHMC 4IBQA 3BAEL 2PP7A 1RHFA 4PB9L 2JIXB 4U6VL 1ULVA 4WFAV 4BK4A 5L8JB 5CP3A 2HJFC 5CCJA 4QTIL 3N43F 3HJEA 4HS3B 1SOXA 3BD5A 4PJEA 2HVJB 4WI0B 1L4IA 1J8KA 5CEZE 2HJLB 3JALA 5HHVL 2EXYC 2VN7A 3DWTA 3PP3K 1LD9A 3DJSA 5T1KD 4AQOA 1YNTB 3QCVH 1INQA 5EO9A 1CD1B 3T4YB 3IE9A 1AQDA 2XQ0A 4FFWC 3GF8A 4E2LA 4BFGA 3H9YA 6FABL 3GYRA 2YRZA 3UTOA 2GIXA 3ABKB 1MIEL 3EOTL 5I1JH 3NYKA 1ZDSA 4DJMA 4QPJA 1CGYA 1PLAA 4ZUUB 1QFOA 4TV8A 1W0VA 1ZVSB 5D7SH 3KKYA 2N74A 2WA3A 5F7DB 1H3TA 3N55A 4OBSA 5L3DA 1S5IL 4NYLA 2CMRH 3HS8A 4Z7UE 4LSVH 1H3PH 2A6IA 3F7RA 4FFYH 2VB5A 3D4YA 3U48A 5GZOD 4X4MA 4Q6IB 1B2WL 1F90L 4WI8A 1NMAH 4M03A 4IBLT 3WUWG 4ELKA 1L9OA 1NGXA 1A2YB 3KBPA 4EUPH 2P5OA 1QLEH 1FORH 3B9KC 2W9DH 1LM8V 3BGFB 1QO3A 5A2QN 1WAZA 1HHJB 1BBDH 4TSFG 1K5NB 3KYKL 1CI3M 1DVUA 3PL6D 1A7BA 3RYIA 3QG7H 4KUZH 4PJAA 3IU4H 2CDYA 3N50A 2Z8WC 3GMNA 4UV7L 4FYSA 5HHOE 4M7LL 3C5ZB 5D5ME 4QJFB 1KTKE 1OY3B 1EFXB 1CWVA 1Q1JH 2EQDA 3SY0A 4JGNA 4ODTL 1M9WA 4LHUB 2OSWA 1MJ7L 1USQA 3QZMA 2IWGA 3CJJA 1RZPA 2X2JA 4RMUA 2BSSB 1S7QB 1GGYA 2JLLA 5G4NA 1UT9A 4P04A 4A7UA 1CIUA 2EYTA 4OLWL 4Z7QB 5BMVA 2W38A 2CLVA 3ZJAA 2HR3A 3S3WA 3S8FB 1MCRA 1YEKL 1VGKB 3AAZB 1IKNA 1OTTD 1OW0A 4IEFB 2XN2A 3DUUB 4ZFOA 4BDVA 1TQTA 2XOTA 2MW2B 3KWXA 5BOJA 4R90H 1XX9C 2HX8A 4CH4A 2CGRH 3X3GL 1GAFL 1RSOB 3QPXL 5CN3A 3SOBH 1OW0C 5IMKB 2I07A 5IMMB 1HJCA 4IKLA 4CH6A 3C08H 4PYHA 5JOFA 3TV3L 4HLZG 2R4SL 1O7VA 4W9LC 2RTTA 4NKOB 2XV6B 1WQVT 1HQ4B 4X6EA 3UTTE 4W4OC 2NY6C 3ICXA 4YL4A 3GMLB 5G55A 2ZYIA 2EUXA 4XPHH 2UVFA 4FCHA 4XP9H 3I6KB 1QW9A 3O3UN 4ZFZB 5I6PA 2W6IG 4GBXC 5AKTA 4CVZB 2DMHA 3HKZA 1U4FA 4RDBA 3UO1H 2EYSB 1Q6UA 1C5CH 1ACYL 3C60D 4OI9A 1OP5K 3T3ME 3CZSA 4P2QD 3OSVA 4RZCA 2AQ2A 5DYOA 1JZ8A 1KXHA 3C12A 1LL1A 4BIOA 2MKWA 2P90A 2CCLA 3KYNB 3LKPB 1JFFB 3HC0B 4KVPA 2XXGA 3EBHA 1YEFH 4A38A 4QHKI 1ZIBA 4JY4A 4WFHA 3ZTEA 3NPSC 4K5MA 3CVHB 2WXRA 2DLGA 3VGAC 2QPSA 4X6CB 5FLXN 2CK2A 2WTOA 3J27A 4AQ1B 3IS0X 1NFDA 2OMWB 4YO0B 3JVGA 4DUYB 2YIDA 2QKIB 4LNVA 5D7IB 4GO6B 3MJ6A 5I74C 4HNAB 4B97A 2B0SL 1AI1H 4NQEA 2GQHA 3GKWH 4PGZA 3T0ED 4FLXA 3HHRB 3V52L 5LQBL 3AWGA 3JVGC 1U8OA 3ZE1F 1MRCL 1P9MC 