1OCZB

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oczB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oczB02
3MBWB 1AZCA 2OCCB 1PZCA 2BP8B 4UAHA 2YAQA 4HAKA 3NJJA 4YSDA 3UAEA 1WA0X 3IE9A 1GS6X 4JHVA 2H3XC 4G71B 3T6VA 3X1BA 1FWXA 1FFTB 1PNDA 1UATA 5B3SB 2B08A 2CBPA 1ASPA 3NJKA 1WAEA 4N4YB 3SBPA 1KCWA 2H47C 1ZIBA 4AX3A 2GC4C 1A3ZA 5AKRA 3QQXA 1KDIA 2VSKB 1AQ8A 3FSWA 2IH8A 5B1JC 1X9UA 1AZUA 1QHQA 1W6WA 5B1JA 2XVBA 1NPNA 3CDZA 2HRGA 1BXVA 2J5WA 5D4JA 2YAEA 1OCOB 3KW7A 1OCZB 3N2JA 3FU9A 1RZQA 3AZUA 1CYWA 2EIJB 5EHFA 3NT0A 3FPYA 1RKRA 3DIVA 3WI9A 5D4HA 3WKQA 3ASNB 5I26A 4E9VA 4GY4A 2IDSA 4L0PB 3UACA 3ABLB 4YSAA 3MX0B 3PAZA 4Q8BA 4F2EA 1OE3A 3FS9A 5B7EA 4KNUA 2YQBA 1PLCA 2BWDA 1MZYA 1NPJA 1BQ5A 1PZBA 3SBQA 5A7EA 5I28A 4W9ZA 5E9NA 7PCYA 2IH9A 2GSMB 2DWTA 2VW7A 3S8GB 1E67A 1JZJA 3FYIB 3FSAA 3S3DB 4YSSA 4YSTA 1T5KA 4G7RB 2GHZA 2XV0A 3N55A 1BAWA 5TK4A 2PPCA 4K9JA 1ID2A 2N0MA 3QJSB 2PP9A 3EHBB 2W8CA 2R7EB 3QPKA 4FAAB 4GYBA 1ASOA 1ILSA 8PAZA 4A68A 2YAMA 2H5UA 1IC0A 1SDDA 1OV8A 3CZUB 4DPBX 4BWUA 1J9TA 1SJMA 1JZFA 3KW8A 1TU2A 4DP6X 2CAKA 2PP8A 2DYSB 2AFNA 2GB2A 2YAHA 3EH5B 3T6ZA 4DP8X 2IWFA 4DP9X 1ZDQA 1X9RA 3X1FA 2YXWA 1CUOA 1GW0A 2FTAA 2QPDB 2XXGA 3NJMA 9PCYA 1CURA 2GI0A 3QJRB 3NJGA 1XB6A 1L9PA 2BW4A 1MZZA 2FT7A 2TSBA 1NWOA 4ZK8A 3QJVB 2BZCA 1AS8A 1KV7A 4MFHA 1JXFA 2BZ7A 3FSVA 2I85A 5I6PA 5I5JA 3WNJA 1NZRA 4HZ1A 2GBAA 3X1NA 3GDCA 4KO9A 1GY2A 1NIBA 1NICA 2PP7A 1V55B 3T6WA 3NSFA 2JKWA 5IY5B 2LLNA 4KOCA 4DPAX 1E5YA 1SNRA 2QDVA 5AFAA 2Q5BA 1ZDSA 4M4RB 5B7FA 1NDTA 4G70B 3FU8A 5PCYA 1ZPUA 1E30A 1JXDA 4E9RA 3NP4A 3NSDA 3ZIYA 1BYPA 1R1CA 3NP3A 3ERXA 4YVUA 1NTDA 4YSOA 4BK5C 4E9QA 2UXTA 4G72B 5I6NA 1E65A 4CSPA 3CVCA 3GYRA 1XB3A 3CVBA 4E9WA 4TXVB 2P80A 2CCWA 1PY0A 2UX6A 2Q9OA 2YAFA 4PCYA 1KYAA 1E5ZA 3WIAA 5I6LA 4BWWA 1J5CA 1CYXA 1EHKB 2E86A 3IEAA 1WS8A 2QPEB 3OMIB 3SBRA 4FA7B 2NRDA 3NJFA 3ZX1A 3FSZA 4NERA 2DY2A 4GP8B 1A4BA 2PCFA 4UANA 2GC7C 4HCGA 4UF7C 2QT6A 2YARA 1JVLA 1SF5A 2OV0A 1AIZA 3TBBA 1ZV2A 1J9RA 2YAOA 4F7KA 4YVNA 1A4AA 2FJSA 2I7OA 3NSCA 3FU7B 3EH4B 3L45A 5I5MA 2A3TA 2HLEB 2DWSA 6PAZA 4AZUA 3TBCA 1JOIA 1XB8A 3T9WA 4BDVA 4BWTA 1ILUA 3AG1B 2GIMA 3FQ1A 2FQFA 4E9TA 3HB3B 3ABGA 2XV3A 3FQ2A 3S3CB 2OJ1A 2J56A 2FQEA 3NYKA 4KO7A 2ZWNA 1JZGA 3AW5A 1AZNA 4AKQA 5I6KA 5F7AA 2EIMB 5PAZA 1BXUA 5F7BA 1B3IA 4YSRA 2FQGA 3AG3B 1KBVA 1JZIA 2JXMA 2IWKA 4DP5X 2IAAC 5FC9A 1NINA 1PLAA 4HALA 4HHGA 1NWPA 3CDZB 3TASA 2MTAA 4GXFA 2WO3B 3OQRA 4E9YA 2AZAA 3ZDWA 2VN3A 2UXGA 3T6XA 3X1EA 4X4KA 3UADA 4KNSA 2J57A 5LDUA 1HAWA 4E9XA 3QJQB 2AANA 1JZHA 2BO0A 2FT8A 1BEXA 1AS7A 1JXGA 3FQYA 1HFUA 2EINB 1M57B 1YLBB 1L9QA 4A67A 1AOZA 3T71A 2DYRB 2EIKB 2W88A 5I5IA 2BW5A 1QLEB 4WKXA 4HCFA 2HXAA 2UX7A 1PAZA 3DKHA 4HIPA 2PPAA 4AKOA 2EILB 1DYZA 2ZOOA 1V10A 2JFCA 6PCYA 2XXFA 1PCSA 3S8FB 2BP0A 1F56A 2XU9A 1W8EA 3PCYA 4GP4B 3DTUB 1KBWA 1SHXA 2P80D 5B1KA 3WKPA 1SDDB 1NIAA 2CALA 1I53A 1OE1A 2FWLB 4G7QB 1AG6A 1ZIAA 2YXVA 4A2HA 2ZONA 4NAJA 3NJIA 2PPDA 3ASOB 2BWIA 3PXLA 1FA4A 1M56B 1ET7A 3BQVA 1SFDA 3HEIB 1ET8A 4G7SB 4F2FA 2PLTA 3FT0A 1SHWA 1L9SA 1PZAA 1BYOA 2BHFA 3H4FA 1W6LA 2IDFA 1RZPA 2VM4A 4HCIA 4YSUA 1BXAA 3WG7B 3FPXA 1ET5A 1JERA 1JVOA 2XX0A 4DPCX 4P5SA 4AKPA 5I6OA 2TSAA 1OE2A 3EF4A 3AG2B 1J5DA 1URIA 4YSEA 5AZUA 1NIEA 4Q89A 4YSPA 5TK2A 1AAJA 1SFHA 2HX7A 2IDQA 3V9CA 3ABKB 4DP4X 3X1GA 1TEFA 4QKTA 2PCYA 1GS8A 1MG2C 1AACA 3H56A 1PNCA 3IN0A 4GP5B 1ETJA 4KO6A 1VLXA 4A2DA 3D12B 1AG0A 4RH4A 4M3HA 3IN2A 4PAZA 5I6MA 3TA4D 2XX1A 1CC3A 4WTQA 3ZBMA 2XWZA 2FNWA 1ASQA 1WS7A 1V54B 4EF3A 2XV2A 3JT2A 3NJNA 2PPEA 1OCRB 2X87A 3U25A 1OOWA 4P5RA 1TKWA 2DV6A 3EH3B 1L9TA 2R7EA 4QLWA 3NJLA 5B1AB 3QJTB 7PAZA 2XLLA 4A2GA 3OM3B 3V9EA 2HZHA 2VM3A 4CSZA 3AG4B 1IUZA 2FT6A 3GXUB 3SQRA 3RYMA 3AY2A 1GSKA 2MRYA 3NJHA 1M9WA 1EZLA 1WA1X 3UABA 1JZEA 2B3IA 1IKOP 3C75A 4DP1X 2FQDA 4YSQA 4E9SA 3CVDA 2VW4A 4W1TA 2ZXWB 3UAAA 2WO2B 2IDUA 1GR7A 1AR1B 4KNTA 4BDVB 1DZ0A 4BXSV 3OMNB 4AI7A 2AZUA 2VSMB 1RCYA 2Y69B 2Y1AA 2VMJA 1GS7A 2AVFA 3PAVA 1KDJA 4JKNA 1AZBA 2HX9A 3PPSA 1N68A 4YSCA 4BXVA 1J9QA 2CUAA 2HX8A 4N8UA 1L9RA 2XUWA 3QJUB 1SF3A 4KO5A 4KOBA 5B7MA 1MG3C 1QNIA 3WNIA 2PPFA 1L9OA 5ANHA 3IBOA 3NSYA 1BQKA 1GY1A 4YL4A 4JHUA 4NB7A 4DP7X 4A66A 2QDWA 2YAPA 1WA2X 1IBYA 3TU6A 1N70A 1KCBA 3PAUA 2VW6A 3X2QB 1A8ZA 3ABMB 2X88A 5B1BB 2BP8A 3BVDB 2WSDA 1IBZA 1TEGA 3G5WA 4HHWA 2XYBA 1NIFA 1J9SA 3OD3A 1AZRA 1ADWA 1OF0A 4DP0X 1PF3A 4ENZA 1BQRA 1A65A 1KGYE 2I7SA 2UXVA 3S3BB 3UGEA 1HAUA 3CG8A 2J55A 2CJ3A 1NIDA 1A4CA 3PLYA 2RACA 2UXFA 3JTBA 2YEVB 1XMEB 4A2FA 1GYCA 2IDTA 1OCCB 4DP2X 1AANA 2HRHA 2IWEA 4A2EA 5D4IA 3OMAB 1PMYA 3FYEB 3FU7A 2BP0B 1PLBA 1AS6A 1MDAA 3H4HA
chains in the Genus database with same CATH superfamily
