1OCZB

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oczB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oczB02
2HRGA 2XVBA 4G72B 3IEAA 6PAZA 2QT6A 5I6NA 1DYZA 1OV8A 1PZCA 1NIEA 1PF3A 2EINB 3NP4A 4NAJA 4AI7A 1W8EA 2PP9A 3MBWB 5B1JA 2HZHA 3GYRA 2OV0A 1AQ8A 3AG1B 1BYOA 3PAVA 2NRDA 2PCFA 4E9WA 5D4IA 2BP8A 2XLLA 3CDZB 4YL4A 3PPSA 2J57A 3OM3B 1JXGA 3FQ1A 4PCYA 2VSMB 2FQDA 4GYBA 1GS6X 3WNJA 4G70B 2AVFA 2IDQA 3NJGA 1IBYA 3PAUA 3FQYA 2XX1A 4M4RB 1JXFA 1NIFA 5FC9A 2EILB 1AZCA 1JZHA 3NJLA 1PLCA 2UXFA 1OCOB 1KGYE 1BEXA 2CCWA 3KW8A 5I6PA 1WS8A 1ET7A 3FT0A 4DP2X 2IDFA 1ILSA 4DP1X 3UABA 3FU8A 2VN3A 1OE2A 4A2EA 1KDIA 1SFDA 3AG2B 1KYAA 2YAQA 2DWTA 3FU9A 2PPFA 4BXVA 1PNDA 2QPEB 3FSWA 4NERA 4BWTA 4TXVB 2VSKB 3CVDA 2MTAA 4KO5A 4KO6A 2B3IA 1NTDA 3UACA 4KNTA 2ZONA 2BO0A 4WTQA 4QKTA 1SF5A 1E5YA 3FSZA 1WAEA 2B08A 1E5ZA 3EH3B 3OD3A 4BWWA 2DYSB 3FYEB 5AZUA 3T6WA 2VM4A 2YAFA 3AZUA 1BQRA 3X1FA 1AS7A 1RZQA 2IWEA 1ZIAA 1OF0A 2HLEB 1CURA 4E9SA 4UAHA 2PPAA 3CVCA 4E9QA 3NT0A 3FSVA 3FU7B 4YSPA 2HXAA 2XYBA 1SHWA 3AY2A 2CAKA 3TBCA 2FQEA 1OCCB 1AS8A 5B1AB 1NPJA 1X9UA 2YAPA 4AZUA 1AZBA 1OCZB 5F7BA 4BXSV 3NJMA 2HX7A 1KBWA 2IWKA 4GXFA 4ENZA 1AIZA 3ABMB 4DP8X 1T5KA 3EHBB 2FQGA 1AZUA 2BZCA 1ET5A 1BQKA 3NSDA 2DWSA 4E9TA 4AKPA 1L9PA 4YSUA 3S3CB 1V55B 2IDTA 3BVDB 3EH5B 5I5MA 2XV0A 4W9ZA 2GC4C 2HX8A 3MX0B 1NIDA 3IE9A 3ABGA 1SF3A 4YVUA 3ZBMA 1OE1A 1AOZA 2GC7C 2YXVA 4HZ1A 1WS7A 2IH9A 3H4FA 1AANA 4HHWA 4YSRA 1GS7A 3EF4A 2PLTA 4NB7A 1B3IA 1RZPA 1ASQA 1ZPUA 1JZEA 1J9TA 2CJ3A 1GS8A 3OMIB 3NJIA 4GP5B 4BK5C 4YSEA 2CALA 2AANA 4JHVA 4N4YB 2X88A 5IY5B 1M9WA 2PP7A 3HB3B 5D4HA 4YSSA 2CUAA 2ZOOA 1N70A 4HCFA 1JOIA 1J5CA 2R7EA 4BDVA 2H47C 3N55A 1J9RA 1E30A 2DYRB 1BXVA 3ABKB 2J55A 2P80D 4GP8B 1FWXA 1ZDQA 5B3SB 1PLAA 1UATA 3IBOA 2BW5A 2YAMA 3U25A 4MFHA 2PCYA 3QJRB 1TU2A 1SDDA 2YAHA 4JKNA 3ERXA 1JERA 3OQRA 4KO9A 4EF3A 1N68A 3EH4B 2LLNA 4UF7C 8PAZA 4CSPA 2YAEA 1OOWA 4DPAX 4YSQA 4DP4X 1IKOP 3G5WA 1JZGA 3PLYA 4G7QB 2OJ1A 3QQXA 1ASPA 4AKQA 4F2FA 4YSTA 2VW6A 1A65A 3JTBA 3QJTB 3NYKA 4DP9X 1J9QA 1E67A 1AG0A 1NINA 2GB2A 3RYMA 3X1EA 2H5UA 4YSAA 3DKHA 1M56B 3UAEA 2ZWNA 2TSAA 1RKRA 2WO2B 1JZJA 2UXVA 1IUZA 2Q9OA 4FA7B 4HCIA 2GHZA 3NJHA 2P80A 3IN0A 2N0MA 4YVNA 5B1KA 3TBBA 4E9XA 2BP0A 1AS6A 2BW4A 1SFHA 2PPEA 1HAUA 5PAZA 3X1NA 4YSCA 2A3TA 2W88A 3V9CA 4A68A 3SBQA 1AR1B 2BP8B 3ZX1A 1ADWA 4A2HA 3T71A 2WSDA 3WG7B 5TK4A 4HALA 5I5IA 3KW7A 3UGEA 2FTAA 1GSKA 2I85A 1YLBB 3ASNB 1JXDA 3FYIB 1CYXA 3ZIYA 4F7KA 4YSOA 1OE3A 3T6VA 2UXTA 1SDDB 2XXGA 1A8ZA 4RH4A 1ZIBA 1FFTB 1ASOA 2VW7A 4M3HA 4AX3A 1NICA 1ID2A 3CZUB 4KO7A 1MZZA 5EHFA 1F56A 3QJSB 4KNSA 3ABLB 4P5SA 4Q8BA 5ANHA 4GP4B 4FAAB 1BQ5A 1XB6A 1TKWA 2CBPA 2TSBA 1E65A 2YAOA 1TEFA 3NSCA 7PCYA 1GW0A 4HAKA 4HHGA 2IDSA 5I6MA 3TASA 2JKWA 1PZAA 1PAZA 3HEIB 1ILUA 1L9OA 3CDZA 3NJNA 4KNUA 4A67A 3QJVB 2UX6A 2VM3A 4KOBA 3AG3B 1AZRA 3FPYA 2VMJA 1ZV2A 1PZBA 1SHXA 3DTUB 2XWZA 1NPNA 1PY0A 2OCCB 4QLWA 1WA2X 3SBRA 1EZLA 3WIAA 3GDCA 2J5WA 2H3XC 3NSYA 1BXUA 1W6LA 1BAWA 2IDUA 4E9YA 2DV6A 2YQBA 4A2DA 4P5RA 1SNRA 4CSZA 5B7MA 3X2QB 4A2GA 1J9SA 3D12B 1AAJA 2E86A 1FA4A 4KOCA 2IH8A 2QDVA 4A2FA 4AKOA 3S8GB 4Q89A 2BZ7A 4YSDA 3NJJA 1EHKB 1CUOA 1PCSA 1ZDSA 4X4KA 1KBVA 2VW4A 3T9WA 1WA1X 3UAAA 4F2EA 3ASOB 1NWPA 1I53A 3IN2A 5AFAA 1A3ZA 1JVOA 3OMNB 4N8UA 2FWLB 4HIPA 2XXFA 1JZFA 4DPCX 2GIMA 3FSAA 2FJSA 5E9NA 3S3BB 1IC0A 1V54B 1GY2A 2AFNA 2Q5BA 1KCBA 3BQVA 1OCRB 1PMYA 2W8CA 5I28A 1NZRA 1GY1A 1A4CA 1NDTA 5I6LA 3GXUB 2UXGA 2PPDA 1ET8A 4A66A 2Y69B 5I6OA 1AG6A 1L9QA 3FU7A 2XU9A 2HX9A 3WI9A 1BXAA 1JVLA 2ZXWB 3CG8A 3N2JA 1KCWA 6PCYA 4G71B 2I7SA 2RACA 3UADA 3X1BA 2XV2A 2YXWA 1NIAA 1QLEB 1R1CA 1KV7A 5B1JC 1W6WA 3SQRA 2FT7A 3AW5A 4BWUA 5B1BB 4HCGA 5TK2A 2I7OA 2EIKB 1XB3A 5B7EA 1HFUA 1MZYA 4L0PB 3WNIA 3V9EA 1IBZA 3NP3A 3NJFA 2R7EB 4BDVB 1PNCA 2GSMB 3OMAB 3QPKA 5I5JA 9PCYA 1VLXA 4DP5X 1ETJA 4K9JA 3T6XA 1TEGA 2IAAC 2XX0A 5AKRA 2FNWA 1HAWA 1AACA 1A4BA 4E9RA 1AZNA 2MRYA 2BWDA 2QPDB 3H56A 1QNIA 3AG4B 1MDAA 2Y1AA 2JFCA 1J5DA 3S3DB 2FT6A 3PXLA 2YEVB 2XV3A 2AZAA 2AZUA 2BWIA 1BYPA 4DP7X 3ZDWA 5F7AA 1MG3C 1CYWA 1XMEB 3NSFA 3QJQB 3WKPA 1PLBA 3FS9A 4DP6X 3JT2A 3FQ2A 5D4JA 1SJMA 2UX7A 5PCYA 1QHQA 1WA0X 2QDWA 4E9VA 5B7FA 3PAZA 3L45A 2JXMA 3FPXA 4DP0X 1GYCA 3X1GA 7PAZA 1L9TA 2GBAA 3DIVA 1L9RA 2BHFA 2BP0B 4PAZA 3C75A 4G7SB 2PP8A 3SBPA 2HRHA 2PPCA 3H4HA 2WO3B 1V10A 4ZK8A 3TA4D 3NJKA 4WKXA 2FQFA 1L9SA 2DY2A 2YARA 1GR7A 2FT8A 1NWOA 5I6KA 3QJUB 2EIJB 3CVBA 4W1TA 1A4AA 1XB8A 1X9RA 1URIA 2XUWA 3PCYA 4DPBX 5I26A 2EIMB 2X87A 4GY4A 1NIBA 3TU6A 1DZ0A 3S8FB 1CC3A 4G7RB 3T6ZA 3WKQA 1RCYA 5LDUA 1M57B 1KDJA 2J56A 4JHUA 2IWFA 1JZIA 5A7EA 2GI0A 1MG2C 4UANA
chains in the Genus database with same CATH superfamily
