1OCZB

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oczB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oczB02
2CUAA 3FT0A 1KYAA 3EF4A 3GXUB 1AACA 4KO5A 3TBBA 1WS7A 3PCYA 1OF0A 2BP8B 1CYXA 2QDVA 4DP4X 2WO3B 7PCYA 4KO6A 4HIPA 3MBWB 2HRHA 2UXVA 2HZHA 4AKPA 2IAAC 2YQBA 4WKXA 4YVNA 4DPBX 2CCWA 4G70B 2XU9A 1XB6A 3MX0B 2AVFA 4UAHA 1ID2A 4DP7X 3FS9A 4A2EA 3KW7A 2IWEA 4GYBA 2BZCA 1JZHA 3S3CB 4F7KA 1ILSA 1J9QA 3S8FB 2HLEB 3NJLA 3N55A 3PLYA 4NAJA 2VM3A 3S3BB 3EHBB 1IKOP 2J57A 2UXGA 1N70A 2ZWNA 3SQRA 3X1BA 3FPYA 3AG1B 1AIZA 2CALA 3X2QB 3ZBMA 2FQEA 1E67A 1NINA 3FSZA 1IBZA 1MZYA 2XWZA 3FSAA 2BHFA 4W9ZA 2ZOOA 2XX0A 4X4KA 4FAAB 1AZUA 4BWUA 1PAZA 1RZPA 3FU9A 4A66A 3OMIB 1OCZB 3AG4B 1OCRB 1SDDB 2BWIA 4E9YA 2HRGA 4PCYA 1GY2A 2P80A 2YXVA 3X1EA 1ETJA 1W6LA 4DPAX 2BW5A 1W6WA 2FQDA 3D12B 2OCCB 3NJNA 4RH4A 1KBWA 4HHGA 5AFAA 1OE3A 1ADWA 1DYZA 2PPEA 1SNRA 5EHFA 1TKWA 1N68A 1BQ5A 2EIJB 3FQ1A 2PCFA 3NJHA 1L9QA 4HAKA 4YSEA 4HZ1A 4UF7C 5I6PA 1ILUA 3OQRA 2GC7C 2ZXWB 2TSAA 2GSMB 2FTAA 4DP6X 5TK4A 4JHUA 2DV6A 5I6LA 4M4RB 1PCSA 2AFNA 3H4HA 2DY2A 3T9WA 4AZUA 3PXLA 1BXUA 3UACA 4NB7A 1E5ZA 2UX6A 3T6XA 1T5KA 3GYRA 4P5SA 2PPCA 3SBPA 3WKPA 3WIAA 3NSDA 2YAQA 3AW5A 3T6ZA 1AZRA 3X1FA 3AG3B 1BEXA 1QNIA 4DP5X 1L9SA 1IBYA 3DTUB 1B3IA 1PY0A 2MRYA 4A2GA 3IN0A 2XLLA 1J5DA 2GB2A 2FT8A 3GDCA 3NJKA 2YAHA 3CVBA 1WAEA 2I7SA 4AKOA 3ZIYA 1ZIBA 2DWTA 4YSRA 5B1JA 1CURA 2IDQA 1ET5A 3FSWA 1A8ZA 3OM3B 2WSDA 3CDZB 2EIKB 1MDAA 4BDVB 2EINB 1AS8A 3FSVA 3QJTB 3PAUA 3SBRA 2YEVB 4EF3A 1A4CA 4A67A 4G7SB 4YSUA 5TK2A 2DYRB 4AKQA 5I6NA 3NP3A 1A4AA 2B3IA 3FPXA 3OMNB 1FWXA 1SF3A 4N8UA 2W8CA 1X9UA 5B7FA 1JXGA 2DYSB 1BQRA 1HAUA 4W1TA 2CJ3A 1BXAA 1A4BA 4HHWA 2VSKB 3ABLB 1KDJA 3QJRB 4YSOA 2X88A 2UXTA 1KV7A 2AZUA 2QDWA 2XYBA 3AZUA 5D4JA 3PPSA 5I5IA 1AS7A 1GS7A 4TXVB 3DIVA 4FA7B 2Y1AA 2P80D 2H5UA 3FYIB 1CUOA 3FQ2A 4DP1X 5AKRA 2IDFA 2JKWA 8PAZA 1WS8A 2HX7A 3UAEA 6PAZA 2FT7A 4F2FA 1PMYA 3QPKA 3TU6A 1AZNA 1FFTB 1GR7A 2BP0B 5E9NA 9PCYA 1A65A 1JZIA 2NRDA 2PP7A 3TBCA 3NJIA 4DP9X 3QJUB 5B7MA 2VSMB 4CSZA 1AZCA 3NT0A 1OOWA 1GY1A 2VW6A 3CG8A 1OCOB 4KOCA 3IN2A 2R7EB 4P5RA 5I6KA 3AG2B 3U25A 4GY4A 2LLNA 4KNTA 1BYOA 3SBQA 3BVDB 1VLXA 1V54B 4BDVA 4G71B 1BXVA 3EH5B 3CVCA 3FU7A 4CSPA 1JZFA 1SDDA 1TEFA 1L9OA 1ZDQA 2BO0A 2XUWA 4A2HA 1F56A 2UXFA 1SFHA 1NWPA 2PP9A 1CC3A 1EHKB 1MG2C 3EH4B 5I26A 4YSTA 2J55A 1JVLA 2EILB 2UX7A 3NSCA 4M3HA 1WA0X 1SFDA 4BXVA 2FNWA 2OV0A 3CDZA 2JFCA 5F7AA 3WNIA 3KW8A 4HCIA 5A7EA 4YSAA 1RZQA 5FC9A 4N4YB 2GHZA 5F7BA 1ZIAA 1PZAA 1PZBA 3EH3B 2PLTA 1DZ0A 2IH8A 2IWFA 2FQFA 2N0MA 4F2EA 4DPCX 1ET7A 3ZDWA 4E9SA 1JOIA 1L9PA 3ASOB 3ABMB 4YVUA 2IWKA 1NIAA 4KNUA 4YSQA 3NJMA 3QJQB 3PAVA 2FQGA 1NPNA 3FQYA 2YAOA 2VM4A 3C75A 5B1KA 4GXFA 3TASA 1JVOA 4BWTA 3FU8A 2PPDA 3OMAB 1GW0A 4GP8B 6PCYA 4PAZA 5B1BB 2H3XC 1XB8A 1GSKA 2R7EA 1ASOA 1NPJA 2GBAA 2H47C 2FJSA 3QQXA 1R1CA 3NJJA 3UAAA 1HAWA 2Q9OA 2XV3A 2I85A 3L45A 4ZK8A 2RACA 3ERXA 1KCWA 1SHXA 2BP0A 1NIFA 4E9QA 5PAZA 2I7OA 1NIBA 1ET8A 1AS6A 3H56A 1QHQA 5B3SB 3CVDA 1W8EA 2VW4A 1JERA 1AAJA 2XXFA 4G7RB 3V9CA 4KNSA 2MTAA 4MFHA 7PAZA 2IDSA 4BXSV 3S8GB 3QJVB 1BYPA 2QT6A 4KO7A 3T6WA 3FU7B 1URIA 2E86A 5I28A 3QJSB 2HXAA 2HX9A 2TSBA 3T71A 3ABGA 4WTQA 5I6OA 1OCCB 4G7QB 4A2FA 1AQ8A 1JZEA 2BZ7A 3ABKB 2PPAA 3ZX1A 3X1GA 1NTDA 1OE2A 4E9WA 2X87A 1AG0A 3OD3A 3HEIB 1M57B 4YSCA 1HFUA 4YSDA 5B1AB 4Q8BA 4BWWA 1X9RA 2PPFA 2A3TA 1GS8A 1SJMA 1YLBB 1PNCA 4AX3A 4L0PB 2W88A 2Q5BA 3UABA 4HALA 2BP8A 4JKNA 3CZUB 2XVBA 1SHWA 2IH9A 2PCYA 2QPEB 4Q89A 1J9TA 3RYMA 1ZDSA 4QKTA 3WG7B 3IEAA 1SF5A 1NDTA 1NZRA 1GYCA 3DKHA 5ANHA 1QLEB 2AANA 2JXMA 1I53A 1PLAA 3PAZA 2YAPA 4DP0X 2XV2A 3WNJA 1JZGA 3NYKA 1AR1B 5D4HA 1NICA 1XB3A 1JXFA 3G5WA 2GC4C 2XV0A 1NIDA 4KOBA 1WA1X 2YARA 1MG3C 4HCGA 1KCBA 2XXGA 1J9SA 1ZPUA 3V9EA 3WKQA 3NJFA 2VW7A 1JZJA 1IUZA 2CBPA 2IDUA 3JTBA 1KDIA 1BQKA 5PCYA 1J9RA 5I5MA 1PLCA 1V55B 2CAKA 1KBVA 2BW4A 1AG6A 2FT6A 1E5YA 1NWOA 2VMJA 2VN3A 1E30A 3X1NA 1ASPA 3TA4D 4E9TA 3NP4A 3H4FA 2BWDA 4AI7A 4G72B 1PLBA 3BQVA 5AZUA 1OV8A 3NSYA 1BAWA 2QPDB 4DP2X 4KO9A 4QLWA 2WO2B 1UATA 2ZONA 1RCYA 1NIEA 2XX1A 3IBOA 1AZBA 2J56A 3N2JA 2HX8A 2YAFA 4ENZA 1FA4A 3FYEB 4JHVA 5I6MA 1KGYE 3NSFA 1EZLA 1V10A 4NERA 3S3DB 4E9RA 1RKRA 3IE9A 1J5CA 4BK5C 4YSSA 2Y69B 1JXDA 2B08A 3T6VA 5B7EA 1L9TA 1GS6X 3WI9A 1PZCA 4GP5B 1TEGA 3UGEA 1ZV2A 4GP4B 4A68A 2GI0A 3UADA 3ASNB 2J5WA 4UANA 4DP8X 1XMEB 3HB3B 3AY2A 4HCFA 4YL4A 4YSPA 3NJGA 5IY5B 2DWSA 5B1JC 1ASQA 1WA2X 4E9XA 1OE1A 2YXWA 2YAEA 1AANA 1IC0A 2GIMA 1PF3A 2AZAA 2PP8A 5D4IA 2EIMB 2OJ1A 4E9VA 2IDTA 1AOZA 4A2DA 1E65A 1L9RA 2YAMA 1M56B 1MZZA 2FWLB 1M9WA 1A3ZA 1CYWA 5LDUA 5I5JA 1TU2A 3JT2A 1PNDA 4K9JA
chains in the Genus database with same CATH superfamily