1M6OA 4FA8A 1UEMA 2Y4TA 4LVHB 1NCCH 3O3DB 2W0PA 4KTDH 3W39B 4AYFA 1EFXD 4PJFE 4ZW5A 3GSNH 3ARRA 1WA0X 2YPKB 4J28A 4XOEA 1AC6A 3D39A 4GRWB 5D7IA 1I3RB 1HDMB 5DJAB 5C0AE 3BUQA 2X1QA 4GYCB 4L3EE 4WK2B 1F6FB 4NO3A 1ONQB 4N4YB 1QASA 5FKPA 5DU7A 4OCSH 2B5IB 2A7BA 3JV6B 4XBGB 1Y4MA 3KVQA 1T83C 3U9UA 4FQXD 1MRDH 1ZIBA 5EO0B 1DQQA 4AX3A 4NZTH 3VXTA 3G4SV 3KPTA 5IJ9B 1EUTA 4LL4A 3QQXA 1NEZG 1KDIA 3ZJZA 5E2UH 1MCOL 2VM9A 5B1JC 3B9EA 4LWSB 1E5BA 3VFVA 2UWEF 4NJ9H 1YN6B 2ADYA 3NZ8A 4I3SH 2HJLA 2ETNA 4PJ6A 1ZE3H 3LXAA 4A7SA 1NMCB 4ODBD 2NY3C 3POCA 4ALAL 4HU2A 4EI0A 1XR8B 4LCIL 5F1NB 5DQJB 4YE0A 5BVJB 2GCYB 4F8LA 1P6AB 3PQYB 3C08H 4Z7IA 3X3GL 1NGYA 4ZS6D 1T0PB 3JXAA 1J05A 3L6FA 4JKWA 4U1SA 1P7QD 4Q9QL 3P4OA 4S1QH 3HNVH 5C0ND 4BZ1L 1N0NA 1F6LL 4XPFH 2GBTA 4GW4A 3RDTB 4F7PB 5AB2A 1IBKB 4JI3B 4MKTA 2Z7ZA 4C54A 5DI8B 3N44B 1HSBB 2A0LD 5C0CD 4M1GH 2W0XA 4AL8H 1KYOF 3L9YA 3WTWA 4LLQA 2WO4A 4IHOA 1T0MA 3QCUL 5ALBL 5TDOA 3DVFA 1CB4A 3H1ZA 3IDNB 4RFEA 1WFTA 3NXSA 2B0SL 1K5NB 3UEQA 4ZAKC 1W16A 3H2WA 4HIHA 2Y9RT 3L3KA 3SZKC 2PPCA 2QQNH 3QUKA 5DC2A 2FR4B 1J1PH 3MLUH 1NUGA 1T6BX 5LXTA 4Z5RB 4EFBA 2R7EB 3K46A 3M88A 3LZNA 3QB7C 8PAZA 4ZTPH 4J8RB 3KPRD 5K59F 2ZKOA 1ZT7A 5LBVA 2Y7NA 5FO9B 1M7XA 1P9MA 2YD5A 2YKKA 1T7VA 4WO4B 3MRJA 2B9AA 2FECI 1SA0A 3ETEA 1RJLA 5L2JA 3PV6B 4KJWD 4B3TB 1ZSDA 2CAKA 1CXIA 4LSQL 4TQ8A 1YVWA 3IDGA 2ZE8A 3IFXA 2GKIA 3D4CA 1CUOA 1I7TA 2FTAA 4HFUL 4NFDA 3HE6D 3QUMB 3ALWA 3ULUH 5F2FA 5IB4B 5EC2A 1O6SB 3K08A 2ICWJ 5BY1A 1WICA 5DHVH 1FXKB 4JI1O 5FGCE 1QLNA 2J6WA 3BPCB 1G7LB 4UQCA 2PXYC 2WB1A 5G5DA 5IQ9B 4JO8A 1IM3A 1MI5E 1UEYA 1WTLA 2I60H 1OB1B 1E8XA 3QISA 4W4NA 4KVNL 4XRCA 5B38A 4QAWA 5C0RH 2BFVH 3UO2A 1QKZH 5H6RA 1G1XB 2JKWA 4H5SA 4KOCA 3TBSB 5DT1H 3MRKB 3LIZH 5F21B 4HPYL 2PYJA 3MHSC 5B8CA 1CTMA 4E9RA 1XQ4A 3C3SA 2UZIL 3MUHL 3SGIA 1BSIA 4HXAH 4YDJA 4TV9B 1GTNA 3MRFA 1SQFA 1SJEA 3VXMB 2G38A 2YRBA 4JAMB 4K7FB 2MIZA 3I50L 1CDUA 5BR8O 2DWDC 2A79B 1XGQB 2BOBA 3BKCL 1E50A 3MV7B 4G72B 4KJYB 1R3JB 3ZYIA 3KZ8A 2DQTH 2RTTA 3KG5A 3L8QA 2F74A 4IJ3C 4ISVB 3GBLA 3OJ2C 2WN2A 4TUKH 1TTFA 5TTRA 2OIGA 2ZSWA 1T20A 1XMOB 5C0IA 1JSYA 3BIBX 2IFFH 1MMMA 3DDFA 3K72A 4BQ8A 4PBDA 2OT5A 3NABH 4GQRA 4U31A 3UG4A 1YI2V 4WNQB 5I0ZA 3LN9A 3MRLB 2J1ZA 1HSAB 4X6DB 1WS8A 4X7EC 1OGAA 2V7HB 3ML9A 4WV1B 5GGRB 1NQTA 3QDGA 2EDXA 1N67A 1RULL 4XN4A 3DK2A 2EXWD 3VVWA 4FA7B 1R1BA 4AVJA 1HL4A 1U8PA 1AHWA 2FGWH 2FHCA 5MENA 3AG4C 2ZNIA 1VFMA 4R4FL 3VACA 4DH2A 3HNSH 2CKBA 4KY1H 3QQ9C 4KV5F 2P44B 4HCRH 5DLML 4YR6A 3K79A 3G6AB 4UF7C 2GC7C 2WVUA 1RZKL 3GXTA 1QI4A 1JVLA 3OV6A 4M8QB 2ZXQA 1CLYL 3MFFB 3ZMEA 2W6IG 2PO6B 4QDGA 1R47A 1K8DB 1LNUA 2D0FA 4IYIA 3SDCA 1HNZB 1C5CH 3LPGA 1A4AA 3GM8A 1EHAA 4LBEA 4XWGL 3OXSB 3A2FA 1KG0A 4HS3B 4Z3HA 4O4IA 4K3JL 1S5IL 3II3A 3QWOB 4J3VA 1NGZA 3S35X 3QSKB 3UPRA 2OAAA 4P2CG 2E7DA 3K8MA 5D5ME 4EN3C 3P4MA 3F7YB 3T9WA 4NIKB 3WFEL 4CJ1A 4L8CB 3AWEA 3FX7A 5T5NF 4F3FA 3B77A 3WEMA 2OL3L 4G8EA 5D72H 3NTCH 5CEZE 3U0WH 1SUHA 3ZMNA 1K5QA 3BP4A 4JHWH 4MNHB 5IBTH 3D0LA 3HB3B 3VG0L 3B43A 5F6HJ 2Z7UA 3CFNA 1XAUA 2DQDH 4LEXH 2HWZH 1IC7H 3ZDYE 2HPOA 3GMRB 3DVNA 5FHAH 5EUKB 3QXUA 3RWHA 1XGUB 1P4BH 2AAAA 3MGTB 1QFUH 2ICWA 3QF7A 2L04A 3CPUA 3Q2CA 2AK1H 2KMWA 4OGAD 3TCTA 1CFSA 1FL5B 3D0AA 5HVHC 2PKDA 3DUHA 4WENB 3TYGL 3CN0A 4URKA 5E51A 2NY6C 2NNFA 1N8ZB 1O9GA 3F64A 5DN6G 5B1BC 2VITA 3OX8A 4FFZL 1K92A 2JRIA 3VRLE 4PJEB 4PGJA 5IVNA 4ZUUB 4KQ0A 2VQEB 1SEBB 1TZHB 1A47A 1P4IL 2WBJB 3G6BA 4FFKA 1DO5A 2MCAA 4EZMA 3Q8EA 3HN5A 5IHZB 2BCKB 3OZLA 5KSUA 4IK6A 1CF1A 3LEVH 4NPKA 4JFHD 1SJHB 1CIUA 4FXGC 4F80A 2DQJH 4U3SA 1C8PA 1E43A 3FT3B 3KM1A 4UQAA 4JFPA 3SZ6A 1I7ZB 2MQCA 3ARPA 1FYTB 4P4KD 1OARH 3P11L 3OKMA 4OW6A 2J4WH 4NNXB 2NNRA 4HD9A 3ELAT 1AI6A 4ETQA 3I02B 4ES8A 1VQ8V 4YDLB 5C7XH 3ZHUA 1YEJH 5KYYB 5C09D 4JG0L 3HKDB 3L08A 3UH8A 1JIBA 2W92A 4ZMXA 3B83A 3BT2H 1KPUB 4X5XB 3UP1A 3REVB 1SHXA 3QORC 4OZ4B 15C8H 5EF3A 3RL2A 3DGDA 3HG1E 4V1DE 4FS0A 3FSOA 3KXFA 1H3VA 1U8IB 4QOKD 1MOFA 4L3CB 2YUZA 1AO7E 3BSHA 4UDTA 3BW9A 2BK8A 2KT6A 5I1DB 5BXFA 4YJ2A 5I9QB 3F62A 4MBRA 1XF4A 1WUNT 4QXWA 4NQQA 5L6YL 5LVEA 4PJXA 1JMZA 1MPAL 2VN5A 4W93A 4XO5A 1FNEB 5B1CA 4N24A 3V52H 1CBVL 5DVKA 4AYDC 1HOCA 1EZUA 3B7SA 2HVKC 4RFNC 4KI5C 4WI0B 5TGBB 1BXAA 4P05A 2UXCO 2H3OA 2A3QA 1FRGH 1FVDB 1PIFA 4QHKJ 1DZBA 1LP9E 4X9FA 1KTRL 3ZSSA 5LWYH 4FMKA 2NY0C 2YFOA 1JCKA 1CGUA 3GGWB 3WFDL 3K5OA 1X5FA 2TSAA 1DL7H 2Z93B 1QR9A 4D6TH 1GMIA 4FLTA 1L7TL 4D9QE 2K7QA 1HS6A 2ZXCA 5AZUA 1IGYB 1N8OE 5KEZA 4EIZC 5JO5B 1HHKB 3OEEG 2F53B 1P53A 5FA3B 3ZOAA 5TK2A 5SX4I 3BUYA 2XA8H 2IDQA 1RJYA 3C60D 4HC1H 1KSRA 5JPMA 4Q7DA 3MX0A 3U4BH 2Y4SA 1MFAH 4MZIA 4RCAA 5BRZB 1E2WA 1AACA 1ZKAA 3NCWA 1KJ3L 2LU4A 1UGKA 3EAKA 5IEHB 2H7WA 5DHVB 2I07B 3KCPA 1HHHA 1M7DB 1TVKA 1KCVL 1D5RA 3DHJA 1DVFD 3B7TA 4FZ8H 2O61A 4ZJ9A 4AMXA 4OLZL 2GITB 3QIBD 4EF3A 3JT2A 3PL6B 4UUJC 1LMIA 2F95B 4FXTA 3ARGA 3U25A 3HPJB 1MNGA 1FKAO 2BXZA 2IADA 4MJHA 2G3ZA 3D08A 4H2CA 5C6PB 3LX9A 3WXWL 4F7EA 5K9KA 2BHYA 3DMMD 3VE0B 1BD2D 4FQXC 5I30H 4TV3A 4PJCF 3EOYG 1EXGA 2R69L 1BZDA 1HVXA 3R06A 3V2AR 2G0KA 2XTJD 4IU3B 1D5BA 5D4QA 3IVKB 1WBZB 2UZYB 1ND0B 3OAUL 4G6ML 5L2KB 3HZVA 1YEDB 2QKAA 1WBYA 2XRAL 2G9HB 1AR2A 3D2TA 4K7PL 4QIRA 1KEGH 5FPRA 3VXSB 5I0WA 1URZA 3UKMA 4YJZL 1LO3H 5IWLA 1T4WA 2AJUL 3K59A 2VAJA 1W0VB 