1OCZB

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
b'MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oczB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oczB02
2B3IA 3HEIB 4YSEA 4CSPA 4HALA 1CC3A 1OE3A 5D4IA 4WKXA 1N68A 3KW8A 2CALA 2BO0A 2UX6A 2VSKB 3SBPA 2YQBA 3ZX1A 4UAHA 4G70B 4G71B 2EIJB 4KO7A 1QLEB 2OJ1A 3DKHA 2GHZA 1EHKB 4KO6A 4UANA 4A68A 1WA0X 1JVLA 1AAJA 1TEFA 2LLNA 4KOBA 4E9WA 1PCSA 1ZDQA 2NRDA 2Q9OA 5FC9A 1CYWA 1AZNA 1GY2A 2PP7A 4DP8X 1BXVA 1OCZB 2GB2A 4E9YA 1ASOA 2XYBA 4HIPA 1NWPA 4G72B 3X1EA 1OCOB 1KCWA 1YLBB 4BWTA 4YSPA 1E67A 2CUAA 2J56A 3CVDA 1PZBA 1UATA 1PAZA 1E65A 4QLWA 1OCRB 1E5YA 1A3ZA 7PAZA 3QPKA 1JERA 2ZOOA 5B3SB 2VMJA 3HB3B 4KO9A 3T6VA 1KYAA 4DP0X 4HHGA 1A4AA 3PAZA 3QJTB 4YSCA 2XX1A 1SDDB 2IDSA 3WIAA 1OE2A 1JZFA 2EIKB 2HRGA 4E9TA 1XB8A 2J57A 3V9CA 5B1AB 1OOWA 4AZUA 3ABKB 2E86A 1JZJA 5TK2A 4ZK8A 2FQDA 3FU7B 3N2JA 1AZUA 1AANA 3NJHA 1ILUA 2QT6A 1PLBA 2VM4A 1T5KA 3NSDA 2Q5BA 1KDIA 6PCYA 4W1TA 3ABLB 5I6KA 1AZBA 3H4HA 1M57B 4FAAB 3X1FA 2GC4C 3DIVA 2FNWA 3PAVA 4YVUA 4HHWA 3S3DB 4GYBA 5I28A 1ADWA 4YL4A 1PF3A 3GYRA 5F7AA 4JKNA 3V9EA 3U25A 2XX0A 2IAAC 4DP2X 3EHBB 1AS8A 3TASA 1WS8A 2H3XC 2TSBA 1N70A 3TU6A 1AG6A 3CZUB 3FYIB 5IY5B 3ASNB 1J9RA 2UXFA 3FS9A 2DYSB 3S8FB 1NIFA 3OMAB 1KGYE 2BW5A 2A3TA 1ET7A 4JHUA 4A2FA 4Q8BA 4A2HA 1A8ZA 2UXTA 5AKRA 1RZQA 1PNDA 3S3CB 4BXSV 1GS8A 3D12B 4KO5A 2YARA 3ZDWA 2P80A 9PCYA 1AQ8A 2I7OA 2XVBA 3CDZA 3NP4A 4E9SA 1ZIAA 2QDWA 4GY4A 3T6XA 1PZAA 2EINB 1GR7A 3S8GB 3SBQA 2DY2A 1PLAA 2IH9A 5PCYA 3IN2A 1IBZA 2PCFA 2HRHA 1FWXA 1L9RA 1PY0A 2B08A 2BWDA 4HZ1A 1X9RA 4YSTA 2GSMB 4BWWA 2XXFA 4DP4X 1AR1B 1XB3A 2BP8A 3FSAA 1CUOA 1W6LA 1F56A 1GS7A 4ENZA 5B1BB 1OF0A 1DYZA 1MG2C 4YSSA 2VW7A 5EHFA 3FU9A 1ZPUA 2DYRB 5D4HA 4A66A 4RH4A 1JZEA 2XV3A 2FQEA 1JVOA 2R7EB 4W9ZA 4AKOA 1TKWA 1RCYA 2XXGA 2YXVA 1GSKA 5I5JA 4DPAX 1HAWA 1NIAA 2XWZA 2W8CA 2BW4A 5B7EA 2IDUA 2IWFA 3H56A 5I6LA 4N8UA 3T6WA 3NJLA 2BHFA 2BZ7A 4NERA 4YSDA 1AS7A 1GY1A 1GS6X 4GP5B 4AKPA 3T71A 3FPXA 3WNIA 2VSMB 3TBCA 3NJIA 1OE1A 1ZDSA 5B7MA 4Q89A 2PP8A 5I6MA 5PAZA 5LDUA 4NB7A 3OM3B 1CYXA 2UXGA 3UABA 2PPFA 4KNTA 3S3BB 1DZ0A 3FQ2A 4NAJA 4N4YB 1PLCA 1OV8A 4M4RB 2QDVA 3NJKA 5B1JC 4FA7B 1BQRA 1J9SA 3PPSA 5F7BA 4WTQA 3NJJA 2P80D 5AZUA 1MZYA 1BXAA 1L9QA 2DWTA 2UX7A 4KNUA 1HFUA 1L9SA 3BVDB 1IC0A 2OV0A 1AG0A 3AG1B 2CCWA 1IBYA 2R7EA 4YVNA 2AVFA 2GBAA 3T9WA 1ETJA 4YSUA 2MRYA 4A2GA 1A4BA 2ZONA 4G7QB 4HCGA 4A2EA 1J9QA 3ERXA 1WA1X 2YEVB 3NJGA 2VM3A 3CVCA 3FSWA 3WG7B 3NJNA 1FA4A 3TBBA 1A65A 3NT0A 2XLLA 4BDVB 4DP1X 1JXFA 1OCCB 1SFDA 4A2DA 4E9XA 3FU8A 2IDTA 2Y1AA 1XB6A 5I5MA 1RZPA 1V54B 1JOIA 5I5IA 3ASOB 3SBRA 1IUZA 1NPNA 2XUWA 2XU9A 1R1CA 2X87A 2BP0B 3RYMA 1ET5A 2HX7A 1SDDA 4F7KA 1JZHA 2Y69B 1GW0A 1EZLA 3H4FA 3AW5A 1SFHA 2PPAA 4P5RA 2HXAA 1ET8A 3WKQA 3G5WA 2FWLB 4GXFA 1ZIBA 2YAFA 2YAOA 4DPBX 1SF5A 2PPCA 3EH3B 2JFCA 3FU7A 4E9VA 5AFAA 3FYEB 2I85A 1J5DA 1MZZA 3PAUA 4HAKA 1KCBA 4BK5C 2AZAA 4P5SA 3IEAA 1NWOA 4YSOA 3T6ZA 1W8EA 4DP9X 1KV7A 2UXVA 4G7SB 2N0MA 1BQKA 1M56B 1J9TA 1SNRA 1NIEA 4AX3A 2BWIA 3JTBA 4BDVA 3L45A 4TXVB 2CAKA 1JXGA 4DP5X 2IDQA 1ID2A 3QJQB 2PCYA 1AOZA 2IDFA 5E9NA 3WNJA 4PCYA 3JT2A 1AZRA 3OMNB 4E9QA 5TK4A 1PMYA 2WO3B 4YSRA 4YSQA 3SQRA 2YAQA 2BP0A 2H5UA 1URIA 3MBWB 3OQRA 3PXLA 4QKTA 4AI7A 2EIMB 5I6PA 2FT6A 2H47C 2TSAA 2W88A 3AY2A 1NZRA 1SHXA 2PP9A 2VW6A 2YXWA 3QJUB 4EF3A 2HZHA 3UACA 5I26A 1M9WA 1AIZA 1J5CA 7PCYA 2J55A 2HLEB 2FT8A 2DWSA 5D4JA 1SJMA 3UGEA 3FQ1A 2VW4A 2CBPA 1FFTB 3NJFA 1IKOP 3KW7A 4BWUA 2YAHA 1QNIA 2FT7A 1BAWA 3IBOA 1WAEA 3X1NA 4PAZA 3TA4D 2FTAA 3UAEA 3ZIYA 4M3HA 2J5WA 3N55A 3NSYA 1WA2X 2FQFA 3BQVA 1KBWA 4DP7X 2FJSA 3X2QB 4F2EA 3FQYA 3UAAA 2X88A 1A4CA 2JKWA 2YAPA 3QJRB 1MG3C 2XV2A 1JZIA 1E30A 4AKQA 1QHQA 1BXUA 2HX9A 2BZCA 2GI0A 1B3IA 1W6WA 1BYPA 1BEXA 1TU2A 2QPDB 3X1GA 5A7EA 1BQ5A 4DPCX 2WSDA 3MX0B 3FT0A 3WI9A 4YSAA 3NSFA 2GIMA 2DV6A 6PAZA 2IH8A 2AANA 4HCIA 3C75A 2CJ3A 3OMIB 3ZBMA 2MTAA 1NPJA 1SHWA 3NYKA 2AZUA 1ZV2A 3CDZB 4CSZA 1NIBA 3AG4B 1JZGA 1I53A 5I6OA 3AZUA 3DTUB 1NDTA 4JHVA 2PPDA 2ZXWB 3NJMA 5ANHA 1E5ZA 1L9PA 1NTDA 1AACA 4E9RA 1KDJA 3CG8A 4BXVA 2ZWNA 2PLTA 3GXUB 1NINA 2YAEA 1BYOA 1AZCA 2IWEA 2JXMA 1NICA 3AG2B 1MDAA 3EH4B 5I6NA 2OCCB 3ABGA 3PLYA 4KNSA 3IE9A 2BP8B 1ASQA 2YAMA 3X1BA 2AFNA 2QPEB 1HAUA 1PNCA 8PAZA 3CVBA 1L9TA 3ABMB 3NP3A 3FSVA 3IN0A 3EH5B 1TEGA 1ASPA 1KBVA 2PPEA 1V55B 3UADA 3GDCA 3FSZA 4DP6X 3WKPA 2EILB 3QJSB 4KOCA 1VLXA 1XMEB 2WO2B 1GYCA 3EF4A 1RKRA 1SF3A 3AG3B 1V10A 1CURA 5B1JA 1WS7A 4L0PB 2IWKA 1JXDA 3QQXA 2XV0A 2HX8A 2VN3A 1AS6A 4G7RB 3NSCA 3FPYA 4A67A 4MFHA 1ILSA 1NIDA 4K9JA 4F2FA 2RACA 3OD3A 4UF7C 1L9OA 1PZCA 4GP4B 5B1KA 5B7FA 2FQGA 2GC7C 1X9UA 4HCFA 4X4KA 3QJVB 4GP8B 3PCYA 2I7SA
chains in the Genus database with same CATH superfamily