5GRWA 3G9AB 4M4RB 3G5YA 2AJVL 5L2KB 3WXWL 1KGWA 2MQ3A 3U0TB 1JYXA 1ZA3B 1VLXA 43C9A 3L3KA 4AH2A 1I85A 2C34A 4IMLB 4JPQA 5CJ8A 4N2FA 2CTWA 3JV0A 3HNVH 4F8OA 2V5RA 5L9DH 1MSPA 1UA6H 3BDYH 4OD3L 4G70B 5D6CB 1OPOA 5TE6H 6CGTA 1MZEA 4MD4A 5IB1A 1SY6L 4YSSA 1F4MA 4IYIA 3RUGF 2B4CC 1Q7YW 3AS3A 4NQUA 3A47A 4R8CA 3R1GL 4MKMA 2D73A 3U7WH 2IDTA 3UYRL 1HXMA 3N40F 2WNXA 3FYEB 2OJEA 4JY5L 4DZ8A 4ENED 4H1LG 3DO7A 3THML 3VWJD 4K8ZA 1KCBA 3KPLB 4NHUA 4DYLA 3CRMA 5JPNA 1E43A 2W65B 2VDMH 1KWKA 2Z5UA 4FXLA 2AGAA 3DETC 2QV4A 5EOCH 4JR9H 3X14B 1UWEL 5D5PA 5ETUB 2VQUA 1XGPA 1B2YA 2R1WA 2CRZA 4LSPH 2Q76B 4YVUA 5FA4B 4TTDC 2GABA 3EJZD 2LGWA 4CN4A 5J8OA 3FPXA 1RUKL 4ECNA 3L45A 4PG9A 5I1DA 2YD8A 2E5LB 1B90A 5K1JA 4Z1MG 2WIIB 1Z9SA 1LMIA 2UXBO 4B7IA 3WKNA 1ETZB 3Q5YA 4C4BA 1XGTB 3AG4B 2OTWB 4R2GD 5TE4L 1CFVH 3FO0H 4EO5A 5ESQA 1AGCB 3UMNA 2KUTA 3SZKC 2BVUA 1GRJA 1FD9A 1IX9A 1S7WA 1SJEB 4GMSL 2I9TB 1EN5A 3NJGA 3RVTD 3VQVA 2BXYA 1A1NB 4KX8A 3ABLB 3H6AA 4TLUA 5I1AB 5DLML 3LXUX 2EDWA 4V2CB 3JD3A 2YMXH 3HB3C 3U9UA 5EEVA 2BRRH 4ODSH 1E5ZA 4YHHB 3IGLA 1FGNL 1NQBA 3ZVVA 4N4YB 1Q9WB 5C0JB 3QHTC 3K4DA 4X65B 3RDTC 4BM7A 1XCQB 4CU8A 3DX7A 4B9JA 4X8JA 1IQDB 1JVOA 4LCCB 2K9FB 4OCYL 3LB6D 2V33A 2Z34A 5MEQB 4A39A 2NY3B 4JPRA 5FGSA 3SIKA 2IG2H 2KZWA 4TF4A 4LVNB 1DO6A 5EBGA 4OLXL 4LSQL 2L35A 3ZHLA 5GS0D 3ERXA 4MTXA 2DBLL 3CBKB 4YLQT 1WN7A 3WN5C 5F8RC 5KSBF 2ZQKA 2CH7A 2PW1A 2QVIA 2GUZB 5KANG 2XQBL 1SVBA 3M17A 4IGGA 2EH8L 4IIJB 1RIHL 2VKWA 3UPAA 2P4VA 3SJQC 5A6IA 2OW7A 4U7OA 4N2AA 4A7VA 3OSKA 4M5YL 4P59L 4WF9V 4JZ2A 2EC9U 2C4FT 1Q72L 5B39G 2DIEA 2X1PA 4BFRA 4DWHA 4E42B 5LDSA 1K4DC 2IQAB 5EOQH 3HA0A 1JR9A 5DZOA 2VZ1A 2G4GA 4JTAB 1LDSA 4TQIA 4EI6A 3IJEA 3IPBA 4HMEA 5KSVA 4HCGA 3S96A 1EZLA 5IWAO 4UAHA 1NH2B 2ZD0A 5CB4A 4YQXL 3WNOA 3B43A 4F33B 4FQQB 2H9GA 3IFNL 4J6IA 4YIQA 2CDGB 1NCBL 1M57B 3VA6A 1S7UB 2XUWA 3CZEA 4V1DB 4XHQA 4G7YH 2Q8BH 2F23A 2J4WL 5C0NC 3U7YL 4BWUA 3TF7C 4WJG3 5G4OA 1JGDA 3A6CL 4IRJB 1JPXA 3LKRA 5JHLH 4FNPA 1L7TL 1DVYA 4TPRL 3ULVF 4OCMC 2A9AA 3VSVA 2LU3A 1O6VA 4ZODA 1RVFL 3ETQA 1X3DA 1YEDA 2G5BA 4LRNH 3V5HA 1FXHA 4IGBD 5JXED 3WHE0 1BMWA 1Z1WA 