1OCZE

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 41
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1oczE00
2DYRE 3ASNE 2ZXWE 5B1AE 2OCCE 3ASOE 1V55E 3AG1E 2EIJE 3X2QE 1OCOE 2Y69E 3ABKE 1V54E 3ABME 2EIKE 1OCRE 5B3SE 3AG2E 2EINE 1OCCE 3AG3E 5B1BE 1OCZE 3AG4E 2DYSE 2EIME 5IY5E 3ABLE 2EILE 3WG7E
chains in the Genus database with same CATH superfamily
2IU1A 4HORA 3VLFA 3IHYA 4ATGA 4GTVA 4ME2A 1ZB1A 3IXEA 2LSUA 1TYQG 2WXRA 2WXQA 3JYSA 2XQ0A 4N5QA 2X38A 5ENRD 4U96D 3ONLA 2L0IA 3KD7A 4Q94A 4F53A 3CKBA 3LVQE 1Z6TA 4KZ0A 3S7BA 4YDOA 1V55E 5CMYA 4DX1A 3LJ3A 3PDNA 2FO7A 2LAIA 3X2QE 2FEZA 4LNBA 4GTPA 2V4HC 3NZUA 3RRNB 2IO3C 1N9AA 3FY4A 1U3DA 2J07A 3Q7FA 5IY5E 3ABLE 5ENQD 2OEWA 5D0QD 2H6HA 3D9LA 2CFZA 5EYPF 3WXXA 2MRIA 5AQ9A 4O6FA 4OVVA 5LOZA 3PZDA 2XGOA 1WM5A 4BWRA 3RRMB 1OWLA 3FULA 4JW1A 4GYYA 2XEHA 4WNDA 2XPIA 3JXIA 4YVOA 2ILRA 1FVFA 4EPZA 3D9HA 3MKQB 4TV3A 3HXEA 1QZ2A 2R05A 4I9CA 2DYSE 2Y4TA 3L9TA 1LD8A 1IQRA 1P5QA 3S7DA 4GPMA 3OXGA 4FA6A 1E8WA 2EINE 4HRNA 2VYIA 4HRMB 3RO3A 4ZFHA 2GGFA 2WXFA 4OAUC 1K1BA 4KBQA 3B7SA 2CG3A 4LSZE 5JHBA 5KJMA 4DX6D 4GB9A 1MQSA 1YMPA 3PUKA 3HRAA 3FTVA 4WAFA 4F1SA 5B3SE 2R02A 1AWCB 4XI9A 1X5BA 4B89A 4D10C 2KC7A 4HRLA 3IKOB 5E76A 1TR4A 1NA3A 4F1PA 3PZ3A 5CHEE 5EYLA 1MYOA 1TN8A 5EIBE 4G25A 3AU4A 3HVEB 1ELKA 5G2NA 3DSWA 4GYWA 3NAWA 2GRNB 2XENA 1IXVA 1GW6A 5EDSA 5CRUA 4F3VA 3G2UA 4TXQA 4G26A 4AM9A 4M7CA 3SO8A 3BQOA 1UG3A 3FUMA 4HOSA 2PQNA 3DXKG 2H6GA 1H6KA 3SZ7A 3K9IA 4F7AA 3HXCA 4HVBA 5AENA 1TJFA 4I1AA 2VJ8A 4O1OA 3UKUG 4AOFA 2GW1A 4BSZB 5KJNA 4A1SA 4BSXA 2WXIA 3TG5A 5AQBA 1IQUA 1TNOA 4E85A 2OCCE 3EHQA 4EBAG 3Q15A 3SFXA 3MV2B 2X6HA 3PZ1A 3QOUA 4RVBA 1JCQA 5FWQA 3ONKA 1MZCA 2DYRE 4G1TA 4GYOA 3CHQA 3MZLB 3LCAA 4CEMA 1NFIE 4CT4A 3Q78A 1WG0A 3SFZA 4ILHB 4RQIA 4KMOA 3ZNGA 3L17A 1S63A 3GZSA 4EZJA 1JWGA 2YNQA 1HU3A 1FT1A 1TJCA 3EDTB 2L9BA 2B6CA 1QYMA 1Z3XA 2YQ8A 4N2SA 4UI9K 3VLDA 3TWWA 3VTYA 3APDA 5FINA 3R9AB 4UWLA 5LCWC 5D0OD 3HHMA 2E0IA 4K03A 3ZKJA 3DSXA 1JCSA 4GMRA 3SF4A 1TEZA 4JXTA 3R7QA 5EX3A 3CHMA 1SZAA 1W3BA 3DBSA 4I43A 2DZOA 2WPVA 3URZA 3FUFA 2ZU6B 3L54A 2PZIA 3QWVA 3ZHEA 4L2LA 5FZSA 3FUHA 2VTBB 4GTSA 3RKVA 4HI9A 