2BMKB 2C9SA 3NACL 5EBMA 4ZS6C 5EU3B 5IROA 4AEHH 5EZIL 5BPPA 3TPKA 2BHYA 1FNAA 4PJEE 5FCUL 4E42A 3GUFA 5ITFA 2ZTBA 3DLQR 2VQTA 1DR9A 2ZWLT 4OGYL 5JXAH 3JD1A 1Z2KA 4X89A 4N90D 2J6EH 2DM7A 3SKJL 1OCRC 2DQMA 3UDWA 2G4EA 4XR8C 2LOEA 3NIGB 2E76C 3PPSA 1BX2B 1FFNA 2WXPA 4HS8L 4MCZB 2WPGA 1U58A 4N2NA 2R0WH 4Y2NA 5ESVB 4OZGA 5ABAA 4N6RA 1XBRA 2EDNA 4NRZB 3M86A 4OFPA 4HOMA 3PDGA 1GAXA 4HZ3A 4QJ3B 5DRWB 4OLEA 4NCC2 5DRZA 5EIIA 1ORQB 5D2LA 3T0VA 4CSTA 4X6CA 1KTDB 3H9ZA 5EDSA 4M6ML 4KUMA 3QVAA 1RJZB 5MHSD 3CQFA 3RBSA 4I77H 3FOMA 4PGCB 3FU8A 4UZUA 2CR0A 1FXVA 3HRZA 5GGRY 1T2XA 2ZF8A 4LSPH 1TUPA 4Z7VA 3KLHD 3HUJB 4MNQA 3QEUA 1CVRA 1NLBH 1BQLH 4LSQL 5CMAB 3V95A 3O9WA 4E5XA 3SBWC 4YHPA 1AI6A 5BS0B 2VE6A 5DUBA 1ONQB 3T3PB 5ID1A 4X65B 2FLMA 3RVWD 4AMKH 1UFGA 3V0FA 5TF0A 1PD1A 1HQ4A 1V7MH 1Q6IA 5EOCH 5I8CA 4L4VD 3NFNA 3HMXA 3IJSB 4G8EA 5DS1A 3VYNA 1H8HG 3Q6GH 3H3BC 2A0LC 5EV7A 4X7SH 4IL6Z 3CFCL 2CG9X 3M1CA 4P3CL 1BWMA 4X7EC 1NCWH 5KA6A 1CPUA 4PS4L 2F61A 5L2KE 1OT4A 4N87A 2GTAA 1RZGA 2PWDA 3CJHB 1RIUL 1WFUA 4LWSA 2W0FA 4QOKD 2J5LB 1OF0A 2D73A 2X6CA 1WAAF 1KBGL 2QMKA 4P2QB 4E5XG 2MPAL 5I1CL 1JPSH 2F7RA 2GIXA 4J7RA 3SDCA 2DLIA 3QC5X 3TN0C 2P5EE 3BISA 1P5VA 2X9XA 4GKSA 2RJZA 1SHWA 2C7UA 4CMHB 4YHLH 3HIZA 5C0AE 3QFJB 1AJQA 1X9UA 4P9ML 3WMQA 3FBQA 5DC9B 3DWTA 5F3BA 3MLSH 1JYWA 3RVYA 2BTOA 5D5MF 3VGDA 3CHSA 1BW8A 1KBWA 4TWKA 2JQZA 3LSUA 4PJFE 5HYIA 2XIIA 1U6AH 3PV6A 4M5ZL 4JJHA 5KZCB 5KSAD 3CDGB 1SA0A 3S3WA 3WKNA 5F0PB 3LKOB 1SYVA 4G7VH 4XMKL 1AQHA 3QJZA 2N7AA 4MKMA 4BFJA 2VXQL 4FKEA 1RLBA 5KSUA 1UASA 4FFVC 4JPVH 1Q8IA 2MFNA 1TSHA 3FQUA 5MERA 4ANVA 5T33L 3G5ZB 3VG9C 3DOIA 2P22C 3IKKA 5F9WB 1FVDB 2PUQT 4ZX6A 4XP9L 1U8QA 3CPUA 5GGTA 1SJHA 2R15A 3DBXB 4XXWA 4LVNC 1R47A 3WS6C 2G0KA 4JRXB 4LAQH 4MJID 1F6LL 4PJXF 1PKQB 1Q6HA 1A7NH 3EF4A 3MBEB 3PQYE 1RVFL 5LOVB 4WWPA 5I1LA 3BHBA 4UM9D 4HIHB 1PSKH 3JASA 4JZNA 1OAQL 4GIPD 5IJ9B 1JD7A 3CXFA 3OX8B 3OMIB 1IAKB 1F0LA 1NCGA 2J8HA 4HLZH 2D3LA 4RMSA 4RVBA 5DZJA 5EC1C 3VXUE 4KQ4H 1QR1B 2YSSB 1NGQH 4JQVA 2OMYA 2HLAB 3NPSC 1TTBA 2OTUA 2A79B 3BFOA 2HN7A 3OR7B 3P3RA 1E2VA 4L37B 2N3JA 5IQOA 2LJ2A 1B3JA 5K9JL 4JQIH 4KVNH 4NQEB 3QEGH 4PP1C 5LAPA 2R7EA 1TQVA 3CFTA 1Y1UA 2YS8A 4K7FB 3VFNA 5BOPA 4R7LA 4LF3A 3FH5A 5HHNA 4HPHA 2QR0A 1NCAH 1TCRB 3JATB 3CH8A 4XC1L 1FE8L 2YXHA 1YTFD 5IWAB 4HUVB 3H42L 5ENWA 5IESL 2OJEB 4Q6YA 3ZL4L 3NAAH 3MCKA 1VENA 2WVSA 1ZT4B 4U1LB 4UT7H 5DUMH 4WI7A 3EOYG 2DH3A 3BT2L 2Y7LA 4NKOB 1SBSH 2G3NA 3NIFE 2IPTH 2KI6A 5FLVA 3SE6A 5CCJA 1JPST 3HS8A 3K2MC 8PAZA 4MD4B 5E1AB 1NGXB 1JMXA 2ZAIA 2BVQB 4O2FB 3RYHA 2Y07L 2WWKT 3GD1C 4L3EB 3QJHA 5JHDA 1H0DB 4XPAL 1A7OH 3WNMA 4I55A 4C83B 1OIOA 4TUJB 3D39D 1EMTL 3CAFA 1DZBA 3B6SA 1QVOA 4AQYB 5J2TB 4Z1MG 5GS2H 1TZHB 2SEBA 3H7LA 5CILL 4OD1L 2TSAA 3B5GA 4QPEA 2G3MA 3Q4HB 1LEGB 4WU5B 3T3MF 2OPCA 3CQQA 1RPRA 2IH1B 4NC1E 3UYRH 4E41B 4R8WL 1RJCA 4R7VA 2WSKA 2APVA 4MBOA 5EC2B 5HGGS 3UTSA 3BUBA 3ECBB 4HWBL 1KCUL 1I7RB 2A74C 3K8MA 3FTSA 5HGAB 1ZCRA 1D5IL 4X8JA 3QNFA 3ZTEA 4QNHB 4LVHB 3I50L 3DETC 4ODSH 1IC7H 2HLDG 4NJ9L 1GSKA 2OMBA 3IM1A 1QP1A 4LBEC 1CYXA 4U1SA 4XP5L 3IDNB 3QI9C 1NGZA 5L4IA 2AI0L 1H3TA 3BIKB 4PGJA 2HVKB 2VH5H 3T1HO 3BT0A 4S2SB 2VW7A 4XNQB 3N0PB 4F7TB 4ZO8A 3RNKB 1U93A 2Y5TA 3WTTA 3QRLA 3ABLC 4FQIH 4NQCE 2DQDL 4TQPA 4OQ1A 3QP3A 1BVZA 2YD7A 1TKWA 3IJYA 1V3KA 4XB8A 1YJDL 3WENA 4IMKC 5HHVL 1DN2A 2ODHA 1T0OA 3IDMA 5GZNC 4P2RD 1OTSC 4X98B 2VXSH 4J3BA 2X4NB 4JQXA 3LNFA 2Y3NA 2ZG2A 3ALXA 1QQDA 4WSGA 1XCQA 5C0CD 2UUBO 3TGUH 3P3PA 4CC0A 3NDZE 1QEWA 3CDZA 5D2NA 4M56A 1VQNV 3BDYH 2AABH 3ML8A 2ZCKH 3NZ8A 1WIPA 4NNYA 4KC3B 1QACA 1SZNA 3UO2A 4UCUA 2LP7A 5FL7G 4GAGL 3ZTJG 1JPEA 5IOPB 1NPNA 3APDA 2IV8A 1S77D 1IT9H 2IG2H 4K8RH 5FW7A 2KHAA 3E2HC 2VR3A 2JKXA 2W07A 1FYJA 3VJ6B 1WLHA 3JTTB 4F58L 2DJ4A 1BAWA 2D03L 3V5HB 3GPSA 3W5NA 3A0BZ 1Q82W 2WXGA 2YQBA 2I07A 4YZFE 3RIKA 2DIAA 5I18H 5KX5A 3HN3A 4PGBA 1FNGA 3IFPA 1XL4A 3DHPA 4MMYA 3O6LH 4MD0B 5EN3A 1N33B 4IJ3C 4BWAA 1G7QB 4HUMB 5E2UH 5FYLH 2QDVA 3W56A 2KERA 1FH2A 1ORSB 1MJUH 4FL4C 3PHQB 4O4IB 2WKOF 3GZPA 4NNXA 5TE4L 1OY3B 2WCSA 2IGTA 4Y89A 1BECA 4R8CA 1EZSA 2CLVB 4MA7L 4PJ9D 2DLFL 1VQ8V 2H9GB 1DJSA 3MV9E 4GLRH 4NO5B 2I26N 3RWEB 3VQMA 1U97A 1T2JA 3EHBD 1OAXH 3FTWA 3ARGD 4JN2A 1VEOA 3Q1SL 4HGKC 3U4EB 3OMNB 2OMUB 2VLMD 3W3BA 5JXEA 3RUGA 3WD5L 3IGLA 5IJCC 2GIMA 1A9EB 4MGXA 4TSCL 5DD1L 3X3GL 2WD0A 1NLDL 5D4QA 3FHQA 3JWNH 2NNAB 3JCZA 5DFWH 3S6CA 1MNUH 1NZ6A 1L0NH 4XB7A 4ZS7H 5GGVH 1C1EL 3WKYA 4U3XA 2R29L 1W80A 3VFTA 2XWEA 2ZAHA 3IU4H 2J6WA 5FFOA 2B59B 2VYRE 4PI2A 2XAQA 1CK0H 1ZKAA 1EFQA 3D5OF 4TM9A 3CBRA 4U6TA 6PCYA 2I7SA 1NC2B 2RACA 5A40E 2I9LB 4RAIA 2XN1A 3FT2A 1CFTB 3IJHB 3KDMB 3WB0A 1ZRUA 4MDRA 3QUMH 4L1SA 4JI3O 5SWSA 4G6AC 2XZZA 4S1SL 4XCEA 4MW8A 1SUHA 2P8LB 3FQRA 3V9EA 3ZT7A 1HZKA 1SQGA 2JS3A 3HNSL 1IEBB 5KJ4A 2A73A 4NFBA 1BF8A 4KXDA 3DJ9A 3K1DA 2NSMA 1VLXA 1BZ9B 3IWVA 4L5FL 4PWIA 3Q0HA 5HVHC 1K5NA 3O8XB 3KKYA 4KXAA 5E0QA 2OL3A 2Y7MA 1AACA 3D69A 1XNRO 5E23A 3BCDA 1GGCL 4JDEB 4LLUB 3HI6H 5EOCJ 1Q38A 1UJ3A 1DO5A 1E6OL 2FYYB 1IGYB 3G04A 3H2QA 4GNKB 4PRHA 5IW6B 1XMQO 2X10A 3PXLA 2VABB 3QUMB 1VFUA 3QUXB 4Y2DA 4GQ9L 1UACH 4NHUB 3CHOA 1TZIB 2HG5B 4BFKA 3QJFB 3WEBA 3QG7H 4AVHA 1HNFA 4D9RE 5FXCH 3SQOL 1XSKA 1JBJA 3L7EB 4HH9B 3BUTA 4ZFQA 5ICXA 3OJDB 5PCYA 5M94B 3B34A 