1VHPA 4HGKC 3ZKNC 3GK8L 2Q9OA 2MJWA 1L3NA 5FHBL 5KBNC 4M6MH 2Y7QB 2Y0PA 4LCIH 1MQKH 3UG3A 3LZFL 1TLMA 4PJHF 3S4SB 4PLOB 4AQAA 4OLUH 3BP7B 3MRNA 5DI8A 5KYYA 4MLSA 1YYCA 1BIHA 2Z31A 3EH1A 2GC7C 3IXAB 4LEEA 4NKDA 4XN9A 3FUFA 1DANU 5IR1A 1RERA 3UABA 4J23A 4AW4A 2YZ8A 1LDPH 2J55A 5KHHA 2Z31C 1EZVX 3H7BB 4DV5O 2D3NA 4PJFA 3TA3A 1FIGL 2NXYB 1WITA 1TVKA 2BTQB 2WC7A 4J4PA 5K1VA 3ME0B 5JJEB 4JYAO 5ESAA 5KSAA 1IGYA 5E56A 3LZRA 5FO7B 3UX9B 4J4PC 2AJZB 1R6VA 2X88A 4CZZA 3LQAC 2NNUA 2UYLB 5DC4B 1J5CA 2YAFA 4GKNB 1NEPA 1AGEB 5D1XB 5KBDA 4M56A 3C9NA 3D05A 4WY7H 1QKZL 2P7TA 1G1KA 3L2MA 4XOCA 5BO0D 3WTTA 4W68A 3DXAA 5EIIA 2YQ2A 1YVWA 1OM3L 4L1SA 1M3JA 4A7SA 4GX2A 1V7NH 2AQ3A 2P7TC 4FIPC 4XMKL 3VXPB 4P4KC 4FZ1A 4QRAA 2M8XA 4FQCH 3FPYA 3T6VA 4TVPE 3X2QC 3FONA 2J73A 2RA1A 2IWEA 1QBZA 3LDDA 1JDAA 1DP0A 1H3VA 4EDWH 1OD7A 1EZSA 1F6AB 1WBYB 3P77A 3POHA 2B1OA 4M7LT 1MVYA 1YG9A 4BSWA 4QXUL 2J5LB 3TBSB 1W72H 1VF6A 4NFDA 5DM6V 4GP4B 5EZJB 3L75H 1U91B 4APXA 4XH2B 2W07B 4A2MA 1FFNA 5LA6B 2XZCH 1VF6C 3V9EA 1MAML 1QFWM 4GX5A 4I4TA 1IEBA 3EJJX 4DR4B 1P5VA 5E8EB 3EYQD 2Y07L 5KS9A 5D7KE 4I9QA 4JO1H 4WUKL 3FAXA 1PLBA 4ZTOH 4DRXA 1Y66A 1U8HA 2R9AA 2NY4B 4E2OA 2QGBA 3BVNB 1QMUA 1HP8A 2F15A 4U1JB 3R8QA 5FW7A 1QYGL 4PVBA 3CFEB 5BMFH 2WYIA 4PSRA 2B1HL 3MLRH 3VXRE 2H41A 4H44B 1E90A 1OAYH 1JWUA 1XO8A 4JFEB 1D7CA 3D8CA 3JARA 1ZX3A 3EYSL 3P0GB 5FPIA 4JZOB 4GAJL 4QEGA 2YDEA 3DJRA 3MV8A 3QGVA 3WHXA 2XWRA 1ED3A 4S11A 5JDSA 4E9WA 4P9ML 3AY4A 3QPQC 3BEWA 1MPAH 4PJ7A 2WBWB 3KH4A 3QJOA 4JFQA 4BELD 1XR9A 4Q9RH 2Q0AA 5DZAA 4Y89A 4ZFGL 3ZQ9A 4FFYA 4N2CA 2PPAA 2QQLH 4ODVL 2A74B 4MMZA 2B2XH 3D18B 2G2RB 4Q0XH 4IBWA 4RMWA 4UBDD 1WLEA 3HMWL 3QJHA 4WO4B 5LNEA 1FNAA 2H3NB 3HMXL 4XC1L 3BA9A 2N7SA 1WLHA 3FFDB 4LFBO 3O11A 1N9PA 2O5YH 1L0XA 3GRWL 4IDJL 4EUPA 1R3KB 4HDIB 4AV0A 1RU9H 1VB9A 5CHNB 4EI5A 1KT2B 2F7RA 4R97B 1FH5H 1ZTXL 4CS2A 2J12B 4WW1A 1QLEC 3QUZD 1WB7A 1EDYA 3FYIB 2UY7A 4HAGA 4Z7IA 4JG5A 4EI5C 1JGLL 5I30L 5F93C 2X4RB 5A2LH 4CL7A 2ZXCA 3I50H 5IW3A 2MCMA 1YEEH 3V5DB 4QCIA 5E94A 4X4KA 3IGFA 1N2RA 1X9QA 1NJ9A 4RGOL 3SGDI 3UAFA 1AI7A 2B1IA 1ZMYA 4WU5B 1RHHB 2YXLA 