3CC5B 3HBZA 4FERA 1R47A 4LHQB 4WWKD 4CSPA 2E47A 3L2LA 2H32H 5JR1L 4M93B 1ZLDA 2AJXL 5D4IA 5D6DC 3EG9B 4KK8D 3TO4B 2XWRA 4LSUL 1U8LA 1UOWA 5KVGE 3BAYA 3LPOA 3L95A 3P4LA 3W2DL 2NYZA 3GTNA 3WIHH 1BSIA 4X0KA 3N85H 3DKHA 5CIPA 5J9PA 2NW2B 5AVUB 3OKLB 2P5WE 4YDJB 1HNXB 2WXGA 2HVJC 3RTQD 5J2TA 2QKIC 2XJKA 3E3QC 4NWTH 2B2XH 4MAUL 4QHUA 1Z9NA 2AITA 4LF9B 1ZDQA 4K3EH 4J3BA 1AZNA 3ZT7A 4HT1L 2DICA 3NPSC 2WYHA 3EXAA 1DEEB 5LAPA 1N64H 2F2HA 1XQ8A 1CTMA 2CKBH 4CN1A 3N42B 5CJBA 4PRNA 3VQWA 4WW2B 2C3VB 2Q8BH 2ILLA 2XZQH 3FCSB 3M07A 3LH8A 3MRRA 4IRSD 3UTSB 4AYFA 4HOMA 3MXVH 3W0WE 1B0RA 3DX1A 4WK0B 4Q6GA 1UOLA 3TONA 3EGSB 2ZE8A 3VFGH 3BCDA 3JALA 3SQOL 4MGXA 3WL9B 7PAZA 1RLBA 2EC9U 1BM3L 2PCXA 5AW8B 2WUCL 2H32A 2W07B 3O3DA 2Y2YA 2YJLA 2PO6D 1FLTX 4WGKA 4ABQA 3ZMTA 4DP0X 2IPUK 1CF8L 4OKVA 1URLA 2PTVA 4EOWL 3A6OA 3SDCD 5BS0A 4N1HB 3GMOB 4KV5E 1IL1B 2V2WA 2F1AA 4PQXA 3WIHA 1BZOA 2W94A 3VGFA 4PV9A 2MCPL 3V9CA 3ZBHA 1MFUA 3UZQA 1XNQB 4CKQA 2DMGA 3NACL 1KYOF 4WTXA 3GXTA 3SJBC 3F2LA 2FQDA 2FAUA 4YFLI 3U7WL 4AVHA 1CG9B 4S0HA 4IL6Z 4HPHA 1S8DA 4HVBA 3B9AA 4DV2B 3FKUS 3GHBH 3MJWA 4OLWL 1HXMB 4TSBL 4Y8DC 1Y6KR 2W91A 4HWBL 4Q4EA 2VZUA 3ARGA 5CJXC 2Z3YA 4AOFA 3CCJV 5I71C 2AQPA 3IXTA 2FNWA 4DRXB 5BRZB 2CKBA 2R1WB 4FQCH 4F5CE 1RIUL 1T1WB 4A7VA 4D9QE 3OWEA 4FZ1A 1XBDA 5I74C 5LHIA 2I60L 3S3XA 1LEKB 2VL4A 5EBMC 1NJ9B 4OCRH 3WTTA 3CXDL 1FDLL 1W0YT 4ORGA 3M17B 4OJYA 4EE2A 4ZMXA 4M43H 3TU6A 2QPSA 4A63A 2NY3D 2YA0A 4WGWB 3B09A 4ZXBD 5DRXA 3WD5H 4MZRA 3FB5B 4RISL 3LZOA 2IH1A 3WELA 4UDUA 4JHUA 4N2EA 4PLJD 4TV8A 3U9UB 4UCRA 5BZWA 4YPJA 1OAQL 3CDGA 1GO3F 1MJJA 3VFOA 4NFCA 3ECUA 4QAMB 4NUGH 1TQWA 4N9GA 4UNUA 2Y36L 5AKRA 5K1PA 3GXPA 5DURB 3VXUB 1YEGH 3ZDWA 1BGXH 4YPGA 4AEIL 1IGJA 1MN4A 3ARUA 5IG7B 1A6UL 2JMRA 3AB0C 1F45A 4JKKA 2I7OA 4PRPB 4LBEB 5I9QC 3NP4A 1TUBB 1XD1A 4HPOH 3AS3A 2QVIA 2D0GA 2IFFL 2JQMA 5DRZB 3KPNA 2ADGB 1NSNL 2RAMA 2CUMA 3GZKA 3IN2A 2MQ3A 3KXFE 3PJLA 2EO9A 5D1QD 4YDIH 1WBXA 3ZUCA 1MCBA 1DQLL 1PEZA 4B9PA 1CE6B 1VKXA 4MNGE 2UY6B 4NO2A 5BQ7A 5IJBC 4AENA 4B6ZA 2C8NA 1OK0A 1TQCC 3QIUB 1MMMA 4BSWB 3LHAA 2QJ1A 3ZHTA 1JPEA 5D7SL 1RV6X 3A22A 4F9LC 1UHVA 1FAKT 3IU3A 3LPFA 3E8VA 4QTIL 1NQTA 3G67A 4S1QL 1LJMA 5F1IB 3QORD 4Z7NF 3PNWB 1OTUD 2D8KA 4RESB 4G8IB 3U46A 4BFFA 5FB8A 4XOAA 3SBWA 3SDXF 5DUPH 3T4DA 3H3KA 3K57A 2OSYA 1FIGH 5C0AA 2YGVA 3SDAC 3CCHB 3NH7L 1UCBL 6FABH 5E1HB 2R4SH 1KCLA 2CNZA 3LRMA 4ZNCD 3QAZB 4YBLB 5KS9F 1U92A 4L1DA 4G8GD 4PS4H 4N8UA 1QBZA 4JEGB 5FDYA 5CEXA 4CGTA 5HDLA 1YAZA 2AXGB 3CGTA 3DTDA 4JY5L 2JJUA 2W0PA 4V2BA 4P46B 3VFUA 4AKPA 3WKYA 3UEQA 2R23B 4RA0C 4Q0XH 2DWDB 4XVUD 5B7MA 3BPCB 4WO4B 3ZS8C 2CPUA 4JF3A 5KYXB 1U8CB 2UXGA 3QQDB 4YHOL 4L9LC 4S11A 4CRPA 2KLSA 1AHWA 1CFQB 3M1BA 3W56A 1NKDA 1IGTB 3QEQA 5B1JC 2BIOA 2WZ5A 3CCSV 1MXDA 4JO4L 1FJGB 4ZBMA 4FA7B 5IMOB 1KPUA 4D0BB 5D7JC 2ZSWB 1QTPA 2EH7L 3MV11 1AKJB 1F90H 1ZTXL 4JQVC 5MP6H 2XWTA 2WKGA 3MJ7A 3WMPA 2ZYIA 1BVKA 3VXNB 3QJFA 4MAZA 2YD7A 1MJUH 3UDWA 5EF1A 4L3FA 4R2GB 4XDJA 1S5HA 1G6RL 3QZOA 4ZAKA 3VYNA 1HNFA 5EORL 4DR3B 5F7LB 4UCSA 2ZOUA 2DQEL 3TH3T 1U91A 2OT5A 2P5ED 1YITV 1ETJA 3JSSA 4LSPH 3RYFA 1DK1A 4QNPF 5EOQL 4JKWA 4LDOB 4AV4A 1OGSA 3LRSA 2XWJA 3BP6A 3CZGA 4HCGA 4KROD 2Q6WB 3K46A 2ZXBA 3CN4A 1A7OL 3DV4B 3QUXC 3UO8B 1A6WH 3EW3B 4K9EC 3U4BL 1R0AH 4HP5A 3TBBA 1VQ6V 1KQSU 1E9OB 4PCTA 2OMXB 4AYGA 4NO0B 4Z7UF 3FU8A 2KZWA 2IDTA 2CE4A 2HG5A 1V54B 3M1OA 1N8ZA 1I7FA 2LQRA 3MRMB 4O02H 5DEGB 2F0CA 1RK0A 2KDGA 5GZND 5FA3A 3CHRA 3POHA 5I18L 4LVNC 4E2OA 4KRMB 1SQGA 4QGPA 1SZXA 1O7DC 4Y16C 4KV5F 3CWGA 1P84K 4R7XA 2GY7B 4GO6B 1HZHH 2CJTA 2YRZA 1QEWB 1T66D 4WTWA 1YQVH 4LOVA 1E5CA 3QO1B 4I0PD 3K0WA 4BSJA 4GSUA 4Z7NB 2PPAA 4NLAA 1WB8A 1A7NL 4IBSA 4P23D 2K78A 3DX6A 4E36A 4QHKI 4XZ4A 2EVGA 1SF5A 3SDXB 4MS8C 2JQZA 4NI6A 1I9EA 4EVNA 2I85A 4MTXA 1EBAA 2ZF9A 1S3KH 4HC1L 5T1LD 2OIEA 1PKXA 2XAGA 4KZDL 2JLLA 1YXBA 3CC4V 4FM1A 3V4UH 5KS9B 3K03A 1IX2A 2ARJA 2XN1A 4H1LB 3KVDD 3LY6A 2AJUL 4HIEA 4U3JA 1RULL 3VW3L 3DX7A 4MQ7B 4KHPO 3DA0A 4QWWD 5C0GA 3RBSA 1TVBA 2AK1L 1P4BL 1FS0G 3LPGA 4XC3H 2V5YA 1SA0B 1UZ6E 3ARDB 2X44D 1JGEA 4O02A 4TXVB 3WDJA 2PTMA 3L4XA 3SQBA 3WNPA 3Q6GL 3FQUA 3LDBC 3L70H 4QKXB 4UNTA 1A9VA 1TU2B 1QSFB 1AZRA 2XRAH 2YXMA 1AB3A 3PHSA 1KCUL 4C4UA 5E6IC 3UCRA 4BW5A 1EV2E 5DEZA 4YSRA 1JMKC 5DD1H 1R3IC 2JI3A 1ETA1 4QRAA 1QEXA 5D1QE 5TH2A 4ZI8A 2EIMB 3MACL 5EB9A 2AW9A 1A8JH 2ROYA 1SHXA 4R9HA 4YBHA 3MREA 2E7MA 4LIQE 4PMFA 5E6YA 5F7FA 1Y0LA 5J7CC 2DMXA 1NJIW 2MQGA 4LSQH 2APXA 2EE9A 4LCCC 5GS0D 5CBHA 3UPRB 3I6GB 3V9FA 3ECBB 2YK1H 3HB3C 4NT6B 4RMBA 1DQVA 1MRDH 1RI8A 1A9BA 1VGEL 4YJ3A 4PJEA 1YZZA 3W0WB 2FT7A 3GSWA 4LFHD 2J88H 4OSUL 2ZDIA 1I7UB 2X3BA 1S9WB 2RIKA 3IS1X 4Z7AA 4JI0O 4Z7UB 1AQMA 5BXZA 2PYFB 3DETD 4F2MA 5DGQA 2WANA 2X4QB 1TZGH 4ZO7A 2WMPA 4K3HA 2ZR2A 4DVRH 3HKDA 4TKWA 2ZE0A 3T4AB 1A3QA 1GH7A 4KHTL 3JWNC 4ZW6A 1QR1B 2VQUA 5GZOA 2MOGA 4K4KA 3SY0B 1E4WL 1C08B 1TQTA 5ALCL 4OB5L 4NQXB 5E8DH 2P44B 1S7RB 4CNIA 2CK0H 2EEXA 1HEZA 1EDHA 4DQOH 4EN3C 1MA1A 5AKTA 5CEZH 4OUUA 2AJSL 4JKPH 5AVWB 5G2NA 2XWXA 3GBEA 3IJYA 1RM1B 1AQHA 3P9MB 1XGYH 2EEDA 1I4FB 4MKTA 4X9IA 4NXKA 2VDNL 3ULVC 4F15B 5FXCH 3REWB 1L3NA 1M7IB 4H37A 4ICGA 1BMFG 2KC0A 2VMDA 3CFJA 4M8VA 4UM9A 2NPLX 1QNMA 2J25A 1X5IA 4JL1A 3CEIA 3CLFL 