3IPBA 4QRFA 1ZLVH 4BZ1A 5J9PC 4LCUC 1QMUA 4RZKA 1U2HA 1TNNA 2DKSA 1G6RH 3VO0A 3S5ZA 4ZSOB 3B43A 1EA9C 2Y36H 1EV2E 3QGVA 3ML9A 2WQWA 4J3SA 3DIVA 5GRZA 3ZKND 2VRKA 2X6AA 4LLMB 2W5PA 1VDGA 1ZANL 1P7KA 1IM9D 1HWGB 2AEOA 4G7SB 5J12C 2X7LB 3WN5A 4GLRI 2J88H 3HKEB 2WLLA 1SERA 2YKKA 5I74B 3T4AB 1CI5A 3F8UB 4RSVA 3ZMVA 4X64B 4F7CA 5GIRB 2N0KA 3EOAB 3SCMD 3ULVF 2F54D 5ICUA 3GBNH 3CVBA 4W1TA 1XB8A 2B2XH 1FNSL 2YOCA 3TA3C 5DI8A 4FA6A 2A6IB 1IC1A 4JG1L 4DKEL 5IJBC 1BAGA 1NAMH 1RK0B 1XZ0A 2J6EA 2Z34A 2IF7A 4ZFZB 3WU1A 2XWXA 5EYPB 3GZOA 3NA4A 4WK4B 3IB4A 1PZDA 1CDCA 2PF6A 2HVJC 1M57B 2J56A 5CLYA 2H2SC 1MCBA 2QVFB 1IQWH 2AXFB 2XG5B 1AR5A 2XUMA 3GSWA 4F92B 1U8OA 5JPNC 1LHZA 4Q7DA 4CGUB 2ENYA 3FFCD 4ZDHA 3L3DB 4Q6IB 3CC1A 3IEAA 3MXWH 5GJTH 3TJPA 4GQPH 6PAZA 2CK3G 5FPIA 4S1QH 2J3SA 5JOEA 1BGXL 3B4NA 5B1JA 4RX4A 3BOVA 1Y76B 3L3IA 3KYOA 2PWHA 4R84A 2ITCB 4H0HB 1AQ8A 1RUQH 2QWNB 1EH9A 3QUKB 1HWWA 1NAMB 1S7TA 1JN6A 1TENA 3GC3A 4A1RA 5C0ND 4AQ8A 3K0YA 1NBQA 3N43B 5FGCB 5D9SB 1ZE3C 2OX5B 1UKTA 1CBVH 4H13B 4G8IA 2WVUA 1SKVA 3TH3T 1WEJH 2CO1A 1GK9A 1R3IH 2RIKA 1E2WA 3TBYA 3RI5K 2A9HA 2VITA 4XN9A 3IJ4A 1VADA 4GPVA 4F15B 2B1AL 5G4NA 2V3FA 5HHPA 4I7ZC 1TQWA 2J7LA 1IB5A 3NJLA 4JG0H 4JI2O 3FONB 4FFZH 1EJ8A 1TUBB 4KKLD 2HPOA 3ETBJ 3I6KA 4OUUA 3THMH 4BSJA 3JQOB 1GPOL 1H9DA 3PIQA 4FYQA 4ODBD 4B5EA 3UABA 2JB5L 3EFDL 3A21A 3L3GB 3RKPA 4A2EA 1MCOH 4M8UA 5D7HA 1KG0B 2D7QA 1CCZA 1KYAA 2YAQA 1AIFB 2PPFA 4WGVB 3V6FB 4CJ1A 2QPEB 5E8NA 1IGJB 4N5ED 5F7DA 1QBZA 3GFUA 5B8CA 4UCSA 3CFJB 2LAGB 4EVNA 4KFMA 3CCHB 1O9ZA 1T66D 1T83A 1P4LB 2C4FU 3MJWA 4UBDD 2D2OA 1PPIA 2R1YA 4NUJB 3V5KB 3KPMA 5ALCH 2EYTA 5HJGA 2O61B 1X7SA 1A6UL 3A5VA 4OX9O 3NCBB 4UI2A 1R5WB 4ZNEA 3QHFH 3MLVL 1GC1C 1U92A 2NXZD 3AM8A 3AZUA 3MJ8B 4R83A 1VJSA 3T6WA 3WEAA 1KIRB 1K7DA 3MMEA 4A6YH 1CXLA 5GGRA 4J4PD 4APXA 1KTKE 2DW4A 1K4DB 1NM9A 2HLEB 5E6IC 4XNXH 3LNHA 2FL4A 1H3PL 1T4KB 1LEKB 1FYHB 5T1MA 4UNVA 1Y6XA 1Z0NA 2FEEL 4I3SL 4CSSA 5LBQA 3DUUB 1CDBA 4HUXB 5EO1A 4JFWA 4WRLA 1CFNA 4FKHA 1JV2A 3A6OA 1R3KB 4R7NA 5GGUA 4WNQA 4F6EA 5ES4B 4WI4A 3NZUA 4ELMF 3WIFA 4AENB 3D09A 43C9A 3U7YH 4DZBA 2ZXQA 2EZ0D 1AIZA 2DBJA 4OZGE 2WSSG 3L4CA 4W9KC 3HG1B 2XNAA 4APQC 2JNZA 5CBFA 3CHXA 4I0XA 1MOEA 1RZ8B 5DK2A 4MS8C 2BZCA 2XC8A 3D2UA 4L23A 3BY6A 5D2LE 2APWA 4PJGB 2DWSA 4XVJL 4X6CE 2CUMA 4N68A 4TSAL 1L0QA 4IIZA 5IFHL 1PNKA 1OGPA 1U2YA 1NTKH 3I6SA 3OZLA 1U9KA 2XVKA 5JHAA 1NL0H 5I5MA 4C56D 3MRLB 3IYLW 4MAYA 2OR9H 4Z7VE 5FK9B 3KEHA 3JTSA 1E2ZA 1LP9E 4MNQE 2GSGA 1H0DA 2LLGA 3KJ4B 3MCG1 1IC4H 2HT4C 2VDRL 3EYOB 4OLXL 3CMAV 2X89D 5KAQG 3RVUD 2VXUL 3MBEC 3QUYD 3SGJA 5IMMA 5L6YH 1Z1WA 2PLTA 1DVQA 3Q6FA 1TTCA 3HBPA 2YJQA 4R96A 1FYTE 2WP3O 3BQUC 4HLZG 3Q4HA 1OAJA 2UUBB 1TQCB 1S7SB 4DV0O 1ZLDA 5IJ0A 4P2OC 1JGEB 5ADPH 3OR7C 4Z0BL 3RVZA 2CWRA 3R1GH 4OFQA 5ERWA 4BFIA 3BRCA 1K5QA 4HXBL 2CUAA 3PWJB 3ZN0A 1Q9LB 4YZWA 5CEXB 3WEXB 4IBTA 2GBOA 1HXYB 2WQRA 4PJAF 3V0VB 2YPLB 4NR1A 4L9DA 4ZUWA 4OFIA 3FB6A 4DR7O 5T3ZH 3IU3B 5LMUB 3L81A 1EEZB 2BW5A 4PV9B 3SJVB 2JELH 3QUHA 1VEPA 1YEHL 1SBBA 3VXNA 5LGTA 2WZ5A 1JYNA 1UGKA 4AY0A 1MCQA 1R5VB 1QLEH 32C2B 4FNTA 2VQFO 3Q5TA 1RUKH 2WB7A 4HAMA 3JD3A 2BSDA 3BXNA 4TQHA 4WKZA 4I8DA 2Q8VA 5IG7A 2A38A 4XNUL 1OOWA 4DPAX 4YSQA 5J6SA 1YDPA 2RGSA 1GHFL 5AZEL 3TURA 4HJJL 3H1ZA 4YSTA 3QJTB 5DJCA 1C5DB 1ULVA 2JJTC 5LGJA 4GQZA 5F1OB 1A4KB 3VXPB 2VLJA 1UKQA 3C5ZC 1RZKL 4YSAA 3VFRA 4L0YA 2NY6C 4X50A 3CZEA 3FQXB 4G7YL 4QPKA 2E3VA 1HT6A 2GHZA 4FCAA 3UTPD 3MLYL 5CJ8A 3WDHA 1XSJA 4DW0A 2CO6B 4Y1AB 2IJJA 3BP6B 1UM4H 4KK8D 4PJ8D 1KJVA 2AJSH 2DYSC 4KI5F 2W81C 3BVNB 3U4AA 4PCTA 2A3TA 1JI2A 2Q7HA 5AYTA 4PVMA 5FF6B 5FHBH 2DQFA 4DR3B 3BPCA 2G5RA 5IB4B 1MAML 1GM7A 4YDVB 2PW2B 1MCSA 5DVPA 1MN4A 5F6HI 4GUPA 4FERA 3RL1B 1W91A 4OCXH 2BVUA 5AB0A 1T21B 5LGUA 3FHAA 4RMUA 1ZHBA 3CMEV 1GZQA 3OKLA 1GXEA 5KEZA 3SYCA 2H3KA 3EJCA 4DFHA 4N3UA 3K6SB 4M1DH 1KPUB 5DHEA 1ETZB 4JTCB 2NY1D 3VGAC 4A7SA 4Y2OB 1KCSH 2WN2A 3VFSB 3GK8L 4LLVA 4N20A 4PJ5B 4PQXA 3QZWA 3EO1A 5FEBA 2NY4D 1MCRA 4OY9A 3LNMB 1KEGH 1C12A 5E70A 5JOPE 1P0SE 1XNRB 2DWEA 3NG5A 4F8TA 3HPLA 4CBCA 2NX5A 3BVWA 3KG5A 4NQDA 4GMTH 4CU7A 5FPRA 1NGPL 1SN2A 2G0LA 4AVIA 1X5IA 1VP7A 2LU4A 1VCAA 4MJ4A 4Z78B 5JHDE 2ADQB 1V7NH 2K6YA 5KAIZ 1IE5A 3CFDA 3CH1A 5TDPB 3HR0A 4EZMA 5DJAA 3CX2A 4KJQC 5CF3A 3ZE2F 5D55A 2HJLA 5GTHZ 2B1OA 2CLRB 2KG7A 3GXDA 1G0DA 4K23L 3T4YB 3HMWH 3OBAA 4G8AC 3TK1A 4MX7B 4WSKA 1D3CA 3OZ9H 1RFYA 1JV5A 2R0KH 1T3FB 1KBPA 4Q9RL 2OMXB 3GDCA 2J5WA 4O4HB 2GUOB 3C6SA 3CUPB 1ZJBA 3MXVH 3UTSE 4I18C 4OGAD 2B0SH 2K0RA 5GPRA 3HBZA 4FTVA 2E4TA 1QLFA 4G8GA 1USQA 2E3CA 1SY6H 4YN3A 3T8MA 4D8PB 1FIEA 1AKJA 1NKOA 2X4UA 5AD0A 2A6JB 3MRGA 4FNPA 1YMHA 4JDZA 4IGBD 4BSWA 2JB6B 4MCYA 1Q0XL 1BQZA 2ZF9A 4U1MA 3WMSA 4K9EL 4FQQB 1K9MW 3U6RA 2X3CA 5EN2B 1USZA 3CEIA 3LX9A 3Q1EA 1FBIL 3TZVA 1NCDL 3O2DL 4CS3A 4ZYKB 1KIPB 1JVOA 3ZE0B 2FWLB 1GZPA 3D4CA 2Z1PA 2HSIA 2OQJB 4QRRA 1TPXB 4F7PA 4JO4H 4Z5RA 2CZNA 5I1EH 2TAAA 1MJJA 3FO9A 2YO3A 3GSUB 3JWNG 3QUMA 3BPZA 4NJAL 4XPGH 2ZCZA 