3DYOA 4NN7B 5AL0A 4P5SA 2YUWA 2UXCB 2BHUA 5IHBA 3ZE2B 4U7KA 4X5QA 5FF6A 4ZUSB 3QI9C 2HJDA 2BSED 2GSIA 2WAHA 3ARZA 3MKKA 1RJLA 1BXXA 3ARGA 1WICA 5E7BA 1G9ML 4UT9H 2J6WA 3V6OA 1PL3A 3EKCA 4MNHA 3JD0A 5FK9B 1JV5B 3U4KA 2LFSA 3G4SV 1BM3H 2GJ6E 3BN9D 4ANVA 1HEJC 2PTTB 3M8OH 2WXOA 3HZVA 3OE7G 5J2UA 4N87A 3N41B 1PKQE 4HAMA 3MFFB 4JRXB 3FK3A 1AP2B 1IC0A 1TYEB 4LARL 3DIVA 4ICGA 4TT3G 2HKFL 4Z7AA 5M94B 4XVTH 1EX0A 1EHLL 4FXKB 3FD9A 4PGDB 5ID1A 3K2IA 2KLSA 4QRRE 3CXHF 3T71A 4H26A 4UMGA 4WTXA 1UJ3C 1D9KA 5BW7A 1QA9B 4QR7A 3Q4HA 2UXDO 4PA7A 4CC4A 1OAZL 4ZOLA 2WNKA 3WFEL 4AVHA 2HG5B 3LN5B 1FSKB 2DEYX 5KBPA 4DV3O 1YEIL 1QPPA 2V5SA 3FUIA 4CC4C 2YXWA 3TBVB 3D0LB 5CSGA 4TNWK 3BXNB 4XCCL 5F9AC 3AS2A 1XGRB 4XNAA 5BRZA 3FH7A 4X6DB 4DO6A 1HWGB 1TTFA 1TFHA 2YIAA 1YMMA 2IVFC 1VEOA 4BSJA 3ARYA 1JMKC 3UYOD 5HYEA 2BVQB 4ADIA 5IB3B 2Q73A 3H9SD 4NPYA 2N59A 1M9SA 4MMXA 4DPRA 3HR5B 4JVUA 3BRFA 4C56A 5CLWA 5HVWA 3G5ZB 3GMQB 1DQQA 2AJYL 5EA0L 5BV7C 4OLEA 2ARHA 1J0IA 1G0XA 1S8DB 1R3JB 1Y1UA 2VM4A 4MAYD 4ZIBA 4MMXC 5DC2A 5EOTA 4DAGL 1ERNA 4IRSC 1IL1A 4X6BB 3WNMA 4V2BA 3RTQB 3WUWA 3VI4F 4GSQA 3MLZH 3Q6FA 2UWEE 1P7KA 3W7TA 4M5TA 4ABMA 1SZNA 1Q9OB 3JALB 5ABAA 4OCRL 4PJGE 2P8LA 3TETA 4DEWA 1FG2A 1H8SA 3DV6A 2DTML 3KXFA 3VWKD 1L9QA 3Q48A 2EO1A 2MOQA 4MXVE 4OIIH 4DTGH 4JLRB 3DHMA 4FLOA 2HLDG 3O2VL 1H9VA 5FUOL 3QIWA 5MP6L 5CIPH 3NP4A 4RMBA 3FQXB 5JQGA 2ZAHA 5C0AB 5ACMA 4ZX6A 1W0VB 1CMOA 4NKIL 4NZDA 3QIWC 1Q86W 4KXZH 3T3PB 2QTSA 3MBEB 4ADJA 2AAVA 5KVEH 1U93A 4DUZO 2UU9O 4PRHD 3C5JA 4NYLB 1OAXL 3U0PA 5IB5A 1F4XH 2XG5B 1W2BU 1E2ZA 3OLGA 4AQYB 1C5BL 3KR3L 5CGYC 4AYSA 4ELDA 5TF1L 1P4BH 4LSUL 5J9PC 4XHJC 1OB1A 3E6FA 1RI8A 2FD6L 3RWDA 2PW2A 2EEBA 3RUGA 4O5LH 2YQGA 4OGXH 4QRPB 2YK1H 2VH5H 1WCBB 4MTOA 1PZSA 2PWFA 1JL8A 2O1AA 3L1FA 3ZYZA 1QO3B 4PCYA 5E00A 1B6UA 1P84J 3ZL2A 3D39E 4UTCA 3L72H 5DU7A 3S35L 1PVHA 1PSKL 4U1IB 3DX9B 4OV5A 3GMNB 4XO4A 5E1AA 4L4VE 1S2EA 2ZIMA 4NUPA 5E9DB 2K6YA 4XZUA 1KEGL 5I71C 1QVOA 2BINA 4OJYA 3SY0B 1NI8A 1MVUA 3T1HO 1UZ8A 4PRBA 3IGKA 4FQJL 4MGXA 3ARDD 3HS0B 3UIZA 3OKLB 1PX4A 4ZK8A 1EDQA 3WTWA 2BVTA 4HJUA 5IW1A 3BLKA 3ZL1A 2JK5B 2EYTB 