2WBJC 4IIJB 4DSYA 1MIEL 1AGBA 2YD4A 3F7YA 1E6JH 2AABL 2ESVE 5KSUB 4NJAL 5KSBB 2XQYG 5CIPH 3FN0H 1CCZA 3MLTB 2VWEE 1XGRB 1FFRA 7PCYA 4I4WA 1SERA 3VI3E 3ZHSA 2WNKA 3ZUCA 3ULVC 4OF3A 5I6XC 2CH8A 1KN4H 2P44B 3KYNB 3VW3H 2BOBA 3D08A 3X3FL 5J6SA 1I31A 2DJ4A 4Y8DC 4ZOEA 2VLLA 4XMUA 3WS3A 5DLMH 1H2KA 4UM9A 2W60A 3ARBC 4PJ7E 3HW7A 3MJ9H 4AGQA 4I55B 3BGFB 3QRFM 4ZOLA 3SDLA 3BE1L 1JDCA 4NAJA 3I6SA 1PX4A 1EJ6A 1ANUA 1S0VA 1SS3A 4LP4A 4MS6A 2C9AA 5KSAD 5L0QC 1X4ZA 4WSJA 2UXGA 1N70A 2BS71 3ULVH 3JD0A 1S7XB 1UYWL 5EO1A 1E67A 3GKWH 4G7YL 3BEHA 1MHCB 3MV7E 2OMXA 2WTRB 2XWZA 4FQPA 5D1QD 1YPZF 1A0QL 1ZVHA 2VSCA 3DWTA 3IGAB 4LIQE 2C4FU 3N9GL 1THCA 1TJXA 4M43L 4PY7B 3IAYA 1UKTA 1L9NA 4K0KB 3N41F 3AG4B 1S78D 3P02A 4HGMA 4E9YA 4FG6D 3R8QA 4N1HB 4GX5A 4PW3A 3KYKH 1GY2A 5EU4A 2YXVA 3TCXA 2C9XA 2Y5TB 4M7LH 3MJ7B 3QXUA 3SGJA 1R3IL 5JO5A 1NUDA 2P7TC 1ADQH 1LILA 2E5EA 1GGTA 1MCCA 5DDHB 3FFOA 3FN3A 1MJUH 3CPLB 3LX9A 3MCKB 1G9MC 3OWRA 3ENEA 1QFUL 5HHOA 2CO6A 3W37A 2R9IA 2AEOA 1XGTB 4NRXB 5KS9E 3FQ1A 1ZK5A 5CIPA 1SYSB 2CLVB 3QZBA 4U1LB 4MVRA 4JI7O 3V4PA 4UT9A 4TSFG 1GKEA 2CGRL 3AFLA 3G6JF 5FUOH 5MENE 1QBAA 1C8PA 1YMHB 4M5SA 1DQQB 2TSAA 5E03A 3WIIL 2FR4B 1UXWB 4U0RC 4CN1A 5LNDA 2PXYD 1B0GA 4Y1TA 1TUEB 1EQWA 1JF5A 4N5ED 3MDJA 2YPVL 4JPKL 5EU6D 2EXTA 2KPNA 4AEIL 1PCSA 3HIZA 4KKLC 1R6NA 3IJEB 1J8HE 3L95B 4GW1A 4XXDB 3TYFB 3I5DA 1MF2H 2F53A 3II1A 1Q9LB 2WLHA 4PJCF 4JFFA 4JPVL 1Z0NA 5GSRB 3IKKA 1NLDH 4PTUA 3T0VA 2W0KA 4MA1C 3BP6A 4DGYL 4BK5A 1OGAB 3UTTA 5CB4A 4YR6B 5GGRY 4J3WA 4C57C 1GN6A 3PIQB 3D3QA 3SDDC 3BPOB 3DX6A 3W5MA 3CVHB 5HI5C 3TF4A 1UKSA 3NIFE 3K2KA 1MHEA 3M7FB 3ARRA 3P4LA 4RDQF 1T22A 3W7XA 2J71A 2VB5A 3VE0A 3VXUE 1OVZA 1J5DA 2ZKHH 2FT8A 4M1GL 2AITA 1JGDB 1CLOL 2ARWA 2WLJA 3CVBA 4PRAB 4Q52A 1BQHG 3B7TA 1CP9A 2A9NL 4L1LA 4LVEA 4DFHA 4YXLL 2E46A 3IS1X 3BRGC 2NPLX 3JATA 4N87A 4NX0A 1DBBL 5FYJL 3S88L 2X5PA 1FFXA 4P2RE 3L1EA 1QSEA 4YBHA 4XN2A 4DGVH 5JDJA 4OCYL 1W80A 3BFWA 1BIHA 1SLUA 4BAYA 4NQEE 4FQ1L 5TE6H 2YEVB 3RYCB 1U95A 3OB0H 3PNWB 3P9MA 2B4CH 2K9FB 4X64O 1CL7L 2A2QT 2YKKA 4GAGH 1AJNA 3QBTB 4JI7B 1U33A 2NXYD 4G8FB 3I02B 4HS3A 4LPTA 2B9ZA 4AJYV 1DQJB 5AAMA 3FPXA 2P5EA 1Q81W 1UVQA 2WLLB 3BP4A 1XCQB 2DMXA 5H2BB 2ZE5A 5C07A 1PQZB 1CICB 4HXAH 1DLBA 5GRWA 2X6AA 2YGVA 3VXPA 4F8LA 1NDMB 3FX7A 5F44A 4ANXA 3AS3A 4OFYD 1CD1A 3RWGB 4XRCA 5FO2A 2ZSVB 4JHWL 4IIJA 3KZIZ 3Q43A 5DVOA 2ODHA 5DSCA 1HH9B 4LBEC 1R5IB 2QDWA 3SOTA 4QYOA 3AZUA 2VUKA 4YHMH 1VFAB 1A9EB 4MJHA 3IU4L 4QNPF 4TXVB 4WJKB 5CP3A 3WFEH 4FA7B 2IO5A 4YHHB 3QJFB 4K94L 4GAGL 4KRPD 4OGXH 3ZYIA 5I71B 4KKAD 4PW4A 5EIIB 2AJ3A 5I1HH 2R8SL 3MFFA 5DJ8A 3ZS8C 1A21A 1NU1H 1AZNA 3ROLA 4GG6B 3H1LH 3U4BL 4QOKE 3TZVA 4B3EA 5HI3C 5LGHL 2NUPB 1XMQB 2BVTA 3H1HH 3P77A 1RZKH 5IK3B 1MREH 1XD0A 4P59L 1PKXA 1NUGA 2AJZB 4APXB 4WIQA 1BL8A 3WD5L 4YY3O 4XWGH 3ULVF 3C5JB 1ERNA 4M9PA 4XO4A 2R1WA 3A22A 3O9WA 1FGVH 3J7HA 1GIGL 2NY0C 4Y7MA 2J43A 3ZDZB 1A3LH 3WTXA 4J3XA 2BDNL 3PGCA 1BEYH 1T6BX 1RZKC 4FXGA 1MZFA 1TEFA 2XUWA 3NDZE 3CRAA 3NH7L 2F4VO 4MWFB 3WMPA 4A2MA 1NFDB 3B2VL 3E80A 1MF2L 2VGLM 3B2PA 2XWTA 3HFFA 3BPLB 3DO7B 2IJJA 4GLXA 5DDHA 5FCSH 2EILB 4IEFA 1WH0A 3NDYE 1TQSA 3JD2A 3GUTA 4JPKH 2WXLA 1WA0X 2R56L 3SKUD 2FNWA 3C6LD 1F1DA 3NUKA 4EEQA 3M1OA 2QEXV 4XP9L 2NYYC 5KMGA 3VAEA 1P9MA 4NPKA 4U1GC 5DM6V 4TUYA 5EBGA 3K9SA 5F7BA 1DDTA 4JPIA 3NZSA 1PPIA 3QDMB 2DBJA 4JHWH 5CB4B 3U7WH 3KCPA 2VDPB 1NGPL 2NT1A 3QUXB 1JOIA 5MP6H 2NY4D 3A23A 2MCG1 2DH3A 3QZWG 5GSVA 1YEKL 2XNAA 3GS0A 3ELQA 2QM7A 1VCBC 1WFMA 5ITFA 1R3LA 1FL5A 4L3FA 2PCPB 5J1AB 3VD3A 4PJGB 3TYGH 2Y06L 3FQYA 4PJEE 5JXAL 5ABAA 4EE2A 3A47A 5D1XB 3V7AE 4M43H 1JVOA 3Q5YA 1EHLH 2DBLL 3BZ5A 1OPGH 1H0DB 5D5MB 1MZEA 4MA3B 2HT4D 3IPFA 2ZM6B 2QVFB 4NZTH 4M5ZH 2FSEB 4ELMB 5DQDL 3W9DB 1IC7L 1ULVA 4KITB 5SX4H 3CHQA 3ARDA 5IB3B 4PRAA 2BHZA 1RHFA 2IFGA 5CJXC 2AQSA 4P2QB 5EUOE 1WZAA 2J1XA 2O5NA 1KCWA 2QQLH 5H2BA 4L3EB 2GBVA 4L8CA 4MSWB 2AQRA 4RAVB 1NDMA 3BO8B 4WI7A 4GKLA 3X3FH 4FIPC 3MUHL 4X9HA 3RAJH 5LGUA 4FZ0A 2HUEA 2XASA 1JERA 4N0RA 3FNKA 1FC1A 4IBYA 1EEYB 3B9EA 3NBNA 1YG9A 4CSSA 2AABH 5JMRA 2D2CB 1G84A 1Y1DA 1QLEC 5TJWK 1VZGA 2AXFB 1ZGLP 1AI6A 3QJVB 4UQ9A 1R47A 4LOUD 1F2XK 3T6WA 1K97A 2OCCC 1WBYA 1QABA 3FOLB 3U0TB 1A7PL 5F7LB 1IGMH 2IPUK 4WTQA 5BOZG 1HYSD 4G7QB 1PKQB 2ZX8A 1CD1B 3QYMA 1IBMO 4PRPB 4YEFA 2H3NA 1CO1A 5DJ0A 5DUBA 5E8PA 5F7DB 1OB1B 3LS4L 3ABKB 5DECA 3ZX1A 1FL3B 1VADA 5A1AA 1EIBA 2H0EA 1U3YA 4GW4B 4YDLB 4MS8C 4PRDB 4EN3C 4Y16D 2IQ9H 4NTYA 1M57B 3K3WA 3E35A 2QADC 1XF5B 4M29A 5FS5A 3C5JA 3HS8A 3LN4B 2CIIB 4MJIE 1ADQL 2BC4B 2JLPA 1NBMG 2XETA 4MVQA 2W88A 3P9LA 3KG2A 3MLRL 3HE6A 3WO3B 4D9RD 2NUPA 5LGJA 3AWGA 1B4JL 4ABUA 2I5YL 4L8JA 3EJYC 3V0HA 1SA0B 3FH8A 2VJXA 3BZ4B 1ZLEA 4YHZL 4M7KH 3DSFL 1EO7A 2R0KL 1FKAO 3G5ZB 3L3IA 4LCIL 2M6YA 2ZIMA 1LK3L 2E6PA 1NC2B 2YRBA 1J0YA 2ZUQB 3QQ9C 1R0AL 4J3OG 4AYMC 2VLKA 1IMHC 1RIHL 1SVCP 3DPBB 2GCYA 2AANA 2P45B 1SN2A 2IAMB 4DP0X 3HI5L 3O3BB 1EZUA 3D3VD 3QA3B 4Z7QB 4NQSA 3GSXB 1K6QL 2G75A 1GPOH 3WL9B 1A32A 1IEBB 3QRGH 3NCEB 1WV7T 4JFYB 3T4ZA 4FXLA 4PJ8C 4Q0XH 5H35A 3NFPB 4KRLB 4PJHA 3BUBA 2G3XA 3NJFA 1AD0B 1FLRH 4B9YA 3IDNA 5CUSL 5I0VA 1H19A 1WE5A 3C60A 4Y2NA 3CQFA 2WM0A 3JTBA 5PCYA 3FBKA 5KMGB 1UD4A 4GPVA 4U1MA 1V55B 4NJAH 4HUXB 4Y16C 5BUGA 1YMHA 1ZT4B 1NTMH 3NPSB 3TA4D 3HZMA 