4YPJA 4WCEV 4W81A 3UYRH 3BSZH 2EYSB 2WAHA 4CGUB 1MAMH 5TE6L 1I9EA 2ERJC 3LKRB 1ZSPA 4YO0A 2DYPB 1L7IH 3BVVA 3Q7JA 3OMNB 5KA6A 2X4TA 2AJ3B 4U0RC 2WZPA 3WY2A 5J3HD 3W9EA 4DGUA 1SS3A 2UXDO 4RQQB 3BIKB 3MRNB 4AXWB 1L9MA 1YEFH 5C6TL 5EEYA 5C0NC 3D2UB 4K73A 4NBZB 3MA7B 1N68A 4R0LC 5HD8D 1KY6A 2X40A 4WUKH 1RUPL 2B59B 1XCTA 2P5WE 4JGMA 4R4BB 4U1IA 4RGOL 1OALA 4FERA 4X8CA 1SZXA 2ESVE 3V4VH 2JXMB 3QWNA 1QUPA 3RYFB 4JMXA 3VD7A 4EN2A 4HWEH 1Q43A 1IGML 2ATKB 1OXYA 2A74C 3ASOC 2PYEB 3J07A 4WJG3 3DGGB 4NENA 4DN4H 1I9RL 1GM9A 4JI1B 2A9MH 5FEBA 4LLDA 4QXTB 2DJUA 1Q6HA 2HJFC 3I74A 4UM8A 4XNQA 3T3PB 1BMWA 3CHPA 4A6YL 4PJAE 2K3HA 5F89B 1TJGH 4ODUA 1WC7A 2KHAA 3W3BA 1QPXA 4ZXBD 3SDYL 3TIDB 1LDPH 4RUFA 2HFTA 3DHMA 3FO9A 2PR9A 4KJWC 4RX4D 5LNEA 3ZE1E 1A65A 2HT3D 1F97A 3BKJL 3L95A 5A2KH 3DECA 4QGPA 2WXNA 1I31A 1S76D 4I9WE 1ZWIC 1OAYH 3QCTH 1CLOH 1N26A 2DICA 4L23A 2LQRA 3WHXB 4AYMC 3HE6C 5C93A 3LXCA 5BZZA 1XGPA 1OP3H 3U4KA 2H1PL 2HKOA 4RRPG 5BR8B 2FSEB 3DC0A 4A1RA 1IC1A 1QAWA 2YEVB 1AI4A 4MVSA 1VFBA 2WXPA 1Q94A 4YHNB 4HWNA 2OJZL 4MA1C 1IE5A 4JI4O 1GVIA 1YTFB 2ZD9A 1P5VB 3UTSB 2WANA 4JY4A 2LTQB 5L3GA 2Y6TE 5I1GL 3BUPA 4F9PC 1ZGLA 4ZNEA 1KPVA 1JPSL 2P5PA 3KCWA 1NFAA 5CGYD 3FF8A 2APSA 2DLGA 3M8OH 4I13B 4DF9A 4Y2OB 2Q7NA 3V79C 4KL1A 3T4AA 1YYLL 3LKNA 4QAMB 5HGHB 2EABA 5TQ2L 4JM2B 4NHUB 4PRHE 4WCYL 5C2UB 2FZ3B 2YAQA 4GKNA 4HAKA 3ZTEA 1AGCB 4LMQI 1D7FA 1QBAA 3JWOL 1UFIA 3TYFA 3VXRD 4YHLL 3S8WA 5HYQB 1ZT4A 3GMMB 4RMSA 4GG6A 2CK0L 2Z8VC 4X99B 2XACC 3SBPA 5CSZB 2NY7H 1L6PA 3RYCB 1EDQA 1IM9D 3QFJE 5I5RA 3B2EE 2JKXA 1IFRA 1A3ZA 1GGCH 1I82A 2ZPKH 1NCUA 3CHSA 4D0DA 1N9PA 1J87A 2VSKB 3WEXB 3N40F 3GSWA 5KBPA 4UT7H 3V4PH 5GZNC 3D4GA 1G7HB 5IGXL 3KWTA 1GJWA 2BVQB 2X12A 4GEIA 1T1XA 1AQKL 1BZ7B 5DUPL 3TBYA 2HVJC 4XAKD 2ZDIC 2DEWX 2M83A 3F2LA 4JO1H 2EXWC 2Q0ZX 5KTEL 2X42A 4J80A 2X2HA 2GQHA 5GS2D 2HKAA 2VJ0A 1Y66A 2E8ZA 1BYNA 5D1XB 2UUAO 1MRDL 3G5VB 1CYWA 2J1YA 2ZKXA 3CLFL 2BJMH 4PW9A 4NQVB 1ZRUA 4E9VA 3MRMB 2JIXB 4ZFFA 4M8RA 2BNRD 1VZHA 1REIA 4B6ZA 2JGUA 4F7CA 3K06A 3A8TA 1XTLA 1DLFH 4KNUA 2WXIA 1JXKA 5D2LF 4TSBL 1JCHA 2HJKB 4Q6KA 5JQHC 1NI8A 3JATA 2AABL 1AILA 5A7EA 2DYRC 1A7PH 1LUWA 2FB4L 3RX9A 1Z9NA 3O2DH 2DW4A 4XPTH 4GQ9H 2WSSG 1BMZA 3QXWA 4GZRB 3V7AG 1Y6KR 3S8GB 1OZ0A 4QRPE 4P2ZA 4RMTA 1YUHA 4DGYL 1OZTG 5JXED 4KUZH 3EOBA 1BXXA 2HTLD 2IOOA 4YXLH 1P84J 5TF1L 4WBNA 3WJMB 3F3HA 3GPEA 1PSKL 4FAAB 4HOXA 4Q58C 1CDCA 1WIUA 4Y5XA 3T65B 3IMVA 1Q90A 2H5UA 4CN4A 4DVBA 3SGKC 5D70L 3MGOB 1ZD6A 3UAJA 2WLJA 5DK0B 4E4EA 3MZTA 1JUFA 5E9DB 1GOHA 5AVQB 5LHIA 5EOQL 1JGUH 4BAYA 3RYHB 1GGBH 4LDLB 4PD4F 2F1MA 3CSXA 1F23A 4G1EA 4YL9A 2NY6B 2YICA 1AGFB 4QPJA 3BP6B 3P3SA 2G5RA 5FL7G 3F12B 4DQAA 1Q0EA 4OLYH 4Y16A 5JHAA 3KYNB 1IGCH 4TNWK 2XNAA 5IB1B 1FN4B 5BVPH 1DTUA 1MOEA 4RDQF 3U30B 4DKEL 4F8PA 1IZKA 1J95A 4D0BA 4X8JA 3GC3A 2F9BT 2XOTA 1YITV 4XXDB 3X1NA 2YRZA 3MRCA 1Y18B 4BGDA 2FLMA 5HYJB 3NIFB 3K0YA 3D5OF 3QHFL 3IT8D 5AVYB 1VF7A 3BRCA 1I3GL 2FSDA 3NSFA 5EIIA 3APCA 3V5DA 1N7MH 3MLXL 3STZA 3GSOA 3CBRA 5LBSH 4RMWA 3V6OA 3G6JE 3ARBD 1R5WA 5HDBE 4G9FA 2KH2B 2CE4A 4A2MA 1Q0XL 2HT4C 3FU8A 4OF0A 5PCYA 5DZPA 3FMGH 1C5BH 5B21A 3NSDA 2X9XA 1RHFA 4NO5B 1ADQA 1UJ3A 2WOYA 3M46A 3MYJA 4PWGA 2V3DA 1QYGL 1X4XA 4YVUA 2G3NA 4NAQA 3IXAB 5E5UB 2W9DH 3O0LA 5FYKD 3TVMC 5C0DA 3ZE0B 2VXQH 4NKOA 2HFGH 1ZS2A 1MFDL 2K45A 3TFKD 3JZYA 1KB9K 4Q14A 5IMOA 2OSLA 1QHPA 2ZAHA 4JZNA 4CN6A 2DQHH 4JF3A 1LEKA 4P4RB 2N05A 3FU3A 1U97A 4POZD 2ZOLB 3WIAA 1RY7B 2NZ9D 1QBBA 3RGVD 3U1QA 3BT0A 5DJCA 4F2MA 2I9LA 2WN3A 2V17L 5EU4A 2ZAIA 1F4YH 3T0EE 3WGUB 2DQTL 3V4VB 2VRQA 4FQQB 4O51A 1B06A 3H3KA 4LNUB 1LO5A 1RHHA 4LU5H 1H2MA 4NERA 3KCXA 3JAKB 3BPLB 3NCFB 3ZKQD 3US0A 4NQUA 1T7ZA 3M6DA 4RFNB 4JI7B 1RZGB 3BFOA 4NC1C 4PV8A 4UT6H 2YUWA 3W9DA 1ZLVH 3QRFM 4Y4KB 4MRBA 2ICEA 1SYSA 5IHUH 4NN6C 3MCYA 3U0PB 1JHKL 4I0PC 3O3BA 3AY4A 1EXHA 5IB2A 3VD0A 1NA8A 2VJXA 5JW3L 4D7SA 4HF5L 1Q8MA 1S4IA 1D5ZB 1VFUA 3CMAV 3OG6B 1XB8A 2N7AA 2D3VA 4BWTA 3P30A 3C2AL 3C60C 3IJ4A 3CH1B 4MXQD 3ZU8A 3UJTL 1FUNA 3P2DA 3VFUB 4L29A 4XOAA 1F11B 3K4ZA 1RUAH 1GAFL 4GRMB 4MMYB 4RMQA 2ZX9A 1MFCH 4JI6O 2JKRM 4X7FC 5DJ6B 1MNNA 1UQSB 3TZVD 1GZHC 1BIIA 1WPBA 1TZGH 2M1KA 2X7LB 5F7DA 3CLEL 2Q7YA 1MRFL 5KYXB 1OSPH 4PJ8A 4FF9A 1J48A 1DVFC 3QDJB 3RTQD 1KCLA 5ISZA 5DM6V 3H8NA 3VXMD 3A6CL 4JFZL 5CBAA 1NZ6A 1VQ5V 2D9CA 3WB1A 5FC9A 3L1OH 4AGQA 3SDXE 3GK8H 4MAYA 5I16A 3DXAD 5J13B 3H9SA 3VRJB 1QFWH 1DANT 1U8QA 2L3BA 2YMXL 3DMMC 2UXDB 2EDQA 1RPUA 2ZOUA 5EZJB 5I19H 1G6RA 4KUMA 5F93C 5I8CB 2YIHA 4P0DA 1SXAA 4MHHG 2WIIB 4XNUH 3VTTA 5DURB 4DUZO 5F9WC 3MRBB 5DK3A 1RUQL 2VN3A 4PGCA 5F7KC 3BE1L 2XTJC 3QIUA 1D2PA 1KXVC 2QVIA 4EI6A 4UTCA 3I6KB 1P6WA 4HIIA 5FOBB 2X4UB 4LLWB 4OZIA 4GPVA 2YS4A 3CXDH 1RUKL 4FHJA 5BPPA 3E8HA 1AD9A 5H2FZ 4J3SA 4XC1L 2X0WA 5EG6C 1W0JG 3VJ6B 4NSKA 3CCRV 4MJ5A 3U1PA 2IVFC 2HEPA 3V4PB 2VGLM 1K8IA 1YYMH 2X38A 2DQEL 4MHHI 2MQGA 5IW6B 4OLEA 1KT2B 2PO6D 1IAIM 5J3HC 3HKCA 5C8JA 1CD1A 1VADB 3IU4L 2KC0A 1EGJL 3O2VH 5HD8C 2JFCA 3L4VA 2JDIG 