4NYLB 1MNGA 4Y4FA 4Z1MG 4BFJA 3T77B 5GS1B 2B1HH 3L5JA 3WFEL 3OKOB 3QDMA 4YJZL 2MPVA 3ESPA 1FNSL 3O6LH 3F7VA 4CBZA 3E8UL 1MHEA 3K5OA 1E4KA 1T1YB 1L9PA 3TZVB 1DLFH 2Y6SC 4HJEA 4X8JB 4X4XA 1MNUH 4F7MB 4G82A 1I3GH 3BZFB 2G9KA 5K9OB 2Z65C 5IFAH 3ARFB 3MHSC 4JG1H 2IWEA 1WWBX 3C87A 3F00A 4K7FA 4WFGD 3HG2A 4PJFE 5AB2A 4U4IA 1CFVL 4TUKH 1K92A 1B4TA 2F8OA 2P8MA 4ZO8A 1ES0B 4YDLB 2P5EE 4UAOB 1ASQA 4GG8B 1KCKA 4PREA 3ABMB 3PUCA 2VCOA 4F7TA 1HJBC 3RHWF 1FZMA 4DTGH 1E28B 1LVEA 1WZAA 4PV1C 3AWFA 4PUBL 4ZZKA 3MLYH 2EINC 3ZL4H 1B4RA 1CS6A 5AUMB 4P4RA 1H6UA 5JJEB 4LAQL 4HLZH 1A7BA 4WHDA 5IB5A 1JZ7A 2J4WL 1K8DA 4HIXL 3L13A 4MJIA 3GRWL 4PELA 1TQBB 1N0JA 1OPGL 2CR3A 3UTTB 3VWKB 2EVJA 2V3DA 2Z0BA 2EBOA 2G75B 4DW1A 2KKWA 3OLIA 5AZ2L 1KFAH 2E3CA 3FQWA 4QRTB 3E1F1 2BVOA 5CHNB 1WWWX 2NR6A 2Y1YA 4LOFA 1XSKA 1JXDA 2DM7A 2XV0A 3KXFB 4CH6A 1QD0A 5ERWA 4KITB 5CGYD 3NSCA 2EIJC 1NFIB 1U41A 3AXIA 3N44F 2ZE6A 2K9UA 2A6DA 4JDVB 1T3FA 2VLJA 3CSFA 4NHUA 4PGEB 1GMGA 3RZCD 3VXMD 1VQNV 4JRYE 4LPUA 1L9OA 4YR6B 5DSCB 4QRUA 5T1MB 3VGEA 3B2DC 1HWYA 1HR0O 3QJVB 4PJAF 2PZSA 3V5DA 4AM0A 2EX3A 4YSEA 1MKFA 4NNYB 5LBSH 1CC3A 2CA3A 4JB9L 1N68A 3QCUH 1JP5A 4PJ8B 3P4NB 1KB9F 3MRBB 3HUJF 3O0RH 3PWUB 4KH2A 1KTKE 4LKXB 2AEIT 4X5WB 2QMJA 1J5HA 1V5JA 4LF7B 3A6BL 4BD4A 3S98A 1DBKH 1V8HA 4G71B 3FO0H 5CLYA 4GW1B 1ETZB 2ZOKA 4Y4KA 2ZUQB 2G0KA 4WWKB 3Q44A 1CICB 2W9DH 2XTAA 3K6SB 4RWYH 2A74C 3C90A 1UYWL 1AI7A 3EYUH 3LB6D 1USZA 2HH0H 2NQ3A 4FJYA 4KX9A 1SQQH 4R7VA 3K8LA 4FQHB 5E99H 1MWAB 2J6WA 4DP8X 5CLWA 4EUPB 4FM2A 1KECA 4ICWA 1ASOA 4E9YA 3EDJA 1KIQB 4Z23A 4KTEH 4LESA 1XF5B 1ZHBB 3LS4L 5FKAB 4YHNB 2QWRB 1OAZL 1W80A 5E1AC 3CMAV 2EDXA 3RTQB 4N6RA 3MSPA 2P4AB 2BC4B 5KYUB 1NC4D 4Z77B 4JY6B 3KPRA 4DR6O 1EHNA 1PU0A 2KPNA 3I02A 1EFQA 5IW3A 3QO0B 5LBSA 1ADQH 2ZOOA 3CZFB 3NZUA 1Q94B 2IANB 1LWJA 5CF3A 5J0BA 3UM7A 3SDDA 1YPZF 3TT1L 3BWUC 3S97C 4IHJB 5B39A 5J13C 4CS3A 4G6ML 3RX5A 2CGOA 1P53A 2PXYC 3BCFA 2H0JA 3AREA 1D6VL 4N87A 5GIRA 3VRLE 4CN6A 2CO7A 5E4AA 2A06H 4GLRI 5EIIA 5H4YA 4IIJA 5C0CE 4FLVA 2HRGA 3JZ7A 4KJPC 4R26L 4TTGA 4BCXA 4FXTA 5FYLD 1OOWA 3KBFA 5L3BA 2NLJC 4Y4HC 1U42A 4JFQB 3ZHKA 3CDFA 5TK2A 3M99B 4DYLA 1M1KW 3ASNC 1EDYA 2BNQA 2Q9LA 3HHSA 5GS3A 3I9GL 1XDTT 5DDHB 1MCSA 5CJOL 4GG6E 1XF4B 4BE6A 4L5FL 4M8QA 5I6KA 4YY3B 3ARRA 3I9PA 3ZHLA 3H4HA 3F58H 2O5ZL 4JPSA 1U3HC 2VITA 2FJGB 4MYWB 3SKNA 3HTLX 1I1FA 4KJWC 3PAVA 3QG6B 4DV0B 1YEEH 3HE7A 4XB8A 3K3QA 4ZRGA 5I28A 4E5XA 1IZKA 4IIQB 4P2OC 4Q9QL 5EBWB 1Q9KB 3MRNA 3N44B 4FKEA 4QLRA 4YHHO 5F7AA 3THMH 4OFQA 1NCGA 4D0CA 4DP2X 1JV5A 5HHNB 4AVKA 2LAAA 1QFWH 1WS8A 4TVPL 4S0TD 2H6UA 3VQVA 4I4TA 1M93A 2R2BA 3DOSB 1NLDH 4H25A 5DQ9B 3FN0H 4PJAB 3WNMA 1ADQA 3HLAB 3OWRA 3IAYA 4X6EB 5C07B 2IQAA 3C8KA 1OP3H 1EAPB 3QYCA 4W9JC 5KX5B 1CD1A 2Y7SA 3WXVH 2FBJL 1ODUA 3IGAA 1IE5A 3G3LA 3WN5B 1YJDH 2BNUA 3HUJB 3FUDA 1QHOA 4OJFH 3SZKC 3OHXC 4JR9H 3MNWB 4JCLA 3LNIA 4KQ3H 1V05A 3VFSB 1P7GA 4D3CH 1FC2D 3SJQC 3TYFA 3VI4E 2VERN 3QVAA 1EN5A 4XNMA 5L4FA 1F4XH 1D5IL 5JMOC 5D2NC 3S9DB 1PZAA 4F58L 2ZAHA 2BNRE 1PLAA 3STBA 4C8XA 1WT5C 2OYKA 4H5SB 1WJ3A 3TNMA 4F6EA 5DK3A 1LK2B 4PJFF 1CP9A 1FD9A 3GNMH 2R0ZL 2ZKXA 1NS1A 1DJXA 3M1CA 5T3ZD 4HZ1A 2P7TB 1YHPA 3PUUA 4JPVL 4OQTL 4MQXD 4LU5H 1OM3L 1DSYA 4BWAA 2VAAB 5F1SA 5AB1A 3PWPB 2CLRB 1G6RB 3HI1A 4XO8A 3LNMB 3ZYOA 4YS4A 4AI8A 1F13A 3UBXB 4RUEA 4UCOA 2FVNA 1Y18B 2HRLA 2JE8A 1QBMH 1J5IA 5FIEA 1JGUH 1YPZB 2DQCH 4KY1H 4PV8A 1V3KA 1UD3A 3N1PC 1WZLA 4LRNH 2Q87A 2EDQA 1NCDH 3UZEA 4ZFFA 3VXME 4RBPK 1E2ZA 1KLUB 4MA8L 3BEWA 1P4LB 4WUKH 1DBML 1QNZL 1R3KA 2C3WA 2DWXA 3JAMN 2FLRT 3DJRA 1N6UA 2OMUA 3QYMA 3MCKA 3DRTB 3BT2L 1NGYB 4P9PA 1NIAA 1Y7VA 2YD4A 3OKEB 4MCNA 4ZYKA 3GO1H 3PDGA 2Q86B 4F7PA 3QEHB 5I6LA 3X2QC 2XZZA 4JYAB 3V0WL 3DUSB 1CU4L 5HHME 3OFNG 1C8QA 3K4ZA 4OGQB 4LB8A 4TNWK 3F5WA 3H7BA 5K39A 3D48R 3RWEB 3L3DA 2VXTH 4ZS6D 3EGXB 5TE4H 1MHHB 4LF4B 1GC1C 1OLZA 2PYEA 3ASWA 1LO4H 4GKJO 4Q89A 5JDSA 4PJIE 4H0GA 5HPOA 5EPMA 5JPMA 1BMWA 1KD1W 3MCG1 5EBLA 4ODHH 5JORA 4IHOA 2W6IG 3BMVA 5CU5A 2C9RA 1UXWB 2IJKA 3EG9A 3TO4A 5CB4B 3LN4A 5CA3A 3WFBL 3MRKB 3WNOA 3U0PB 3C8HA 2G3ZA 4WTQA 2HPOA 5LXVA 3DJZA 3CN2A 1KYUA 5DMIL 4UT9H 1QRND 4IGBD 1GOGA 4DEPC 1F00I 4YDJA 5D70L 2CHZA 2OV0A 4XN5A 1BECA 1AG0A 3BHPA 1XCXA 4TRPL 1VQLV 1AI5A 1FXKA 1SN2A 1IBGH 3BPOB 2WCSA 4ZFOL 2OSLB 3CFUA 3SE3A 1JJUA 2GITB 2HKHH 1THCA 2OMWA 4R4FH 1VFAA 4WW2A 5HHOA 1KELH 3ELQA 4PPTA 4MX7A 1Q9LB 1H15A 2FJHA 4YX2H 5JJJB 3RGVA 2Z93A 4I3RH 5J9PC 1YDPA 4PJFB 5FYLE 2R2EB 4L3AA 2E46A 1XB6A 4G7YL 3T3PE 1RZPA 4PB9L 2WINB 4L23A 1HC1A 3Q4HA 5CZRA 5I5IA 4HA1A 3GI8L 1O9VA 1JWSA 2D7MA 3GSQA 4UMSA 5SWZA 3SBRA 3LRKA 4TQHA 1YECH 4B7IA 4YQXH 2X41A 4ENED 3HI5L 4FZ8L 4WFFE 2CTWA 4M5ZL 1HOCA 4FJCC 2NZ9D 4ALAL 5A2IH 4MCMA 1BG1A 2X7RB 3GMOA 4JG0L 3B34A 4J7ZA 3B8YA 3TPKA 3QRGL 3SGIA 1RJZA 1MLCA 4UT9A 1XGRB 4NKOB 3KLAB 4GG6F 1UD4A 4AM0Q 5BZDA 1JG9A 2J2ZB 4DPBX 2YAOA 1DBAL 2PPCA 4KKCC 1CG9A 3QTCA 3V6ZB 4G5ZL 5IVNA 2NY6D 1XEQA 2ZCHL 3WENA 3WTWA 4R97B 1HXMA 1XHZA 4A7GA 4B0MM 1BZ8A 