2IBBA 2OXHB 1LUWA 3DV4B 3BZEA 2ZOKB 3S3JA 2AEQH 2B9AA 2EIJC 4PJBB 3QXTA 4JO1L 1BAWA 2QPDB 4KUCD 4B53A 3UTTD 1VQ4V 4RFEA 3TO2B 3QJXA 4Y1AD 5HDLA 1M53A 3C12A 2F7IA 5IGXH 5J6HB 4H88L 3Q1SH 4KXCA 5CCHE 4OGQC 3N2JA 2W60B 3PAYA 5I73B 1YMMB 3QAZB 1X4TA 3JARA 5LP6B 2YKLH 3BISA 1RU9H 3T2NH 3DA0A 4GRMB 4ZODA 3VD5A 4PQXA 3ZKQD 4PW9A 3M8OH 3P11H 4NERA 3HR0A 1LQSR 1ZAGA 4ODWB 1CXLA 4RGOL 5EG6C 3Q06A 4X8GA 5IFJA 1GTNA 1BBJA 5EPMA 5HHPA 4JRXE 2AK1L 3HC4H 1Z3RA 4P9HL 5CILH 5ADPL 1BHAA 4A6YA 1YY8B 4BYHA 4F24A 4YC2C 2NY1B 4LKXB 3HKZA 4WBNA 4UT7L 3T0EE 4NDMA 2VRQA 4FQIL 4EDXB 1CBVH 1S5JA 1ZJAA 4X6BA 1RIVH 4FPPA 1XMOO 1RIUL 1D6EA 3PHQB 2GTAA 4CMMA 4L1SA 3D7PA 2DLHA 2DYPB 4QRRA 3J07A 1RM1B 2VR8A 3LZNA 1IQDA 1XBRA 2KKWA 5C7XL 4G43B 5IHLB 2VQFO 1E28A 2BK8A 2DLIA 3GSVB 4GRLB 4POYA 3SOBL 3FCSA 2OCHA 1VADB 2BP3A 5EZIH 2ZUTA 4FLWA 2PP8A 2QZ5A 4N86A 4WO4C 2WLLA 1EEQA 1E27A 4X6EA 1E5BA 3T04D 7FABL 1GM7A 2CO6B 1DANT 4MJIB 1NANH 2F8OA 4DK5A 4P2RA 5CBFA 2EDLA 3VWKD 4KDTA 1M56B 5BMFH 3ULUL 1BBDH 1WBYB 4XH2B 4QCIB 4KXZH 3BKYL 4ZX5A 4JZOB 2NYKA 1OIOA 3R06B 2A1WH 4X8AA 4JY5H 3HRZA 4FKKA 4XMKL 4FQHB 3T8VA 3VXMD 1CXIA 1TJIH 2Y48A 2VITA 3AXLB 4G80A 2EYRA 3RKDC 1FVDA 4TYUA 1BVLB 1VPOL 4OD3L 1KXVA 1JZ3A 4P0DA 4XPFH 5IJVA 1P84F 3HNTH 2CCWA 4BRVA 1GTFA 1NEZB 1ZHBA 4F37F 2MPAL 5D71H 1L0PA 2ADIB 3N1QC 4XPAH 4K73A 3JASB 4H1LG 5CD3B 4H5SA 4KXDA 1NCCH 1YEEL 2HLFC 2J8HA 3S8FB 3QXWA 1IIKA 3LUTB 3V0VA 2NY7L 2ENYA 1XF2B 1MHEB 1AR5A 1JFHA 3LIUA 1BVZA 1SZNA 2GUZA 1JPSL 3CCQV 4AE1A 1S9WA 3LNHA 5HP5A 3UTOA 2MSPA 2X2HA 5KBPA 4HJJH 2W5PA 1FQ9C 3DVGB 2XZAL 3DXAA 4Q6IA 3ARWA 1XCXA 1YPZE 1L7TH 5IW6A 3OMIB 1OCZB 1GYVA 2BWIA 3KPMB 5ICZB 4PEEA 4AL8C 1HEZB 4PJGF 1YJNV 3GLDA 4KWUA 3SPGA 3X1EA 5DHDA 2CDYA 1W6LA 4UTBL 5HPOA 3D12B 3QC5X 2CTPA 3X11B 1XNRO 4KHXL 5AFAA 4TLSA 4OZHF 5BY1A 5C9JA 4IK6A 4L1BA 3X12A 5E2WH 3L75H 1TKWA 3U1SL 3WTWA 1N68A 3RYHB 4R2GD 2YS8A 3WENA 1TSRA 2MCAA 2FIKB 4HZ1A 2PYLA 4LF6B 1QVFU 1E9QA 3RA7H 4BZ1H 4PVLA 1TVDA 4IBTA 4FL4C 2QQQA 1QSFA 1Y4MA 1NAMH 1AHMA 2NXZD 4TQEH 4CN4A 3SJVA 1JPGA 2AJXL 3DX9B 3T3ME 3OZ9L 2DMCA 1AOHA 3P4OB 4HJGA 3VQWA 1E1QG 3Q8AA 4W4NA 5ITFB 2NDGA 1I8KA 5MERA 1T4KB 5JIQA 4K35A 2CUGA 4TT3G 4K55A 4YHKL 3SBPA 4WK2B 3RRQA 5DK0A 2YAQA 4M1DL 5JPNB 4X88A 5IT9N 1H0DA 2MK3A 4W4LA 2HRLA 3GIVB 3HG2A 3DJTA 1SKVA 4X6BB 2COQA 3SJVE 2Y3NA 1PV0A 2CSPA 2I27N 3MV9A 3Q8CA 5BMVB 1B3IA 1JV5B 4KK5C 4CMMB 2ALWA 3RNQA 2ITFA 1Y66A 3VFSB 1DLFH 1ZSPA 1TZHA 2BY2A 4GQZA 4YDKH 5GS1B 3CCHA 3PDOB 5GS3A 3FUKA 4LLDB 1QCEA 5LWYL 3WEXA 5D7IF 4NQCB 3SE8H 2JQZA 4MVMA 1GAFL 4UINL 2LU4A 2JDIG 4XNUH 4S1DC 4YZFF 5FPIA 3K57A 2HVJC 5E2UL 2GFBA 4CH3A 3TV8A 1YECH 5IT2L 1I8UA 2NY3D 1I08A 2YMTA 3UZQB 4EF3A 1XNQB 1I9IH 2HJLA 3P54A 4XH2A 3HMXL 2V7HB 5IQMA 3KPTA 3CYOA 5D9SB 1PU0A 5GS0C 3I6GB 2EDDA 5DC2A 2IJKA 2VSDA 2P5ED 3WBDA 2P26A 4OPHA 4FFYL 1NC4A 2B3IA 1UURA 2PNDA 2HP4A 4IOIA 1SF3A 4PGDB 4Y1SA 4DN4L 3AS0A 5E8OA 1SQFA 4Y2DD 3EZJB 1BMWA 1AJ7H 2YPKB 4HBCL 4PRIB 2DZEA 3H9SE 1NSNH 1NOLA 1J0KA 1RERA 1A4BA 1XGPA 2X70A 1AFVH 4HHWA 4ZMAT 2H3NB 2X9ZA 4DV7O 4XP1L 1YJDH 2BVQA 1OB1A 2J8UB 1F58L 4JFXB 3RWJB 5MEQB 4Y4HA 2CH7A 2YGOA 1K4CC 3KGTA 5IKCB 3QTCA 1YMMD 1VESA 3PPSA 3DC6A 2VZ1A 5FA3B 1AFVL 4RISL 2H5UA 4GI8A 2E6JA 2MFNA 5AKRA 4BUQA 1JPFB 2EDMA 2PCPA 4AW4A 3L4YA 3C90A 4U7MA 2X4PA 3ZOAA 5C8YA 3VM7A 4L37B 5DT1H 3UERA 3TU6A 4NENA 2G30A 1TJGL 3GXMA 2CO4A 4PJDE 1VQ6V 1XBLA 4F7MA 1N7ML 2UY7B 3CBKB 4RMUA 4FMKA 5C0AE 5A2IH 5CGBA 1XF2A 4CC5A 2ADYA 2Z1KA 2EVIA 1J1OH 4NO0A 2GUZB 4GBXA 2EDFA 2Q20A 3FTGA 5GGTH 1GAFH 2K7QA 1OGTB 2DM4A 1IVLA 4W9FC 3SBQA 1A4JA 1MAML 4WEBL 1NCBH 4J80A 4F27A 2N05A 5B1BC 4TTDD 5JUEH 3QO7A 2IAMA 3LKQB 3RVTD 4XCEA 5CXPA 3CZEA 3FU7A 4KHTL 3TBYA 2A0LC 3P2BA 5ISZD 4LNRB 3VE0B 1N10A 4QHMB 4GKOA 1SFHA 1NWPA 2H4EA 4I89A 1WFNA 4FQXD 2J55A 1HR0B 3BCFA 4K23L 1JVLA 1MSPA 3MGAA 1U8HB 4LEOA 1K2DB 1KPVA 1AD0A 2DN7A 4ZMQA 4M3HA 5HDBE 1GL4B 3G5VA 3NR7A 4ZNEA 1JA8A 4JRXD 1WHPA 5KBKA 2AGAA 2VL5B 2NNXA 4WCYH 3THMH 1LP9B 3QORD 1EZJA 1KZYA 4RO2A 1FHGA 2JKXA 3FULA 3QE5A 4JFEE 4K8RH 4W6YB 5J3HD 1PZAA 3HS0C 4X98A 3SDCB 5J7CC 1P84J 1WT5A 5KYUB 3I02A 1ZX3A 1IAII 4OZHE 4KTDH 1VF7A 1QLFA 1JTOA 4YWGL 3POHA 3LQZB 4HCRL 1RUPL 1FAKT 3VI4E 5DD6A 1S77D 1T2QL 2XWDA 1P5UB 4YO0B 2CDFB 5AALA 4QUOA 3BAAA 1HCFX 2DYRC 4G8EB 4TVPL 3OZKA 1RFYA 2VDLB 4FN0A 4NQCA 2KZ1B 2JE8A 3GSOB 4AVIA 4HF5L 1IZ3A 3TASA 3QEQB 1R17A 4MXQD 4QYOB 1HHIA 2CMRH 4GP8B 2F93B 1CQKA 1JV5A 3EBIA 1RK1A 1DSYA 3CHRA 3MZTA 2B15A 4GKKB 2ZUQC 1VARA 1N0NA 4FXKC 3TBTB 2WOYA 3BDBA 5IEKB 4X6DE 4U2YA 4N90D 3GMPA 4LLDA 2OZNA 3BT2H 4FZ8L 4PPTA 5ISZA 4Z8FH 3SODB 4ZMNA 4XBGB 4QJFB 3CV5A 2VDQH 4J27A 2ARJA 3KPRB 1Z5LB 2BP0A 4GXVL 5EDSA 3H3PH 2GFBB 2QKCA 1PZDA 4ZUTB 4D3CL 5J0BA 5K69A 4PRIA 5I15L 4NKQB 3WKYA 5TE4H 1WBXB 2XY1A 4I5BA 4JL1A 4XPHH 2WZ5A 4GRLA 4G7RB 2A73A 4NBYB 1V3JA 3WO4C 3WG7C 3BRCA 2EXWC 2ITCC 1LR1A 5JXED 5KX5A 1FNSH 4X9GA 4HC1A 4JN2B 1AP5A 3L73H 3UG3A 1KEGH 4LAJH 3I6KB 3HG0A 4NCC1 4J3OD 1TDQA 3DXAE 4XPFL 4ESKA 4QXUL 