4I0PD 4AI7A 1NVPD 2BNRB 2CLVB 4N8VA 3FF8A 3L73H 3ZMUA 1GHFH 1LEIA 4BV1A 1YXBA 4PWKA 1AG0A 5DGQA 4M93B 4RGNE 3ZT5A 4WFFA 4BDVB 2PPCA 3DLQR 1QFWL 5B3SC 1WZLA 1KIQB 2YEZB 4TUOA 2IALA 4UM9A 4IBVA 3DSNB 1OSZA 3TJPA 4G6MH 5C2BL 1I5YA 1BWMA 1J5EO 1HOCA 2AHYA 1OF2A 4A63A 4YWGL 3GXNA 5I1EL 5D1QD 2FLBT 2EO7A 3H6JA 1XF5B 3HKDB 1KUQA 5LUMA 3CXHJ 4NZTH 2QLYA 4WU7A 1T20B 2LW7A 2XWDA 2E6PA 3ISWA 4OFKA 4E9XA 5DJZA 5EZYB 3SYAA 4ZS6D 5F6HI 5L8KB 2ZOKA 4GJTB 2CU9A 1YCIA 4HMCA 2X05A 1HHHA 1EXUB 1GOHA 1QZ1A 3L3GA 3T2NL 1WS7A 1VFAA 2FYUH 5JHAA 4JFWA 5KSBA 5JHLA 1X5IA 4LZKA 4QXTA 4CVWA 4F20A 3B7SA 1GN6A 4QY8A 1ZLDA 2RFXB 4H1LA 2FT7A 3CG8A 4F6RA 2F8OA 3MDJA 4N9GA 5JHDB 1WIUA 4AEIH 4Z76A 1JZIA 3EO0B 3GSNB 2UUAO 2X3BA 4GW1A 2KKWA 3SB3A 2WVUA 4GAAA 2HZHA 4P2RA 1ORQC 1AJ7H 2IAMC 2XNAB 4JN1H 2DTSA 3AG7A 2OPCA 1PG7H 5LGUA 1T89C 1EEYB 4PAZA 5EG6C 3QDJA 3AG3B 1YYMH 3VG0L 5C3IA 2ZDIA 4DV4O 3EADA 2CNYA 1C12A 3B3IA 3ARFA 1K34A 2PTVA 2Y22A 2ISDA 2V8MA 1PFOA 4UNVA 2Q7HA 3UH8A 2XPGB 1WBXA 3OHMB 1CDUA 3ARFC 1CFSA 43C9B 4I77L 4LFAB 2ZWNA 1GR7A 5KYUA 4EKJA 3D50A 1U96A 3AFLA 4QT5A 5C07E 4EEQA 3BH8B 4O58H 2D3LA 4HYTB 2TAAA 4C59B 4XWOC 5IB1B 2BJMH 1XF4B 1CGSH 1VA9A 4AG4H 4MJID 3QA3A 1R3LA 4FEIA 1VQOV 3WU2Z 4NM4H 4XOBA 1H3XA 1V8HA 2FYVA 3KPRA 1M93A 5CZVH 4OGYL 2L8AA 1EZVH 4O02H 4OCXH 5HD8D 3BQUD 4XNYH 3CRCA 1HXMB 5CJ5A 4I9WE 2OJEB 1HNXO 3DSFH 2WXHA 5IB2B 5CEYB 3NEOA 4UT6L 5JPNB 4MMYB 4KTEL 5FYKL 3D0VB 1IU1A 1I7RA 3FMGH 1PJ9A 4LU5L 4PJHA 1DVFB 1YCSA 1NMBL 3IK2A 4Q6IC 3L3OB 5CKGA 4Q6YA 2EIMB 2VDOB 2NDFA 2ZE0A 5HYQB 4AXWA 1MW1A 4R26H 1CGTA 2LW3A 1PS3A 2YOCA 5I1DB 1MCWW 1U3ZA 1F1GA 1W72A 4DV1B 1PPJH 3WOVA 5EF1A 4W70A 4QRSB 4NPJA 2XPYA 3O3EA 3MJ9H 4WCYL 5IHHA 1XZ0A 5D9SB 4FL4B 2DY2A 2XKSA 4WUUE 3KPMA 1BZKA 1S7WB 2QVTA 4A66A 3SQBA 1J7VR 2RNBA 1DTUA 5C0EB 5FLVA 1CVSC 3BOVA 1JHKL 5C08D 4J28A 3IJ7A 3GBML 1I94B 1E2VA 2UUDH 1MWOA 3MLWL 3CVHL 1AS6A 5HTSA 2NR6A 4PUBH 1Y6MR 3G5XB 1OHQA 3BGMA 3F7YB 4CH5A 2D7OA 4DP9X 3V0VB 1D2OA 2NR6C 4PJ5E 4QHMA 4LCWE 1AKJD 4FLZA 3H8NA 3Q05A 4IU2A 4LOUD 3HKCA 3WS3A 4FKHA 4CDGC 4KVNL 2D7NA 3ULUE 1BVNP 3PAUA 1M1XB 5E8PB 3ZGIA 4ODUA 4Z1VA 