3IMSA 1XH2A 4HAKA 3BUYB 2XFXB 2IIJA 3BKYH 2G4GA 2R1WA 1J7VR 4ZSOA 3BX7C 3DMMB 1VZHA 1KXVA 2EDYA 3CH1A 4R0LB 4JRYB 4XAWH 1JF6A 1KV7A 3H2QA 4KTDH 3ALWA 1LEKA 3CPUA 2WA3A 1NJ9A 4XNQB 4I18A 4AK1A 2N7SA 3FHAA 4F7CB 3I74A 1LEGB 2QQNH 3TBTB 4CVXB 4GFTB 1QFPA 5DJ0A 5F97E 4R7CA 1NM4A 3JARA 4LPWA 4Z95H 1OF2A 2VDNB 3HC4L 4Q9BA 4G83A 3L73H 3OC8A 5CNHA 3NTCH 5E2UL 1EXGA 3RNQA 3QDAA 1FV1A 3ARGC 4YFDB 4BFEA 1IEAB 5IROD 1N9PA 3S35X 1Z3GL 5AOMA 3A4FA 3OMNB 4LMQI 4ADGA 2AVGA 2FLMA 2ZXDA 4OF0A 2WD0A 3FT4B 1FFNA 5FPRA 1DN0B 1XCWA 4OKDA 4ZMOA 3F7QA 1NKOA 5GGRY 3VI4F 5T3ZE 2QADB 5F1NB 2UUDH 2WPDG 2Z92A 4PRID 3FXIC 4OVUA 4ZMAT 5JOFA 2K9FB 2W88A 4UYQA 2PP9A 4JN2A 5IG7A 2WC7A 3KGRA 1MFMA 5GRUL 5KEZA 4FYRA 4KJYB 3ROLB 3LD8C 2CCVA 1TUBA 4P5KA 2Z8WC 1RIHH 3JD1A 2IH1C 2CTQA 5L2KB 3FUEA 3CSXA 5B3SC 2DWSA 2ADGA 1NR1A 3NIFE 5T33L 3UGEA 1DBBH 3E2HC 4XBFA 5KAQF 3LZFL 2NSXA 4HAFA 3K06A 5BMFL 5C7XL 1QACA 3TCLB 1MJ8L 3RWHB 1IILE 4NNPL 1EJ6A 1WA2X 2FQFA 3U0TB 2ZD0A 4EEEA 1KG0B 4B7KA 3UEZA 4DP7X 4BSWA 5GTHZ 2MPAL 3FQYA 1KB5L 5G55A 2YAPA 1Q72H 2AZ0A 4PTTB 1JZDC 1MQKH 2BJMH 2ATKA 3P4MA 2V33A 1IVLA 2WZ0A 3P69A 5F1IA 1Z5WA 4AT6B 2LT9A 5C0CB 3NBNA 2BZCA 1BA9A 1HHIA 4YIQA 4G8IA 2ORBL 3RWIB 4WUUB 3LKPB 1T04B 2NZIA 2DMCA 5B1NA 2L6LA 1HKLH 4GW4A 4I48B 4PJXE 3CCHA 3GHPA 3HZMB 1PTZA 2D2CB 4GG6B 3BZ5A 4HXBL 4ANWA 4GT1A 3BXNB 1BLNB 4DKAA 4P5TD 1CXKA 4V1DD 4PH8A 4DGYL 4PA7A 3IBEA 1BW8A 4ZJ9A 1K2DA 2AXGA 3F85A 1JFQH 1PEWA 1QBLH 2O5XL 3U1SH 3K74B 1U8MB 4OZFH 1NM9A 2CO3A 4GRWE 1NCHA 4XCCL 2VXVL 1GTFA 4MW8A 3BPCA 3JYBA 3SBWC 3TNNB 1NH2B 4Q9RL 5KYNA 1UWGL 3PL6B 4X7FC 1NINA 2YAEA 3QQDA 4U7NA 5E8OB 2BOCA 5DI8B 1SXCA 2BSRA 4M1CD 5I6NA 1JX9A 1GGCL 1G7LB 3ZUNC 3UYRL 2JSFA 2VABB 3B9DA 4O2BB 2ODIA 3ZE1E 1C12A 4D0BA 3QQNA 4ZNEA 1CFSB 3GK8H 3JYCA 3JSNA 3FH5A 4Q2ZA 2I07B 1MEXL 2A9BA 3VXNA 4WTZA 4POYA 4FQLH 1CXZB 4C55A 5H94A 4NPKA 2F23A 5DWUL 3VI4B 4PWFA 1WP8A 2CO4A 3O6KH 2CDGB 3STLA 5CM1A 4KKRA 3RDTA 1AHWC 3X14B 3BRFA 2AJVL 3L17A 3JCUZ 5KJ7E 3MYZA 2BNRB 3UTPD 1VFBB 4HH8A 4LF3A 2ZX5A 2IWKA 5F7EL 4JAUA 5LQBL 1YEHH 5HJDA 2HX8A 3CZEA 2XG5B 2XN9A 3TBVB 4NUJB 2GY5A 4OZFA 5D2LA 1BX2B 1AJNA 1ZLZA 4H33A 1GGTA 2W0FB 4NC2B 3HRPA 3W9EB 1ZHKB 3ARBA 1WBYB 5BV7C 3M8OL 2D3JA 1B0WA 5GGVH 3ETDA 5ITZB 1RFYA 1J5OH 1S5HC 4IBUA 5BJTB 3MRMA 4M7LT 4X98A 4H26B 2PW2B 1WDAA 1A9EA 1UJ3C 2IBBA 3IK2A 4GBXB 5LL6Y 3UQ8A 1CFBA 2NCEA 4ODSH 4DR7O 5KVGH 3ZMRA 2I9LB 3ZQWA 3VU2A 1QEWA 4GEJA 1Z5YD 2Q3ZA 3RZCB 1MFAH 2AV7B 1YYML 1N5AB 2OP4L 3QO1A 5H37G 3VXMB 3LQZB 3TP4A 4GW5B 4X1IB 1ZHLB 2B0SL 4TQPA 1LO3L 5DA0B 1ECYA 3QCVL 1G84A 2VQFO 3VYPA 4YNYA 4ZMPA 2HG5C 4UCTA 4IRJD 3WLBB 4H8WH 3BH8A 1G7HA 3MO1A 3NA9L 4D7SA 2NXYD 1QLEH 1QBAA 3OJVC 1WA0X 2HMID 2FHCA 4E9WA 5HHMB 4Q52A 3IKKA 1XCTA 4NQSA 5KS9A 3BP4A 3X3GL 2MOQA 1BXVA 1H3GA 3L3KA 4EFEA 4AH2A 1BLIA 3D4GA 3F7YB 1N0LA 5A2BA 4OLVH 3RIKA 1GA2A 2MNJB 3OKNA 5FLVA 1OCOB 4DK5A 5IVOA 3SD5A 5BO0D 3IJSB 4HKXB 2Q8VA 5C3LD 4PRIE 4U1JB 3V0AC 5ILTH 1MUJB 4EB6B 4Z3TA 1K72A 2X4PB 1K3EA 4FFZH 2K6YA 1PZBA 4PWJA 4FEIA 4TYUA 1P7QA 4NKGB 1PAZA 1ND0B 5L3FA 1Q6HA 1E9PB 4W9IC 3VFRA 3QIBA 3MLTA 3S4SB 4I7ZC 4DF9A 1OOAA 3K4AA 2NY0C 4YL9A 2XT9A 2CM6A 2VLKD 2YGOA 3HC3L 4FXKB 2EDWA 3EYOA 2F43G 1SXNA 2P5WA 4KDWA 3UTQB 3KG2A 1P7BA 1CK0H 1J1OH 2X89D 2Q69A 1KTBA 2Y5TB 3U83A 1KTDB 4JK0D 2YOCA 1DANT 3QJXA 1ZGLB 3WE1A 4M6NL 3PHQA 2ED7A 4ZPTB 4ZS7L 4ZK8A 1J5EB 1ZT4A 3VE0A 4GT7A 3UPRA 4TL5A 2D7PA 3UXFA 1T5KA 3QZMA 3O4OB 4X7SH 2A9NL 4OV5A 3FH8A 4BUHA 3ECBA 4W1TA 3RWCB 5CD3B 5JR1H 5L6YH 2ZIOA 1A4JB 3Q05A 2FE0A 3NK3A 3O3AB 4YVUA 1VF5B 5DZPA 4JI8B 5F6HJ 3W0WA 4A7TA 1PZ5B 3QZWB 4L4TA 3IDMB 5HYJE 5GONB 3CCRV 2Y69C 1PF3A 3GYRA 3ARZA 1S9WA 1JXKA 5D7IE 1KEMH 2DQGL 3QWRD 4FFZA 3QUMH 4K7PL 1T2QL 3ULUL 3UCSC 2OIGA 4UQIM 4EI6A 4JY4A 4UDTA 2X4QA 1SY6L 5B4MD 5DK2B 5F70A 5GGRB 4LCYB 2KZBA 1GKEA 4V1DE 2N05A 4UQCA 4MAUH 2DQFB 1XGPA 3T4AA 3FN9A 1BM7A 2UUAO 3S8FB 3RWFB 3OMAB 1FBIH 2ZUWA 3F7LA 2A9DA 3GC3A 1C08A 1QHTA 2OI9C 3WTSA 4LLVB 4IOFD 2DZEA 3L9BA 4B9YA 4R50A 5AKSA 2ZDIC 2D7OA 4NKMB 1FPOA 4RWUA 2LW1A 4MNQB 4OZHA 1XBRA 4N2BA 1GS8A 5CWSB 3REWA 1M7IA 1EDQA 3K8MA 4PG9B 2Q20A 2QGDA 3FT9A 4HS8L 3PG2A 5JXED 3GUFA 4NYLA 1DVFB 2R15A 2R70A 4OD3H 4XO5A 3VM7A 1Z3RA 4FADA 4F5CA 1FFQA 2XV6B 3GIZL 2AQRA 2JJVA 3BIKA 4G6JL 5GZOC 2CDEA 3SBQA 4AYDC 3VQMA 4F8PA 3A23A 5E9DE 1T1YA 4EOWH 3DO7B 4HD9A 3BEVA 2J12B 4X8JA 4HS3B 5K9OA 3JZYA 3C6SB 3H1ZA 2G38A 1R46A 5HSFA 3M86A 4H8QA 3ML8A 2B08A 2B8OT 1GZQB 2VDRL 2X6CA 3QUMA 2H0EA 3NACH 3RJDA 4TPRL 4PD4J 1YY9C 1FNEB 2JELL 4GG8A 1C5BH 4Y9CA 4Z8FH 2JIXD 1ZSHA 3UTPE 2C1OA 1CD8A 2FJFA 1U0QA 4JFXB 3VFWB 4M6AA 1JMZA 3L9RB 4C56E 2VT0A 1E28A 1WAAF 3EYVA 1D5NA 3ZDZE 1IJ9A 3AAZB 4LL4A 1HH6B 3F7VC 3JAWB 4UZUA 1SERA 2WP3O 3QUKA 2VM9A 1E4KC 2HPTA 1O6SA 5AUMA 3LKSA 2DJUA 4QGTA 2YPKB 4JZ2A 2UXBB 3CVIH 2FQEA 1SS3A 5IBUB 1WUNT 3EBGA 3VWKA 1NUGA 2DIAA 4WK4B 5I1JL 4NKDB 2APTA 4IRZL 4TV9A 2XWZA 1ACYH 5FM5M 5D5QA 4QHNB 2BW4A 3AY4A 3ESMA 5CHNA 5B7EA 5LG1A 4JM2A 1Q9WB 3ULUE 1MWAH 4XCYA 4F33B 2DB8A 