12E8L 4L29A 3OT7A 1BQUA 4LCUB 4OKDA 4X7EC 4AIZB 1UEMA 4R2GB 1TO5A 3L7EA 4BH8B 2WKLA 2VXUH 5F6HI 1YCIA 2UUBO 4LLQA 1JZEA 4P23B 3WY3A 2E9GA 4J41A 4BFEA 1Y18A 1KCSL 1ND0A 3KE0A 5IQ7L 5C0BE 3AREC 1CFQB 3V5HA 1RZGA 4LSSH 1VACA 3HZVB 4N6RB 4TOIA 2ZNWA 3TVMC 3Q8FA 3ZU8A 2YPLB 4X8CA 1HL4A 1J95A 2YBGA 3E7JA 3GC3A 1T1ZB 4TMPA 1JUFB 2RFXA 3DOIA 4M6MH 5T3ZL 3K7UA 4PJXB 5GJTH 3U4KA 1JYXA 3K71A 4WDIB 1VZHA 4XNQB 5FR3A 2BP8A 1NCDL 5C7XH 2XVBA 2KKQA 2WGNB 2V7QG 3BPCA 4O9HL 4YHNB 4RAIA 5FWQA 4HXBH 3MLPA 4Z76A 5ILTH 3NZHH 2R4RH 1CFTB 3QDAA 4AGMA 2Y4UA 2GY5A 5AYUL 3KPSD 3P3SA 5CMAB 1IAOA 2X12A 4RMRA 1KPVB 2ZUVA 3BN9C 1DBMH 4UAOB 1GYCA 4ZFFA 2FEDC 3NIDE 1HH6B 4IBZA 3UO8B 2YOCA 4IW4C 2XZQL 3KWTA 2AK1H 1B2YA 4NP9A 4FFWC 2VC2B 1ZLWK 2IAMC 5LB1A 4LNRA 3LKSA 3IFPB 5DVLA 3G5WA 4OR1A 4YNYB 5IHZB 4GG6F 4IYHA 2NY3C 2C9QA 1KCBA 1EAJA 3SJCC 1JGUH 4EVNA 3SD5A 4ADJA 4JYAO 1E8ZA 3ZE2E 3PL6C 3X3GH 2VAJA 3F7RA 2E27H 1AXIB 1DTOA 3C9NB 4Z77A 1H6FA 4DR5O 1S9XA 3G5VB 4BQCA 4CKQA 3K8MA 2E6QA 1LP9A 4FFVC 4QCIA 4BV1A 4R26L 4UM9B 5HHQB 5DHVB 1G7PB 2F58L 3ZTNL 1I7TB 2FRGP 2VXQL 2WN3A 2QBWA 3FZUD 4WWKA 4Z7NE 3MBXH 3S3SA 3T4AB 4E9TA 2HFTA 4HKBA 1FFPB 3EYQD 1X5ZA 2QKIB 5T3XL 4AMKL 5ID1A 4FZEL 3F5WA 4PCTA 1RK1B 4XPGL 3ZKMC 1JYNA 3MNZB 2Y23A 4QTIL 4KUZL 1ZGLB 4HHAA 3TBWB 1I85C 2UZIH 3ZZSA 1XSKA 4YDVA 1L0NH 4NP4H 3JASA 4XP5H 2J2ZB 5IQOA 3SDAC 1UWEL 3BA8A 4PVNA 4WF9V 1OCRC 1KGYE 1Z9OA 2LU3A 2PR4L 2O4EA 3A6CH 4GRWH 4N22A 1IBDA 4N2KA 3ML0A 4LCWE 1KKDA 2CLRA 2DOSA 3QULA 4IDJL 3RJOA 2BSCA 3OKLA 1BMZA 3VDCA 4PJAA 4L3CA 5IYZB 1QR4A 4Y19A 2VKWA 5LBSH 4B9PA 3TP4A 4B3TB 2R29H 3L9BA 4JCWA 5C9KA 1B2WH 5IESL 3HC3H 3VXME 4Z7UE 2FCBA 5LGKA 3WKMH 4FHBD 2AQ1A 2JKRM 5CIPB 1XMEB 2HVJA 3AQZA 4HCFA 4WJG3 4LCUA 5D9SA 3BLPX 4UXNA 1TETL 3BGFC 3IAQA 4I2XB 2DQ0A 4G8IB 4NWTL 4QI3A 4DWHA 1YMME 3TN0D 2HKOA 4QTIH 2X89D 2VDNH 1U8PA 4LDCA 4M4RA 4OFYA 4XAKE 2HT2C 4BQ8A 1QG3A 4GW1B 3L7FB 3P40A 1H8OA 2LFEA 3RVVD 3UJIH 2KH2B 1G6RB 1O7SA 2CGZA 2F53B 4HZLB 4Z0BH 4ECNA 3M8AA 3QA3A 1FG2B 2X2IA 4XN5A 3WIHH 3QIUC 4K3DL 2BERA 3NA4A 5KN5A 3ILQC 3JT2A 1P53A 4G11A 3DO3A 1EHXA 3EADA 3ARUA 1QSFB 2IG2L 2MNUA 3KYAA 3HKCA 1DJIA 2VISA 3CFIC 4X99B 4PRID 1B0GB 2BNQE 4LLQB 2L7UA 3SJVB 4F3FA 3GSQA 4Q9QL 4HIIA 4X6CA 5T1LA 1CXKA 2ED8A 2WBWB 4FNPA 4CW1B 1CYXA 1I7FA 1QZNA 3BH8A 4N2AA 2BSSA 4EXPX 2I60L 3W7TA 3DURB 2OQJB 4HETA 1VACB 3HZVA 5AVTB 5E8NA 5FYKE 4K07A 5MERB 4EN2A 4Z7NF 1YQVH 4HUXA 3PDDA 1KLUB 4BFFA 3M07A 4WSKA 1JZHA 1SDAB 3RKDD 1HCYA 4WKZB 5IEHA 3PWJA 2OXHA 3VH8A 3PIQA 3IU3A 4ODXA 3TIDA 4LHJB 4JI2B 4PGJA 1MFBH 2F0CA 5CSGA 1KCLA 4NUQA 4EZJA 4RIRA 2ZAGA 2DJSA 1T22B 3SE3C 3TO2A 4AV0A 5FPOA 2IANA 2ENQA 3CZKA 2QQLL 1MZYA 3CE1A 4R4FL 5GS1A 2X9WA 4IGBA 4MZ2A 1NGQL 4X4KA 3SGEH 1SYVA 3PE9A 2IGLA 5C2UB 2FEJA 5HBBA 4Z77B 3PV7A 3VYPA 1S7RA 3JALA 3P30H 3Q6FB 5FUCC 3B2EE 3W7SA 3K9AA 4PCYA 1PG7H 5AW8B 2FHFA 3QFJA 3PNWA 4Q6IC 4B9KC 4ZMLA 3ZO9A 2QR0A 2XIIA 2C7UA 1KBWA 2LFRA 1M5IA 4LKXA 4NUGL 1D5XA 1RJLA 4KH9A 5INDB 1O7DC 2GJ6B 1V3MA 3T1WA 4LSSL 4HJUA 1BQ5A 2WSKA 4MBRA 1D6EB 1CICA 4UF7C 2I69A 4F37K 5ABDE 1GMEA 4IJTA 4XVJL 3IMTA 3RWGA 1VF5B 4LR3A 1ZA3B 1KJ2L 3GSVA 3F7YB 4DP6X 5KYYB 1AKJB 3CX5J 3LH2H 5JH7B 4JYAB 4IM8A 2Q8BH 1FFPA 3QUXD 4I3GA 5IKCA 3U7YL 4OZGA 1D5BB 5K9KB 1KMIZ 1VA9A 4LSVH 4EN3B 5C6TL 2B59B 4UTAA 3SPHA 5IYZA 2X10A 4NXNO 2VLLB 4XHJD 4TV3A 5ESQA 4P04A 4B95C 1AC6A 4JHAL 4N8VA 4E41E 3FJTA 5C0BA 4F6RB 1WWWX 4FS0A 4YDJA 4JFWA 1RULL 2G3NA 4XP4L 4MVOA 5CM1A 2UVFA 3G9VA 2EYRB 1LTXA 4YIQA 5HYSB 2VXVL 4F7MB 3V6BR 2HVJB 4A2GA 3ZIAG 2VUOA 3BVXA 1BEYL 1CXZB 4FHJA 3HFML 4JRXA 1TVHA 5D6DC 4FDWA 3ARFC 3VA2C 2YIAA 1BG1A 1FHNA 2V5SA 1S7TB 1Q1PA 4CILA 3N40P 4DO2A 3NCCB 5DJXB 2ATKB 3CFJA 3FXIC 3NIFB 5K9JL 2ZKMX 4AYID 4YFLF 3F5WC 2RNBA 2P8LB 2YD2A 3ABZA 4NHUB 5BZDB 5L88L 1EN6A 2PXYA 3GM0A 1QR8A 3SBRA 5AD0A 5KJRL 1OAXL 5SX4I 1QWNA 5JO5B 1LO4H 4TQHA 3PWLB 3UH8A 5C08A 4Z1VA 1N4XL 3SCMA 2UXCB 5LGHH 2DYRB 4DR2B 3CU1A 3Q2VA 2BVUA 4QNHB 4F15B 3ZBHA 2YA1A 4J39A 2D03L 2HG5C 1RLBA 5J6GB 4QR7A 1W0KG 2NZ1A 4KROB 3RX7A 4U1LA 3WE1A 3TURA 1E8XA 2ZIOA 3SGDI 5EU6A 4LLVB 3BT0A 3E1F1 3NACL 2FWSA 2XPGA 3K4ZA 3SGKC 3B09A 3QNEA 2X88A 2ZXAA 2R69H 3VH8B 1Y18B 3UYOD 1JV2A 3U82B 3RUGF 2XTJD 5I5IA 4AUYA 4CC4C 4HBNA 4KQ4H 3LRSB 3CCSV 1INEH 2IDFA 2CCLA 3IETA 1R3LB 2V9QA 1WS8A 3U9PL 4HMCA 4PREB 4KK6D 3UAEA 5JHLH 5FWRA 4PJ5A 5B3NA 4O58H 4WI8A 1N34B 5BXFB 4NR1A 1GRJA 2A9ML 1LL1A 4JI2O 1W9XA 1H8HG 3CBRA 3VWJB 2R2BA 1HHKB 1L4IA 2BIMA 5BRPA 4L8SC 3LHAA 1HILB 1H38A 2A6IA 3R1GH 3UTPE 2EEFA 3QJUB 4S1SL 2EX3A 5A3ID 3BJ91 1OALA 4L1DA 1A9BB 3FN9A 3VJ6A 5BZWB 1VMGA 1S7SB 4PJFB 2ICEB 5A2FA 2CK0H 1L7IL 4IGBB 5A9GA 3TVMA 1CXFA 2I32A 2V2XB 4J8RA 2C7FA 4G71B 1VQ9V 3TN0B 2J4WH 5L3EA 1DO6A 2UUAB 2C8NA 2J1ZA 2WHVA 3LQAL 3LJ3A 2O5ZL 4HSQA 4ZUTA 3RNQB 2DEXX 3TXAA 1RZFH 4P4RB 1ACCA 4I4TB 1U92A 5CJBA 2CTRA 2DIBA 4JFDE 2B2XH 4HT1L 5DUBB 1MMMA 2A4EA 1DVQA 2W1NA 1M1SA 3FQXB 3QIUB 5HDQH 2WSSG 1W2BU 3WEXB 1AH1A 2X1WL 3OWEA 2UX7A 4GW4A 1MUJB 3UAJA 2QTOA 