1JGVL 2YD6A 3MYJA 3MR9B 2NX5D 1EO7A 3EF4A 3F5WB 3DPBA 2PPFA 1R9FA 4XR8C 2EE2A 4E41A 2AV7B 2PW1B 4JFPB 5CBHA 4XMTA 4K94L 1IKFL 3BSGA 1CLYL 4N1HB 2N7AA 2XBZA 3O2WL 5C09A 4XB7A 4HPHA 2ILLA 4DV6O 4MXQC 2XA8L 1I3RB 4PRIA 4XNQA 2A0LA 1VESA 1NDMB 2PCXA 3BPLC 5DEFA 4YR6A 1RZJH 3CDZA 3BRGC 5K9JL 2ZX9A 1GYAA 2KT6A 2BFGA 4MQSB 3EYOA 3MLTB 4IRZL 1HEZA 1JPSH 1LWHA 1BQUA 2A0LC 2JCCF 3IEAA 4IJ3B 5JO5A 1A65A 1OAJA 3GS4A 3HEIB 1C7TA 1TOXA 1YYLL 2EDLA 1L6XA 3IJEB 3S96B 4KJPC 1OSYA 1ES0A 1JUFA 2XCMC 3FAVA 5CB4B 4OM1L 1T7XA 4W81A 3TU6A 3PUUA 5IIEA 5JVDB 5ITFA 3AXHA 4GKZB 1TTUA 1NLDL 4NOFA 5EU6A 1QLNA 3L48A 5FKAB 2FSEB 4UQCA 1FF5A 1ZPLA 4ZO7A 4U3HA 1XREA 3MUJA 1SDDA 3D3VE 2EDQA 3SE9L 1YNLL 2XG4A 2KZ1B 3EH4B 2FJSA 4A2HA 2QKIC 3R66A 35C8H 4QOKE 3IDMA 2E7DA 1HWHB 3AWEA 2EZ0D 1T22B 5DUML 3Q1SL 2WJ7A 1VPOH 4PJDB 4YEFA 1WZKA 1YEDB 2G5BB 4UT9A 2X0WA 3QIUD 1KXQA 3GSRB 1N32B 2C7FA 1EIBA 1OAUL 4C7UA 3ZEDA 2CDEA 1QSEB 2EIDA 4AJYV 5C0CE 4AEEA 4Z7OE 2AMGA 4QJ5B 5I6LA 4Y9EA 4JFUA 2Q7GA 3O41B 4F7TA 1AROP 5EZLB 2QJ1A 1CD9B 4HD5A 1B06A 4UV9A 3FDWA 4EZLA 1SFHA 3FQWA 4OZGF 1XI1A 3TZVD 3ZYOA 3QRGH 1G4MA 1T0OA 1CXFA 3BCFA 4XNMA 4ETYA 1RZFL 4ENZA 1NEZG 3TT1L 1QSVA 4XPBH 5IFAL 2MOVA 5EF3A 2MMXA 2Y06L 3HKBA 1WFUA 1MCOL 1BZ8A 4LEOA 3QO1B 4HJIA 3SDAD 2MCPH 5FYKE 3UZQB 2DYRC 4JREC 4NIYE 1THZA 3QQ4A 4Z95L 4EDXA 4KKZA 5KMGA 2BPBA 1OP4A 1GJIA 3DXAB 5T1KB 2ZXBA 4NTXA 3UOAB 5EIQA 3ARUA 4R4NC 3EDJA 4MTMA 1T1WB 5CLTA 1E4XH 1A14H 5SWZD 4M7JL 3BP6A 2P44B 3B9VA 4FAAB 1LK3H 3B37A 2W0LA 1DYZA 5DJCB 3AGWA 4JL1A 5GSRB 3DGGA 1T2QL 3P77B 4G1MB 3VM5A 2G3XA 3OKEB 3QDGA 2J5WA 4PBWD 1KCWA 5D96C 1UKTA 4HIJB 3PWJA 4G9FE 5DTFA 2NNFA 3V6ZB 5EU3A 1FZOB 2R72A 2HP4A 4JPVH 5I1KL 4O2AA 1GW0A 1QRND 4DR3B 1VQ4V 4LF9B 1O9WA 4GG8A 5SX4H 2PYLA 4CNIA 5H35A 1NCAH 3D3IA 4I4TB 1ONQB 4Z7VB 4D3CH 1HH9B 3W37A 1P5VB 3DUHA 4LF4O 2PCPA 4HJGA 3SQRA 1K6QH 4HD9A 4ZPTA 4OIAA 2CKBB 2R27A 1BVOA 4DRXB 4PTUA 2IJ0C 3N1PC 3N42F 4S1QH 4BFKA 4ZW7A 1A4JB 1D6VL 2WZ6A 4HKJB 2VLJE 1X4TA 2UZXB 2VLLA 1TZHA 2X2UA 1NCHA 1YY8A 5MENE 4NRXB 4G8IA 4HAFA 2Q7EA 2AJXL 3MV8B 4NO0D 1A6VH 1VEWA 2L3BA 3ASWA 4HZ3A 3GTNA 2VL5A 