2FX8L 3KXFA 4NQCD 4RISH 3FO2B 2HJKB 3I2CL 2KLTA 2HG0A 4LPXA 1EJOL 1U36A 2NY2B 4MNGA 1PPJH 1MVUB 4I77L 4R6ZA 4XMPL 2VSMB 4AGLA 2J1YA 2VLRD 4YR6A 3O0LA 2EEBA 3BVUA 3M46A 5C09B 4GQZA 5T1MA 3QE5A 2M26A 4G6FB 4ZX5A 3TM6A 4K8XA 2EXTA 4HDIA 4JFYB 3JUZA 3FTSA 4ZDHB 4AEIH 4NNYA 2EYTB 1HINL 1AVAA 3NJKA 1E8ZA 2NR6C 2G3MA 2I26N 1G0DA 3GXFA 5L8KB 1JHLL 2FX7L 3MRBA 3P4NA 4ES9A 3UTZA 2BDNH 3B5GA 2IFFH 3B7SA 3LDEA 2FCBA 2BHYA 2J6EH 3F7KA 3KL3A 4TUJB 1FSKC 2R9AA 3CFBB 1IEBB 3K08A 3NCYP 4A7QA 4GW1A 5EU3B 3WN6A 4HX1A 2WV3A 5IBLD 4W4KA 4WWKA 2DM4A 1XZWA 1MW2A 2IPTL 1I75A 5FDWB 5I0YA 4LFBB 3K6SA 4GKKO 3EXJA 2VN6A 1ZLVK 3WXWL 2CJUL 1W0VB 5J3HC 2WLKA 3G6JE 2GBAA 4FQHA 4JI1B 1MWAA 2AABL 2HHHO 2DQJL 4E42A 4FG4A 1KIQA 5F7YC 4A2EA 4A37A 4JFUA 5GS2H 2X0VA 1XF5A 1ZHBA 4ACTA 3RTQA 4P2YA 1FA4A 1H3TA 2ZKHH 3PQYD 3R19A 4CJ1A 4Y4KC 5KYUA 2YOAA 4RAIA 3A47A 4P2RD 4Z77A 1S7TA 1FJ1A 4A2DA 3MLXH 3GTTA 5MEOA 4N2FA 3ZHUA 3QO0A 3NH7H 4FDWA 2QV4A 3SY6A 5FK9A 5FFGA 3LKRB 1TO5A 4QT5A 3P2BA 4IHJA 4CZZA 1CGTA 2E5LO 2AV1A 2AXFA 2FIKB 2R9HC 5CJ8A 4F7KA 3ZMSA 1KXQE 2J6EA 1KC5H 4I85A 4KK5C 2YGPA 3H4FA 4UINL 4XVOA 3P3NA 3QQ9C 4MXQC 2F58H 4WY7L 2EJ7A 4X8GA 4Z3FA 5EOCJ 3EVKA 4JFQA 4MMYA 5F2VO 3VSQA 4J5VA 3OKMB 1A25A 2PO6A 1AIFB 4L3ED 4XNXL 4FK5C 3QR2A 1FAIH 3HZKB 2H0FA 3BWSA 4F37K 3FUJA 3SDCA 4WJG3 1KB5B 4WJ5B 5GGSB 5D71L 2HR3A 1KCBA 2DJMA 2XNDG 1MH5B 1ORQB 4ZUVB 3CXCU 3SB3A 5IB1B 1OARL 4LSSL 1DE4B 2UVEA 1W8EA 2HT2D 4DP9X 5EBWA 3DHMA 4UIMB 5FNVB 2N0MA 1CVSC 4QXUH 4HZAA 4KXZI 4X62O 1NAKL 1FHNA 3U10A 4X9FA 2ATPA 1VF6A 3CXHJ 3VG0L 4DHLA 2NDFA 5EORH 2V2TB 4DKFH 1GN2A 1VZGA 1EAPA 2ZX8A 4HV8B 5AOJA 5LN8A 3BUPA 3EOAA 4N0FB 1F58L 3OB0H 4PBWD 5ESVB 2EIDA 3PREA 3VDCA 1RUML 5HYIA 1F97A 3G6AB 4RQQA 2KSDA 2VS0A 2BOLA 2X9WA 5JZ7C 3GLDA 4PJ7E 4LIQH 5I17A 3N6YA 3UT5B 1B6QA 2YSSB 3GJFK 4ZXBA 3UJJH 2ARHA 1TGOA 5E8EB 2ZWSA 5LBVA 5AAPA 1C5DA 4OCWL 3PS6A 4XBEL 2NY5L 2OMYA 1AIZA 3IMUA 2VDKL 4UILH 4IMLA 4AUYA 4CDGC 1NFKA 2GJ6D 3QWNA 1RPQA 2G2RB 3ETSA 2P3YA 3IGAC 3L7EB 4OCMC 3FQ1A 4H5SA 3OAYK 3R1GL 5CJQL 1I7TB 5GW7A 3H6JA 1R19A 3NCMA 1HILB 4PJ5D 4M3KB 1MCFA 1W16A 5I5RA 1SYVB 3WEBA 1AO7D 2QPFA 2VAAA 4AUUA 1JF1B 4QYOB 3L3IA 3OF6D 2YD9A 2VJ8A 5FYKU 3DGEA 1FYTD 2ED9A 3W5MA 3FFCB 4F91B 4NQCE 2R72A 4KZDH 1GYAA 4OXSA 4K71C 1U8OB 5D1QA 3NIGB 3VACA 2ZCKL 2RMNA 4OZGE 3QF7A 1X5YA 4D9RE 3ISYA 2R56L 4YFEA 4YGVB 5KSBE 1BEXA 3VW3H 4N5EC 1UA6H 4HKBA 1X7QA 3MLUL 1NMBH 3ULUF 3DRTA 5I23A 2AK1H 1P4BH 1UB5A 2JKTM 3OKEA 5TDOA 3RVTD 2YRPA 5T1KD 1JAEA 1NEZG 5DD5H 4XZUB 4RFEB 1IBKB 3L71H 3IMBA 4J3TA 1IXBA 3IU4H 2V1DA 1DLBA 1MCWM 4NN6C 2AZUA 4QXTA 5DXWA 3ARTA 2K6ZA 4OLUL 4B9IA 3HC0B 3RWEA 5HYJB 2Q3AA 1B06A 3DTUB 5IGXH 4Y5VA 4YDVA 4PW4A 3N9GL 4BIOA 1LD9A 1MHHA 4LEXL 4MB1A 5FUCE 3CVHB 3OAUH 1WWAX 3BAJA 3UZEC 4PYHA 3MFFB 1SETA 1R3KC 1BOYA 3WIFB 4HLJA 2I69A 4XTRC 4G8GA 3P30H 5T3XL 1M1SA 4G7VL 4ORZC 1UXWA 2UWEE 4KNSA 4AGQA 2JS3A 3PYCA 4L37B 2YAMA 4FFBB 5CB4A 3UZVB 1QSED 3F5WC 1O9ZA 8CGTA 1A5FH 4HIJA 1IGIL 4ZI7A 4CMHC 1Q6UA 4G27B 4LP4A 3PQYE 1D5ZB 2WLNA 1M9NA 4X5XB 4OSUH 4O5LH 3FCUB 5IW1B 1VADA 3G6JF 3IFPA 1K4CA 1WPBA 3R8QA 1TYJA 1IAII 1KY6A 2VSCA 5C0RL 5I30L 5JPMC 3W7SA 1BXXA 5EBLC 3OTTA 4P9HH 2X53A 4RRPG 5DQDL 4Y1AE 5I1DA 1JUFA 1AR1C 1U97A 3AG3B 4QY8A 3TO4C 1KZYA 2JB6B 4IM8A 1N6QH 1WTLA 2OSLA 1W2BU 5E9DB 3WFCH 2DD8L 3CN0A 5A2JH 3ZTNL 3UG3A 5DRNB 4CVWA 4L29B 4UZGA 3N2GA 3ZTJG 4HQQL 4DO2A 1Q9LA 1SOXA 2X42A 4H8UA 4PJFA 3LMJL 4FMVA 4K2UH 5DZLA 5F9AC 1CCZA 2PR4L 4R5XA 2FHBA 1BD2E 2P5EA 1FYJA 1XGZA 2ITCB 1F2XK 2XI9A 3P30A 3BP7B 4J7JA 3ABTA 2YJQA 4X4KA 1UT2A 4ZOLB 2VDNH 4XNBA 3PCYA 1SQFA 5C2UB 5GGUB 4C56B 3RBZA 4XPBL 3MR9A 2E7HA 1DVSA 1GMEA 1FXKC 2GBTA 4QHMA 3K6OA 1YYLH 3S3PA 5FGRA 2CALA 3SE3C 1AD9B 1NMCC 2DYPD 2FNBA 3B2UD 3GMNB 4WW2C 1XGTA 3BZ4B 3DPBB 2XKUA 3A67L 5LGJB 3GHEL 3QQ4B 4FN0A 2O4EA 3MV7E 3RGVC 1XGRA 4NKOA 2Y07H 4KO7A 1UB6B 4TNVK 2IOIA 3V6ZA 3UGUA 1MWOA 1NGZB 2J8HA 3SPVB 3WKNA 5L9DL 5E8NA 1E6JL 3QNZB 1CFVH 1CMOA 1NBZA 1F41A 1L5GA 2K1EA 2PP7A 4FYTA 3MLRH 4PCKA 1WH0A 2Z7ZA 3E8FA 3GRGA 2R69H 1OCZB 2FLBT 4MA3B 5JQGB 4GMSL 5FO2A 2OXHB 5K9QG 1IAIL 1WP7A 4JRYA 4XH2B 1N6VA 1RERA 4WWID 5F9WC 3SDAD 4ELKB 4GINA 2WBXA 2O6PA 4N0CD 2WBWB 4MVBD 1JK9A 4XNQA 1KP2A 4YSPA 4YUEH 4F7CA 4TTDD 5T1LA 2WXQA 4DCQA 1LEGA 4HIXH 4LLUB 3TBTA 5GS0H 5LMUO 1KTRL 5KOVC 1YN7B 3J7HA 3FU0A 3C6LC 5EIBD 1HW7A 1NTKH 2CE6A 3AG1C 2GBUA 2ZP8A 3K3WA 4I88A 4TM9A 3FQ4A 3HMWH 4YHIB 2VMJA 4GIOA 4LLQB 1QA9A 3GSUA 3EAKA 3FX7A 5FFLA 1KXVC 4LSVH 5T1DL 4ZKIA 1SDDB 3QDJD 2EC8A 2GJZB 2Z7WA 5HDOA 2P67A 5CINL 4I18C 3WG7C 1AO7E 5F7MC 4AVIA 2XQBL 2R4RL 1NDGB 1D2DA 3WU2Z 1JL8A 4YC2B 3G6JB 4BGLA 4FLUA 5EOTA 4PDMA 1G7PB 1AROP 4KJYA 3ROLA 3KWUA 3BOVA 1FYTE 1IARB 3CFQA 5I0WA 3SPGA 4N8VG 2NYYD 1PLBA 2OZ4H 2WNXA 3OGCA 3UPAA 3QZLA 4JO1H 4U2YA 3JWOH 3V5HA 5I8OL 3EOTL 12E8L 2J5LC 1L7IH 4PJGE 2R69A 3TXSA 1FNHA 4FRWA 2XOTA 3HAEH 5E0QA 1QFWM 1YMME 3F83A 3V52H 1JPGA 1G43A 2V8LA 2DMBA 2O57A 2ZUUA 4V11A 2Q1EA 3O41A 4OGAC 3RX7A 4C57C 3QWQB 3MZTA 2EXSA 3EHBB 