3SPJA 1PLGL 4JO3H 2JXMB 4KXBA 4GCZA 3WFHA 4IQHA 3HLKA 4XCFH 3H6JA 5F1NB 5INCA 4D8OA 1NGYA 1DBKL 1TVKA 4FADA 3GXNA 4YSAA 3U83A 1KCVL 2YC0A 2HCZX 3TZVD 3B7SA 1C8QA 3FT2B 3V9FA 5I17A 4AEIH 3TJTA 1RVFL 1KJMB 2YPVA 4MNGA 2X3AA 1ZT1A 5F7DA 2BSRB 3TCLA 4ZT1A 1EHNA 3VH8G 4IU3A 4NUPA 4QIRA 1TQVA 4KU1A 4Z3FA 2BOLA 2UUCO 4EKWA 5EBMC 1SUJA 5AAPA 2ZP9A 3SDXF 4MJ6B 1CB4A 2MNWA 3CCJV 3GMRA 4KNUA 1H3GA 1VB9A 2X1OA 4B3SO 5CINH 1CIUA 5JNYA 2BRRL 4WF7A 1LE9A 4U05A 1LVEA 3HOGA 1OCWL 1T1ZA 3EYUL 2NQDA 2ZD0A 3QIBB 4V1DE 3V52L 1LWHA 1Y7VA 1XF4B 3IDMB 3F7VB 5BO0D 1GW0A 2V4LA 3BQUD 4HWEH 4XVTL 2F5BH 2HTLD 1N59A 5G2NA 5HJBA 2Y25A 4AGNA 4MVBD 3MGTA 4C4UA 4Z76B 4ZXBB 2OR8A 1RZJL 1T7XA 4OUUB 3L3OC 4B0MB 4NWUH 4DH2A 4F92B 2QMKA 3E6FB 1NIFA 1AQMA 4KQ3H 3VYOA 2Y24A 2Z8SA 3KVDD 5LAXB 4AQAA 1OHQA 1LEGA 2YD1A 1QSED 3NN8B 2BNQD 3V9CA 1NCUA 3KL0A 3QHZH 3FUMA 1E8WA 4MFHA 3FTGB 3VG9B 2IALB 2E7CA 1U42A 4HUKB 5D4QA 5F3FA 3SBWC 1NR1A 2IGTA 4BH7B 2FYVA 4UU9B 1Z2GA 1EV2E 1HOEA 1MWAH 2WXHA 4QJ5B 5AG8A 2P24A 3C60B 4P3CH 2UU9B 4AE0A 3MTXA 4X4MA 1PIGA 5IVZA 1JNLH 1MW2A 3DK0A 3IK2A 1KELL 4RBPH 2WQAA 1NUFA 3BHBB 4NM4L 3QDJB 9CGTA 1F4WH 3L72H 2XOTA 3LHPL 4KI1A 3BPNB 2RBLA 5E0FA 3Q4HB 1QATA 1JFQH 4MCMA 3BH8B 2ZOKA 3ZGIA 3CFCH 3HEIB 4ODWA 4QWWD 1KULA 4UCSA 4PJHE 1ZHKA 3TPUA 2BCMA 3VG9C 1VGEL 3T0BA 5T1DL 2ENSA 2QPUA 4LH6A 2QQNH 3U30C 1R5VB 5D1ZB 3MSPA 4UTBH 3UGUA 2A3TA 5BXFA 1XH3A 4BQ6A 2WVUA 3C8HA 5DR5H 2UXDB 4L0PB 4ODXB 3WTYA 2KERA 1OP3K 1PVHA 4ERSL 3TN0A 4ELMA 4RIRB 1HILA 2WQRA 1L7TL 3LH9A 3Q44A 3WFZA 1BIIB 4M6OH 4Y19E 4YFEA 1BBJB 4N90E 2ILLA 2NNAB 3OKDB 5GGTA 5EA0H 4ES9A 2I9TB 1SF5A 1T0OA 1U21A 2OMVA 2CRYA 3L2MA 2I26N 5I66B 2WWNA 4WI5A 4EI5D 4FXGC 5E4EB 5J12C 2Z31C 3N43B 1HWYA 2XV2A 1FO0H 2YO3A 2Z7WA 3FB8B 4NRZA 5F1NA 5INCB 3UZVA 3W1ZA 1UXMA 5L8LB 3PHQA 3QZPA 1JXFA 2XQYA 3BXNA 2QWQB 1NMAH 1H2SB 3O9WC 4MQXC 4OLVL 1GKFA 1NGWA 2F7OA 2EDBA 1QSFE 4KOBA 3X13A 1RUAL 4J7KA 4QXGH 2FDBP 3VVVA 3I2CH 2XBDA 2ZE8A 5I1GH 3D05A 3MLTA 4EDWL 5IHHA 1Q94B 1NLBH 2ARJB 4OF5A 1F6LL 3ME0B 2NLJB 5F3HB 1G6RA 5I5MA 1AY1H 1M6OB 1OK8A 3CN1A 3VI3B 3C8KB 3STZC 4BHUI 1FG2A 1LE9B 4WUKL 3JWDH 1CT8B 5G4OA 4L0ZA 2A1WL 2ZDIA 4XMKH 5AVRB 5IP4A 1J8KA 1CFVL 3VTTA 4OQTL 1K5WA 3FFDB 5KUKA 1F4HA 3H42H 1ASPA 4I9XA 3LPWA 4JJ5B 4JVUA 5KW9H 1BBDL 2K0RA 3CVHL 4UIKL 4MHHG 4PRDA 1LO3H 2BVPB 4LPWA 2BTQB 2ZJSH 4OJFL 4MYPA 5AZUA 4DV2O 3LB6D 1IV8A 4KJWD 3B2UC 3US1A 3U0PA 5HGDB 1BWMA 1R3HA 4PJHF 5JNYB 3C5XA 5JHBA 3Q48A 2B0SL 1TGOA 3L4WA 1KYOF 2H1LM 3DXAB 1QO3A 3MUGA 1YZZA 4OFDA 1JRHI 3S35H 5GXBB 2YN3A 4QXVA 4X9YA 5CJQL 3OKNA 1T0NB 2Q7NA 5LGJB 1RIUH 1E4XI 4ZBMA 2J25A 3INUL 3S96B 1CBVL 4A1RA 1Z0MA 3B2XA 3IE9A 1EMTL 4JR9H 2HG5A 2EEXA 1YEGH 2X2JA 1R46A 4XWOC 4S1RH 2ZD9A 1F1AA 2ICWB 4H0LC 4BIZA 4RQEA 1WZMA 2J5LC 4JFPA 5M94B 4JGNA 3FAWA 5C0AD 2IADA 4TUJB 3QQ3A 2VMDA 5TE7H 3T1YB 4OCWL 3FL7A 5JMOC 2J20A 3RVWD 2J5WA 3ML8A 2CLVA 1SYSA 4PD4F 1A6UL 1V3KA 4NQSB 4WJ5A 1KGCE 4H13C 4JEGB 2X44D 4Z3IA 4Z7NB 2XG4A 3N85H 3QCVL 2IM9A 4U1SA 1H15A 2XTJE 3ARFA 1CDGA 5L3BA 1HKLH 4JB9H 2FO4B 5BRZE 4KP4A 1D5XB 1RJLB 4GMSH 4WFFE 5FV1L 1N34O 3SDAD 4GQ9H 2P47B 4I48A 1LUVA 3D1MC 3K6SB 1DQIA 3G08B 5E6ID 1MZZA 3ZMNA 3GJEA 1E6OH 3HI1B 3DECA 5I5JA 4KKAC 2CHXA 4PDRA 2XAFA 3ZDYF 1WP7A 3VFNB 4MMZB 3WJLC 3V4PH 4Z3JA 4TOYH 1AKJA 2EINC 3PCYA 3MLSH 5B39A 1OF0A 1M4KA 2ZOUA 4PJ5D 1FL6B 4PB9H 2QSCL 3QR0A 4GQQA 2UU9O 1EEUA 3CUPB 1RH8A 4YGAB 2HRHA 2P5EE 1BIIA 2HZHA 3LIZH 4WKXA 4JK0D 2QHRH 2OMZB 1IM9A 4DUZB 3SGDH 3EFDH 4XN4A 2CJSA 4P2OD 2AVFA 4LNUA 5T33H 4XXWA 3LCYA 4FD0A 1FYTA 2FO1A 4N8VB 4F7KA 2DS4A 4IIZA 4XVUD 3DGDA 3E38A 5DJCA 3T3PB 2FHBA 1KLFA 4KAQL 1FNAA 3PREA 1P1ZB 1YDPA 3BAKA 4YLCA 2UZXB 3EO9H 1YNKH 1I7RA 1SHSA 2J57A 4M8UA 2VM9A 4FMTA 3OPZL 5EPMB 1K9TA 5EOCL 3NA9H 1DFBH 3B1TA 4YJ2A 3GGWB 4S1QL 5FM4A 4CVXA 5AKSA 1GGCL 1NINA 5JW4Q 2E7HA 5D7SH 25C8H 2BHFA 2MNJB 1AKPA 4L4VD 4P2OC 1ZVNA 4B41A 5AW9B 1SRYA 1IT9L 3S0PA 1JCHA 2AHZA 3I9GH 3UZEC 4ODUA 4X1KA 5DA4A 3HRZC 5AW4B 3EXJA 4B08A 1O0VA 1USQA 3IMVA 3ISWA 4GSXA 2AQ2A 1GYUA 3Q5TA 4RGNE 5E79Z 2FQDA 1C12A 4RH4A 5GS1C 4R96A 2EC9U 2NY3B 3V8CA 4B7KA 3K8LA 5DMKB 5E5UB 2NW3A 2JI3A 1JPXA 1M57C 2BVPA 2PPEA 2V7NB 5E7BA 2Y4SA 3FT9A 3T0EC 4XDJA 4DVBA 4V1DB 4WI6A 4DPRA 4YSEA 2NLJA 5AB9A 4PJIB 2Q5ZA 4CGUB 3ULAB 4AW7A 4HLZH 3G6EV 4IMKA 4EI5A 2AJ3B 2JI1A 5B66Z 3FT2A 2EUWA 1HZHL 2UWEA 4G7VL 1N5AA 1NM4A 2VT0A 1KY6A 1OW0C 4UZGA 3PRZA 4L4TA 2O30A 5C0CB 1WA8B 3FCTB 5IJ0A 1M2VA 3GI9L 4DV4O 1X5HA 4CJ0A 1NTKH 3OAWA 3QEGL 4N0FB 1FVDB 5IJKA 4KRNA 4KVNH 4BR6A 4UOW0 2L7EA 1AVMA 2P28B 1BXUA 1DK1A 4NB7A 4OLWL 3QIWD 1E5ZA 5KEZA 1WVZA 2ZAIA 5GGVL 2F5AH 5FGRA 1TU2B 1IAKA 4J3OC 3MV01 4AC4A 2PPCA 3WMSA 2Z4TA 2DKMA 4HDIB 4FVMA 5D1QE 3FB6A 3KNBA 1E9PB 2CBOA 1RSFA 2CGNA 4R3SA 2NSQA 3L5WA 4PA6A 5DJZB 1IM3D 1BLIA 1AYRA 3C08L 3ARBB 3E8UL 4Z7WB 4Z78B 3BCDA 4KJPC 1SQVH 5FK9A 1XQ8A 1DE4A 1WAEA 3A0BZ 5TPWH 2CXKA 3W2DL 1N32O 3FHEA 4IEFB 5DHYB 5B1JA 4OFKA 4GUQA 3FUEA 1RD6A 3CDZB 2EINB 5D5QA 5ICZA 1I4FB 1G0DA 3U9WA 2EULA 