5JDSB 5J6GA 4M8VA 1XF2A 5TFSH 2FEDD 1Y0LA 1ZHLB 5GS2H 3CD6V 4LLUA 4E9LA 1CR9L 2EBOA 2OXHB 4JFQB 1JDDA 5DVKA 3PQYA 3AM8C 4PTTA 4ZMLA 1TJIH 1G7PA 4MD0A 3U2SA 1EJOH 1O7DC 4JM4H 4J2QA 3VI4A 4MMZB 3G80A 3N43B 4Z8FL 2VC2L 2ZOTA 3VFNA 5K1PA 4JM2F 2Z0BA 3GMOB 4PJ9A 2C4FU 1EFRG 1NTKH 2KMWA 4GI6A 3QJXA 4H8HA 4ZQTA 1E1RG 2IBBA 4WW1B 3VD1A 4PJ9C 1XSJA 4FNTA 2UY7B 2J8UE 2VSKB 1KGYE 2DRUA 5EIBC 1X6LA 3A67L 1TA8A 4BFIA 4WFEA 4IRJC 5BS0D 2WN3A 1R5WB 5FM8A 4DVBB 1N2RB 4TOYH 3M6DA 1KBKA 4MZIA 4Z3TA 4OAWB 5IEKA 2GI7A 1AQKL 1G7IA 4ZD3H 1FVCA 1TQSA 5E5RB 3CRAA 2LVEA 4WI3A 1ZWIB 3HPLC 2CIKA 2VR5A 2XIBA 3QUXA 1B88A 3IFOB 5JW4R 4P2YA 4U0RB 3LXAA 2YD9A 2G3MA 1JZFA 2YWZA 3ECVA 1RJLB 3QUXC 4CN6A 1BMFG 3ARGB 4P2QB 4OB5H 3WLWD 3SGJA 4BZ1L 4HCRL 3O2DA 1OP9A 1BM7A 1C8PA 2ZX8A 3RI5F 2CCVA 1QABA 3F64A 2OR8A 1YI2V 3FB5A 1HYSC 1M1KW 1GL4B 1FJ1A 3PWNA 3AJ7A 3AC0A 1A5FL 3PHSA 3MGTA 1R5VA 3ESNA 2CLZB 3EOAA 1N34O 1JF1B 3HE7D 3QS2A 4M5ZL 2VLRD 4IW4C 1MG3C 1ZSHA 4HGWA 3CMAV 4FFVC 4H5SB 3G6EV 1NAKH 1HDMA 4R4BA 5JW4Q 1CE1L 4OCWL 4H26B 4HGMA 2IJKA 1XILA 1KB5A 4UV4H 5ADOH 2CIIA 4P9OA 2WLJA 1D9KB 2R69L 2Y7SA 5D93C 3VXOA 4KO9A 3I9IA 3L5XL 2OZNA 1BWWA 3RB5A 2RDCA 1H8EG 3Q4HB 4HT1L 2DQFB 3E8UH 4W9IC 4J3TA 4HUWA 4A2FA 3VU2A 4KAQH 3OR6C 1CFNB 4NUQA 4AQ8A 4MD5B 2HFGH 4PW3A 4XE5B 1BGXL 5EORH 3VSUA 2ZT9B 4WFGE 5ES4B 3Q06A 5BXZA 1J0ZA 4NC0B 2E74C 1XWVA 4YDLC 3GXFA 1LUVA 2J5LC 2XYBA 2WQWA 1AY1L 2JKJA 3EDEA 3NIGE 4ICXA 4TULH 2B1AH 3MACH 1QTPA 1XMQB 2JB5H 2G2NA 4Z7NF 3OMZA 2AQPA 4RFOH 4NPYB 1KTDA 1KPVA 5ICUA 1I9IL 2JB6A 1DQMH 4X9IA 4F7MB 4LVEA 1AO7E 2XY1A 2PCFB 4TYUA 2OZ4H 1I0HA 4NWUH 1BAFL 3QDMA 3HG2A 3OR7C 4W4LA 5EOTB 1AD0A 5E1QA 3GZQA 2DYPD 4LF7B 5ITZB 3P0YH 4R83A 1UQSB 3W39A 5J13B 3WUWB 1MCPH 2HA1A 4AIOA 3RPKA 4J3OG 3DX6A 3FCUB 1P7KB 5CD5C 3K59A 2ZD9A 2WQVA 1BQLH 4L8SB 4R2GB 5DT1L 3EHBB 2AMUA 1MWAB 4CJ0A 4J2XA 1GZQB 2JJ1G 3RYHB 2P8LB 4PRPD 3KWVA 4LGSB 2OSLB 1FYTD 1FYHB 4WEMB 2JFCA 2IANE 7TAAA 3TPKA 4L1BA 2QM8A 5I6XC 1M1SA 2AK4D 2XWJB 3MGOA 5EFIA 1OP3H 1UEYA 2HAZA 2Y5EA 3D69B 1EBPA 2IFFH 3L54A 1JK9B 4MTGA 3B5TA 5LHDA 2PGGA 1NKDA 1KJ3H 3GMRA 5BCAA 1A3ZA 4OV6F 1N19A 