1K72A 4U3JB 5CA3A 4PYHA 4Y9EA 4UV7L 4QNPE 5I28A 4E68A 1E27B 1PL4A 1TZIA 3UZVA 4BUHA 4G28B 1DQDH 2NLJA 5I6LA 3FQTA 3GXUB 1ET8A 3BIBX 2ZWSA 5KVFL 3TV3L 2I5YH 3WXVH 4DOHB 1LUWA 4JZ2A 1BD2B 4AC4A 1VARA 5DJDA 3RURA 1ZXKA 1BYNA 3ZRWA 1EHLH 1JXKA 3ARFA 2NXYB 3ZHNA 4DJMA 2WCPA 3C87A 3S37X 5HYSA 1AGCB 2E56A 2J20A 4KGJA 5D2NE 3VXOA 1AMYA 3RDTD 1PG7W 5JPMC 3U0WH 1LNUA 3VI3A 3NFSL 5HPOA 3RYIA 5AKVA 3VTMA 2Z35A 3SDXB 3SQRA 2WBJA 2WXHA 4PJHA 1IVLA 2FT7A 4OI7A 4U0RC 5ECJE 1PD6A 4KKBC 3FAVA 1SPDA 4X66O 2CK2A 4FLQA 5J11C 1G0XA 4N28A 2AJ3B 4PTUA 5BJTB 3EOBB 2OI9B 1EJOH 2A06H 1Z7JA 4DKDC 5I5JA 1PTZA 4DP5X 5DD0L 2QWOB 2VDOH 5A3ID 4HWNA 3B2DC 3MCLL 4XNYL 4TVPL 4ZODA 4ZXBD 1G6RA 2BWDA 4LCCA 4NXSA 1FG2A 1OANA 1K4CB 5J1TC 3VNYA 3LKRA 5LYJA 3QHZL 4V2BA 4OU3A 5E6UB 1BLNA 2D31B 5I30L 2FT6A 3TXQA 1JJOA 3HS0B 4AGLA 4LEOA 4XTRC 4GG6B 3ISYA 4XZ4A 4DP7X 4N21A 2HG5C 3WIIL 2VN6A 1YECH 2C1PA 3MU3A 2F7PA 1XXFC 2BM3A 3LH2L 3RUGE 3OG4B 4KZDL 2K3TA 1I5YA 1UEYA 1MHCB 3MSPA 2QSVA 4XNBA 3W57A 4E9VA 4WJ5B 1ES0B 5AVSB 2K6ZA 4K5NA 1OXYA 2JXMA 3WTUA 3NEEA 4N2EA 4PIBA 3R4DA 1RMFL 1X9QA 3OC5A 2QPUA 2BP5M 3POHA 4BZ2L 5HVWA 5L2JB 2Z6FA 4X6DA 1XGRA 2IOOA 4DV6B 3IC7A 3BSZH 4ZD3H 3MRRA 1A47A 4UOJA 4MDIA 4JDVB 4RRPM 2PR9A 5IBTH 3SBPA 4Z7OF 1KT2A 3TJEH 3T2QA 1XGTA 5I76B 4RUFA 2WZ6A 4JFZL 4BHUI 4K5MA 4TUKH 5CLZA 2YLKA 4CU8A 5BXFB 4NQXA 1DJXA 2Z91A 1QW9A 3EDJA 2JJSC 5F6HJ 5BO1L 3MOAL 3PN1A 4J7ZA 4FLUA 1AZVA 2XY2A 1HXMA 1F11B 3EZJB 2BS8A 5SWSE 4LP4A 3PCYA 2R4SL 5EO0B 2DQTH 1QFWL 3TEWA 2B14A 1B90A 4CN6A 4FLZA 1KY6A 2WBKA 1RCYA 3LZOA 3HNTL 4NWUH 4P5KA 5A7BA 1AMXA 3CD6V 2V7HB 3P2BA 4XMZA 2ICES 1H38A 5EOTA 4NDMB 1CLYL 1HILA 5HHOA 5K9OB 1FC2D 1MG2C 1P4BL 2V8LA 3G5XB 5HJ3A 2WUCL 4PRDA 4U7SA 5AVRB 1AY1L 4OLYL 3TEYA 1G1CA 3KWVA 4RFOH 4PRHE 1CF8H 4FFZA 5IHHA 2ZKYA 1AGDB 2V4DA 3CHPA 4OAWA 3ZJAA 4EZKA 4NHCL 3RB7A 5BZDA 1A2YB 2DWDA 1FH5L 1PIFA 4X7DC 2NRDA 2PCFA 4MLIA 5IB5B 3UTOA 4E9WA 4UQDA 1WJZA 4GAFB 1H6FA 4X1IA 3QSKB 3C5SB 2CIIA 4YL4A 2EO1A 4AXWB 1GMGA 2G5BA 5D1ZB 3L9RB 3D85D 5CKGA 3RIFF 4P59L 2DD8H 4ZFGH 4NC1C 5AVZB 1JNNH 1NMAH 1R4XA 1KJ2B 3IMSA 1E8ZA 4DV0B 3WLWC 4F7MB 3CFKA 2ZIOA 3EO0A 4MVBD 4Z7UF 4F15C 3PWPB 4Z7QE 3QIUD 2BSCA 2DL9A 1XCTA 1ECYA 2EH7L 4I9WD 2IBGA 4MQXD 2XX1A 5E1GA 5KMGA 2AEQL 3ZRFC 5BRPA 4M6OL 1PLCA 1N0XH 3FF8A 4YXKH 1MSWD 2V9QA 5B1NA 2EEAA 2NZ9D 2DM4A 4XVTH 3AFLA 5J6GA 4G8FB 1HCVA 1M1KW 4HS6B 4OD2B 3MRMB 3KR3L 3CRQA 5GGQL 4A6YA 1TCMA 2ZUSA 4AH2B 5INDB 1KCRL 4K5LA 3BKJL 3RNQB 5JIMA 3GZKA 4OVUA 4I9XA 3RZCC 3KPTA 1NFIB 3DSQA 5I8EB 2GHYA 3CVDA 3VDAA 3ZDXE 1VPOL 2MTAA 4KO5A 2ORBH 1NTDA 3MLWL 3QWQB 2VQFB 1ND0A 2ATKA 3VB8A 1KWKA 4BH7B 4WO4D 1UWGH 2F74B 3T0XA 3ARBD 4ZS6D 2CTWA 3QEQD 4KK6C 4W4LA 3H6JA 3P69A 1E5YA 3HUJE 1LK3L 2WAMA 2A6KB 5CBGA 3NPZB 1HHGB 5CU9A 4HUWB 1PZUB 3NDYE 5LNDA 3KVDD 5KHHA 5B22A 2P67A 3T4DA 2OMTA 3ZKSD 4D9LL 5I1HL 3OGCA 1HNZB 3VWJC 5E2WL 2OP4H 3ZXAC 1MNNA 1QNZH 4P46D 4IS6A 3M88A 3ARPA 3MAWA 3PABA 3F6LA 1K4DC 3TH4T 1AS7A 5D1XB 1I08A 1ZEAH 3E3QE 5D5MB 2IPUK 3FU7B 4I50A 2P4VA 4HIJA 5C0DA 2BWQA 3QG6A 4J11A 4X6BA 3T04D 1R3KC 3N40F 3ARSA 4GT0A 4NWTL 3CVIL 3L3JB 3VWKC 4J3UA 3ZE1E 2ZUXA 2ZM6O 1FRGH 3WJJA 2YDEA 1I8AA 3NZSA 5CEXA 1JCHA 3NJMA 3NQIA 1RAMA 3IXAB 1EVUA 4GXFA 5D1ZI 1A6WL 3TVMA 2Q3XA 3MFFA 2H4EA 2WJ7A 3BKML 2PTTA 3QFJE 1OV9A 1H8SA 3G6AA 1EX0A 3IRPX 1ZHLB 4X5WA 3ROLA 3L73H 5CINH 3PV7A 2W9EH 4KKAC 1L3WA 1Y0LB 3S3CB 2EIJC 2FX9H 5GS0H 4OJAA 5BV7H 3FRUB 4PJXB 4XVSL 1KLUA 1KFGA 2Z4QA 3JXAA 4X9FA 4JPRA 3OHXA 1S9WA 3MX0B 4NNPL 4DEWA 3D08A 5I2IB 3D51A 2BVPA 5F7YC 3PL6A 5D6DC 4W68A 3BESR 1RFDL 1Y6MR 2CUHA 4U33A 1W2BU 5MEPB 4KXCA 3X17A 3IMUA 4CILA 3RFZB 2YQGA 3H0TA 5C0FA 1YY9C 2CMRH 1DVFB 4X8CA 4XMPH 5HVGB 4GP5B 4WI8A 4BK5C 3ARDB 1ZHNA 2FB4H 3I9PA 3MV8A 3WKMH 3TN0D 4ZNEE 2BRRH 1XSIA 1UWXK 2L8AA 2NNRA 2OR7A 1HXKA 5ELIA 2CXGA 4EOWL 4UOW0 5FF6A 3K4DA 1QOKA 4M5YL 4J9YB 5EU6A 3N55A 3GSRA 3IFLH 1Y67A 3P2TA 1OJHA 2FHFA 3FUHA 3ABKB 3QDGA 5FKAA 3PNWA 5AZ2L 3P2DA 4HPYH 4NSKB 5KW9H 2Q76A 3B40A 4JFDD 4JN1H 5C09A 5C08D 3H2PA 1RQ5A 4XWOC 4HKBB 4XO5A 5KVGH 2CPCA 2PCYA 3UTTB 1MABG 3FT4A 3OTFA 2EDBA 2VM9A 3P9MA 3TNMB 3JD2A 1MHPL 1UH4A 3LTVA 3S36H 1DEEA 1S0VA 4FFVD 2B1HH 1TJGH 1C08A 1F23A 1FSKC 1CIUA 3IMTA 1B6UA 5HI5C 2IXQA 4WI9A 1E90A 2OCHA 4AV0A 3JT0A 5EBLC 4DP4X 3FOLB 3SE4A 2FJGA 3EFOB 4P9OA 1JF1A 4PREA 4UVBA 3QZNA 3RN4A 1BOGA 2M26A 2QQKL 3T3MB 1OAKL 2WC7A 4BR6A 1AVMA 1J9CT 2H8PA 5LHGA 2V2XA 2EZOA 2AEPH 3MTXA 3P1VA 1G7PB 4UUJB 2HYMA 4UCVA 1LWHA 4U1HA 3KGUA 4W4OC 5E03A 1AQKH 4L3EE 3HFML 1CGUA 4BCXA 4BKLA 1IGMH 3ZHKA 1X5HA 3U36A 1KB3A 1FKAO 5AEAA 4F8OA 1CDJA 1N12A 2JCWA 1NJIW 3E8UL 3O2WH 3BP7A 4MJHA 4UQCA 3TBBA 1A14H 3VSVA 3EFFB 5D6CA 5EULV 1UM5H 3ZMZA 2FGWL 1P53A 3BFWA 3KH3A 4IIJA 4FQXA 4AYID 5IHZB 3QCTL 5KHGA 4PH8A 4A2HA 3KXFA 4PP1D 1A7RL 1CZ8H 3MRDA 4Z76A 3PY9A 2YR3A 4KY1H 4L8SC 3O4LA 3BGFB 4OCLC 4Y19A 1RURH 2VDNH 3DGGB 5F7UA 5IQ7H 3GSOB 4TUYB 3ZVVA 3JAWB 5C07B 4Q4IA 3CLEH 1RJYB 1O6SA 2DIJA 3RHWF 1I1RA 2A77L 5CHNA 4C54A 5BS0A 