1DZBA 3U0TA 4J12A 3VVVA 4NENB 3LTVA 3V6BR 1XQ4A 5DECA 2O30A 5IEHB 1AG6A 4NBZB 4OZGF 4GRMB 2BMKA 3L6FA 3O6FD 4P9OA 4H0LC 4IKIA 3D0VB 4KK9D 5CAYB 1G1YA 3O2DH 4DV1B 1MIMH 2ZOWA 3CBRA 4K94H 3BN3B 3NSXA 4X6FB 3A6CH 5DMJB 3VBBA 2MKWA 1J05A 4H44B 1BQLL 4Q8BA 5C0CA 1EFRG 1NAMB 4P2ZA 1T04A 1J1XL 4J41A 3OR6B 3QIWD 4A2HA 2M8XA 4Z3GA 2FO4B 1TKWB 2JKXA 3QULA 1S5JA 2HVKB 4GCZA 1BEYH 5JHDB 1RZQA 5IUCA 1VQMV 1J8RA 1WF5A 1QW8A 1LE5A 1X5KA 4APXB 2YARA 3BXNA 1BLNA 4HPYL 2QQQA 1I3RA 4YDKH 3N1FC 2OZ4A 4JI4O 1E40A 2ATKC 2OMTA 2OS7A 1HDMB 4Q6YA 4IU2B 1QSEE 3LXAA 3V0GA 3HAEA 1THZA 3CH8A 5PCYA 5DMGD 1Y6MR 3E1ZA 5DTFA 2E75C 1AXIB 4P30A 1GGBH 1JA8A 4MVRA 4YAQA 2DJVA 2WXHA 5IMKA 2UWEF 1I31A 5DFVC 1QZNA 4NQVB 2Q7EA 4RAVA 1C16B 2HFEA 4M56A 3REVB 3MUGA 2VABA 4FQXC 3NR7A 2ED8A 3CHXA 4RZKA 3O2DA 2APBA 5B1BB 1OSZA 3ETEA 2EIZB 5F7NC 4ESKA 5KSAD 4X4YB 1X5JA 1INEL 1AKPA 4H2CA 3PJSB 3WB2A 3CIAA 4WFGA 2ZT9C 5EZOH 4PS8A 5HBBA 2ED6A 1IJNA 3T0ED 4IW4C 3VI4A 2XV3A 4MVSA 3HS8A 1J0ZA 3D50A 5J2UB 1T03H 1CZ8H 2APFA 3E8HA 2BOCC 2ZM6B 5LUMA 3DYOA 2NTFA 5KYWB 3RJQB 1N26A 2A79B 1IM9D 2X6BA 1UPGA 3B8SA 5BR8B 1KLGB 2BNRA 4P3DB 5A2FA 1KXTA 2WGXA 4FHKA 1WD8A 2MK3A 2OTLV 1T5XA 3TBVA 2BHFA 4IDJL 3WJMB 4NUJA 4YXLH 1AS7A 4FFTA 1CXIA 2SEBB 4GP5B 2W0FA 3W9EA 1K8AW 1ZHKA 3BGFB 1JI1A 2JKSA 3L3OA 3QQ3B 5KW9L 4J11A 1G0XA 2B4CC 1AGBB 1LMKA 5ITZA 3B6SB 2Y0IA 4BW9A 1MCWW 4NZUH 5BJTA 4B3TB 2PP8A 3WJJC 3STLC 5I6MA 2GFBA 3SYPA 2DIJA 2PW2A 3RDTC 2YXHA 3SKJL 1JNLL 4GBXA 5HHXH 5K59F 2AEWA 1UCTA 2PPFA 2H1PL 1EN4A 3MJ6A 3PABB 2KL6A 1CYGA 5KSVA 4OZGB 3K2KA 2E6PA 1D5IH 1YVWA 3NCEB 3RZCA 3PPSA 2QWQB 4HK0B 1N5AA 3VXMA 2GEEA 5KANG 3H9HA 4GW5A 1ZHLA 3C08L 3ARBC 1T7WA 3VD5A 2AHZA 3ZHSA 2J1XA 3P11L 3KYNA 4U05A 5FF6B 4G43B 3WLBA 4HJTA 1CXFA 4GO9A 3AT0A 3C09B 3DJSA 3D7PA 4HJ0D 2KKQA 2CCWA 1RSYA 5B3JE 4EPSA 2OR9H 3D4CA 2LW7A 4LF8B 1N32O 1CJYA 2VXQH 5GRVK 5INCB 4AGOA 4B9GA 1AP6A 2PUQT 4OI8A 4DR2O 1SOSA 2KPWA 3MU3A 4LNRB 3WDHA 2GSIB 4LPYA 2WJ5A 5FYLH 4WI5A 2VZ1A 1IB5A 1WA1X 2ZKWA 4JMXA 5DD3L 2AF2A 3GEFA 1XGUA 3IJSA 4PJIA 3I3BA 2Y06L 4X5PA 1EZVX 2XLLA 4UOZA 2X4PA 3FH7A 4XOEA 4XDLA 1SFDA 4F27A 1R24B 1JGLL 4RGND 1RZIB 3QT2A 2UWEB 1ND0A 3Q13A 5BO1L 4DGUA 2C7FA 2P8PB 3MRCA 1DJIA 3BT2H 3D0LB 5EF3A 3BH9B 2HYMA 3S4SA 1JK8B 3HFML 1PFOA 5C9JA 4G8EB 5HGHB 4K5NA 1SVZA 2VDKB 2CLVB 1NC4A 5J6HA 4E0RA 4XVJL 3CQQA 5ID1B 3ZDXE 2NY4C 4BRJA 1NKRA 2VR7A 1KTDA 4O58H 4U1HB 5EF0A 3DK2A 2CCLA 4NRYB 4H8HA 3MNZA 5BVPH 3G5WA 2N1TE 4Y1AB 1CFNA 2A4EA 3I6KB 2K9PA 5DT1H 5C0EA 5JQ6H 3AK3A 2VXQA 5L0QC 2J72A 3QIBC 3CFDA 2LJ2A 4PA6A 1S7WB 3PWNA 3RWCA 4HCRL 3LOWA 4DK6A 4MCZB 1VQ9V 1A4JA 1DBJL 4PGCB 2ZNXA 3DV6B 1INQB 3O3AA 3KNBB 1IBBA 4D7PA 2G60H 3QHFL 3KM2A 4JPWL 1GH6A 3EO0B 4J9YB 4XXDB 3B4SA 5GONA 3VRJB 2X4NA 1BD2B 1DQIA 2YEVA 1A22B 1MY5A 1IT9H 1T89C 5EOCH 3EH2A 1G1OA 3CX2A 4H8WC 4LLYB 4B3MO 5D5ME 1T1XB 4Q6IA 5DK2A 3SO3B 1QLEC 2X5PA 3HKZA 4LCYA 5GGRA 2VRAA 3MLWH 3V10A 2WOBA 4B41A 3D39E 1WE5A 1OT2A 5IQOA 5H35B 1FL6B 1EHLH 2VLME 1INDH 3TA3D 4PWHA 2PTTB 4N2CA 3MV7B 3BO8B 5T3ZH 3VOUA 4ZD3L 4FABH 1X44A 3LVEA 4QE7A 4NKMA 4Y2NA 5EC1A 3PXLA 4YHKL 5D1XB 1G7JB 4TNWF 5CWSA 4YDNA 3AY2A 1HIMH 3MTXA 1S0VA 2YLKA 4G7YH 3RW0A 5CFHA 2BVEA 5I26A 1DVFA 4MMZB 3DC5A 3WTXA 3KL0A 1LR1A 4PSRA 3RL2B 4GXVL 1FHGA 3EBHA 2RDCA 1NCCH 1RZJL 2ZE7A 5ADOL 2FO1A 3BD3A 2X70A 1TUEB 2VH5H 4OVVA 5D4JA 3CZSA 4FZ8H 4LFCB 1K4DB 4FJZA 1FFTB 2UZIH 4POUB 1AGEB 5F9JA 1B0IA 4JG0H 1YNKL 4ANKA 3T0EE 1XF2B 2JXMB 5TISZ 3GIVA 3QRGH 1ZTMA 2OULB 3R66A 3L9EA 4BRVA 4YGAB 3N06B 4QJ4B 2EXWD 2HWZH 1AFVH 1BQSA 4M3HA 4AMWA 5GJSL 1YNTA 4G5ZH 3LS5L 3CCEV 2ZCHH 2IQ9L 3PDDA 3D25A 3VFWA 3U0WH 3RKPA 1JJ2U 3LEXB 3AAZA 4AQOA 3JAWA 3FOMB 4QOKB 1BXUA 2HX9A 1OV9A 1TT6A 3ZYIA 1DSWA 2JKIS 2YPKA 4NAQA 5FHAL 3Q8AA 1NBVL 1H2NA 1HSAB 2WOYA 1OGPA 4WFEE 1TETH 1FI8C 4HIIA 2GIMA 2Q0OC 4RIRB 3ILDA 4NKDA 3ZHDA 2VZ3A 2W9LA 3VTMA 3RFZA 2XWBB 1V7ML 2A73A 3IDXH 3PRZA 4GI9A 4NO3A 2L4OA 5DUMH 4RMVA 5E2VH 5F6IB 4RMTA 4X64B 2ZR3A 1IXMA 4GRWH 1YMMB 1YIJV 3ZZLA 3KPPB 5DD0H 4EIGB 3GTVA 3CDZB 1N0NA 1CTOA 3Q2NA 3EOBA 5DLML 1OO2A 3INOA 3A4EA 3NK4A 4NOBA 4E9RA 1TQBC 1UT9A 2BSTA 5IB3A 1AC0A 1JCHA 3NJXA 4MDIB 3LNFA 4JBSA 2XPGB 2EYTA 2ODHA 1K33A 2XHBA 3AY4C 1KKDA 3MYJB 4G6KH 4JM2C 5SWSB 2FEDD 1HU8A 4M7JH 1KT2B 1VQPV 2QPEB 2R2HB 4B3SB 4U7SA 6FABL 5AYTA 2Z7YA 4TUJA 1V55B 1IEBA 5T33H 4DQAA 1SBSH 5D4QA 5IFHH 2YPLE 4PJXA 1W15A 4ZUSA 1YUKB 1KUQA 5B3JF 3U4EB 4K8RD 5A9GA 1U9KA 1CGUA 5FDWA 4CSSA 4RGNE 5TE6L 3C5JA 5A2LH 3AK2A 3IS0X 2VZOA 1OAXL 3RVVD 2P1YA 3O3BA 1VAHA 4DXWA 5JPNA 3CX5J 2MPAH 1YN6A 3G4SV 3T8XB 5HGBB 3GD1C 2Y4TA 4DV6B 2Z31B 3JV4A 1JF5A 2XY2A 3C5SB 3ZN0A 2OTUB 2KDYA 3DGDA 1QRNA 3K91A 4NS0A 1IQDA 1AS6A 4YK4C 3O2WH 2JI1A 3Q5YA 3D85B 4LL9A 4WWKC 5KVFL 3UC2A 3JWDL 4XNZB 2OJZL 4IS6B 4Y5YB 1RUPL 1USQA 5CA1B 4XN7A 3C5ZB 5FYJU 4HBCL 4KK8C 4YXWG 4U1IA 1FZKB 1ZK5A 4I13B 2FR4B 1ZS2A 3TURA 5AL0A 3LKRA 5D7EA 5T5FL 4U7KA 1CTNA 5IIEB 5EFIB 4RZCB 3KZIZ 1EAOA 3ZDXF 1UM4H 4BHUI 1RXLA 4O4IB 1R6VA 1AYRA 3ALPA 4UV7H 1Q38A 