1AY1L 3K2UL 4X6FB 4ZQTA 3QDMD 2ZCZA 3R0NA 3DTUB 4HK0A 2ATPB 4QRQA 1PNLA 4ZUWA 5HYFA 1M4KA 3GLEA 4OUOA 2HB0A 3HB3D 3H9ZA 3V95A 2DQCL 5B3SC 4TNFA 4ZUVB 1MY5A 4JCMA 2R1YB 1MCDA 3NIDB 5GGTH 1ZLSL 2PUSA 3ASOB 2O5XL 5C07A 2Z7WA 4X98B 4JI4B 1V3LA 2DM7A 1ET8A 2NUTB 3F5WA 3H42H 4FNSA 2Q87A 4O2BB 4KDWA 1BEYL 1WD9A 4OF7A 3UYPA 1QBZA 2KPNA 5DLLA 4PJFB 1E3FA 3U48A 1PZAA 2B4CL 2WQSA 2MWCA 3DX1A 3O3AA 4DTGL 1M7IB 1DFXA 3CZFA 4FZ1A 2Z64C 1A7OH 4TV8B 1R5VB 3T4DA 3C90A 5C0AB 4FC3E 4BFRA 3QUXA 2Y06H 4ERSL 4CU8A 5GGUB 4Z1PA 5I2IB 1FORH 4NYLA 3GHBL 5DHDA 4TVUA 2JJ2G 2JK5B 1JHTB 2DLFH 5SWSA 5D7KD 2AJXH 5FW6A 2DRUA 1JPGA 1ZANL 1QRNA 4Q6GA 4N2NA 1QNMA 2OSYA 4MD0B 1ZGLP 5DJXA 2IANA 3I6SA 5HHXH 3OGOE 3V9CA 5SWZD 5CD5D 1EJOH 1QD0A 2JKLA 4GT0A 1IXBA 1EXUB 2LP7A 4U2YA 4MNQD 1XGRB 1MG2C 1YQ2A 2W07A 1PNCA 3B5TA 1PPIA 4FXKA 4AGOA 1ZLWH 4R50A 4PUBH 5CGYC 4G6KH 5K59E 1OGPA 4GKKO 4PAZA 3ISWA 3LN5A 4IRSB 3QG7H 3P69A 5DQDH 3JCUZ 2HFFB 2JVDA 2WWOA 1H5BB 3MOBL 2W65A 1EJFA 2NY5L 2UUAB 1KU9A 1UOLA 4XVOA 5DJZA 3DHUA 2W91A 5J89A 1BM7A 3KYOA 4LFHD 3D25B 1G1KA 3V7MA 1JZ4A 5B1AB 4PTTA 5HJ3A 7PAZA 2XLLA 3GSNA 4IBVA 1N8RW 2Y2WA 1I75A 3NPSC 3E86A 4E5XA 3BAWA 2V5TA 5EIIG 3N04A 2PWDA 3TPUA 1NCWL 4AJ0A 5BV7H 2QKIC 4ODSH 2ADIB 2F08A 5FXCH 5EDSA 5F88A 1WITA 2VZOA 4LOUD 2NXZD 4JYYA 3U7YH 4BFIB 1ORSA 4M6ML 4LLUA 1MREL 3NESA 4XPAL 5I30L 1IGFH 1KIUB 4PA3A 2XZCH 1EEUA 4I4TB 1PFCA 1EFQA 2EEBA 3KPNB 1KXTB 3T3ME 2FMLA 1LUVA 3G67A 3CN3A 4PJ7A 4Z3FA 3RFZC 3I85A 2YEZA 1WB7A 1NH6A 4JKNA 1KDJA 2ZIOA 3UAFA 4EMZA 3KLHC 3EYUH 4HBCH 3BWAB 4YEFA 4JN2B 4XVTL 3GMPA 3UIYA 3E2EA 1KTCA 4P5KA 1HNYA 2QGBA 3DSNA 1QBML 3PHAA 4OM0L 2QQLL 4M4RA 5FGCB 3OKDA 5EULV 5HGGS 3OC8A 2VL5B 3FOLB 3J2PA 5GJSL 2ZG2A 5TDPB 5IJ0A 3H1JH 3FQUB 3NCXA 4YL4A 3L7FB 1MI5B 5IJBC 2HTLC 1FFXB 4GAJH 2BSKA 4P9MH 1BLIA 4UQ9A 4C59B 5EPMB 3P54A 1C9SA 4JAAA 1UWFA 1UM5H 1GH6A 1CXLA 3NZHH 1FH5H 1XMWA 3NGBC 1A4KA 3DETD 4DQOH 4UOQA 1WCBA 2BP8A 2H2SD 4IS6B 2CM5A 2O5ZH 3DBXB 2GIYA 2X89D 2YMOA 1CXZB 3MCLH 4UCTA 3OD3A 5IESH 4DP0X 4I55A 1PS3A 4QTHB 3JAWB 4PJBF 2DBLL 2IGFH 1JF1B 3LQZA 4YHYC 1O9VA 2KQXA 3QHZH 3D3QA 4U7OA 1K33A 3QZWG 4JFFA 4KROD 4WFED 5F7FA 3JASA 2KZBA 1NIDA 3KPPA 3MODL 3QR0A 1YNKH 1WISA 1FQ9C 2XFGB 5K1NA 4MA3A 3E8UL 4U1GC 5E1IA 3HC3H 3BAAA 1J0IA 4QF1A 1GAXA 4P04A 5F70A 2YD0A 1SYVB 1TYJA 1O7DE 1CK0H 1WGOA 4L4TE 1MCLA 3OMAB 4GRLC 5AL8A 3OKOA 5DK2A 4PI0A 5AAPA 2YC0A 1AZCA 3ARBC 4MMXC 4EVNA 3AG1C 1SQGA 4XHQA 3CUPB 3IJSA 4GQQA 2J8UF 2Z35A 2VIRA 1ROWA 3F7RA 4WJKB 4G8GB 4E36A 2H9GB 3VFRA 4NAMA 3S36H 4M5SA 3ZTNL 1UATA 1OJHA 1XDTT 1SEQH 2V9UA 3K6SA 4AZ8B 1Y07A 3SDAB 2CHWA 1NCDL 5L3BA 4HKZB 1QUNA 1DHKA 1FFRA 4HJGA 4N9GA 4PS3A 4W9JC 4LH6A 4X5QA 4Y1SA 5DZLA 2IGLA 2H26B 4M1DL 1T83A 3GMLB 1AQ8A 5IR1A 1E4XL 1HI6A 1J1OL 3FUIA 3RGVC 3LHPH 2J2ZA 3QULA 1J11A 1FC2D 5B1JA 4HFWA 2XIDA 2H3NA 5AOIA 3ZDYB 3ZYJA 1NC4A 2JVUA 1SLWA 3MLZH 2NY7L 4AWJC 5FUCC 2RCSH 1I9JL 3PABB 4KDTA 4LARH 5DYOA 5FDYA 2EIJB 2A6DB 2BP5M 4X1YA 4JI6B 3I9AA 2F1BA 4HZ3A 4MNGA 4YFEA 5EORH 4GY4A 1IX9A 3ENEA 4RO2A 1T5EA 4FXLA 5E94B 4NKDB 3ATDA 4FQ2H 3PWNB 2ZE7A 4MVZA 4QJ5B 2FIKA 1MHPH 5CA1B 4ZMTA 4I0PB 5J56B 1T80A 1CFTB 4FD0A 2D0GA 5E9NA 2BE3A 3FTGA 3EOAB 2IH9A 5F3BA 2FL5B 1KCKA 5CLZA 5L7XH 1LK2A 2V4LA 1YTFD 3S3DB 1DBBL 1T5KA 2ZSVB 4YSTA 4YSSA 4MXQC 4JFYB 2RB8A 3WEAA 3SOBL 3RHWF 2BNQD 1MEXL 1DSWA 3N43F 1TKWB 4LCWE 5EMYA 1NU1H 2VXTH 4YFLI 4HKBB 3WIFA 4BUHA 3ZXAC 5C08E 5FO8A 3KYMB 5K1JA 1H6TA 3TZVC 2ZUSA 3TCLA 2NZ1A 4JM2D 4KX7A 2AQPA 4YXKH 4IRZL 5AOJA 2NY4B 1OV8A 3CN2A 1B2WL 4CJ0A 3RTQC 3TA3B 4J3BA 4X7DC 1QP1A 2VLJD 4KHPB 3RA7L 1KV3A 3KW8A 4B53A 3VFGL 1DO6A 2CO6A 4Q20A 4ZTOL 3EH5B 2H32H 3ML0A 4TS6A 4CVZB 4XOCA 3GT6A 3IF1A 1XBDA 4LHUG 4LAJH 5DJ8B 3THMH 2FYYA 1OD9A 2GI0A 4CKQA 4B08A 4V1DB 3FRUB 3SCMD 5JHDE 4AQ1B 1QSFB 3RVUC 1E6OL 1AO7B 5F9WB 4BV1A 3W7SA 1QSEE 4P3CH 4Y19B 4X9QA 4MASA 5C71A 1X4TA 1QLFB 4XCYB 4YDKH 1CL7H 1QR4A 2WINB 2XKNB 4ZS7H 2PXYA 2X5PA 3P9MB 5DJ0A 4RFOH 3MV9E 1NIBA 3VH8A 3MNWA 1V55B 2NW3A 5D7IF 2LE9A 3LKQB 5BV7B 5F7NC 4NQXB 3E6HA 4M7JL 1TQUA 2CO1A 3QFGA 5FYKH 2NR5A 2JIXD 3KPMA 3MRPA 1AIFB 1ZL8B 3MV8D 4PJ5B 3WKML 3V0FA 4P57A 1LP9B 3CH8A 1IO4C 4P30A 1BP3B 4JQIA 1NGXA 2BY3A 1S77D 1N0JA 1R1CA 2WYZA 4AGNA 4Y5YB 4OCXH 1A1OA 1KCSL 1BZ9A 2WAQA 4H8VA 5ACLA 4LQ1A 2H0PA 2OW7A 5F3FA 4CSPA 1IGIH 3G6DL 1TENA 4IMLA 5LGUA 3VSTA 1VKXA 1C1EH 4Y9EA 4N2KA 2OMWA 4AQEB 2A4ZA 2UXBO 1Y0LB 3L74H 4S1SH 4ZHQB 3RQ3A 4UQBA 4G82A 3BPNB 3C87A 3HLAB 4N90D 4P9HH 3JD4A 1OM3L 4M1CD 5HHPB 1OGTA 4IYKA 5AB0A 1EBPA 2ZCLH 3IEAA 3QIWA 5J2TB 3VU1A 3VXQA 2PYFA 3I2CH 3SBRA 1BQHG 3EFFA 2VDMB 5IMMA 3MRDA 2B1HH 5E1QA 1Q9OB 3HHMA 4LLYB 4UQDA 3A4DA 5KHKA 3V0IA 4F4LA 2E27H 3FSZA 1S7VA 3M1OA 4PBWD 1QLRB 1A4BA 5E00B 4HCGA 4OLVL 4GKKB 1FAIH 3WIIH 3VD9A 3ABTA 1SF5A 1TVBB 2QSCH 3KPSA 5SWQB 3H53A 3OTFA 1F5WA 1U8CB 3FO0H 5GONA 2AEQL 1IQWL 2YAOA 2M2DA 4V11A 1IBGL 3IGFA 1GGTA 3QJHA 4P2RA 3RWDA 1A7RL 1NBMG 3JCZA 3Q6GL 5D1QC 4XX1G 3FU7B 1CGYA 2XT9A 5D6DC 1YNLH 3TIEB 4F6EA 3UO1L 