3C5JB 1T0NA 4G6JL 2CBOA 1HQRA 1WEJH 1W0KG 3NJJA 5F72S 5BQ7B 4XCYA 4R97C 1PU0A 4U2YA 5DZVA 1UB6A 3MJ9A 5AUMA 3MHZA 3AK2A 3GSOB 3RUGB 3D09A 1QR1A 4NGHH 3LKOA 1KKDA 3FUHA 1TKWA 1I8MA 1FWXA 2BCKA 3PDDA 1QFHA 2EXSA 1W6WA 5DHVH 2UUBB 3EYVA 4NHCH 1Z5YD 4ORZC 4NN7C 1X5HA 4CC6A 4RZKA 1GGCH 1THCA 2CRMA 5HYJD 3ZRWB 4QO1A 4OV5B 5E1AB 2GTSA 3IMWA 3RNKB 1MZFA 2EIKB 4QAMB 4XBEL 1BVLA 3L74H 2Y2YA 1MREH 5SX5H 2IPUG 1HJBC 3PRZA 1NCNA 1FNGB 2AGJL 4LLVB 2A2QT 5DD3H 5EPMA 4MNQA 3FKSG 2NY1B 3VXTB 2OV0A 1MFNA 3NN8A 4J3OF 3UG5A 1T7YA 1KENL 1P7QD 5FYJE 2K1MA 5ALBL 5LGYA 4CADA 4LB8A 4YDMA 2B08A 5T1JA 2K8MA 4CS3A 1F4WH 2R2BA 4P9HL 2QQKH 1QSFA 5E6SB 1JHTB 1T04B 4L5FE 1QBBA 3ARSA 3ELQA 3HHMA 4FJZA 2FR4B 2E46A 4IU3A 1P4RA 4OLZH 2NYKA 2J71A 1NBVH 5GTIZ 5JWPA 1UVQA 3PWPD 5DD0H 3F7KA 4G7VH 1MA1A 2IALB 4F2MB 3QXUA 4LSDA 4A1RA 1SYVA 2F08A 2J88L 1M3IA 4CMMA 2AABL 4WEBL 1BZ7A 4X5XB 5KYXA 4LASH 2VKXA 1INEH 3SCMA 2PYEE 1SM3H 4KU1A 1RZJC 1K9MW 2ZX7A 5ILTL 4NP4L 2UY6A 3MI6A 2XTLA 4K2UH 4Y4KD 5CNHA 3ZKQD 4FC3E 4YFEA 3ABMB 1N0XL 1C5DA 5K9KA 5JOPD 2NXZD 5LAXB 2DF3A 5LNGA 2WXGA 4J3OH 1ZLUH 1NS1A 2F7PA 4PJCB 1Q3EA 4KJQD 4TWKA 4JO2L 3MLXH 3UADA 3DNKA 3CBRA 5G4MA 3U2JA 4XAKE 3CZUB 5E5MA 4H1LB 4F6RB 1THAA 2P5EA 4XP4L 1G6RH 5FGCB 4YDIH 4ZXBA 1IO4C 2BVOA 2B3IA 3UT5B 1PIFA 4HUVA 4X7SL 4MVSA 2EXTA 1TPXB 2OXGA 2P5WA 1RJYB 1H38A 1EEUA 3QDJB 2XTAA 3Q8CA 3UGXA 2ICWJ 3ZRXA 1GYVA 2IGFL 2JCCA 4K23L 2MPAH 2DYSC 4TLSA 1DUYB 4F93B 3G04B 3K5SA 4PJIB 2DQIL 5I15H 1BQ0A 5DUJA 5F1SA 4FFBA 3ZKXB 3PDOA 4D0CB 1WJZA 2A6JA 4PJ8D 2Y48A 1WBXB 3RL1B 1CD0A 1CFSB 5D8JH 4BK5A 4G83A 1KZQA 4WWNA 1RUAL 3CXDH 1Y18B 3CDCA 4BGDA 5E2WH 4P2OD 5TISZ 1KDIA 4K9EH 2V7NA 2WVSA 4HWEL 3IDUA 2E75B 5IKCB 5C8YB 4G5AA 3QA3B 3DJTA 2PCYA 1JK8A 2W9EL 4AJWA 2P22C 1HL8A 4OJCA 4M48L 1K97A 2X4PA 4L8CB 3BKJH 2QT6A 2XOKG 4PI0A 4P23D 3REWB 2YKLL 1UA3A 2HTLD 4K0KO 4AL8L 1LO3L 3OD4A 1P5UA 2IQ9L 2G75A 2F7IA 3RGVA 4AEFA 1P84K 4MAUL 4OQTH 5J89A 3EBGA 5KAFZ 3L5WB 1GGUA 3OKDA 3MV7E 2JTDA 4ONGL 3H3PH 3O6KL 3VXNB 4MASA 2CD0A 4AXWB 1NCJA 4HW6A 4J6RH 5BVJB 3CH1A 4GEIA 3ARBD 4OZGA 3BO8A 1GZHA 1TTRA 2Z8RA 1MI5D 2WAQA 2YD3A 4LPYA