3KCYA 1MPAL 1I94B 1YC8A 1EHNA 3RBZA 4JFED 1YEGH 3EAKA 2K7QA 4JPKH 4X66B 2KMWA 4I3GA 4XN2A 3NFPB 1SQMA 3AU0A 2AQQA 1U33A 3LZPA 3P4OB 2RA1A 4Q8BA 3ETSA 3INUL 1WICA 1BQ5A 2VLLA 3NEOA 5J2UB 4FFYH 2F7QA 3VU2A 5SV4A 4OB5L 1E4XI 5JMOC 1B4LA 2Z31A 3OHMB 1LWRA 3FQWB 3TASA 1KEMH 1JFHA 4XXCA 5DS8A 3CCMV 1TETH 4ZZKA 1ZLZA 1SY6A 3ZZSA 3QRBA 1DQML 4FJZA 4LHUD 5EO9B 2QWQB 4DV3O 4PM1A 5FW6A 3ET9F 3ZJZA 1PZ5B 5KBMA 2Z8RA 2A9NH 2VR4A 3B7RL 4YNYA 3JWOL 1MFBH 5FYJU 3WFBL 1OWWA 5KHJA 2EDTA 4PRID 3K74B 5J6GB 2VLJE 2AGJH 2KKWA 3FU3A 4CVWA 1NKRA 2XN9D 2JIZG 4IBLT 1CD0A 4Q9CA 2R51A 4DV1O 1M93A 1QI4A 1QKZL 4KRPB 1QSZA 1KB9K 4F9LA 3DETD 3X3FH 4ABVA 1IM3D 3ZHUA 3AU1B 4EQ2A 3B4SA 4IRZL 3RGVD 2CGRH 3HHMA 4D0DA 4P04A 1ACYL 4P5RA 4H8QA 1TTRA 2VLKB 4ZQKB 2V17L 1ZX3A 2OYLA 4DGVH 2V5SA 1LD9A 2XAGA 4N9GB 4HK0A 1AHWB 4Z7NB 3C60C 3MACL 3S8GB 5ILTH 4XZUB 1GCYA 2ATPB 3DROB 2ZWKA 4Y7MA 4RNRA 1WPBA 4EI0A 2X6VA 2Q6WB 3ZYIA 2DYRC 2YQ3A 3ILQC 1H2GA 4O02H 4GUQA 2K70A 4WAFA 1TTUA 2ZNXA 1ZT1A 1UZ6F 3MRIB 3U9PL 2GJ6A 4YBLC 3BUYA 3FB7C 5JW4N 4JY5L 4ATWA 1X5AA 2XWBB 3MGOA 4P4RB 5AFAA 1S7UB 3DX6B 1AD9B 1L9NA 1TPXC 4K71B 2R23B 1OTSD 4KRNA 3KPSD 4QI3A 3UX9B 5D7SL 1UCBH 1V54B 2N59A 1GY2A 3QAZB 3HAEH 4FXTA 2ZUQC 1C5BH 1A5FH 1NZRA 4AIZB 2NW2B 4P4KA 2K45A 1A4CA 3LKPA 1ESOA 3UP1A 2WTRB 3GHEL 2X0VA 2Y69B 2NX5E 5CGYD 4NQDE 3RAJL 4XC3L 5B38A 5FW8A 4O02B 1W8OA 1KUMA 1D5BA 1MHCA 2XWTA 4W9GC 1UH2A 2MJWA 5B66Z 1MRFH 2K9PA 1PU0A 2DMHA 2VB5A 2ZSVB 1JVLA 3DRQA 2V5YA 4IKKA 4YJ2A 3VXTB 2HT2C 4H8HA 2EKSB 1HQRA 5HGDA 2BSKB 3F3HA 4K0OA 3RU8H 4IHOA 1E50A 3G6JF 5EBMC 5IMOA 5IROC 4IBSA 4MYWB 4FMFA 3X1BA 3AGVA 2P5WD 3P73B 4OCWL 1U8HB 3VTAA 3IRCA 1I7TA 1R1BA 1QZ1A 3MRKA 1FZOB 2K8MA 1YNLL 4O2BA 3HHSB 1HFUA 1MZYA 2VJ8A 3JAMN 4V11A 4XBGB 2OI9C 3UDWC 4LSVL 3V0WL 4PGEA 2ZR2A 1PNCA 4JFQB 4KROB 3GI9L 1XOUA 4Z23A 3H1JH 4BK8A 5EEWA 3FCGA 3QPKA 5DHVA 1K34A 3CSYB 1L7TH 4G8GE 3F05A 4LSUH 2J72A 2QV4A 4UNTA 3DX2A 4HKZB 1KTJA 3JWNE 4UQIM 3VXMD 1G1YA 3GMMA 3T2OA 2HTLC 2WUBL 3W7SA 1M6OB 3B2UC 1TZGH 1MWAL 2JRIA 1JWMB 3ESOA 3MJ7B 5HHMB 2YIBA 3ABZA 2BIIA 4TSBH 5T1LB 1H2MA 3MRPA 1N2RA 1M3JA 4KY2A 3MFGB 4O4YH 4UT9H 1KB9J 1MQKL 3BSZA 4JGJA 3SZKC 2DDQL 5I16A 3FTZA 2PO6D 1U8IB 1NANH 2V7HA 3B9VA 3U4BL 4K94H 2HUHA 1F4HA 3VTTA 3O3BA 4GBXD 5F89B 1XMEB 3HRZC 4H5SB 1I9IH 2JEXA 5DJ8B 3CLFH 1T4WA 4QRRE 4XPBH 1JPGA 5KYXA 3CIQA 2GY7B 3Q06A 4FM1A 2WYTA 1QSFA 3LRLA 3O9WC 1US6A 4IYHA 1FNLA 3EFFK 2KZKA 3PAZA 4XXDA 3M07A 3PUCA 3LEYH 2IW5A 2Q9LA 3BYYA 3FU5A 1TR7A 3ISRA 4TNWF 2XSKA 2GBTA 4YJ3A 4F6RA 2QGNA 4FMKA 1MI5B 2BHFA 2R56L 4LMQI 2EVFA 2A1WH 2CBTA 3KS0J 3L5XH 3BWZA 4AEIH 4K15A 4G6AD 5IMLB 1YJNV 5ETUA 1CO1A 3TA4D 2V7QG 4D6TH 2QKSA 3K5OA 4AOFA 3Q8FA 1IBLO 2UY6B 3VI3E 5CS7A 1U3HD 2ICWA 4PJHE 2PI4A 2E5EA 4NFCA 3SDCC 2EULA 3GSNH 1AXIB 4FEMA 1U8NA 5MEQA 1WAZA 5E5LA 2BNUA 2Z8SA 3OLEA 1T6BX 5IQNA 3TTYA 1SXBA 3TU6A 4JL1A 3EDEA 5I15H 1W9XA 2OMZB 5TDOB 3U1PA 1QASA 3LHAA 4Z95H 4XHQA 1JF5A 3U10A 1VHPA 4HBCH 4X4YA 2XTLA 3C5XA 2PN5A 4BFBD 3LHPL 5LCVH 1VQMV 3JV4A 1MFCH 1NOFA 6FABH 1EAPB 1U8KA 4FFBA 2K1EA 3MKGA 1JHKL 4YHKH 1LO4L 4JI5O 2DMXA 3OSVA 2B9ZA 1T5WB 4QJ4B 1J5OH 1FFOA 1GC1L 2F5BL 2WWNA 4O5LL 3BPLC 5M7QA 3GSNB 4YBHA 4YUEH 4JMXA 2A5UA 3QR1A 2JKNA 2NY5L 3EO9H 3QBTB 1WAAA 5D4IA 3TJTA 2J25A 3EIFA 3IDXL 3GMPA 3OJ2C 4FI7A 5BUGA 5L3FA 5EIVA 3HBQA 2HAZA 1OSYA 1WZAA 1JXGA 2KLTA 2IANA 1VCBC 3WNJA 2W38A 3UO8B 4OBRA 3BEVB 1WWBX 2VAJA 3GKWH 4PJIF 4H2CA 1MVUA 4PUBH 2JK5A 5E8DH 4JS7A 3BZ4A 5D7EA 2ZXWC 5HDBE 2PY5A 4LNUA 5LBSL 1Z6JT 2VN4A 2AHZA 4LFCB 1NAKH 1MVFA 2GEEA 4FXGB 5IEHB 3DO7A 4N2CA 4KHTL 3HI5H 1T1XB 4H20L 4UCFA 1SLWA 1G5AA 3G80A 4P5MB 1TGOA 2CCWA 2JKJA 1SQQH 2AJXL 3ZO0A 3LJ3A 1MCLA 3R18A 4NN7C 2XTJC 4JQVC 2X1OA 4DP2X 5DT1H 5LDSA 1H8NA 2FYUH 1LDPH 1DLBA 4V1DA 3GEFA 5E4OA 4GAYB 3LH9A 3UTZA 1A3LL 1QD0A 2DQHH 4LLDB 4FZEL 4RO2A 4QEGA 1XWVA 4YEFA 2VKXA 5DEGB 3ZRXA 3K2UL 4WUKL 2VDQL 4NTXA 3AWFA 2FJFA 1Q9KB 1HOCA 4FHJA 5DVNA 2H2SD 1JHLH 3H1HH 3CPWU 2XFXB 3T5WA 5EDXA 3CXCU 4LSSL 2ED9A 2NQ3A 2NY0C 2VAAB 3BLPX 2VMCA 3LMJL 2ESVD 3U11A 3C6LA 1F3JA 3FSZA 3RP1A 1RULH 2QPFA 1AJNA 4WW1B 1K6QL 2ZKHH 3B77A 5HHOE 3AROA 1NUGA 1INEL 2BY3A 3UAFA 2D3NA 2ZKOA 3PJLA 1NGWA 4GKNB 4I48B 1XHZA 4ONGH 5GS3A 4KUCD 3JWDC 3S5LA 3CFBA 3ZRCC 5D70L 5IEKB 2R2EA 2AK4D 4PRAB 4AHCA 4EI5B 2WXIA 1PEZA 1S5HB 1NBYB 1BVOA 4ELMB 1MXGA 4O4LA 4G6KL 1JVMA 2VDKH 3LKSB 3MRHA 4YFDB 4B9CA 4BBWA 3QVNA 4TLTA 3KCPB 3RYFA 4Z18A 4J3TA 3S4SB 4HISA 1OCCB 3F04A 4IT5A 3GKZA 1HHJB 2WKGA 5BQDA 4GXUM 3W7WA 4UQAA 2XA8L 1QFOA 4QXTA 2ZE6A 3WFEL 3IMWA 3ZL1A 5KJ7E 5C1MB 4JO1L 3DRTB 1R9FA 3EGXA 3K6IA 3BE1H 3QFDA 1B0GB 4PR5B 2K4AA 3K7UA 4LOVA 4WUUA 4F24A 1R24B 2E6QA 1CDIA 5DYFA 4LKCB 2PYEA 5CJQL 5JJNB 2XZCH 4ANUA 1RI8A 1NDGA 1MZEA 4Z3GA 5JW4R 4FYTA 3I56V 4YDIH 1FO0A 5FKPA 1A22B 1Q1JH 2VDKB 2J44A 1L9PA 3QK0A 4X4MA 1LYQA 2FSEA 5J3HC 2E74B 1BHAA 3SGEH 3ROOB 2JKTM 4FNLH 3G7TA 2IMNA 3MRBA 4PRBB 1FNFA 4LNVA 3ZHSA 1MREL 4ANXA 1HNWO 3DX9B 2PW1A 5ICYA 1GL4B 4JFHE 5C7ZA 5B3NA 3AVEA 2WLMA 