5AG9A 1ULVA 1HR0O 1EX0A 5E6RB 2OW6A 3HG5A 2K8MA 2OMZB 3BO8B 1VEMA 2ITCC 5D1ZD 1JOIA 3US1A 2EKSA 1K8AW 3KNBA 4OUUB 1XEDA 3WOVA 2YIDA 1DFBH 1E8YA 4JBSA 4EN3A 5CD5C 1KBGH 2Q0OC 3NQIA 4ENEC 4YHHO 4NX0A 2YN3A 5E2WH 2FQFA 3EFDH 5HHVH 3UTZA 2Z8SA 4F5CA 5SX5H 2F15A 2OK0L 4WFFA 2GJJA 3L5HA 2FJHA 1J8SA 3LQAL 5CD3B 3UZEC 2QSTA 2GFBB 5FDWA 3FB8A 4OKVA 7TAAA 3GRBA 5L0QC 4UAOC 2IC2A 4PWJA 1FGNL 1ED3B 4K8RH 4BZ2L 4I18B 4FFBB 3CJJA 1TZ8A 3JUYA 3WJJC 4YMPA 2F19L 2G5BB 4LRNL 2BM3A 3MLSH 3E8FA 4M7ZC 2P5WB 5HYSB 1CICC 2B1AH 4X0NA 1Q9LB 4GXFA 1ZEAH 4I7ZC 3HNTH 4YQXH 1KMGA 4ZOLA 3VU2A 2YD7A 3ELQA 3L71H 3EH2A 3Q6FB 3HA0A 5TQ0L 1T1WA 2ESVB 2QR0B 5IBUB 3DUUA 4GX2A 1GC1C 2CDEB 4X4KA 3VXUA 1H2GA 1H2LA 2IH1C 3LNNA 2J57A 2YPVA 3WHE1 3UTTE 1CU4L 1T4KA 4IKNA 4DO5A 3LKSA 3RX7A 5BW7C 1YXBA 2PI5A 2NXZC 2EIZB 3P3YA 3RWEA 1UT9A 3JD3A 4PJAB 4FQPA 3A23A 4PJDA 2EINB 1M57B 1S7RA 5FYLL 2VXSL 2QQKL 4KHXL 3SKOA 5I74B 4W9CC 2JELH 2JKJA 2W60B 4FXGA 4Y1TA 2FATL 5JTWA 3APQA 3JSNA 4R8CA 3ZE1B 1UH2A 4WI9A 3K2IA 4PRDA 1TJHH 3NBNA 1MCIA 2B16A 2Q6WB 5CR8A 4J1UB 3ARTA 1USZA 3IDXL 4ZZFA 3RTLA 2AF2A 3IPEA 4NBXB 3BSZA 4DRXB 5D7LD 4N5ED 1F8TH 3K80A 1C5DA 3MLTB 1OGSA 3NCJL 1KN4H 4UINH 4XP5L 3P4NB 5CLWA 1R3IL 4R97B 5CJOL 3QH3A 1XHZA 1J8HD 2MKLC 4JN1L 4TPRH 3QORA 3QO1A 4EOWL 3BLKA 4IHJA 3PRZA 4YK4C 3BKMH 2BXYA 3STLC 3D85A 1GMEA 4RLDA 4A2HA 3DJZA 2X09A 1NAML 2BSED 4R26H 5E8NA 1HE8A 5CEZL 1K4DC 3PP3K 1N2RB 1GYUA 5DJYB 4UU9B 3P3TA 1WAPA 3OHMB 4Y8DC 5EU6D 4PRHB 1WRFA 3QDJD 3VRIB 4B3EA 2G3XA 3K5MA 2H2SC 1LNQA 1JNNL 1I8AA 1W6LA 4KVCL 2IDFA 4DHLA 5AW5B 1TXKA 1R46A 3VSUA 3FL7A 4GO8A 4HJ0D 4LVOC 5E5MB 4B7LA 2HVKA 5E0FA 5HPOA 4G80B 4NLAA 3L1EA 3Q1SL 5D2LE 1M3IA 4G8AC 4Y5VB 1QMUA 4O2EB 2H6PB 1OCZC 3AG2B 4B95C 1G0XA 2PTTB 2G9KA 3QFJB 4WU5A 4OLUL 4U6HA 5M94B 2SODB 4X66O 3F65A 1K97A 3GBNL 2JNZA 3ASNC 4HIEA 1FPTH 4Q89A 2KI6A 4HS8L 4BFNA 5F9JB 2QKCA 1T0NB 4JRXE 3U79A 3L3IB 2BVOA 3A6BL 3QJOA 2CGNA 3X1GA 5IJDC 2WLLB 1CD0A 4X80L 1Q86W 4MZ3A 4Z7VB 1J5HA 1AGEB 4B3SO 4B9JA 4GRLB 3TJEL 2ZJSH 2MNWA 1T1YB 5EZLB 3TV3L 5BOJA 2AHYA 1B6UA 2DAVA 1NJ9B 3IGAB 3L3OB 4XZ4A 5KW9H 3ETBJ 2XWXA 1INEH 3QUZD 1NLBH 3QDAA 2IIJA 4LE8A 1EFXA 2I69A 3NJNA 4Z7WA 2JE8A 1BAFH 4HA1A 1NCHA 4UUJA 5AB1A 2XHBA 1FFOB 1GC1H 4C56D 1NUDA 4WY7L 1T5WB 4C55A 1UACL 1KTKE 4PRID 4I9XA 5KSBE 2DIBA 3QGVA 3S88L 3G5ZA 4S10A 4FQXA 4JZOA 1M2VB 1QVOB 1XGTB 2Y1VA 4H1LB 4GLRH 4MQSB 3QJFA 4HLEA 1A7QH 1Z5VA 2F8IA 4AG4H 1R33A 1MF2H 4TVPL 1OOAA 1AVAA 1WA1X 5DD0H 4FNLH 4YHPA 4GEJA 4PA6A 4YBLC 3L2NA 3W0WE 4E9SA 5FAAA 4BINA 1W0KG 4HWBL 5ITFA 3FD9A 3QO0A 3JQOB 4G2AA 4P59L 4LPXA 3UC0H 5T5FA 2JKNA 4L3ED 2YRLA 5IF0B 1HEZA 1A4JA 1OAKH 2DQ6A 2GJZB 4IBWA 4AT6A 3VCLB 4Z1MG 1S9YA 4X20A 1OAUL 3BP7B 4OJYA 1KULA 3AMLA 1P7QA 2VS0A 2QMKA 2AK4D 3NFNA 4K3DL 4EO5A 2J5LC 2YSSA 3BN3B 3EGXA 4TULL 2BX5A 4FFYA 2EJ7A 1Y6NR 1E40A 2PMZA 3MCKB 3S5ZA 5DFVD 4E2OA 2A0LA 5C0CA 3FQXB 4BH7A 1QNIA 3CD6V 3HE7B 5JH7A 4KPHL 3VD1A 5HVFB 4JHUA 1A6UH 3CCUV 4Y9CA 4TQFA 1MCWM 4LCUA 2C2AA 3BAXA 3BH4A 3U9PL 3P3RA 3ZTDC 3O2DA 2A74A 3GKZA 2YD6A 3B6SA 3TXAA 4XC3L 4ZUTB 3B8MA 4KBPA 4MTFA 3GO1H 2HJFA 2AV1A 3KPRA 1KZYA 2P46B 3TBTB 4GMSH 2VDML 1A2YA 4B97A 1BFTA 1J9SA 3L3DA 1BJ8A 4FA6A 4EDXA 5DTFB 1BQRA 3F83A 2JSFA 3FB7B 2FO1A 1NDGB 3CJHB 1R3LA 2V5SA 3PJSA 2GTZB 3BEVB 3HC0B 3TONA 3UTQB 4PV9B 4FJYA 1ZWIA 3EJQA 3K8LA 3MMEA 3SCMC 3PHQA 2BSSA 5H4ZA 3HE6A 1E4WL 3MA9L 2IALB 2UXFA 1ZA3B 5G55A 1FVEA 5AVSB 3MCLL 1OCCB 1P5UB 2OMYB 2ZAGA 5BOZG 2VDKB 5BUAA 1AANA 1ROPA 3SY0A 2Y5QA 4E9LA 3DSFH 3S34H 1NBZB 2UXBB 3ESOA 2V4DA 3QNYB 2V9RA 5DHMC 2Q10A 4ODWB 4KTEH 3SPVB 3CHQA 4D3CL 3U2SA 4KTYA 1JJ2U 3FT1A 1KKCA 1MHEA 2YUXA 1R19A 1U8NA 3NEXA 2IBZH 3HN3A 3MNVB 5BZWA 1BLNA 5H5NA 4MA7L 3RWCB 1MZFA 2P47B 1G7MB 1WNSA 1WZLA 1ZHBB 1YEIL 1THZA 3KL3A 1ZTMA 2CBPA 3OJDB 4OD3L 4GINA 5EK0A 1D5IH 1N6UA 2CLZB 2WMPB 2XVKA 3AB0B 4WHYH 4CMMA 4S0TD 4FG4A 1KLUB 2HKHH 2ZX8A 3OAZH 2O5YH 3VI4B 4UCFA 5FO7B 2QTEA 3AGWA 3CFDB 1AJ7L 2GC4C 4NRXB 4NZRH 4ZMNA 2ZE5A 2VC2H 1KXHA 1J0HA 1CE1L 4FQ1H 3ZR6A 2Q69A 1O9HA 2EZOA 1HR0B 2XPZA 5T1LB 5CB4A 4M1CC 1VQKV 2ZUQB 3ROLB 1GPOL 3SN6N 3AS0A 1IAIH 2V8LA 3B2VL 3TTYA 2XVBA 2I9TA 5IVZA 5E6ZA 2HVJA 2ZXWC 4R7LA 4YHHB 2ZDIA 2D3OW 1HCVA 4Z23A 2WLYA 4KKQA 4XMKL 5CGBA 1OIOA 4WGVB 5EHFA 5JOPD 4EZJA 1U8LA 2UUDK 5CF3A 5LMNO 4A5UB 1Z5YD 3HR5B 4ONFH 3TH2T 3C3TA 1RPQA 4N2CA 5FHBH 5GZOD 5AQ0A 1MLCB 2C1PB 4FHKA 3DOHA 3VI3E 1G4YB 5M95B 1PLCA 1A6WH 2Y2YA 1TTGA 2P4VA 3Q2NA 5EOCH 3ZYOA 1WK0A 5HFMA 2IBGA 1NPJA 1KGWA 1AQMA 2Z5UA 1EV2E 1Q6UA 2FGZA 3O6FD 1DJHA 1QATA 1QR8A 5D1QB 1C12B 5GRVK 5JR1L 5KVEE 3EO9L 3NUKA 4NKGB 5D1ZC 1RZIB 2VW7A 4TNVF 5FYLD 2ITCB 3V6BR 3Q5TA 4UCRA 5E79Z 1JOYA 2W5PA 3F7VC 1UFGA 2VABA 2YKLL 2V3FA 5F1OB 3HAEG 3WTVA 4JK0D 5JORB 4GKLA 1RZ8B 4HX1B 2FRGP 5LCVL 2X6VA 4UILL 3QPKA 4GYBA 2GJ6D 2V7QG 3K71B 5L3FA 5JDSA 2BH0A 5DVPA 4WTWA 4CSSA 4ZRGA 2A6IB 4RGMB 1YEKL 3MUZ1 4I48A 2ADGA 5JW4N 3SGKA 1A6AA 4C57C 5CBGA 4GLXA 3L7EB 4NQCB 4NUQA 1W72H 2CTPA 2P8PB 5EBLC 4QCIB 4WI8A 2J8OA 5AWNL 