4KK5D 4PBDA 1IFRA 2HKFH 2WLMA 4TPRH 5FM5O 3HTLX 4DVRH 3HKDA 2G5RA 3WJMA 4P3DA 5J8OA 1MQ8A 5CBAB 4AKQA 2A9MH 4JFEB 3RBZA 2BIHA 3OJMB 1BECA 1NCTA 2EDRA 2IDCA 3QEGH 1W2KT 5EUOA 3ARGC 4KI5E 4QMEA 4ZUUA 1PY4A 2BVOA 2RMNA 1Q5OA 4DUWA 3MA9L 1XHHA 5C0BD 3GTVA 1JJ2U 2ROYA 3GXIA 1RP3B 1S7WA 2MH4A 2X4UA 3R4RA 4AUJA 2M2DA 5KVEE 4PG9B 2B4CC 1EBPA 1WWCA 5ES4B 1B6QA 3GKZA 3ZDZF 4YSOA 1KJMA 2UXTA 4K9EH 1YYML 3KJ6H 5DJCB 3PV6A 4LF8B 2OBGA 1K8AW 3UT5A 1EANA 2VLMD 5T1KB 3APQA 4LFCO 3VD7A 4OQTA 4Y4HD 1G7HA 4ZTPL 4ODTH 1U8CB 4LWSA 3GMLA 2EVFA 3LY6A 2VZ3A 4ZTEA 3W0WA 3GVMA 3L9YA 3FB5A 3HR6A 1IEHA 1BGXH 1TOXA 5IVXF 2DL2A 2DQDL 3C6LC 4TSBL 1PMYA 4R90H 2UXCO 4I55A 2IANE 3S37X 5TDOB 5AW7B 4KTEL 5FW7A 2YXLA 4H1LA 5C0AB 3I9GL 3RQ3A 3HCVA 4LFCB 3BO8A 5H6QA 1UM6L 2GSGA 4NFBA 5TQ2L 3TTYA 3DTXB 3KS0H 1USZA 1OCOB 1WBZB 1AHWB 5GZNC 1XGYH 4MXQC 3G5YA 1NFAA 4FG4A 4WFFD 2DQHH 2DEYX 2LFGA 2NY6C 2VC2L 3H9VA 1DUYB 3BVDB 1MXDA 4H7VA 4OD2A 1P4BH 3EBAA 2NZIA 4XZUB 1BXVA 1TF4A 2FECL 3AADB 5T3XE 1O9WA 3LEYL 3LNEA 2VZTA 4FLYA 3E8FA 3P9WB 3OKYA 4UTBA 4JI3O 4TSBH 1D5IH 4I18B 5EORH 5IBLC 3IMBA 2FR4A 3WB0A 1LD9B 1K8IA 3MHSC 1RULH 4TRPH 5D96B 3QQ9D 4OFQA 3MRNA 4P5MA 2M26A 2AJVL 1ZS2A 4XXDA 4MVSA 1ETZB 35C8L 5IDJA 4JFFE 4UDUB 2HFFA 2OV0A 5EEZA 1RHHB 1B3QA 3ASOC 1A6AB 2FL4A 2LT9A 5C3TA 2BY0A 3MRRB 3LKOA 4O51B 3L81A 1A6WL 4EMZA 1DQML 2B1AL 2JI2A 1U3JA 1CVRA 4YR6A 3B5GA 5F7YC 1JJOA 3LH2L 3MRCB 3BKML 2VXQA 1T0PB 2WXPA 4L4TB 3MFGB 3AU1B 3TFKC 1SVZA 3CH1A 2YGQA 3DIFA 1VKXA 2Y4TA 4GQ9L 2QADD 4F9LA 4JY6B 4G82A 4YHNA 4P57A 3ECQA 4EAEA 1VQMV 4L3ED 3D09A 1OF2A 3PJSK 4R8CA 1P4LA 2DD8H 4LSTH 3RIAF 3UYPB 4YSQA 5CJXA 3N85L 1FVEB 3B9KD 2APFA 4NQQA 5BPPA 2WY3B 1Q9KB 2NYZA 1AE6H 2Y7OA 1A3QA 3AACA 3DPBA 3GMMA 5LUMA 3CMOL 2JVUA 2LLGA 4QXTA 4JV5O 1U8JA 1G9EA 3APOA 1BM7A 2MWCA 2XWJA 3GBNL 4MNHA 4GZRB 5LOVB 4LSQL 1NPJA 3ETSA 4LIQH 1MHPH 3RB5A 3MLWH 4EZKA 3CNKA 1R3LC 5AVQB 2QTEA 3LZRA 2L7JA 4HZ3A 3PNRB 4V11A 4AV5A 1ACYL 2YRPA 1LK2A 3PJSB 4E42B 1SGKA 1S7VB 3MOBL 4AVHA 1IKFL 3H9SB 4J3VA 1TR7A 3IFPA 1A9BA 4NZDA 2ZR3A 1XSIA 4NYLB 1IGIL 4JBSA 4HS3B 1H15B 5C0IA 2LLLA 3IJ9A 1R5IA 1P9MC 4EVNB 3BSZL 5AYTA 2CTQA 1A9EA 4E5XB 3T1HB 4M8QB 4XVOA 1W0WB 1C7TA 3CXFA 3K0WA 1BYPA 4RFEB 1GN2A 2AERT 1KYOJ 3EO1B 2V33A 4LGPB 3WY2A 4D9QE 2P46B 2X4OA 3IRPX 1GRWA 1S7WB 4A2FA 2CK3G 4PTTA 3S5LB 4ZX4A 3EUDA 1HZHH 5GGQH 3ZDXF 2BZ7A 1OCZC 3JVFC 5KOVC 4N8VG 4ZQKA 4DR1B 4NVPA 1CYGA 2NW2A 2QKIA 4TL4A 4UM9D 1Q0XL 4MQXD 1SZTA 1WNSA 1QLEH 2VE6A 4EDWH 4NQXB 4LWSB 3QJFA 3F5WB 2FYYB 4JI4B 4YSDA 1NGYB 1PJWA 3L9DA 3CJHA 4TNEA 4Z23A 3W0WB 5DEFA 1QRKA 1MFVA 2TRHA 4A7TA 4XN1A 2CNYA 5I17B 1ZGLA 1NKDA 1BZ7A 4ZFQA 3V4LA 3VRIA 2E4TA 2NY2C 1YLBB 4I1NB 4JAMA 5CGTA 2AQPA 5DD5H 5E6IA 2GJRA 3KKYA 3BLBA 4FXGB 2QPEB 2GV9A 4YQXH 5E4EC 5AUMA 3JXAA 4JCLA 4C4BA 3J8F7 4MW3A 4YJ2B 3GGWA 3Q6GL 1Q72H 3O0RL 3EJCA 3WKML 2E7LC 4Y19B 3DO7A 3K4DA 4ZNCD 3IGAA 3TEYA 4PJCE 2QA4V 1JWUA 5EOCH 4JFHD 2V0AA 2DMHA 5LBSL 4Z3HA 3B6SA 3WHXB 4N1EA 4RA3A 5GZOC 1GA2A 3WHE0 4JNXA 4Q6YA 1NCJA 4HEME 3SJVD 4ZKIA 4JPIB 1M1XA 2VRAA 1HOCA 3Q5OA 1C12B 1DJZA 2VLRE 2H3OA 3E6HB 3FO1A 3HRZB 3G67A 4HCGA 1FGNL 1RSYA 5T1DH 3MR9A 3WUWA 1J9SA 3WDIA 3BKCH 4WQOA 3APMA 1EWHA 4JF3A 2QHRL 2ZXDA 3KYMB 1J5HA 1IUZA 3VI4B 2HT3C 2B5IB 2D7MA 2GUOB 4ZTOH 3WHE1 4IMLB 5B5EZ 3HI1A 1AG6A 2UWEB 4QRFA 5DO2C 4YGVA 1N6UA 5E2TH 1EK3A 1FBIH 3T0XA 4HQQL 3X1NA 4EFEA 5C3LD 3PABA 2VISB 1MAJA 3MBXL 3PWJB 1TQCB 4KRPC 4PFEA 5C09B 3A4FA 3H4FA 1DJXA 1DQDH 2NY5H 1QFWL 5DCCA 5HHNA 3ECBA 4FABL 5CLYA 4L2LA 1YA5A 3CHXA 2XZCL 5E6UB 1B9KA 1B0WA 2XNAB 2WBJD 4N6RA 1KIPB 3DXRA 1LO0L 3W9DA 3QHFL 1SBSH 3TOPA 5IBUG 1OF2B 1WQVT 2R9HC 1CXEA 3MA7B 1UA6L 4I7ZC 4QRSA 4B9JA 3CJJA 2HX8A 1RJZB 3QCVH 3F83A 4JREB 5BCAA 4G8AC 4ENZA 2OMYB 5CR8A 3OF6A 1X6LA 3FHAA 4HUVA 2Z4QA 4R3SB 4YXKH 2C3HA 1HK6A 1D9KA 1PY9A 4UILL 4RAVA 3NZ8B 2ZCEA 2WLKA 2FATL 3DJSA 2IBZY 4BK5C 2FYUH 2XZQH 4MJ2A 3WNMA 2KDYA 5TGBA 5JW3H 1MIML 4PWGA 2D0HA 4N9OB 4KY1H 3GRBA 5EEXA 2V2TA 3NABL 4CH6A 1NMCB 3JBG7 3PWPD 4CC1A 2HKHL 4HIJB 2H0PA 2WKOF 1KPUB 4QOKD 4U1IB 3DUSA 2R4RL 4I0XB 1CGWA 5D7JB 1XHXA 4HXBL 3GMQB 5D93B 1DBAL 2YZ1A 3L9RA 5B8CC 4WHCA 1CU4L 3DPDA 1NCDH 1ZTXE 3C5ZA 3HKEA 2BRRH 2ZWLT 3EJZD 1SXAA 3V8OA 1X4YA 1D2PA 1RURL 5DQ9B 4M00A 4Y89A 3DJ9A 3DX9A 4I0PC 2FTKA 5DMKA 1KFGA 1KB9K 2C9VA 3NCYS 2EE2A 1ZLVH 2E76C 4A2DA 1P5VA 2A6KA 5KSBE 3RY6A 3BEVB 3MROA 2YPLE 4FC3E 1NCWH 1TITA 4LDLB 4ZS6C 5KW9L 5LDUA 1GC1C 3LN4A 5IW3A 1FZKA 3OX8B 3WSQL 5BQ7A 2LGNA 1U9KA 1VQPV 4PTTB 5DUML 3F7PC 1AD9A 3EFOA 3EF4A 5C0BB 4J12A 4XO8A 5GGRA 3TBBA 4HKBB 4PRIE 3T4YB 5FW6A 4WEMB 1NLBL 3RIKA 4AQOA 5JW4N 5L4IA 4J6IA 4L4TD 1YN7A 4G70B 3D3VA 4PUBH 5E8EB 3VSUA 1K72A 3GBMH 5DEFB 4A7VA 4PLKD 4UYQA 1B04A 1YNLH 4G5ZH 3K4AA 2FBJH 5G4NA 1ACYH 4XAKD 4YDVB 4I13B 4AG4L 1LEIB 2ITEA 4M6NH 4XMLH 3RPIB 1H3WM 2OMUB 4RMWA 5K1PA 1MY7A 4U6HA 5AQ0A 2XT9A 2WXKA 4JAMB 4QGPA 2Q8AL 4AQYB 2JRIA 1P7QB 3S3BB 3MLWL 1GGUA 3BAEL 3WNKA 2MOVA 1MHPL 1RUKH 5D72L 1R3JA 2QJDA 4LSQH 3BZ4A 4D3CH 2JELL 