1D6VL 2GSIA 5C2UB 3G67A 4HYTB 4X80H 2GABA 1T1YA 2CKBL 4LPYA 5DEZA 3UCSC 15C8L 3HE7B 1WS7A 3NN8B 4YSRA 4H25A 4K3GA 1FZMA 1JQ0A 4P3DB 2ATAA 1G7PA 1NBMG 4ODXB 4F37K 2OXGB 3VRLF 3FW6A 1KELL 1OB1A 2VIRA 2DQEH 1OAUH 1ZLWH 5AAWA 3QO7A 1J9TA 1GS8A 3SOTA 3PNRB 1XD1A 3PWUA 3CDFA 4DV3B 3OF6D 1YEFL 1OSZB 2IQ9H 1CE1H 2X9ZA 4KFZC 3REVA 4PJAB 3UPRB 2ZX6A 3GF8A 4I1PA 1Q0YL 1A7QH 3AREB 2B5IB 3J81N 3GM0A 5IY5B 1IGIH 5IR1B 4OCSL 4CS4A 3G9AB 4RMQA 1JOIA 4Q2ZA 3PGCA 5FYKL 3NCMA 1RUAH 1J9RA 4DV1B 3ABKC 3PWVB 1E30A 2P7TB 2YC0A 3G6EV 1CBJA 1FWXA 1X5MA 4UU9A 5B3SB 4U3HA 5CD5C 3GSXA 3ETDA 4OPHA 2Y7QB 1AQDB 4APQD 1AXSB 3P3TA 4QHPA 2HRLA 4G9DB 2CPUA 3QO0B 4MS8D 4YLQT 4LSRL 1VA9A 3V0AC 4MTMA 2Y4UA 3I9AA 3GRWH 5GS1B 1D9KB 1UD4A 5C0BD 2YPLE 1HINH 2UZYA 4WFHD 3NFPA 1KGWA 4YPJA 2FBRA 4CNIA 4UF7C 5C92A 4WI6A 4EUPB 3P4OA 5E08L 3G5WA 4OV6F 2E4FA 1KY7A 1BP3B 4WI2A 4PRNA 3AG2C 2J8OA 2Z3FA 1FGVH 1VF5C 5I9QC 1WF5A 3U1QA 2HT4D 1D2OA 4UTAL 3K72B 3QDMB 3WL9B 1YPZF 5JCOA 1BFOB 2F58H 3IFNH 5KBPA 2XACC 3RYCA 1IZJA 4S0SD 2XQBH 2RD0A 3ZIAG 4LNRB 4S0TD 4JVUA 5AYUH 2DLEA 3BQUD 4AV5A 4MA3A 4XMLL 4LLYA 1CICA 5JXEC 2P80A 4YVNA 3UAJA 4OCRL 5T3ZE 4HCRH 1OP4A 1MCKA 5PAZA 1HE8A 4X83A 1AZZC 4I3RH 4D0CA 2IAMA 43CAB 4GYCB 4F4LA 4HFUL 1YYML 5JOFB 4FFYA 3LQAH 3KW7A 3MROA 1IGTB 2ZWYA 1FLRH 2XVLA 4MNGB 3WNNA 4YXWG 3MV8E 2XI9A 4Y1AE 4OZ4B 4NKDB 3ESUF 4GG8A 4PA3A 3OXSB 5LAXA 1CGYA 1FFPB 3SGEI 1S9XB 4HK3N 2VO5A 4WF7A 3A22A 3D0LB 4P23D 4LCWA 2CRMA 5EU6E 2OJZH 4KX8A 1WFTA 1GA2A 1EPFA 5C09E 3QWRA 3IFOA 2GBUA 3DMMD 1Z9SB 3HI1A 3VXRA 4UT6L 1R6VA 2ALAA 4UDUB 1XF5A 3ZYJA 2NDFA 2CDYA 1QSEA 2VDPL 3O2VH 2D7PA 3C8KB 4QXGH 5D5QA 1EZVX 1BQHB 3MBWA 4I0KA 1JUFA 3V79C 1SDYA 4RLDA 2N1KA 1UYWH 3RZWA 2NQCA 4XBPB 3C5ZD 1JZ5A 4AV4A 3OEHG 1F5WA 3PU7A 4JANB 4NAMA 4PJ5E 5AVVB 1FL5B 3ES6A 2NY6D 4XRCA 5C6WH 3GINA 3T2PA 3S96B 2FECI 5DVMA 2P48B 4KNUA 4P06A 1RHHB 3BVOA 2OXHA 3DTXB 2AQ3A 1RV6X 1U8LA 1URZA 3SB3A 3UTQA 2AZ0A 3UJJL 4HNAA 1PY0A 4RQQA 3UT5A 2ICEB 3LD8B 1G7HB 4WW2F 1UENA 4Y2DC 1EO7A 1NC4A 2BVTA 4HUNB 4XPHL 2ZT9C 1O7DC 3A24A 3QARA 4M43H 1NFKA 3TT1L 1HX0A 2I60L 2HKFL 4OZFA 1T7XA 4ZTPH 3HAEA 1IIIA 3OW2U 1TT6A 2YK1L 4IHBA 3KXFE 2QKIB 5FYKD 2Q86B 3HZMB 5T1JA 1NGYB 5KBLA 4OFDA 4Y19E 3V55A 2Y4TA 5C3TA 3OFNG 4YFEA 4JAMB 1PCSA 1I7FA 1IBLB 4AQ1B 5BS0E 4QHNA 5F7FA 4FEIA 5KG9B 2NYKA 5E2TL 1DL7H 1U96A 4JI0O 1EXHA 3WN5C 1X4ZA 4L4VB 4MVUA 3HVDA 1A3ZA 1QBAA 2CRYA 1YUKB 2LHAA 2W9DL 3MRQB 5T1LA 3L48A 2VDML 4ZBMA 4FRWA 2APXA 4JRYA 4MSWB 3U0PB 2XETA 4ASUG 1CL7L 3HAEG 5T1KA 4MS2A 4KVPA 3MDJA 1P7QD 2AEIT 5MP6L 3QYMA 2Q5BA 4ZO9A 4WI0B 1FS0G 2W8CA 2XN2A 3KYKH 1UC6A 4P07A 2E75C 4JY6A 1C5CH 2YFOA 3JSSA 4KJQD 4QOKB 4DXWA 2DQ3A 3B83A 4JM2A 5ICZB 3QO1B 1AP2A 1R5IB 1R3LB 4CDGC 4GKKO 1HI6A 3UZEA 2NTSP 3A4DA 3OAUL 1AP6A 2Z93B 4DO5A 4HF5H 3KG2A 3MAQA 2W59A 3OPZL 4QY8B 4BYHA 2EDXA 5JHLL 4NXKA 3SY0A 3BEHA 1EO5A 4XCNA 3VSUA 2ED6A 4MVOA 3KBPA 4Y4HA 1DGSA 2BSRB 3ZS8C 2DM3A 2P46B 4G5ZL 4UT9A 4YHHB 2WLIB 5B1JC 1DJZA 3HZVA 3KPRA 3FB5B 1MFNA 1W6WA 3P02A 3ZDZF 3DGCR 1ZSDA 3CMOH 4TTDC 4KDTC 5KSAB 5AOKA 3Q3GA 4OZIB 1GAFH 1AR1C 4W4KA 1N8ZA 2XZQL 4ZT1A 4AQ8C 1A6ZA 3AXLA 1ADQH 1F8TL 1K8IA 1L0XA 3K6FA 4E2OA 1CFQB 2HVBA 4XO4A 2UY6A 2CM6A 4NN6C 5C2BL 3JALA 1QTYT 1TQBB 4K9JA 1CD1B 4RAUB 2D0FA 2VLRA 1E5UI 2D3JA 3O3EA 4GAAA 5SWQA 5JHBA 4EEEA 4A38A 4A7UA 4X9GA 5D1QA 4PWKA 1JG9A 2R69H 5F1KC 5DQJB 2UZXA 2QTEA 3DX7A 3TCLB 1T1WB 2XKNA 4JZJA 4MJIB 5AW8B 3PREA 1OCWL 2GJ6E 3BC9A 1BYPA 2ZD0A 1IVTA 2WZ0A 3QR2A 4UM9B 1MXDA 1HTYA 3SD2A 1IJNA 2YZ8A 5DA0B 4B7EA 1YEEL 3U7WH 2DN7A 4DUYO 4ZMYA 1P4IL 2F5AH 2HJKB 3F62A 3WNKA 5CEZH 3O6ML 1UJWB 5IOKA 3KPPB 3PDOB 3RX5A 5B8CC 1U91B 3UIZA 3UCRA 1T2QH 2C9AA 4PJCF 1UT1A 3MPCA 3RTQA 4DP0X 1T83C 1G9EA 4Z7OB 3RWFB 3S88H 2VWKA 5L2KD 3LSOA 4KKCD 3U1SH 3QA3A 2IJHA 5JIIA 3WELA 5BZWA 5E56A 5BVPL 4DK1A 3SKOB 3WFVA 4B9PA 1Q3EA 3ULSB 1YTFB 2VSDA 5SX4H 2P5ED 3GMRA 2H94A 4KKBD 4L3CB 3AM8C 2GT9A 3L4VA 1JDAA 5C0AD 4CVZB 5EZYA 1QU7A 1UXWB 4J3OC 2FZ3A 4OKDA 3QTCA 3BD3A 4WKXA 2GJZA 1XH0A 3ATEA 2UYLB 4XH2A 1W72H 3NCJH 1LE9B 3L74H 1EEQA 3KM1A 4PS4H 2ZSWB 4FG2A 3SYAA 4HJ1A 3IPEA 2YGNA 1CU4H 5F6IC 1P7BA 4N8VB 3ILPB 4R4BB 2PXYA 3DSNA 5I26A 5M95B 1FFQA 5I1CH 1DBMH 1IARB 3DTDA 1KGCE 1AJ7H 3OSKA 2F1EA 3VXQB 2FO1A 2KDYA 4DVRL 3D39B 3MO1B 2H3NB 2P8MB 3NH7L 5IUSA 3DDFA 4XTRD 4DIXA 2G2RB 1I7ZB 4Z7WF 2EIBA 5KBKA 4JHWH 4UANA 1PS3A 4G72B 4FQLH 3TESA 5JQGA 4NEHB 4HIXH 4U1KA 4FFKA 4U1IB 1HNWB 4LF4O 1A21A 5AVXB 1M1XB 1CG9B 2MPVA 4GI9A 2C1OA 1H8LA 4DUXA 1ZS8A 3V4LA 3AG1B 2FL5A 1K2DA 1LO2H 4L8BA 5DMGC 1WWWX 3ZX6A 5I8KH 5E2JA 2EE6A 5GJSL 4DN4L 3PQYD 2BP8A 2C3XA 1RUMH 3LB6D 4JM0A 4KTEL 4MAYC 3SPCA 2XWRA 3BMWA 3C5JA 1JPFB 1GMEA 5T33H 1IIKA 3S7GA 4MCMA 4TQEH 1BJ1J 3G5YA 1QSFE 4GT7A 4GYBA 3RY6A 4CW1A 4EI5A 1L6ZA 2UZIH 3L4ZA 3CFEB 1A6TA 3VXUD 4BSVB 1XEQA 2FO4B 3BH4A 3I2CL 3SGJC 1H2LA 1A1OA 2BNQA 3F5WA 3GMQA 2ZIDA 3ZYZA 2EACA 3RWJA 1H3XA 2NPLX 3W11D 3MUGA 3H3PH 1H8EG 3CC7V 1RJLB 2JCCA 4OD3L 1A8JH 4QYOA 2BY0A 4XN7A 1CD9B 5E6RB 5I1GL 