2PP8A 5EUOA 3LUTB 2SEBA 2P4AB 2XN9E 3JSSA 1M56C 3T0BA 2R9RB 3GRWL 5B3JF 1NVPB 2DTMH 2B39A 1U4FA 3CFJB 2CLRA 1CICB 4JFDE 1A14H 3QJRB 4S1DC 4JB9H 5CEZD 3HFMH 3BUTA 3HRZC 2ZCEA 2UWEB 1L0QA 4Q9BA 5E1AA 5GJTH 3HI5L 1AQDB 3WN5C 2XG5A 1JWUB 1JD9A 2IH1B 2ALWA 4ELMA 3RX8A 4X89A 1U8OA 1D7CA 2VZ3A 1XT5A 2AKRA 4QRRD 4GG6F 5IY5B 2F0CA 4KVPA 5KLVH 3PPEA 1BCIA 1TZAA 1Z9PA 5ICYB 1S9WA 3BD5A 2H1XA 1JF5A 4P4KA 3CDYA 4ATTA 3ZHRA 3GIZL 4KKLD 4YGAB 3PV7A 4NUJB 1ZHLA 1IURA 2ALAA 5DJDA 5BOPA 3GWKC 1FLTX 5CBEA 5I1LB 2C3VA 2I5YL 4QHMA 4N5EC 3ABZA 2HH0H 1FZJB 3TVMA 3MLYH 5C09A 3CK0L 2ZOWA 1L5GB 1X5KA 4N8VG 2NXYB 3DRQB 2IPTH 4JY6A 3RW0A 3AROA 2C3GA 1CIDA 2VB5A 1PY0A 2UX6A 4N6QA 4Z7QF 1E5ZA 4HYTB 3IDIB 4HKJA 4QOKA 4XP6H 3LSOB 4CU6A 3SE8H 1XI1A 3TS8A 3UTPD 3FAWA 1I7RB 5DMIH 5A6MA 4NXKA 1VACB 5I1JL 2LW3A 1K4DB 3GMQB 4LASL 3ZX1A 4XO8A 2WYTA 1A5FH 1WIOA 2E8YA 3D18B 3GZOA 2XG4A 2LFGA 3I9GL 4QHUB 2WXOA 3CFMA 3SE3A 2PCFA 3VXOA 1EHLL 4B3SB 5GGTA 4G83A 4WKZA 4Z7UA 1KTLA 4U6VH 5DEZA 2WGXA 4IDLA 1U0QA 4LVOB 4QPEA 3TBBA 2DJ4A 4JFSA 4DK1A 2UZXA 2J88H 4DR7O 1HQRA 4FIPC 1DUYB 3HG1D 1XGYL 3E22A 4MVRA 5I5MA 1VIWA 4TVPD 5AZEL 3ZR5A 1UXSA 3KG2A 4ICXA 2WHVA 3QEHB 3V0VA 3OUSA 2W9EL 1GN6A 4OLWL 3BH8A 5H94B 3ZRVA 3RIKA 1QSZA 5KOMC 1ILUA 2ILMA 2CNZA 3GJEA 4HUUB 4KQ4L 4APQD 3GB7C 5JQ6L 2HFEC 1NC2B 2PW2B 2VRKA 3NZSA 3C60A 1X5JA 1WF5A 4KKRA 2BHZA 3HKZA 4PYHA 5HPMA 3C6LD 1TJXA 2J56A 3BFWA 3KHQA 3UGUA 1LK3L 4P46B 2ZWNA 2D3LA 4NQDD 4H0LC 4PVMA 5CWSA 5KOVC 5AAWC 3RJOA 3APMA 1CFVH 1AFVH 5D2NC 1GZHA 2F54B 3T3MB 4PRAB 5DZ9A 3VQ1C 1VQ4V 3QUZC 4BRVA 3IXTA 1N5AB 4H44B 1KBVA 2O1AA 3EG9A 4BZ1A 4HEPG 1DVFA 2H3KA 3T2OA 4PJBE 2ZKYA 5HHQB 1OSZA 3BVWA 3I3DA 3QIBA 5DJ2B 3S5YA 5CR1A 2LQTA 1E6JL 1NBYB 4P5TD 1H3TA 1Q1JH 3B56A 4LAQH 4UOZA 5EFIA 2AEIT 2WXKA 2WO3B 4DUVA 5FW7A 1RI8A 5CHNB 3DMMA 1F2XK 5K9OA 1H6EA 1BD2A 2AJSL 3RY6A 2Z91B 1OAZL 4MJID 5LG6A 1BBDH 1SDYA 2CCVA 5I1CH 4ZSOB 1JPXA 3H3PL 6FABH 3HUJE 2OMTA 4GXUN 1I1AD 2AERT 4N0YH 1ORQB 3QQ4A 1KXVA 4JG1H 4DV4O 3TGXA 2FT8A 3TC9A 4JE0A 4K15A 4KHTL 2WUBL 5CJQH 2VC2B 4DAGH 3MACH 4LSPL 1CQYA 4E41E 3ZN6A 2O6DA 2VDKL 4XVSH 3ZZ1A 3ZY7A 4Q0XL 5IKCA 1C7SA 2UYLB 2EIKB 3CCVV 1MWOA 2W88A 2Y1YA 4JUTA 1LE9A 4FLVA 1HESA 3ZRSA 2OTPA 2DWEB 3CX5J 1UA6H 5EC1C 3VTAA 2EUZA 2K9FB 1O0VA 4UCVA 4DGIL 2YLKA 1VHPA 3ESUF 1V10A 4HBNA 4NUGH 3QEQB 5AKVA 3MKGA 2AV7A 5GSRA 1ZT1A 4WI4A 1JZ6A 1DVSA 2LAGB 2MCG1 1W8EA 2J5LB 1MJJB 1OLLA 4MDIA 4WI3A 5DFVC 2FO4A 4WUUE 5LP6B 5KMGB 3GNMH 4YDNA 2QPSA 5ALCH 2E5LO 1YRKA 4PIBA 4CVWA 4PJHF 3GJFH 4L4TB 4Q9RL 1R5IB 3O4OB 1WH0A 1E5CA 2ZQMA 5T3ZD 4PVNA 2OJEB 3HIZA 4MWFA 1P84F 5GS1B 4XMPL 1VEWA 1INDL 2ZG1A 4JPWH 4CVXA 1FG2A 4F2FA 4XE0A 2BCCH 4P2QE 3SJQC 5HI3D 2UVFA 2B3RA 2BC4A 1EDYA 2JWYA 1SESA 5FLUA 5H37G 1IGJB 2OR7A 1CDIA 1V3JA 4YSUA 1A9BB 2FX8L 3JUZA 3S37H 4FADA 5GQBA 4RESB 3GUTA 3NAAL 4LDOB 3U46A 3FQRB 1U96A 4RX4A 2Q8AL 3SHSA 3QUYB 2KG7B 3MRGA 4KDVA 3TN0B 4MVOA 2YBGA 3CCQV 5EN2A 3V6ZA 3VNZA 2Q2LA 4UTAL 3UG5A 4O2FA 1W72B 1QNZL 1I8IA 4EBQH 4JTCB 4LB8A 3W5NA 3KYAA 5KBMA 1PTZA 4MCZA 4OIAA 4QXGL 3N2KA 3C8KA 2F68X 2KBGA 2DS4A 5HJDA 3EYOB 3LPFA 4HJJL 4CVUA 1JV5A 2NYKA 2Y7OA 1BZOA 3D52A 3P9WB 3GIVB 5D6CB 2Y23A 3EADA 4J3OF 1I3VA 4PG2C 4WTQA 4KP4A 3W56A 2NQCA 3PXJA 2Q4PA 4M02A 3ZBMA 2PUQT 2FNWA 3QTCA 1PG7L 2CH7A 5A2CA 3OKKB 1BZKA 1KY7A 5I8OH 4YDVA 4DGVL 2VOTA 2DMCA 1BGYH 4I9WD 4WTXA 3ZVVA 5K9QG 3PJNA 3VXRA 4X7SH 1TYRA 2UY6B 4ZFQA 1LHZA 5JJEB 5LMNB 2JJVA 3BEWB 2P48B 2VLRE 3FUKA 1U8HB 1Q72H 1TLKA 2EYTB 5IYBO 3PNWB 3R1GL 2OL3A 4I87A 3LSSA 4PRBA 5F9OL 5ES4B 4OZIF 3IGUA 2UUCB 4N6RB 3LQAC 1IM9A 4TLKA 5KW9L 2YPLA 4P5MB 5IYZB 4PA9A 5KHIA 3H6AA 4LCWB 5ADOL 1HZHH 1FNLA 5DRXB 3UZVB 5IMLA 5K9QI 4DV6O 2MRYA 1F6AA 1GOFA 2XZQH 4MAUL 4O9HH 1R75A 2QKIA 5C08B 4LOVA 3SE6A 43C9B 3BAEH 1E4JA 2LV4A 1VQLV 5D7IE 2IU3A 3UG3A 3H0TB 2YGQA 2ZXWB 2IH3C 3S3JA 2O30A 2V7NB 2VLKB 2DM4A 4DW1A 2IQ9L 4KNTA 4OJFL 1DZ0A 4L1BA 3BUDA 2DD8H 4FLRA 5GZOC 4O4HA 2YGVA 2X3BA 3RG1C 3V5KB 5JNYB 3GSVA 1NR7A 2Y69B 1HIMH 2BNRA 2VMJA 1LE5B 4GMTL 4U1JA 4OT1L 4ZMAT 3RFZA 2JB5L 1J9QA 3O6FC 3ZRXA 4GG8B 3LS5H 5JLZB 2WGNB 2OXHA 3MRHA 1SQQH 2HKFL 1I8LC 4E0RA 3P73A 3NRFA 1BQKA 1BVKA 2C26A 3GSXA 4MD5A 2YAPA 4JR9H 4LLMA 4Y2DB 3BZFB 1RSOB 1J1XH 2WLMA 2NDFA 2G4GA 3PAUA 4P06A 1CTNA 4O5LH 2DQIH 4L8SC 3ABMB 3U2IA 3C5JA 1IZJA 3O3DA 2LVEA 5JW5B 1OPGH 4XXWA 1B0IA 3KDMB 1ROCA 3G5WA 2YPKA 1CXHA 4XH2B 2DMKA 2GJRA 2V2TB 1R3IC 3DV6A 4TL5A 3FB5A 4HH8A 2XFXB 1S6NA 2VQ1A 5DJAA 1I3RA 3H2PA 2R1XB 2I7SA 3OB0H 4K0KB 5B39A 2QLVB 4PJCB 1G9ML 1TTUA 3S3BB 5JA8B 4F6RB 3BAIA 4FABL 3HZKA 4UNVA 4QRPD 4G3YL 1MCSA 4HETA 3JARA 3N50A 3VFWA 4JDVA 2CZNA 3RAJL 4LSTL 2IDTA 4TQIA 1DE4A 2R4SL 3SGDI 2UY7A 2CMRL 3CSBA 4EZLA 2H8PC 2QGDA 3ZTCC 1JNLL 3I75A 1N0LB 4O02B 5HHNB 2EDKA 2F7IA 2B15A 1R6TA 3CMEV 1MFUA 4LF6O 3H4HA 1I1YA 3GVMA 2X4RA 4MA8H 1C8QA 4S0SD 3S36X 4Z0XA 4JRYD 2X4PB 2ZOKB 3ARBA 3NJJA 4MMXA 5KSAD 2LGQA 4JUSA 1V7NH 2EYRA 2WJ5A 1OP3K 1BJMA 1PNDA 1S9VB 1FO0H 4QWWD 2H0FA 3KGUA 4XBFA 1WYJA 1WAEA 5EOTB 