2ZAIA 3O11B 1LM8V 1WFNA 1OSPL 5KA6A 4X9YA 3RTQC 2VXVH 3GEWB 1OGTB 4J6RH 4WGVB 3LQAH 5IJVA 2ITDB 4ZX4A 1UG9A 5EO1B 2QSAA 5AW9B 4XVSL 2R27A 3TO2B 1JN6B 2WYTA 1GGIL 1WIOA 4U1KA 3WLWD 2D7TL 4MNHB 1KUMA 5I75B 4WJ5A 2Q9OA 1KN4L 5EUOE 5IR1A 5EA0H 1MH5A 4IRSC 3J7AU 4U1SB 5LOVA 1SEQL 2Y3NA 4IHBA 5TDNB 1KACB 1U2CA 2CZNA 2FEEL 1N36O 3L1FA 4FNLL 2JKLA 4XPAL 1A1MA 1S9KC 5BMVB 2GBVA 4MZ3A 4DR5B 4RGMC 4QJ5B 2C1PB 4N0YL 5CZVH 2PWFA 1TJHH 1KN2H 2IDCA 1OAUH 1PLGL 2PO6C 4NN5B 2C9XA 4DZ8B 3S37L 1D2PA 4MBRA 4HV8A 3QJHB 1A3ZA 1RPRA 3SDCC 4N0FA 4FL4B 3HC2A 1JPFA 4QXVA 2P22C 4EI5B 5AB9A 1QP1A 3T3MF 4BK5A 4UTBL 1VF7A 2RN9A 2ERJB 4DH2A 5EBWC 4RQFA 3NJVA 5TTRA 3VFTB 2ROXA 1A6AB 2WYIA 1SJHB 1I9RH 1ZA3B 2IBZX 3DC0A 4WK2B 3UT5A 2YSSA 1R4XA 3WTUA 3WNKA 3W82A 1QCEA 5E8EA 1QX1A 1VF6C 1JZJA 5IROA 5E2WL 2ZINA 1J0HA 1F8TL 2F61A 4UQDA 1W8OA 3Q8CA 3PIQB 2Q5BA 1KDIA 1NCWL 2G2RA 2XQYK 2NY1D 4BBWA 5TDPB 1LK3H 3L7EA 5KBNC 4OD1H 4HHAA 4PRIA 4BKLB 3CVHH 4XGZA 3FMGL 1AY1H 4QO1B 4UIKL 3MAWA 2B0SH 1U8PA 2NY3C 1SYVA 3MV8D 5LCVH 4ZXBC 5C6TL 5HDQL 2Q0ZX 3GMQA 3QO8A 4AGMA 2QEXV 5EEZA 5IFJA 3QVNA 3NA9H 4PLJC 3W39B 3ZMEA 3CZUB 5ALBL 4XPTL 4D0DB 1DEDA 2WLLA 1J9RA 1OSYA 1OAYL 4XCEB 3DURB 2GV9A 1U8OA 3TV3L 5FECB 4B3RB 3O9OA 2W65B 4U31A 5JLZB 3T09A 4QR7A 5IQ7H 3K59A 1BVNT 3ZDXB 4WF7A 2XAJA 3BHBA 3B2VL 2BSKB 4A2MA 2HUHA 4HU8A 1AQDB 3VJ6A 2YN3A 1ZV5A 4R8CA 4BEIA 3GXIA 2QSTA 1PNDA 2XAQA 4BXSV 1KBKA 3O6FB 1KMGA 1KCVL 3K0DA 1E3FA 2JCWA 1X5XA 3ZRSA 5HHPA 1BOGB 4WAFA 1VIWA 2A9ML 3NZSA 4KRPB 5L3EA 4HD5A 2ADIA 2XVBA 1F4WH 2XWCA 3QIWB 3UROR 5D1QC 3QAQA 3QSKB 2HJFA 2OTPA 3HC0A 5DCCA 3US9A 3VD2A 5E00B 5D7IA 3S2AA 3CVHA 4R96B 2H9GB 3QDGD 2HJDA 3HC3H 3MFFA 2EUXA 2HRHA 1T0MA 2GJPA 4EDWL 3WIFA 1JHKH 3HS0B 5LCVA 4P5TA 2VXSH 3H42L 4V1DA 5BUPA 5HVHB 1K85A 1W72L 3R06A 2UY7B 3DRQB 3WO4B 3GMRB 2ESVE 1OHZA 3D39B 4BK4A 4X6BA 3QORC 4FFBA 1JRHI 4Y19B 2LGQA 1OTUC 2EKJA 1KKCA 3KDMB 4OGQC 2E74B 5FOJA 1F11B 4HWEL 2RCVA 4Z9KB 4YSSA 4Y5VC 1UACL 3HCVB 4FNSA 3NZHL 3T3MB 1AC6A 1Z5VA 3C60B 1Z9LA 3N2KA 5DU7A 5AENA 1JZEA 5DRWB 1ROWA 1R3LA 3K2UL 2R7EB 4DGIH 2VQFB 5DUBA 4HLZG 1I94B 2A1WL 2YXVA 1D5XA 1KCSL 3ULUH 4F57L 3ARGD 1CF1A 5LJYH 2I24N 5MI0B 1TZOA 4MZ2A 1RK7A 1UFUA 2IXQB 4KQ4L 2JB6A 4FQPA 4TVUA 5E9DA 3KH3A 1KJ2H 4NC1C 4XVUC 2CUGA 2IADA 4L29A 2BZ7A 1LDPL 1PL3A 3LYRA 1ML0A 4YSDA 4L8SA 3F7RA 5F9OH 2E4FA 3FBQA 4J3SA 1NBMG 2CBOA 3T71A 2BSCA 4MZIA 2A6IB 4MB3A 1BQZA 5FCSH 5F7DB 5DJCB 3FQNB 3NJIA 1K4CC 4N6QA 2ITCA 3ARWA 3BJ91 3MJ9L 3T4ZA 5KVDL 1P4RA 1MCKA 4BIZA 2HKFH 3UABA 4C56A 3CFEB 2DQHL 3B5HA 4M1GL 4M7LH 2IH3B 2G30A 4R6UA 1ACZA 4G6JH 1D9KB 2OL3H 3BZ4A 5LGJA 5FOBB 2X2IA 3QQ4A 4RAUA 3THOA 4ODTL 1U8IB 3WFHB 3N1GC 4XN4A 3BRDA 5B1OA 4JVWA 5IV2A 4C58B 1UB6A 3T2QA 3CCVV 5EIIG 1MZYA 1BXAA 2DLFL 3EYFA 1QKZH 4JFDD 2EYRB 1K5NB 1NGZA 1OGAD 4KNUA 2A4CA 3DVIA 5EUOF 1IFGA 3HPJB 1NGXA 2YEQA 4KROC 3WHE1 2L7QA 2XWDA 4NQTA 2JELH 3PWLA 4GRLD 1IC4L 4RNRB 4X9QA 1I7ZA 1KJ2A 1DFBH 4N2OA 4APQB 4YLCA 4NQQA 4N25A 3S36H 2KUTA 1KIUB 4IRJA 4ELKA 3QUZB 4ONGH 2ZSVA 3CFCL 3BUQA 2XETA 1LNQA 1TLMA 2JEUA 1I0HA 2EILC 1YSOA 4R97C 4P9HC 3P1VA 1JMXA 2CRMA 4NEHB 2GQHA 1NCIA 1S9YB 1FVDA 1T66C 5ENWB 3KCXA 3RU8L 3S35L 1IUZA 2D31B 1WBZA 2EDRA 2JJSA 4I0PC 3WFVA 4NTYA 4JYCA 2X87A 3MBEB 4BH7A 2QWOB 2YPLB 2P5OA 1WICA 4P23C 1NAMH 2OL3A 1AXTH 1SDDA 3KPSD 4MYPA 3ZT5A 2B59A 4QTFA 3PP3K 3MV8E 1SN5A 2AEPH 4P5RA 1IO4C 4UV4L 4DUVA 3G6JA 1P9MA 2D7QA 3F65A 4OAWB 5J6SA 3K5LA 4E9VA 3WMQA 3IFXA 5IHWA 3T2OA 2F53D 3GQFA 4QXGL 4TNEA 3HR6A 3WNLA 4BFKA 4PJ9D 4OU3A 2P48B 5KVDE 2OM5A 4XMXA 5CCKH 1G9NL 3K81A 2R59A 2X89A 1JHLH 4ZOBA 3EGDA 3QP3A 4QWWC 1FL5B 1AI4A 1DSFL 2MHAA 2Q2LA 1EFXD 1BBDL 4HBQA 43C9B 1CT8A 3PF2A 5KHIA 3WSQH 3QEQD 4I9QA 1A47A 2WWOA 4PJHA 3RWGB 3K04A 3JTBA 3ESOA 5IJ9B 1GGUA 4GRMA 1A21A 4R7NA 3SGKA 5LKNA 3D2TA 1JDDA 2C9QA 3INUL 3OGCC 1MIEL 4JDTL 1HYRC 1ID2A 4LLMB 3RILA 1KXQA 1FGVH 4PY7B 1KLFB 1A7RL 5E9NA 4RDBA 4XMTA 1WRFA 1QVGU 5E4IA 2UZPA 3QDHA 1NAMA 2YHGA 3LHPL 2VQEB 4JHWL 4UQ3B 3VXQB 1CLYH 2FO4A 3QWRA 3W1ZA 2ID5A 2RD0A 4LEEA 2J20A 4ZAKD 3ZL1A 4I0XA 2YBGA 2QSCH 1ZL8B 4MLSA 2MWCA 1K9TA 2WA4A 2E7LA 4UT6H 4PVMA 1FPTL 5GS0C 2WWWA 1OAKH 5DK0A 2F19L 1Q9OB 1S7UA 1UOVA 2YUXA 2Z4TA 1Y07A 2D03L 3FB8B 3NFSL 3JV0A 1ZTEA 5LA6B 4PGDB 5EUOB 1XHXA 5C08D 3TA3B 3KPOB 3GMPA 3LN5B 1X4TA 1HDMA 2DQ6A 1N5YL 3DGCR 3Q1EA 5I1HH 4MS2A 3QXUA 3D52A 4X99B 3HVDA 1BDYA 2DEWX 3D05A 3NJFA 4LZKA 4W6WB 2YAHA 3DETC 1CXEA 4U6HB 2ENQA 3X1NA 3BI9X 4WY7H 5TPWL 3DVNB 1Z2KA 3TFKD 1P6WA 5J1AA 2CH8A 3REVA 2V5TA 4QEGA 4QCIB 4N8CL 2W9EH 4NM8L 4OF8A 4AITA 1TZHA 1A4CA 3JWOC 3P73B 1MHPL 2YRLA 1MG3C 2HAZA 2HTLC 2XTJD 3CCUV 3OAZH 2W60B 4WWOA 3EJUA 1BMGA 3T1HB 3PJSA 4PJ7A 4AKQA 3MA7A 1A4KA 1PNLA 3SE8H 5DQJA 5I1GL 5IB2A 4TL4A 4FLZA 1JWUB 3BH4A 4M6OH 4J3VA 1D7DA 4X9GA 2I32A 4B9KC 4BH8A 2R8SL 2FYYA 4CADB 3BZDA 2CH7B 4UT6A 1NFDF 4PDRA 2XZAL 3FT0A 5KYWA 2EE6A 1N59B 1VFMA 2H41A 4RAHA 2IPKB 2HFEC 1CN4A 3HKFA 4P3DA 5FYKE 5GHWL 1RU9L 4FG6C 3WEXA 5FW6A 4PS3A 2YEZB 1ZV2A 1NUNB 4K94C 3WJMA 