4ESKA 3VRJA 3W1ZA 1BEXA 5I6PA 1L8DA 1RVFH 5JW5A 4QCIA 1JFQL 2IDFA 1XUQA 1OAQH 2WTPA 3PWPE 4GRLA 2V4LA 2A9AA 4NKMB 4YWGH 1DSFL 1YZBA 1SFDA 3DVIA 5E6SB 5DQDH 3U30C 2DWTA 1JZ4A 4ILDA 3FUIA 4P2RB 4M03A 4XE0A 1D5MA 1DN0A 2IO5A 1ZLSH 3FB6C 1P49A 3KYNB 4FQ1H 4GS7B 5K9JH 4JBSA 4A55A 4PPTA 2B20A 5C0CB 3T0EA 2J2ZA 5F70A 3CSFA 3TXSA 3LDBB 4CMMB 1L4IA 3F7YB 3AGWA 4N1HB 4PD4K 3EG9A 1G6VK 2WQ8A 2YXLA 3BWAA 1T5XA 2CDGB 4BRJA 4ZPVB 5IESH 1IQDA 4D0BB 3C90A 1D7DA 1GW6A 4AT6A 3BT2H 4ISVA 1EEYB 3KJ6L 4KX9A 1BZDA 1MEXH 3CXDL 3MOBL 3EYFB 3UMNA 1S5HC 4YDLC 3BMVA 4FG6C 4H33A 4KDVA 5KTEL 1HP8A 1OM3H 3WLWD 1A1NB 5GRJH 1HSAA 1WAAE 3NT0A 3WO4B 1XTLA 4DEUA 5B4MC 2CAKA 4XPAH 1BM7A 2WWWA 3AREA 4LKXA 4YDKL 2EKJA 2PTUA 1R73A 1B88A 2V5TA 3LRSA 2A9BA 2ZCHH 3QWOA 4XB3A 2C9VA 4HG4K 3TBVA 1XR9A 3F7PC 4HIEA 5I1KL 2IANE 5FWQA 1CWVA 3IDYB 3O6FA 4X1YB 2UXBO 1MLCB 5AB1A 1GRJA 1XILA 1P2CB 5EU5A 1HYRC 3UJIL 1T5KA 1H15B 3AQXA 1IBMO 3EHBB 3DXRB 1HEZB 4LLWB 3M8OH 5EWIH 5BOJA 3ARGB 1KJ3H 4QTFA 1N4XL 1IURA 1G9ML 4PA4A 3OL2A 4N0UB 4J23A 2Z0AA 3RZCD 4HIIB 2QVMA 5A2JH 2CQVA 2FK9A 2GK0A 5KSBB 4G6MH 1JNLH 3K57A 2DQJL 3KWTA 3BKYL 4F8LA 5K1JA 4NQCD 5HXMA 3IDGB 3OB8A 3PG2A 4YHIA 3F7VA 5E8PB 1N26A 2GC4C 2E27H 1CLCA 4KK6D 3KHQA 3GUTB 3V6ZB 3V5DA 3ZKXB 2WLZA 5L4FA 3J2PA 3TWCH 1NBVH 2EYRB 4LOFA 5IW1B 1GS7A 3HC3H 4UQ9A 3VWJD 4I88A 3SKNA 4NQVB 4NPKA 5DGQA 4K8RC 1YJ9V 3RWIB 3V4PH 3FTGB 3VRIB 4GRMA 5TF1H 5F72S 5AW9B 1N5YL 3GRWA 2WXNA 2DWEC 4P57A 2DQCL 3HPLC 2W95A 1N0LB 1PFCA 3HG5A 4HD9A 4JHVA 5F7MC 5IYZA 2B5IC 3FMGL 2NR6A 3VA6A 4ALAH 1DF4A 4KK9C 3MUZ1 1LR1A 1YJDH 1PFOA 1I8LA 3VWKD 2XY1A 1ZV5A 3NABH 3VCLB 1WJ3A 5DSCA 1U95B 5DHMC 1XGQB 4ZUSB 3QO8A 2C26A 2FX8L 2J55A 5K1VA 2LQTA 1FZJB 1KYOK 5I1AB 2R8SH 2BOBA 4JI7B 4AYMC 1UATA 3IBOA 1BMGA 4W4NA 5EZOH 3E6HB 2AQTA 3P11L 5CFHA 5E0FA 3CZNA 1TU2A 2VQUA 3EYSL 1WP7A 1D9KC 1OGAA 1MRCH 2GY5A 2CHZA 2JIXD 4GAGH 4JFXB 4K3EL 1XF4A 4WEBL 4DUVA 1BG9A 3P4MB 4CC6A 4KKAD 1FV1A 4WUUE 1N68A 5ITZB 3FAXA 4L8DB 3SDYH 3TETA 2PYEE 1MCIA 2WA3A 3DVGB 4JO3H 4M48H 4O58L 3V10A 4AJVA 3MV9D 3K58A 2LO1A 3RWGB 3WJMA 1ZTEA 5JW3L 1IX2A 1ZVNA 1BLIA 2YGQA 4JI0B 3RGVA 4EI6A 1X4TA 3VGEA 2X4SB 4X4ME 1G7LB 1WQVT 2QJ1A 1E42A 3RIFK 1QRNA 3OC8A 3DC0A 4WTWA 1MH5B 5AW6B 1ITBB 4ETQA 3WYRA 3W9DB 1RKRA 2OMVB 3P0YH 3VFGL 2F53A 3TZVC 2UUAO 3ESPA 1MZFA 3F65A 5JUEL 1I7UA 1S8DB 1YY9D 3OKEA 5LHIA 4TV9A 2DLFH 4DV2O 4TNVK 2FEDD 2YN3A 3UYPA 5I0XA 1FXKB 2BW4A 5F1IA 3SQBA 1DTOA 1IKFH 1IM9B 2FH8A 2YRZA 1BBDL 1KLFA 5C8JA 5BR8O 3OR6B 4FQPA 1Y18B 3Q1SH 5KVGE 1J05A 5F7LB 5E4IA 4I2XA 1G8MA 2ITDA 2X44D 4QTHA 3VAEA 1JZ2A 4IBZA 3UGEA 1BQHG 4LL1A 3SCMB 1ZHKB 2F54B 4ODTL 1Q81W 3FRPB 4URKA 3SDDA 2VO8A 3BPOC 3QZBA 4XWOD 3ARFC 2Q86A 5EORH 2QKIA 1C1EH 2UY7A 4O51B 2A9ML 1KC5L 4H44B 1JK8A 3AT0A 2R29H 1OCZC 2NMSA 4DWHA 4ODUB 1JZ6A 4FZ1A 2BIMA 4Y1TA 2DLTA 1JGIA 3SOBL 5H35A 4XWGH 5HI5D 1OLLA 1F45A 2WBJC 3AS0A 4Y0GA 1EGJA 1SGKA 2V3EA 2CH7B 4NRXA 3CN4A 1K8DB 4HT1H 2W1NA 1HJCA 1RPOA 3FFCB 5EF3A 2L4OA 4QHLA 4Z8FH 3DNKA 4QT5B 5F9JA 3WE6B 4YLCA 4RISH 1PZSA 5LXTA 2Y5EA 1E7UA 2YSUB 1ODUA 3NEXA 5ITBL 4JKPL 3SYOA 2JKWA 3W82A 4GO6B 2WXKA 2FJHA 3FCTA 4BAYA 1KYOJ 3S34L 2DIBA 3PXHA 4Q9BA 5IT2L 5HVFB 1F6AA 4R5XA 1OSPL 2AMUA 4Y5XB 4BW5A 4D9RD 3ICXA 3WUWB 2IBBA 4N22A 3LUTB 3B09A 3RWHB 1T20B 5EBWB 3TFKC 1AGFA 4ICGA 5AUMB 1M2VA 1GGCH 5HD8C 3FJTA 4O2AA 1SETA 2JDIG 4UAOC 4ZMLA 3SBRA 3SO3C 1EZLA 3X3GH 4GAJH 5I0ZA 4X6FB 4R9HA 1UM6H 1E5BA 1LXMA 5EZLB 3MGTB 2NCEA 2G38A 1FPTL 4N2GA 4F1ZA 1VFAB 5KVDH 4E9YA 2AHYA 3P54A 2WPDG 4GQ9H 5A6MA 1DLHB 1F86A 1VQOV 3TYGL 3BVXA 1E4HA 5B7MA 5IWLC 3UL4A 2UWEF 3BAYA 1IGFH 2VC2H 5I71B 1FA4A 3RVVC 4KBPA 1JJ2U 1YXBA 2VNCA 4MCNA 4KOCA 2BC4A 4A7QA 4YHOL 3KLHC 3ECQA 3LEXA 1B3QA 4R90H 2B7DT 1DSYA 2X0UA 2R9HC 1KYFA 1KJMB 5JDJA 3NJVA 3DX1A 4AQ1C 2IH3B 2DQUL 1X6NA 3RVWC 3F00A 2AGAA 1MIEL 1U3YA 2QV2A 2IVFC 5T5FH 1WUNT 1LQBC 4EIBA 2CTQA 1ML0A 3FQNA 4LCWE 2ZQKA 4PDVA 4X7TA 4G42A 4ECNA 4WEUD 5AG2A 1TJHH 1E4KA 4OF0A 1QUNB 2ZNIA 2XXFA 4QR7A 1NI8A 5EZJB 4ZOBA 2EDFA 5DJ0B 4H1LH 2QHRH 3VXRE 3D6GA 4JI4O 4HIQA 3LV3B 4HXAL 5DF0A 5CGBA 4NYLA 4ADGA 3Q9PA 4QRQB 2NXZB 5IBLC 5JQ6H 2AFNA 1KCBA 3DV4A 3V4VH 4EIGB 2QMJA 1QSEE 3CZFA 5ACZB 3FTUA 1GY1A 1FUNA 2MIZA 3OAWA 5DGRA 1BM3L 1IEAB 4NKGB 4FM0A 4J3XA 1VKXA 1FNSH 2CUGA 5AVYB 4LRNL 3LVTA 3HZYA 1OHHG 2BDNH 3HMXL 4JE4B 4LF4B 2NZIA 4A39A 1KTLB 2X4PB 1IBFA 3PJSA 5K39A 2KKQA 2OZ4H 4QO1A 3QIBD 4FCHA 2F95B 3GIVA 4QMEA 1SRYA 3RWFA 3BA8A 4ODVH 2R69A 2Y0SA 2YXWA 3SPJA 4KV5F 4UILH 1S3RA 4WHTA 5DRNA 2J8UF 3ULUH 4UOZA 1KV7A 3B9KA 4K0KO 4X1KA 3D3VA 4L9LA 1EEUA 1RIVL 1P4UA 4A2MA 2PTVA 1ZL8A 2DWDC 4PLJC 3V4VB 2R1XA 1XB3A 2RDCA 1UXMA 4G1EB 3WNIA 4UQ3A 4QRSA 4IBUA 3C60D 2CU9A 3NJFA 4JPIB 4N2BA 2WB1A 4WEMB 4BDVB 5IGXL 3BO8B 5F9OL 1PYWA 1TQBC 1E9QB 4B97A 3ILQD 5CCKL 3T6XA 1YYLL 3VB9A 5I1IL 1GJUA 1P6FA 2BVOB 3P9WB 5GSVB 2X4OA 3R7QA 1HAWA 3L3KA 2M6YA 2OTLV 4C56B 1EAOA 3JV5A 1Z9PA 5E00A 5F7EL 1M6UA 4CC4C 4JYAB 3FT9A 4PDLA 5CIPH 4UB8Z 4ODHH 2IFFL 5K1PA 2R0ZL 4RIRB 1F1DA 