2PWGA 4FCHA 5D1QA 4KTGA 4F2MA 3UO1L 5KBLA 3N2KB 5TFSH 4MRBA 1BZOA 1RJYB 1AZUA 4IGBD 2Q68A 1AE6L 4GAYB 2XKUA 1PAZA 2PCXA 3FU9A 1CR9H 1KTRL 1T0NA 1TFPA 2CHWA 3MQIA 4FFTA 4TL5A 4YZWA 3TJHC 4OFPA 2BNRE 1TQUA 4NN7C 2DD8L 1T0MB 1E4WH 2OSXA 5DR5L 3TBVA 1AGFA 3O4LD 2XWTB 1I7ZA 4DPAX 4MVZA 4X7TA 1BF8A 3SJBC 4ODSL 4JI0O 1MVYA 3PABB 4AQ8C 2ICWA 4KXAA 5LO7A 4BHUA 1INEL 5SWSE 1WAAA 2DQFB 2A9HA 1T80A 3LIZA 2Z31B 3NEXA 4PJBA 5EHFA 5SWZD 2R15A 3T2LA 2V9TA 3SIKA 3A0HZ 2QPSA 4I0PA 1BFVH 2EDXA 5FHBH 4P4KB 3RYIA 3UO3A 1AP2A 2JTYA 2ATKC 4HCRH 2EDKA 4MB5A 3O3EB 5GGSA 4KTDL 3TIEB 4YEEA 5TK4A 3DO4A 4FLUA 1WLHA 3RBGA 1K9MW 4F3FB 3BD5A 5IW1A 2JMRA 4LEBA 2Z4QB 5I6LA 3IDIA 3GB7C 4FULA 5E51A 3ABTA 4XXCA 3T3MF 5E8NB 2AK4B 3LRSA 4O02H 3G08A 4WWKD 1Q6UA 2PWEA 1TTFA 1I8LA 5BZWA 4PJGA 2D2OA 1FVEA 1KTJA 4ZPVA 5EC2C 4ZUVA 3S9DB 1JZDC 3LKQA 4KDTC 3ESPA 3CD6V 2KLRA 3F7QA 1FO0B 4KQ3L 3IAPA 5TDNA 1XGYL 4L8BA 1YO4A 1MFAH 3KBPA 2X0LA 5TISZ 1G0XA 1M7UA 3RWHB 3AK3A 3QQ4A 4JVWA 3FMGH 1YZBA 4AQEA 3B7RL 1OHHG 3UM7A 3FAXA 3O2DA 4BGDA 4IGGA 1V9PA 4PJGE 3HR5A 4YSRA 1X59A 4GT0A 3RGVD 3TVMB 4YXHH 1YEFH 2OMNA 4LQ1A 2FVNA 4Y19D 4J8RB 4XP4H 4P2RB 5DWUL 1I7RB 1QNZH 2VL5A 2WUBH 1QPPA 1HT6A 1RUQL 4HJ1A 1Q0YH 4CVXB 2FJUB 2YD7A 2ZXWC 2M8XA 1PJ9A 3KPLA 4EEEA 1CDUA 5HYJD 4Y4FB 3BI9X 5C93A 3K72A 4DTGL 1UUSA 2QADB 3IDJA 5CN1A 4ZSOE 3TCLB 4B9FA 1MCHA 2WAMA 3OMNB 1YYMH 4X8XA 5I8EA 3MV7B 3B40A 3I9IA 1JD7A 1XD1A 1IAMA 2B1HL 1BSIA 1MG1A 2CIKB 1HX0A 1TVKB 1OGAE 3LPOA 1PDKA 4F7CA 1CDHA 2DJVA 1IIIA 2F54E 5BQ7B 2DQ3A 4FM1A 1X7SA 2VERA 5JH7A 3QDJD 3QEQA 5GZOA 3VFTA 1G6RH 4AEFA 4MHHI 2V7NA 3JWOH 3CLWA 3KLDA 1N59B 3BUDA 4XBMA 4KJYB 2N0KA 4DVRL 1KIRB 4X7CC 1S7XA 1W72H 2F54D 1P7KA 5ACMA 3QUKB 1S9YB 4YE4L 1OAKL 3GMPB 5I1EH 1T5XA 1E43A 3K91A 1X44A 5KVFL 2BC4A 1X5JA 3MREB 1CDIA 3P30L 4AQYO 2YLHA 2O5ZH 5IW6B 3MJGX 2K4AA 1OSZA 3JWOC 4KVCL 4OCRH 4LC1A 2R70A 2ZCZA 2OL3H 1KT2B 1N2RB 2XN9A 1D6VH 4UBDC 2IH1C 2CQVA 1CICD 4POZD 3GHBH 1V7ML 5D1QB 1I1AC 4ZXBA 2DM2A 3X11A 1VF6C 1H2GA 1BYOA 1RZ8B 3K6OA 4W68A 3JAWB 3N2GB 5I8OH 1VLXA 5IJ9B 2QWNB 3FQ4A 2ZKOA 4GAYA 2QKIC 5E1AB 4AV4A 5JZ7C 2NXYB 2P24B 4WI4A 4ELKA 1BZ8A 1EVTC 3OJ2C 4QOKA 3LOWA 3RIFF 5GGVH 1L9OA 4RRPM 3VTAA 4OLWH 2IXQB 1CDJA 1HEZA 2DLFL 1T0MA 3TBVB 1MG2C 5C08B 3SCMB 3QUZC 2CRMA 1BJMA 3B2UD 3WNLA 1R9FA 1QX1A 3FO9B 4JFYA 3MR9B 3UJJH 4N2OA 3IFXA 3TJPA 3FFCD 1IGFH 5IW1B 5C0ND 3UCRA 4XN7A 3KYMA 1MI5E 2BIQA 1DBJH 1DF5A 2AMUA 2KQNA 3IDXH 4X4YA 2LVCA 4UU9A 2BNQB 4ONOA 1TKWB 3ARTA 1ZHKB 4QO1A 3FC8A 4LLVA 5ECJE 1PEWA 5FC9A 1GHFL 2CNZA 2HFGL 3D2UA 4QPKA 1X5KA 1ZT4A 4HEPG 1BOGA 3C5SA 4X7SH 4ZPVB 3WJMB 3EVKA 2LV4A 4WDIA 5F7NC 3AG2C 3U10A 4WTZA 2VLJD 3T65A 2PTVA 3CVHA 1FG9C 2Q73A 1OAUL 1CPYA 4M5TA 4KKBD 1MWAA 3QORC 3K80A 3ZTCC 2BVOB 4M1CC 5DZJA 1N0LA 3WU1A 4PY8J 3AY4C 2D03H 5J6HA 3BGMA 5IE9A 1HXYA 3MRMA 3S3PA 2AEWA 3KM2A 1XNRB 2YMOA 2EYSA 1UEYA 2ZUXA 2OMVB 4O2EA 3VQXA 2PY5A 4LMQI 3JARB 5LP6A 1PNKA 1XIWD 3Q8EA 4GXFA 4KMQA 4EOWL 4QRQA 1UWXK 4HD9A 3IGLA 1BYNA 3WGVB 5JIMA 4GBXD 1ZANH 4CMHB 1YY9C 4PAZA 3UZVB 3R66A 4FM2A 2CR0A 2NY0B 3L5HA 4K7PH 4MCYB 5DI8B 1XGZA 5C0GB 2YICA 5KHGA 5CA1A 4QD2E 3QQ4B 4K3EH 2D7QA 2W07A 4G8FA 4S11A 2GBAA 1VEWA 4NKDA 3X13B 5AB0A 1T83C 4FEMA 3ISYA 1I1YA 2I85A 5FYJE 4B0MM 3WTUA 1RM1C 1JPSH 1FNGA 1KGIA 4KXRA 1S9VB 1U4EA 4H25B 2VXVH 5K33A 1IFHL 5JQ6H 2CIKA 3VFPB 3C8KA 3O3UN 4I4TA 1U92B 5IB2A 1NEPA 3CVDA 3VSTA 8FABA 3D4GA 4ANUA 4DK3A 2E7MA 4KV5E 2JKIS 2J8UA 1YAIA 1CEZA 5D7EA 3G3LA 1PW3A 5F7HA 1JNNH 3PXHA 4LBAA 4N21A 3QNFA 2BTOA 4OD2B 4XPAL 4LKCB 4KX7A 2A6KB 2WZAA 2PYFA 1KIRA 3DX0A 3B4NA 4LF7O 2E86A 1N33B 1QEWA 5EU7C 2HXAA 2HX9A 3MLXH 4YN3A 3CFEB 5CZVH 4S0HA 1PDKB 4F7CB 1QFPA 2BVEA 5IZ7A 1G94A 1HHJB 2VCOA 2Y6TE 3B34A 3N40F 2WUCH 4IS6A 4PLJC 5EZOH 1ZT1B 3ROLB 4F8QA 5JYLA 4NSKA 4UT9L 4KNQA 3MRNB 4P5MB 3AY4A 4X66O 2CH7B 1OE2A 4JRFA 2X87A 1NBVL 1IQWH 2CLRB 4KJYA 3ULUH 1NCAH 4NNPH 3RPKA 5CGYD 1U91B 3V0WL 2R1YA 5HGDA 1XBDA 4FXTA 1A6UH 4O51A 3NXSA 1UG9A 4K15A 5T5FL 1T5XB 1Z9NA 3OQ3B 4QRSB 4ZHQA 2C4XA 5CD3A 3LNGA 5DLLA 3MRCA 3S3XA 1DVFD 4ZMYA 3AB0C 1FXVA 4KJPD 1D9KB 3UAJD 1NGZA 2PWFA 1T04A 1ZVSB 1GXEA 1GKOA 1TVBA 4P57B 4DCQB 1HJBC 2PI5A 3ULUC 1MCOL 2L4OA 3AM8C 4JZ2A 1SETA 1TUBA 3IEAA 1E4KA 2HVBA 4PJ7B 1KB9F 4UV9A 2WXJA 3OLDA 4UT7H 1I75A 3HRPA 3UBFA 3E6FA 3SGEI 4I48B 2P67A 1I53A 1CLCA 1B6UA 3JV5A 4QXTB 1JZGA 1I3VA 2B0SH 2ED9A 4H1LH 4NO2B 3F58H 3GJEB 1G7QA 3H55A 3HBPA 2ICES 3TVMD 4FQJH 4QLRA 1LEGB 4ELDA 5KN5B 2GC4C 2W6JG 5IG7B 3D2UB 4C56E 1ORSB 5CEXA 1NIDA 1HNWB 3FCGA 5T1MB 3C5ZB 3VFNA 3VXTB 1MG3C 1DHKA 1IE4A 3MRJB 3A4EA 3PJLA 2VYRE 4LCWD 3V9EA 5EF1A 1HW7A 3LQZA 1UFUA 4XVSH 5GSVB 4H88H 2CUHA 3NTCL 4TV8B 4B3RO 1BQKA 2FGZA 3VFVA 3T77B 3JWDL 3TZVC 2R69A 1IM9B 3QG7H 1AY1L 4LNUB 3DBXB 4MA8H 4H13B 3GMOA 3KH4A 4CH5A 1MRFH 4NRYA 3O6KH 4X98B 3SDCA 2OSYA 1H3PL 4B97A 3EHBD 3TGUH 3H2PA 4FYTA 4ZMPA 3I2CL 3CC5A 3PP3H 2ERJC 4JRYD 4MMYA 5TF1L 5CEYB 4E5XA 1JWSA 1XGRA 3SZKC 4O4LA 3E9TA 5FLVA 1S76D 1EXGA 2K6WA 3WYRA 4O4HA 2F53E 3T0WA 