1EXUA 1LEIB 3EJTA 1Q0YL 3JV6A 2D9QB 1LWRA 3KPMB 5CN1A 1NC2D 5GSVB 5I6OA 4TQEH 1UFGA 2OZNA 1BE3H 3SJVE 3QEUA 1AGBA 3B9KD 3B6SA 5C7ZA 4TOIA 2E9IA 4P57A 5K1NA 1JGDB 3L4CA 2HA1A 1KDJA 1OGAE 3LPWA 5KA5A 1G7IB 3WJLA 3MBXL 3EJZD 4NQCA 1ZCRA 4KVNL 3ABUA 1PW3A 2WBJD 2XVGA 2OCCB 5AVQB 3X13A 1BJMA 4OZGA 5LHGA 3FTXA 2VXUL 3X1BA 5KSBA 2VGLM 3DJ9A 4LLDB 4XX1E 5TGBB 1JZ6A 1GN3A 2FWOB 3NRFA 2C4FU 3FOLB 3IRZA 1TEGA 2DQIH 3TN0B 1ZVSA 4Y2DB 4JM4H 2W0FC 1QLNA 1BZ7B 4UB0H 1CDBA 3L3OC 4OLZL 2Q3XA 1ZLUH 1H8LA 1ZT7A 4NIYE 3TH4T 1Q81W 5CJQH 3NCCB 5FF6A 1NVPB 4NXNO 1HN1A 4OCXH 4QJ3B 4RFNC 4UOQA 2FO8A 1KB3A 3IMWA 3KWWA 4EJ1C 2KG7B 1FKAO 4GBXC 4MS6A 3FSOA 4ES8A 1VENA 2FIRT 5CGYC 1ECZA 1SF3A 1TXKA 1K5WA 2WQAA 2XDHA 5FKPB 2CTRA 2C9VA 4LNRA 1XSOA 3RZCC 1LYQA 1QQDB 3SOBL 5E5MA 2QKSA 1FVEB 1N3NA 2ZCKH 4MD4B 3TEZA 4XCFL 2YQ2A 1D7CA 4U1GC 4AJWA 2DWEB 3ZO0A 4WLCA 4K5PA 1I9JL 1JFFA 1R24A 4N68A 2DDQL 2ESVB 2F68X 3HBGA 4LPCA 2UWEA 4G80B 3CPLA 4HWZB 4PRHD 1Z6JT 3GI9L 3D0LA 4JHAL 5ITFA 1BVLB 4HSAC 2VZVA 1OK8A 4PEEA 1BIIB 3HRZB 3H9SB 5C9KA 1HH9A 1KNOA 3RIFK 5ITBH 1B4LA 4X6DE 4QMEA 3PQYA 1BFTA 4FQ2H 3DROB 2F66C 2VWEE 3UJTH 3GBDA 4NOFA 3ZX1A 2Q7NA 3D3VE 1OWRM 3V0VA 5D1ZB 3N9GH 5LHHA 2BIMA 2CKNA 2B5IB 3LB6C 3ULSB 5I66A 1NUDA 5IJKA 4Y1AA 1RZFL 4GUQA 4LGSB 1NFDB 3I6KA 4Y4FD 3ES6B 4DEUA 2ZJSL 4QRFA 4HOZA 2VDPL 4YO0A 3VG9C 1D5BB 2AJYH 2QHRH 1ORSB 1J86A 4G7VH 3LRLA 4MCZA 2NRDA 3MMEB 1ZK9A 3ZHNA 4PGCA 1GY2A 1WG3A 3DV6A 1INQA 4B97A 3KNBA 4KKLC 3F84A 2BOBC 4PIRF 5EZIL 3SPHA 4EBQH 3BDYL 3EO0A 4LHUB 2FB4H 4XXDA 2XXCB 1R5IA 3CHPA 1BD2A 4MASA 4XNUH 3IGKA 2E9JA 4L3EA 5DS8B 3D4ZA 4LLYA 5CMUA 4OTXH 4PJCE 2J56A 2JB5L 3MFGB 3TEWA 4HK3J 2WQVA 3IXAB 1F6LL 5INDB 1E3XA 2E5EA 4FKHA 1E65A 5C08E 4BA0A 3TEXA 4PGBB 2PI4A 4HYOA 3KD4A 1JERA 2A6KB 1SJXA 3DHUA 4M9PA 4UNIA 2F93B 3HG5A 3O8XB 3KLHD 4GKZA 4ZG1A 4LAJH 1RLWA 2PTTA 4Y9GA 3BABA 1DQJA 3MV7A 4YHPB 2DD8H 2EIEA 3K7UA 5LNGA 1B9ZA 4PJBF 4B9JA 1KEGH 1F42A 5JNYA 3IFNH 4JLRB 5ADPH 4HQQH 1IIKA 3WIAA 3ARYA 3FUMA 3LMJH 2E27L 4XC1H 1M3IA 5EZYB 1DQQA 4NPYB 4Q6IC 5F0JB 5FAAA 1A6VH 1DHKA 3IF1A 2YD0A 1W72B 1FFPB 1AQKL 3K6NA 4NXSA 3RL2A 3RYHA 4NRZB 1QLFB 4TS6A 5HJ3B 3CD6V 2QT6A 3IDYB 1B6UA 2OCFD 5B8CB 5EH1A 3APOA 2BXYA 1OQOA 4KI5E 4P4KB 1WHOA 1K4DA 1LNUA 2J3SA 3RPIA 4NYKA 3FUHA 5GRVL 3CP1A 2IGFL 5EC1C 1A1OA 1IGMH 3GHEH 3RBGA 4OBSA 1XF2A 3UO3A 4YL4A 3IDIA 4UM8B 3RA7L 1KIPB 2GJ6A 1AS8A 1RHFA 2QQLH 1DUYB 1NMAH 2H3XC 4FXGA 4MA7L 2X4RB 4ANVA 4E41B 1G9EA 3FYIB 3DIFA 1UH2A 5IY5B 4O51B 4YJ2B 4JI6O 3APFA 2DYSB 2EAEA 2X0UA 3GJFB 2FSEB 4OD2B 3DI2B 5CUSH 4JI2B 4JTAB 3CCMV 2QZ5A 4FP8L 2NUTA 4Y4KD 5H4ZA 4BFOA 1AO7A 1RUQL 1HHGB 1HSAA 5ID0A 3GZOA 3OF6A 2M7WA 5H37H 3QXTA 3BGAA 1FYTA 1ONQB 4RIRA 2XWEA 2XWBA 1Q5OA 1UXSB 2IAMB 1IMHC 2IMNA 3G5VB 3BGMB 1E90A 3D87B 4PJGA 5KN5B 4TNGA 5CA0B 1YMMA 5K93A 2VLLB 3KPPA 2GJJA 3CDZA 2BRQA 4X7TB 4ZFOA 2QDWA 4MHHG 1PG7H 4J9ZB 1UVQA 2DBLL 3MLSL 4KK5D 4N0RA 5CS7A 5SX4I 3FUFA 4MQXC 5T1DH 3ZKSD 1RJCA 1RZGA 1T5WA 5FWQA 5T1KA 3RY5A 1XXDC 3GLZA 5L88L 5D93B 1L9RA 4KU1A 4NQDD 2P8LB 1NCOA 2XPGA 2YUZA 3D07A 2R4RH 2JNZA 4IIZA 3WS3A 3RFZC 2XXFA 32C2B 5ISZE 1ZA6B 3SDDD 4F3FA 3BY6A 4JI5B 4LF5O 4UQ2B 5CP3A 3H9ZA 4IEFA 1CUOA 1W6LA 3GS4A 1VB9A 3ARED 1PKQE 4JFWA 5I8OH 1KBPA 12E8H 4FZEL 2CO1A 2VMEA 4G9FD 4NHCL 2XN0A 4EN2A 1XH3B 4LCUA 4U4BA 5EHFA 2X4SA 3D0AA 1FFXB 4PJBB 2W0LA 3U4EA 5MEQA 3UIYA 4RH4A 5H37A 4NP9A 1DL7L 5IB4A 1JVOA 4X65O 5IHLB 3KR3H 4EFBA 4AQ1A 4I55B 2D0HA 2J44A 3SGDH 4Q74A 1QFHA 1QSEA 5I6XB 3T8XA 3HE7D 5HGBA 1QI4A 1YG9A 2GUYA 4LR3A 2Z31A 4ZS6C 2OTUA 1V7NH 4R8WH 4I2XB 3F12A 3HZVB 3EYSH 3BAXA 4JAVA 1O9WA 4H1LG 5F89A 1N7MH 3BISA 3PGFL 2V5MA 5IT2H 3QXAB 3WFDH 3VM5A 2WAMA 3AK1A 3HKEB 3F05A 4N0UB 4IS6A 5CA1A 5PAZA 3FJTA 5IF0A 4ZMVA 2FR4A 3EJJX 4X6DF 4QRSA 5FUZL 3TC9A 1U8JA 2CTPA 1TQVA 2DQUL 2ZIDA 4HPYH 5JPNC 1MAML 2FRGP 4YHZH 4IBVA 1K8IA 3QI9D 4O4IA 2FYVA 4KK6D 3PHOB 1BQRA 2QVMA 3O11A 4FTVD 3RYCA 2KH2B 3MRHB 1QYGH 1ZWIA 3FRPB 5H6QA 1KC8W 4J7KA 1L9QA 2ITDA 3ZRWB 4JFFD 4ZPVB 5EO1A 1NDMB 1YY8A 3PDOA 1JNNL 1SYSB 3BVDB 3TO2A 2AMUA 2V4DA 3MGAA 3QC6X 2Q8AL 4EQ2A 4AZ8B 2LLLA 5FV1L 3RQ3A 4MNHA 4F93B 4Y9BA 2P4VA 1J88A 2AVFA 4X20A 4XNYH 2GT9B 5DVNA 4KNQA 2F5AL 4LKCA 1X5FA 2LGNA 3IKCB 4A2GA 4YSUA 4BFIB 1H9DA 2JRIA 1T6VN 5E2TH 1IAKA 3SJVB 5I1LB 5MHSE 4UB6Z 4K0KO 1XF3B 3R7QA 5BOJA 4DV3O 1I1CA 2A6JB 2GK0B 1BMZA 2RMKB 4ACPA 3EO1B 2DTSA 2N04A 2C1PA 3TF4A 1E79G 3IDGA 4YE4H 3U7YH 1CDYA 1I8UA 1G87A 4DZ8A 4OIBA 1CGSL 2V17L 2JGDB 3QJHA 4JFPA 2QQKL 3APMA 5EIQA 2NZ9C 2DW5A 2QDOA 2DTML 3Q7JA 5CILL 4JFEE 3RP1A 4Q20A 5F3BA 5TE7L 3BAKA 2CQVA 5DHXB 2COQA 4X8XA 5JW4N 2Y3AA 2XNAB 1BSMA 4ZUTB 3RYMA 4JI7O 1KPVB 2HX7A 2VYRE 3B43A 3BSGA 3QFDA 4IDJH 4YE0A 3VXSB 1A6AA 1SJHA 2WXKA 4M48H 4NXMB 2NY6C 4G42B 1WFTA 5KW9H 1SFHA 1A6TB 4M61B 5AZEH 3MCLL 4ELME 5DC4B 2IALB 5AWNH 4ONOA 1AI1L 3U9PL 3G71V 5DJ2A 2FWLB 4M7ZC 3ARVA 4AG4H 1NL0H 2Q10A 2FB5A 3MRLB 4KI5F 2DBJA 1G9HA 1TNMA 2WHVA 4GLXA 5BW7A 3L5WA 3PIQA 1UM5H 4U1MB 1UTDA 4XWGH 2VRKA 4B7LA 1DQKA 3W9DB