1WSST 5FS5A 3T3PF 5C0JB 4P9HH 1HH6A 2DWXA 4ODWA 3QUYB 2B1AH 3AAZB 4O2EB 4PWJA 2C7FA 2P49B 3K71B 1J1OL 3MV7A 1I82A 1YUHA 1ZA6A 2AAVA 5DJXA 1ZGLA 4FDWA 3BPNC 4DGYL 3H9SD 3EYUL 2KPNA 5HHME 1PLBA 5K59F 4FLSA 4JRYE 1VFOA 4K7PL 1CXKA 1W72A 2Q3AA 35C8H 5GGTL 4L29A 4J80A 1T22B 1WA0X 3BGMB 4S11A 3SPHA 4G80A 2E9JA 2ATKC 4OF5A 4N8VG 4HMDA 1EAJA 4LVEA 2WSPA 4WTZG 4Z7UA 1RLWA 5IROD 2J4WH 4R4FL 2ADGA 2OFQA 2NY7L 2BCKA 3NA9H 4JFYB 2C3HA 1GH6A 2ZX9A 5EU7C 5G4MA 5AW5B 4FXKB 3H2WA 4KDWA 4O2CA 2PP8A 3STZB 1YSOA 3BDBA 2LV4A 5F88B 2X42A 5H2FZ 5I17B 3TBTB 4ZTEA 1U3JA 1WISA 2HA1A 1S3JA 5FB8A 3KPRE 5JIPA 3MLVH 1A4AA 3MUJA 3QQ4B 1HCZA 4RESB 3M17B 2I32A 2UXBB 3N9GL 2R0LH 2HTLD 1OB0A 3D1MC 4GY4A 4FG0A 3UYOD 1AFVH 1IBMB 3TBWB 2AJVH 1KBBA 3J27A 1PVHA 2FSDA 3N91A 1NMBL 1U8PB 4G7RB 4QF1B 3WJJC 4H88L 4P5TA 4HHAA 4C57C 3ZGHA 2CIKA 4FQCH 4RWYL 2X2JA 5LUMA 2EIDA 4G9FB 3B56A 4FXLA 1NFDA 4YJZL 4NI3A 1IBBA 2VDLL 2VLRE 5ESQA 1QHTA 4ZTOL 2GAZB 3UO1L 4G59C 4OT1L 5D1QE 5I6NA 1I1YA 3GXMA 4JFFA 2PKDA 3N2KA 4PCKA 4MB1A 4PGDB 4AI7A 1SZTA 2EINB 4MNQD 5TJWK 2PP9A 5FOBB 1KF9B 1JK9A 3H55A 2EDRA 3JWDL 3QT2A 4UIKH 3O9WD 1MRDL 4PJ8B 5IVXA 3SO5A 3E83A 3P30H 2ZUTA 2WIIA 3ZHDA 1SYSA 3H01A 4QHUA 5HDRA 1N67A 1EJ6A 3VDBA 4XPTL 3A6CH 5JMRA 3DC5A 2NW3B 4QHMA 2H0FA 3FFDA 1RSYA 1UVQB 1TJMA 3K4AA 1DUYB 2Y7OA 3MJ9H 4OGXH 2C3VB 3ILEA 3FQYA 1SHSA 2VDRH 3QEHA 4K3DH 4ES9A 4M62H 2GCYA 3MRCB 2KT6A 2WNGA 2UXDO 3VD5A 5C97A 4XN8A 3GHBH 2KYIA 2NY1B 1QLEC 1WZLA 4JM4H 4R7DB 3SDCD 4JEGB 3OAZH 3ME0B 1HHIA 4ADJA 4UINH 2NY4B 4FQJH 3BYTA 4XX1G 4JFOB 4NZUL 3ATFA 4QRPA 3KPNB 3VH8A 3LNNA 3NOIA 4U3SB 4Z0BH 2A6DB 4BZYA 3UM7A 4BWTA 1YY8A 2P8PA 3MLTA 1WA8A 3US0A 2PUSA 5DDHA 2GTZB 2IADB 5E8EA 2HHHO 4X8XA 3W7XA 4XBEL 3RTLA 4DR6O 1J48A 2ZONA 2VDRB 2VISA 4LPVA 4MJ5B 3RPKA 4DKAA 5FECB 5EA0L 3LDBC 1YEJL 3GMLB 2WK2A 5E9DA 4HJGB 5LBSA 4NP4L 4AIOA 2I27N 4HKXA 4WI5A 1MJ8H 5AZUA 3ETBF 3SE4C 3VH8G 1U42A 3LN9A 5GISH 2AEWA 1AI1L 3DURA 2B39A 5IW3A 1RZQA 2W60A 5KBNC 3VI4B 2ETWA 1YEDB 3D8CA 1NDMA 2CGZA 2UUAB 1MCCA 5E5MB 5FIEA 4ZOLA 1N3NB 3BAJA 2H8PC 3ETQA 2HPTA 2HXAA 4DV2B 5AZEH 3NIDF 3AS1A 4MD5B 4HKJA 2F19H 4WSJA 1YMMA 5CJXC 5DFTA 4HYOA 5BR8B 4IGBB 4LIQH 2AERT 3MNWA 3CSPA 1UD3A 4N8CL 4M9PA 1KCVH 3DSFL 2HFGL 4F2MA 5LXVA 5MENA 4HUCA 4PJ9C 1WFMA 2BNQE 2XTJD 3IJEB 2AQRA 3V2AR 1OTTC 4RGNE 2JCCE 5EB9A 1UURA 3V4PA 1AZUA 5DHYA 3TYFB 1N64H 3SD5A 4X42A 3OXRA 4MNHB 2PYFA 2LW7A 3OKDA 3VVWA 3JAKA 2AJUH 3FO0L 5AOJA 2NY0D 3VXSB 1S7QB 2WVVB 1NVPB 3KYMA 3IAQA 4Y9BA 1BAFL 1X7QA 4IYIA 3ZKXC 2CHNA 3P77A 5JOPD 4HFWB 3BP5A 3QZOA 3OLDA 2XASA 2HEPA 4Q58C 4YIQA 4HHWA 4G1MB 3V52L 4IHJA 2YMXL 1PEWA 3CLWA 3T0EE 1JZDC 2HFTA 2YD5A 5JHDD 4OR1A 4EO5A 1GJIA 4K3JH 4DESA 4Z2WA 3RDTB 5IKCB 2O6EA 2X1PA 2KZWA 5INCA 4AQEB 2O5ZH 2Z31C 1QATA 4ABUA 4XXCC 1HL9A 3LIZH 1QLRB 4DAGL 1B4JL 3THOA 2XWJA 3QIWB 3MV01 1QSVA 3IETB 3QQDB 4MA1C 1OPGH 3ARUA 3RI5F 1UD2A 4HDIA 5DQ9B 1NGPH 4ZMTA 1JGUL 1D5ZB 5ESAA 4MMZB 2R2BB 1M3IA 3PP3H 1SLVA 5IVZA 1QFHA 7FABH 1MFMA 5DLML 4PJAE 3UTSD 1FI8C 4EDWH 4R0LB 1KTBA 2ED8A 2Q7YB 1WD8A 1FN4B 4M7KH 4ZXBB 4C47A 4ANWA 1JWSA 2YAHA 4JPSA 4NC2B 1U8JB 5F1NB 3IPFA 1J86A 2EILC 4ZX5A 4F9LC 2JWYA 4IIQB 3WUZA 3DHMA 3VQXA 2R59A 4NM4H 4LO9A 5J3HD 1YPZB 2R70A 2GFBB 2OTJV 4Q9RH 2QTSA 1IKOP 4NLAA 4FTDA 3OAYK 4XO3A 1Q9WA 1AXTL 4HQQL 3WE6A 2L7QA 3A4EA 3BAXA 2OL3L 5I19H 4PN6A 3ZTNL 3FDWA 1L5GB 3F01A 4N0FB 1W0WB 1Z3GL 5DWUL 3KE0A 8FABB 1CFSB 2BFVH 1BCCH 1WBYA 2DI9A 3RYMA 1Q43A 1EDYA 5FOJA 1IFRA 1CE6A 1J1PH 1N7MH 1XXDC 1ACZA 2W0KA 4JI4B 5E6ZA 1MHEA 4HPOL 2EC9T 2ZOKA 4DR2O 1ZT7A 1DP0A 2MTPA 2ZX7A 2ZX5A 5F96L 4KZEH 3QDME 3WSQL 1T04B 5CA1B 2CH8A 4E9XA 4UZGA 8CGTA 3KVPA 4Z0XB 3E1F1 4I4TB 1NCDH 1PL3A 2W88A 2MNUA 5TQ2H 3SBQA 4KI5E 2Y1YA 4J39A 1KPRB 3T71A 4BZ1L 4P4KC 5IMKA 4Z1PA 3BRFA 3BZEB 1NH2D 5LWYH 2OKMA 3O45A 1LWJA 5FA3B 5T5NF 4RQEA 3GLDA 4XCCL 5DEFA 1U30A 4MBRA 4ZI8A 4R50A 2DI7A 5L7XH 2QKCA 4JJ5A 4K0KB 1YEIL 5B1AC 1JTOA 3TV3H 4H44C 1F4NA 5HPMB 3EJTA 3A67L 4W6WB 4LASH 2DEXX 4UYQA 4XCYB 1Q6UA 3L71H 1NICA 1U8CB 2OBGA 4ZUVA 1HHKA 3CVHH 4PJFF 5HGBA 5LVEA 2BRQA 1DQIA 2WQVA 4N3TA 3PP4L 5EHFA 2XHBA 2X2YA 3OB0K 2BCCH 1T1ZB 5ISZA 1BVLB 2IQAB 1MIMH 2J73A 1I9EA 2F8IA 2CBPA 4J8RA 1OGAE 2ARJA 1TYRA 4NGHH 4IRJA 5JXAL 1QBMH 5AW7B 2R2HB 5IHUH 1GW0A 1E9PA 4M7ZC 2H6PB 3GB7B 2J6EL 2MQ3A 3OKMB 1K5SA 3CFMA 5DJ0A 1J8HA 3OAZK 1PZAA 2K3HA 4Q6KA 1DO6A 3HEIB 3L3HB 4XT1C 1JR9A 2VGLM 3FT3A 3P9LB 3ZDYE 2R0WL 4UQ2A 4WW2B 4Q52A 3RWDB 3GSQA 2WBXA 3D85B 2VN5A 3UMTA 4AGQA 5JXED 3CVHB 4KOBA 5EBWC 1OW0A 4ZUUB 2AQ2A 3G6JA 3D0VA 1QRNE 4ORGA 3ZE2E 3RGBA 2ROYA 3KEDA 2BTQA 4XBFA 3II2A 3QIUB 5T5FA 1M05A 3O11B 2F53E 3IF1B 4KJWC 4N2IA 3QHZH 5IVOA 4Y4FB 5GQBA 4NRYA 4TV3A 1PQZA 4I77L 5H94B 4KKLC 5KOMC 3EGSA 1XSOA 2EO7A 3T0DA 2O93L 3U82B 3WIIH 4LSPL 4H1LA 1SNRA 3T77B 4WV1B 1J10A 5I71C 3WMPA 4N25A 1MUJA 5I82A 1Q72H 1J9SA 4B9GA 1E9OA 1BQLL 1NLBL 4F20A 2QQLH 5HYJA 4HWZB 4GW5B 4RMVA 4DGIH 1F4WH 4I2XE 1J7VR 3OD4A 4Y5YA 4AKOA 1ANUA 2YEZB 4AMKL 1E4WL 4N5EC 4PP2A 1V7ML 3NJJA