5KUMA 3FUFA 3K04A 3LNDA 4FX5A 3O3AB 3EF7A 2YXMA 4X1YA 4LARH 5F8RC 3WO4B 5F7UA 1BQ0A 4N2FA 4P9HC 1EGJL 3OL2A 3DK2A 2VJ8A 4TQFA 4QEGA 4W9CC 3RPIA 4ANKA 1F13A 2IV9A 1ZE3C 2JJ2G 3FB6C 4KKCD 2PTUA 3WDJA 4LSRH 4UUJB 3FOMA 1K6QH 3Q6FA 1SQQH 4AHCA 5KSVB 5KYXA 2GABA 3HC3L 2EDHA 2CPCA 5DFWH 2B08A 3T1FB 1L9TA 1HESA 2I9TA 1AHWC 4P2QD 3FUIA 2H9GB 2HG0A 3WI9A 1U30A 1R0AH 4IHJA 2JF1A 2KHAA 4GP4B 4UV4H 5LXTA 4MAYA 1OM3H 5FKPB 4UCTA 1P84K 3L5IA 5D7IA 1MLBB 4DUZO 1B4LA 4JDZB 4YSPA 3WMQA 4Z5RB 2CUMA 5EZLB 2Y5TA 4IKLA 1WA2X 4GRWF 4BH8A 4WV1C 4X7TB 3V5KB 3CFCL 1HXMA 3POCA 4OGXL 4ONHA 4OLUL 5CN0A 2OSLB 1X6NA 5C0CA 3MCKA 3AK1A 2YWYA 3HN8A 5LNGA 2DM3A 1UH4A 3NZUA 4JN2A 3HZYA 1XGTA 5EDXA 1YC7A 1M9WA 1QEWB 4X7SL 1CYWA 4YHHO 1TU2A 2D7TH 4OM0H 4P4KA 4Y4FD 4HCRA 1F42A 4D9LL 2BVQB 4KH2A 1GHFH 1LGVA 2WXIA 3TJHD 3C2AL 1SEBA 4X62O 2APSA 3KXFD 3VFTB 4FQXC 3Q05A 2BP8B 2BTQA 2H41A 3AUWB 4HU2A 4P5KB 1IGML 2YEZA 1NBYA 3NQKA 4I1PA 3L5WB 1JPFA 1W8OA 4WNJA 3ZT5A 4RMBA 4Z78A 2DWXA 4XMXA 4L87A 4QHKI 2ZIDA 1IL1A 3CCEV 2ATKA 1OGAA 3EDKA 3S3CB 2PTTA 4R97B 2PWHA 4BK8A 4EXKA 5KHIA 2VDRB 1J05A 1IKOP 5AD0B 2DIJA 5TDNB 2Z92B 5I76A 4L8BB 2XAGA 4Q9RL 1FZMA 2C3WA 1DSFL 3L08A 4YUEH 4XXWC 4F15C 4MQSB 2GJZB 2WV3A 3BVWA 5T1MA 2KLTA 2ZOWA 5F7WC 4AYEC 4KMTH 4PJHB 3ULSB 3JZYA 4O4JB 3GSRA 4AENB 2ZPKH 1KP3A 4HPOH 1UC6A 4FQXA 4LP8A 3AXIA 3HN5A 4MW8A 3CSTA 1IC7H 4U1MB 4YL9A 3ZKSD 4CNIA 4HK3N 4ICGA 3V4VL 3WJLA 3WNNA 1ONQB 4XHJC 4KJWC 3T6QC 4O4YH 5FOBA 5IG7A 4N8CH 3F00A 5GJTL 3S6CA 4P4KC 4B3SB 1MEXH 4N24A 3MJ6A 5IYCO 2FEEL 1W0YT 4HHGA 4R7XA 2ZE7A 3KDPB 3NEEA 3UYRH 4BFBD 4RISH 3GEWB 3VXSD 1HN1A 4IKJA 4ZUUB 2F74B 3DUSB 3LRGA 2BNUB 5TF0A 1JDDA 4POUB 3H6AA 2P43B 2EDWA 3VXPB 4URKA 2DQCH 4WV1A 3G04A 1MFNA 3WELA 5HHQA 1CLYH 2OI9C 3GMOB 4NRYB 4OT1H 1GMGA 3O41B 1I7TA 3B9DA 5FDWB 3P3TA 3GUFA 1SN5A 12E8H 3ILPA 2FZ3B 2R23B 1E79G 2X9XA 2DV6A 2PYEA 2LFSA 3CC5B 1VFAA 4RRPG 1MWAB 3G6JB 1A1NB 2H26A 5ISZE 1DVFB 2OTPA 4O4LB 4HD5A 4FFYH 3UACA 1XH2A 4RGND 3MZGB 4G8EA 4MVUA 3QB7C 4L4JA 3F7YC 4GW5A 5C0JB 1Q0YL 5IB4B 1RUQH 1L9MA 2HFEB 3CVIH 4N26A 3MFFB 1W16A 3MV11 5E1IA 2GTWA 2WBJA 3ZE1B 3LXUX 5DUPH 1DUYA 2A4CA 4IHJB 3GTNA 4PIBA 4ZW5A 2YGPA 4FLRA 4NDMB 2J2ZA 2BNRB 4IKIA 2EXWD 3T4YA 4FNRA 3NCWA 2DMGA 2WQXA 4JDZA 4JGUA 3V5DB 5KVDL 3OKLB 1QVGU 5KYXB 2XN9B 3L5XH 2GB2A 2R29A 3VNZA 5IREA 1ACXA 5EUOF 1OCCC 2WC7A 3T1FA 4TLKA 4KJQD 2X4SA 4R8WH 4NM8H 1X9QA 1ET5A 3FQUB 3K2IA 3VFGL 1F2QA 2ZUUA 4DN3H 4GKNA 2VUYA 4QRTB 2HFFB 5GQBA 4O58L 1CE6A 3GSNB 3ZE0E 3ZGHA 2Z7UA 2F23A 3HKBA 4L4TE 3FRPB 3LQAC 5JOPD 4YHKH 2ZDIC 4Z5RA 4UAOC 4OLXL 3HMWH 5EOQL 2H94A 4KQ4L 4QGYA 4I18A 4LZKA 3STZA 1XNQO 1A7NH 1A4AA 4PLJD 3ZIMA 1KJVA 4G80B 2YUZA 1VKXB 1FWXA 3H9SD 4N8UA 5DTFA 3OMZA 2CJUL 3US0A 3MUY1 3L3KB 1BVLA 43C9A 5B7FA 3TC9A 3VXMB 3LDBB 2DKUA 4O5LL 4HU8A 1X5IA 3TS8A 4HZLA 2AF2A 4JGMA 5LQBH 2CJ3A 2X6CA 1BOYA 3QWOA 4K94H 3UYPA 4PJ7F 1NAML 3MRRA 1M3JA 4XMPL 4AIZA 1UTDA 3MV9D 5CMUA 2QDOA 1ZLDA 1OAZH 3H3BC 2HT2D 4H5SB 5FHBL 4Y9FA 3RL2B 3IU3B 4L4VA 2Z31A 4HIIB 1P6WA 4X6CB 4JQXA 4ZBJA 5T1LB 3DIVA 3DVFA 2P80D 5IBUB 2YD3A 3BFRA 4CS4A 1Z9MA 2OJEB 3HMWL 1LO4L 3EOAB 3O45A 4HXAL 4MTXA 3G80A 2VRZA 5HDBB 4PS7A 2RFXB 1KLUA 4OF8A 3UX9B 2WN2A 4XNAA 4ZHQB 3WEOA 3NCFB 3QPKA 4NC0B 2P3YA 1GCYA 1Q9KA 4ZSOB 4KI5D 4R8WL 5D8JH 4NZFA 4P5TB 2PP7A 2DJUA 3PL6D 4PJAE 1DVUA 4N6QA 3Q2LA 1EJOL 3DYOA 3NT0A 4Z7WA 4HJJL 3WE6A 4FQ2L 2R0WH 3PGFH 2IANB 4LASH 4DGVL 4D0BB 4FLVA 2W07B 1Q6HA 4GAFB 3EJJX 3VQYA 2CA4A 4O4JA 3GSRB 4AENA 2OX5B 4BDVA 3ATEA 4JHAH 4NOFA 4M1GH 3TNMB 1XQ4A 2RJZA 2BVYA 3FCBA 3SE4C 3ZE1F 3UC0L 1JZFA 4P46B 4M6NL 4XMLL 1TJGH 4WW1A 4A2HA 1NMBL 1ZWIA 1RV6X 1ORSA 1QBLL 2Z65C 3HNVL 4U33A 4W9KC 4B5ZA 5CEXB 2HN7A 4H40A 3IGAC 2Z8WC 4YSTA 4AQEB 1JTTA 5IYBO 2E0PA 4FP8H 4X9BA 3HNTL 3QIBD 4RZCA 2E7LA 1IEAB 2VDPL 1GTOA 3LSQA 3DYMA 1MJ8L 1GJIA 4Y5VA 4U7SA 1NFKA 2XTAA 1MA1A 4PJ9B 4UV7L 5J9PB 3B56A 2JFCA 3NIDB 4JDEA 3WNIA 2JGDA 5DUMH 1MHHA 3FOLA 2X4UB 3U0TA 1UPGA 2XQYK 5D2NC 2OTJV 5JQIB 1IX9A 1G7LA 3W9EA 5DK0B 4Y4FA 2WWOA 4K7FB 1SUHA 4DPCX 4H26A 5T1KA 2FX7L 5CCKL 3D4ZA 5L7XH 1BP3B 3RUGE 2DI9A 3FTWA 1WIPA 5E6SB 3L3JB 5IHBA 3V5DA 1DN2A 2YLKA 1NR7A 1RURH 1TZHB 1PG7L 2A77H 3TT1H 4BFRA 5JZ7D 2ZINA 2Y69C 4NEHB 3FCUB 2VZUA 2O6CA 5B1KA 4YLQT 5CEZH 2GTWB 2WBJB 5BVPH 3FHQA 5G4MA 2FAUA 2VO8A 3P9LB 3FOMB 3ARXA 4FQLL 1EM1A 3QO0B 1CE6B 3GSNA 3RTQD 2HKHH 2PXYB 5E2VH 3QH3A 1TVBB 4DCQA 2H3XC 4PJCB 4EUPH 4HP5A 1N0XH 4UINH 5BOJA 2XV6B 1J0HA 4L48A 3T4DA 3FO1B 3BIBX 3G5ZA 1TENA 3L3IB 5I74B 2DF3A 2H32H 2Q9OA 5L2KA 4NTXA 1KJVB 3MREA 4LF6O 3UAJC 1AI1H 4RLDA 5KVEH 4JAVA 4MAYB 1JNJA 1K8DB 5CA0A 2W9EH 4OB5H 3VI4A 5BZDA 4QRTA 5FIEA 2YKLL 5IMKA 4UOZA 1WISA 5FGCB 3B2MA 2VOTA 3GSXA 3BWZA 2BHYA 4J1UB 3ICXA 1OK0A 1ZL8B 3CC2V 1QHOA 1Z1WA 2VW4A 2XXFA 2UYLA 1SMAA 3KXFE 4H0GA 3UCQA 2HR3A 3V0FA 3WL9A 5JXEA 2MTAA 4QTFA 4HFUL 1MY5A 1DJWA 2XVKA 3DC0A 1XH0A 1BZ9B 5HYFA 5CU9A 3VX0A 2JCCF 1G7MB 5HHNB 3C2AH 4UCVA 3IDYC 3N50A 3QNXB 4HK0B 1Q86W 2NY5L 4TQIA 5JQGB 4HS6A 4ELKB 1Q38A