3HZMB 1OLZA 5F7EL 3IE4A 2WD0A 1TUPA 1F4XH 3ZHQA 3JWNG 5BJTB 4IJTA 4DR7B 1Q8IA 1XHXA 4MKMA 1JDDA 2WCGA 2WVVB 3QRGL 1EUUA 4WIQA 2GAZB 3OKNA 3EYQC 3X11A 2WUCL 4OV5A 1A0QL 1UVQB 5JPNC 2Y07H 4GKSA 3L9RB 5E8OA 1V8HA 2HLAB 3D9AL 5A2AA 1UYWH 3SJBC 3RGVA 4OZFA 3BPOB 3O3EA 3OHXC 3C09B 4Z78B 5I1EL 4MX7A 5KA5A 3O6LL 4Z7AA 3G9VA 4OGYH 1JBJA 2JKTM 3P9LB 3PWJB 4RAVA 2ZCHL 3K5SA 3OL2A 3ESVF 3L3HA 3II1A 3T04D 2F66C 4NM8L 4ZO9A 3KDPB 2Z4QB 1CGVA 3SGEI 1SQVH 5H4YA 2R69A 1BQ0A 1KELH 3BSGA 4WFAV 1JNJA 3FUDA 1ANUA 1OGAE 1YPZE 4ABWA 3QDGE 4QPKA 1MUJB 2R9HD 1E1QG 3HKEB 2GTWB 3C5ZD 2ADQB 2DWTA 2F43G 3GZKA 3VX1A 1JDAA 2FUTA 3A67L 3UTTB 5I8KH 4APQC 2CE6A 2GHZA 2DQUL 4JFQB 4OCRL 4DR3B 2FBJH 3T0ED 3DXRA 1CFMA 1NEUA 4JCWA 2N0MA 3C6LC 3QJSB 3RWFA 2PP9A 2CUGA 1IL1B 2RH0A 4PJIE 2YGPA 1EFRG 1Y67A 4DV4B 3R4RA 5DFWH 4OJCA 3TZVA 4NWUH 5MERB 4X6EB 5IFAL 2NR6D 1SJMA 3AC0A 3WDJA 3FRPA 1P2CA 4KUCF 2NYYD 3RTQA 3CCMV 3ARDD 4R9HA 4GKJO 1XF3A 2GB2A 2XQYK 3FT4B 3NK3A 4DP8X 4P5TC 1I4FA 3P0YL 1QWHA 3RU8H 2YXWA 4RVBA 4L9LC 4XMUA 3DXAA 1GW0A 4OCWH 1MDTA 4F8NA 1T3FB 3IFOB 5E4AA 3BESR 4M93C 1JPTL 3DGEA 3W2DL 4HUVA 5T1LD 2WWKO 1QEWA 3RKPA 1SLUA 1YEHH 35C8L 1UUNA 1HZKA 4NT6A 3WNJA 2LT9A 2I85A 1RSYA 2FJGB 4J8QA 1IT9L 2BCMA 5CA0B 5I5JA 4A6YA 2CHZA 3U4AA 4LGRB 3L3GB 2E5LB 4WV1A 3VQMA 4IKIA 4OF3A 1R3KC 2D3NA 3FOMB 5CZXD 4OTXL 2ITDB 1UD4A 2OCCC 2QDVA 2UUBO 1VFAA 1ZDSA 2VO8A 4GI8A 1MIEL 4I50A 3HFML 5AD0B 4UIMB 1MVUA 2CXGA 2DM2A 3CQFA 1ZOXA 5KVEH 1JXDA 2ITFA 2OCFD 5D2LB 3DC6A 2Y36L 3F58H 5FFGA 3R4DA 1G9NH 1IFGA 2Z92B 4YUEH 2JJUA 2QVTA 2YMTA 3VMOA 4PGBA 2N4IA 4M29A 3WIHL 3WLBA 4DO2A 2HPTA 4YPGA 3L2LA 3QDMA 4GJTB 3T2NL 4O4YH 1A64A 4NM4L 3F7YA 3FQTB 4XOBA 2A6KA 2JCCA 4KITB 4DZBB 2CO4A 1X7QA 2DOSA 4OFQA 1IDSA 4OJEH 1ZA6B 1EHKB 4PS4H 1T03H 4MTMA 2A9HA 3D36C 4MTOA 4DUYB 1GCYA 4JI0O 4WWKD 2NRDA 5KJRH 1X5GA 1KYOJ 5JIQA 4FNTA 1WT5C 5HI3C 3WUWA 4HUWB 4BSJA 5E8EB 1M05A 3S6CA 3V0WL 1JFQL 3CFEB 3QPXH 5EO9A 5AVRB 2ODMA 4X1KB 3CXFA 5CJXC 1AIZA 2LFEA 1M53A 3KXFE 3FCUB 1CQKA 3IFPB 2NCMA 4F7KA 3RNQB 2P6JA 4R7CA 4NGHH 1N8ZA 2FJSA 2FHBA 3K6NA 1VERA 2A77L 1TUEB 4MD4B 4Z77B 1ZGLM 3NSCA 3NSJA 3EH4B 3GSQA 4F15C 2D7TL 3QYCA 4NNYB 2HLEB 4F33B 1ZUQA 2NSMA 5E1GA 1YJ9V 4ZUUA 5K1VA 5IJVA 4PJXE 1BF8A 2FNBA 4RISH 3DX3A 3EJJX 5D6DA 1OK8A 5EZIL 4OSUH 2GSGB 4BDVA 4UDUA 4EZKA 2IQAB 3KWXA 5DD5H 2FYVA 5G2NA 5SWZA 5IHZA 3EXJA 4FDWA 4XI5C 4EB6B 3WNOA 4MNQA 2DQFB 3W0WB 4BSWA 3I56V 3KVDD 1JZGA 3OBAA 2R0LH 4DV6B 2F7OA 3F6JA 2EIMB 1GGIL 3O11A 5JHLL 3SQOH 2CR6A 1NBVL 1U2HA 4ZYKA 4XN1A 4YAQB 5L8KB 3NA9H 3BZEA 4QUOA 1JN6A 1SERA 3EO0A 2IAAC 2C3HA 2R72A 4V2BA 5GHWH 3K7UA 4FKHA 4DCQA 1FC1A 3WJJA 5LOVA 4FLYA 4JTDB 3UX9B 1KLFB 4WFBV 4FI6A 2NXYD 2EH8L 3TASA 2R4RL 4GXVL 4X5XA 1XF5B 2L7EA 3L4ZA 4G5ZL 3ETTA 3UBHA 3P3NA 1XR9B 3EJCA 5DHXB 1MCQA 4F20A 1FO0B 4PA7A 2FLBT 3X1EA 2VO5A 3T1FB 1UWGH 2JIZG 2YXFA 1BG1A 1HAWA 3OR6C 4CBPA 1DLHA 4YE4H 3KBFA 4ABQA 4U1KB 4F1SA 3L5XL 3Q4HB 2ODIA 4O4JB 2CDFB 3J80N 4IEFB 4HIXH 1ZVYA 4CC0A 1TG8A 5BW7A 1O9WA 3N42F 1HFUA 5JVDA 3MJ9H 5HHOD 4A67A 4Q2ZA 3RL1A 3RLSA 1B04A 3JYCA 2WW8A 3WXVH 3RN4A 4WEBL 4FQCH 4WKXA 3ZE2F 1KENH 1OP5H 2BMKA 1JWSA 4O02L 4HCFA 3H1HH 1H2SB 1H8HG 2VDRL 4FP8H 1PQZB 5CP3A 1FVDA 4ZMVA 2DWXA 3RB7A 2EO1A 1U3HB 2WKGA 2JJSC 5T8IA 2B2XH 4ZBMA 1UCBL 4MTXA 1TQSA 1F1DA 3EOTH 4NQED 1H15A 4PRNB 1EZVH 5HDWA 1X3DA 2RJZA 5B1OA 4WW2F 3GTVA 5T33H 1HHKA 2WBWB 5FYJU 1NIAA 3POHA 2O93L 3N2GA 4HUNB 4TOYH 5T3ZH 3Q5YA 1CEZA 4IK7A 4U6TA 5DRNB 2ZX6A 4GH7B 4B41A 5KHGA 2FAUA 3BFQG 4J12A 4EEEA 1ZIAA 3L4YA 4NJAL 2W0FC 2VWEE 4OV6F 5CCKH 4KRMB 3WTTA 3VFTB 4F57L 1GHFL 3STLA 3BD4A 3BQVA 1MFBH 5MHSE 3H7LA 4UTBL 3BGFC 3BPZA 5LGYA 1JK8A 2D2OA 1Q9WB 5CJBA 3FONB 3L3JB 3H4FA 4LT7A 2XBDA 1X5MA 3ABUA 1Z9SA 1TZOA 5E6UB 3VWJB 4DFIA 1WZKA 1PYWB 1BFOB 4LF6B 2X89A 2A83A 1KGIA 2XDHA 4QXUL 5EOCJ 5EZYA 3MNZB 2BDNL 3K4AA 4FI7A 5I6OA 4PQXA 1FCGA 4OFYD 1UWEH 3VE0A 3VWKD 2G30A 1UB5B 4C83A 1ZXQA 1K72A 5J6GA 3CSGA 1U8JB 3S3SA 4WFEA 4MMZC 1KIPA 1JYVA 3O4LD 4UIKL 4FQHB 1W15A 2HX7A 4DPRA 1JQ0A 4IU3A 5H35B 3EYVB 3FRPG 4NQTA 2VE6A 4L1LA 4QKTA 4UV7L 5I8EB 2GK0B 3H56A 2QM8A 5IV2A 3H6JA 1W59A 1EEYB 4LNVA 4J3WA 2BVTA 1PGRB 5F9DC 2HG5B 1NFDA 2QTSA 2AGJH 4K5OA 2W9LA 1A6TA 1UKSA 3U1SH 5C8YA 3QG6A 2XKSA 5CP7A 5GRUL 1UZ6F 3LKRA 3S5LB 1IV8A 5GGSA 3FTSA 4UI2A 5KSVA 5KSAC 4HT1H 3SE9H 5DK2B 4AMKH 3VI3B 2XV2A 2ZNWA 2NY1B 3V5HB 5GGQL 3ZKXB 5JDJA 4ANUA 5I76B 4HH9A 4Q6IB 5DDHA 3VG9B 3RP1A 2CQVA 3MUY1 5LGNA 2TRYA 3LV3A 4N0UB 3RVWD 4AM0B 4OQTH 4ZNEE 1F4NA 1HQ4A 2B59A 2NNAB 5F1IB 3AU1A 4G42B 5AW2B 4RWYL 1I1CA 2KUTA 1MCFA 1JYNA 5IFHH 4H4NA 1YY8A 4MW8A 1T1ZB 3DX9A 2FT6A 4PJDF 5IIEB 5CCJA 5IB5B 2DIAA 3S96B 1ZLWK 5I8OL 3ZMTA 1BQLL 2OMXB 2DYSC 2BVPB 2Z1KA 3NCMA 4PJGA 2C7FA 4PWKA 5CN0A 4FLSA 5CN2A 5HYIA 3CC4V 1XNQO 4TNWF 3UROR 1M9WA 2BSTA 1ODAA 2QHRH 4DFHA 3LZQA 4AENA 3GLZA 3GUFA 4L05A 5ADPH 1WAAF 1NUFA 1NGWB 4GG6E 4KZDL 4YOKA 1FNSL 1DQJA 1M1SA 4W1TA 1OT4A 3O41A 3V6FB 4KZCA 1G1OA 4GAYB 2KSDA 5C0BD 1M7UA 4DV7O 4A7TA 4P49A 3CC7V 4QGTA 4PV1C 2XN9B 4GBXB 3F6IA 1U8KB 4JO4L 1KIQB 4YEEA 3ME0A 4O2AA 3AVEA 4XPHL 3Q8FA 5HSFA 3DGCR 4JFDB 4R6UA 3GMNB 3WHXA 4BFBD 2AQ1A 3IB4A 4GKJB 2R9HC 5DD3L 2OPCA 3C5ZC 3VM7A 4K23H 3EJYD 1MG3C 4GUNA 2OQJB 2Z7YA 1QR1B 1LO4H 5GSVA 4U1MB 3VD3A 1GY1A 2IJIA 3BKYL 1P5VA 4TL4A 4DP7X 3RNKA 2NYZA 3OW2U 1AGDA 1N5YL 1CDBA 2Q7GA 2QVKA 2BNQA 2OX5B 4PGZA 4WI2A 2EH7H 4GNKB 4KI5F 4MSWB 4WHTB 1A8ZA 4Y0GA 4I0XA 4M7KL 1XREA 5JWPA 1ZHKB 2IG2L 4XN8A 1TVHA 1X5XA 2NR6C 3SDDD 4JHAH 4Q52A 2ZUWA 3IWVA 5AW7B 2E76B 2VDPH 2UUBB 2C1OA 4QRSA 2VLJA 5TJWK 1PF3A 3C6SB 3CV5A 1WBXA 3S97C 1FFPB 1FHGA 3AWGA 3BA8A 3D09A 3KZIZ 3LDEA 4IW4C 5CSZA 1ZAGA 4U2ZA 3OFNG 4J9ZB 2WTRA 4WHDA 3SKNB 3QNXA 4L9LB 5J1SC 3DX7A 4JDEB 5A2JH 3AUVA 3TNMB 43CAB 1Q82W 2FH8A 2XJLA 3SCMA 4GT1A 2DI7A 4AQAB 3RWJA 3BD3A 3ZSTA 1N12A 2Y0IA 2CLVA 3ARED 1GIGH 3H9VA 1GZQA 3CSPA 4O2CA 5FYJH 4BE5A 3NCYS 1IFHL 4XP9L 1NAKH 4FEMA 2IBZX 3F7LA 4LCCB 5HBBA 3D3VD 4GS7C 5CZXC 1JGDB 5J12C 2BP0B 4N2HA 5IVXA 2WZ0A 1R3KB 1MDAA 4AEHH 1EHNA 2G0LA 3R66A 1EMTL 1HP8A 2OCCB 3HCVA 3ZQWA 4JI0B 1MHCB 3U0ZA 1WG3A 1XIWB 1OKEA 3LKPA 4NO0B 4B9KC 5L3EA 3PP4L 2JIXA 3MV8A 1S3KH 3M99B 3KPQB 2DJVA 1MXGA 2D8KA 3X1BA 3ZTJG 2EUVA 3MXWL 1PD1A 1QOKA 3KS0H 3T4YA 2GY5A 4K3EH 2WPDG 4HHAA 2LR4A 4LNRB 4JZGA 4UVBA 3FN0H 2OZ4L 4L3AA 4MZ2A 5G4MA 4IBQA 1JTTA 1AHWC 1P7KA 1WZ1H 4H26B 3T4ZA 1B0RA 1HXMB 3IDMA 5J1AB 4BH8A 4LL1A 1XH0A 1ECYA 3T8VA 1QSED 3U0TB 1T6WA 5T3XE 5ANMA 4YY3O 2VRAA 5EA0H 1JK9B 2OTJV 3RIFF 4NP4L 2GABA 4G9FE 1A1NA 1Z1WA 4Q9CA 5KG9A 1KFAL 3MV9D 4L37B 5SX4H 2WP3T 2XAJA 1A9EB 1K4CC 4YWGL 3GMOB 1RJZB 4JE4B 2Q73A 1FNGB 1D5XB 3B2XA 3CDZA 2Z31D 2HRGA 4N2OA 4WWKC 5FUZH 1S7UA 3ZN0A 4LKCB 1CE6B 1UXWB 4L8BA 5F0JB 2CA3A 5F7MC 5MEOA 3Q3GB 3NCCB 1GTOA 1S0VA 1DEDA 1QTSA 3AU0A 4LIQH 4PJBB 4JYCA 5EBWC 1F90H 2X7RB 4W70A 2NSQA 5F0PB 4MDRA 4HG4J 3PWLB 1IVSA 3JALA 3HPLA 3UT5A 3HC4H 4L1TA 1OE3A 4DV0O 4XMLH 4WSKA 3BMWA 3GXPA 4ONGL 3HS8A 1M1XA 4F2ME 2VTFA 3FK3A 1U95B 1B0GA 3C2SA 4JLRB 1LXMA 1SRDA 3F12A 1QLEC 4J23A 3OZ9L 4PR5B 2YBRB 1N32O 3WFBH 1BF5A 1PZ2A 1ZJBA 2WXMA 1HH6A 5BRQA 5LAXB 2EADA 3QK0A 5D1ZA 3FT2B 2IJ0C 1NMBH 2VDOL 4G6FD 2MFNA 4XPGL 3RWIB 1F58L 3Q01A 5T1KB 4LF9O 3ECQA 5ENWB 3F7VA 4E41B 3TTSA 1QI5A 5I82A 3GLAA 3CHXA 4U6XA 1HHGB 5GRJH 2R2EB 5J0BA 5K9JH 4PP2A 2J8UB 5MEPA 4Z3TA 1P7BA 2DJMA 5T1MA 3THML 1DQDH 2EDRA 4DYLA 4XVUC 4J6RL 4PY8J 4P23C 3B5GA 1H3UA 4DV3O 2YD9A 2K9UA 3E2HB 4UFZA 1U33A 4P2OB 5EBLA 1K9TA 5E9AA 3ARXA 4XNYH 4UXNA 2YD2A 2LAAA 2ZXGA 5TH2A 1GN4A 1MFEL 1QO3B 1JGLL 1JGEB 1CGTA 4WUUB 4LF3B 2YK1L 1EAPB 1MZZA 3EKCA 3WG7C 1DJYA 1GN3A 4L5FL 4JM4L 4JFXB 3ORJA 4LEEA 1QCEA 2FYUH 2FD6L 3HRZA 5ISZE 4NKIH 4QY8A 5CSBA 5D7SH 3FN3A 3TO2A 4MVUA 3BCDA 2DKMA 1IVLA 1PZSA 5CO1A 4BA0A 1BZ8A 2HLDG 8FABB 1CXEA 1DUZB 4AGMA 1AGBA 1YZZA 2CDYA 4GW1B 5CZVL 1AQHA 1UTDA 4BFOA 4P2QB 3TT3H 5LBGA 5AFAA 2OMVA 4XB7A 3OF6D 1G9MC 4U3CA 2XI9A 1S9KC 4KKBD 1IEBB 2Q2EB 2IMMA 1E30A 1W9XA 3NP4A 1MCPL 1ZTXH 4KI1A 4NRZB 4FX5A 3VFMB 2CKBH 3DIFA 3LEXB 4U1LA 4CGTA 4ETYA 4X1IA 4GCZA 5AW0B 3J27A 1S5JA 4PYGA 2WA4A 1WP6A 3D7PA 4NRYB 4C7UA 2EC8A 5DRWB 3WUZA 3EYFB 3Q9PA 1RK7A 1XSKA 4JMNA 5D7LA 5IHHA 1H3PH 3UBXB 3ESPA 2X4NA 2MCPH 4L8DA 3PGDA 3S4SA 1E7UA 3UTTD 1BJ1J 2ZCKL 4UT9L 3GSRB 3N43B 1EPFA 2AQNA 4FNQA 4DZ8A 5EEZA 3IAGC 1J8HA 1SY6L 2NLJA 1A1MB 3IJHA 2K6WA 2JS3A 2K4WA 3F7KA 3JWDC 2W0FB 3DVGA 2MSPA 32C2B 1MSPA 3ZMSA 3FQNA 4XNXL 6TAAA 1LWJA 1Z3GL 2P7TC 1RM1C 5EU6A 3II2A 2OWOA 3GJFA 1ZLUH 4GP8B 4JFOB 1FL3B 2PR4H 5HVGB 5IB3A 2WQWA 5JPMC 1V05A 4OIBA 3CFKB 4WU7B 4U6YA 5DSCA 1IRAY 1CCZA 3P4LA 4NPYB 4HGKC 1GZPA 5DUMH 1QLEH 3ZT7A 3SPCA 1FIGL 1ZVSB 2VLRB 4GQPH 3VMNA 4IIJA 4K55A 4D9RD 1IMHC 5JOFB 1J8KA 3OB8A 5F6IB 1S5HC 1YECH 4OZHA 3VWKC 4XP1L 3L45A 5C07E 2GSIA 3VGEA 1M6OB 3ZT6A 5JJNB 4MLIA 2V2WA 6PAZA 4AYFB 4ZDHA 1B3QA 4A7VA 4TM9A 1BZEA 1OCWL 1XH1A 3G04B 1XCQA 4DV2O 4XPBH 4PD4J 5DWPA 4CUCA 3D39B 5D7IB 3GB7A 4HOMA 2HFEA 2XV3A 1HK6A 2X9YA 4NO3B 1PLGL 5FKPB 5E2JA 5EUOF 4ZI8A 5AYUL 1XNQB 3U9UB 4WFHD 1TUBA 5SWSE 1H8LA 2J1KA 3QXDA 2KYIA 5AAWA 3VXTB 5KS9A 4Y4FD 4LR3A 5AW8B 3V4UH 3GRGA 5D2NA 5H8DA 4GFTB 4ODTL 3LNIA 4LSUL 2E74B 2IANE 2LU3A 3EGSA 3OTTA 3QUZA 4GQZA 4N8CL 1EO8L 3VFVB 1MJ7L 1RZJH 4A04A 4DV7B 2AJZA 4RGND 3NZ8B 2WLKA 3KMDA 3FTUA 4JPIA 3RVWC 2GIXA 3R7RA 4ELMF 1QFHA 2WXLA 4X50A 2BLFA 1ZLZA 2UZPA 4DKTA 3ILEA 5D8JH 4C56A 1YN7A 2OMUB 4JRXD 2Q7HA 2R2CA 4PRIA 3HI6L 3K3WA 4E9YA 1KP2A 1O7DC 3H3BC 2DL9A 5D7JD 1TSRA 4ABUA 3CWBH 2QGEA 4M5ZL 2R29H 1NGYB 2AANA 3L6FB 4HGWA 1J05B 4U1SB 2YWZA 3K5RA 3ZRWA 1VP7A 4K71C 3P4OB 5TE4H 5M7QA 1FL6A 4GW4B 4KX9A 4PREB 5FUOH 1DBAL 1H9VA 1JMKC 1RK0A 4YDIH 3DRTA 3NRQA 1OSYA 3KKYA 2X28A 3D30A 4LLQB 4WW1B 3QNZA 4IHOB 1T0MB 5CS7A 1CDHA 3R18A 4TV8A 1KYDA 2HXAA 4RFEB 2WZ6A 4J7ZA 4HIHB 1HXKA 3IRCA 2YXYA 3DKHA 2PPAA 3N1FC 3L3KB 4G7YL 2EIDA 4L3EA 3QUKB 5E8DL 3T0VA 3ECBA 5EC1A 3Q8BA 4YLCA 2GUOA 3E80A 1KCUL 4N2FA 5LXTB 1CN4A 3SO3C 2QM4A 3E6FA 1ZT7B 2GUZA 1KBWA 2AK4A 4M48H 5B1KA 2FCBA 4HMEA 3EJYC 4QTIL 3JWDH 5I73C 2GG1A 4MD0A 5KBLA