1U2VG 4TXRA 1LTXA 2AXVA 5BXUA 2GROB 4PUCA 3UM1A 4CGWA 4IYPA 3OXFA 4EZKA 4BESA 5CEDB 3UM0A 3ZGQA 1NZNA 1WDYA 2DZNA 3ZXPA 2EIJE 3MCXA 5A7DB 3P2BA 1H19A 3OTNA 2IO2C 3EJNA 5JJ6A 2Y0BG 3G2TA 3S2AA 1K3ZD 2XS1A 1ELRA 4CT0A 3UT8A 3U9WA 2DBAA 1OWPA 4Q69A 1XGWA 4OAVB 5AQ7A 5EKQD 2P9SG 1JWFA 4CRWA 4DRXE 4ANUA 3UI2A 3CK8A 3AJIA 4URKA 1SZ9A 3BUAA 5G05C 1PY1A 1PAQA 3FH7A 2P58C 2ETBA 4XX5A 1JCRA 4K5CA 5AYWD 1YYHA 2AVPA 4Y6CA 2FO1E 1UW4B 3FTXA 2VGXA 2J4DA 3FU6A 4BT8A 3Q9UC 5T4YA 2I2OA 2WXKA 3JUEA 3SGHA 4G24A 3AS4A 4CDNA 4FULA 4FP7A 5AJLA 4JD2G 3O48A 1OWNA 4GZ6A 4LRZA 3ZU7B 3AG2E 5ARGA 4AY5A 1O1SA 3B7RL 4O60A 2LUHA 2OVFA 4PS3A 2R59A 4RLYA 3N71A 3ZUVB 2Y69E 3FDHA 2Y1LE 3QDNA 3GYZA 1Y8MA 2EIKE 3DRAA 2A4ZA 3TWSA 3IEGA 3FWVA 5CRVA 4LUNU 3P1UA 2WQHA 2X6FA 1HF8A 4ATZD 3ZYLA 3G2VA 4HQDA 2R2LA 5BW8C 4JHJA 3UIOC 4B8CB 4ABNA 4N3BA 4TUMA 3ASGA 3JQ1A 4DUIA 4A3VA 3ZEFA 3TAXA 1TNUA 4UWKA 3NB2A 5FIOA 5JMND 5BT1A 4U0SA 4AXHA 5JJ7A 1U3CA 4HFGA 4NQ0A 3FTUA 4KVMA 3UM2A 3ZYKA 1OUVA 2KCLA 4UUCA 4AEZC 1MX4A 3HVEA 1SVXA 1HFAA 2J49A 3PUJA 3UPVA 3U3WA 3E33A 3ASOE 3EHNA 2EQXA 3AS5A 3APFA 3UINC 2XZTG 3HXFA 3TWRA 2AWIA 2ZGGA 4A63B 2WXHA 2YHCA 3FTZA 3UIPC 3IHVA 2E2EA 5G05J 4DJAA 3Q49B 2XS8A 3CHPA 1N4QA 2WXPA 5G04C 5EN5D 3ZXSA 1FT2A 2J8SD 4AY6A 3QJZA 5D2MC 4YVQC 4LCTA 4J8SA 2X6KA 4C0EA 4LG6A 2XGSA 2UY1B 1E7UA 5KWDA 3S7FA 4G11A 2XCBA 5KJLA 3TWQA 4N39A 5BPPA 5CECB 4L9PA 4IULA 1X81A 1HE8A 2P2CP 2YINA 3PNTB 3SBSA 1LD7A 3UQ3A 5JHAA 3ASHA 3ABME 3CK9A 1BLXB 1EYHA 3QAQA 2EIME 3ULYA 2IOSA 4MRUA 4CDRA 2HYZA 4WUYA 3LY9A 4G8KA 5LCWJ 2OOEA 4ILGA 4DX5D 5HS0A 4W9RA 5AN8A 5B1BE 4FJZA 5ENOD 2IY0C 2J9QA 4BTBA 1N4RA 3L82A 3JQ0A 2IEJA 3V31A 2BKKB 3FUEA 4CZ2D 3SBTB 5H7PA 3IV0A 1SA4A 3FU3A 4V3IA 2R03A 3CVLA 1D8EA 4K5BA 3I3NA 3TWVA 3Q79A 2LAHA 4I2ZA 2WM9A 4GA0A 5AQAA 1QBQA 2PL2A 3DPYA 3D9IA 2C2LA 3PEVB 3G2SA 1UN9A 4I6JA 3DXMG 4Y6WA 3FUDA 2Q7FA 5J90A 4JZYA 4I17A 4JVSA 2P9UG 4BTAA 4DX2A 3U66A 3ULQA 3CQCB 3FUNA 3C72A 2IONA 4MLPA 2V8SE 3SQVA 2FF4A 4BX9A 1DNPA 1E8ZA 2X3MA 3CHOA 2WMNA 4H7XA 4EHMA 3LEWA 1TNYA 2A5UA 3FTSA 1H6OA 3KSQA 3D9JA 2XHEA 3PE4A 4DLOA 5BV0A 2WXJA 1DCEA 3RSEG 4FLBA 4ILIA 3KEAA 4BEPA 5HKPA 3UX4A 4BY6A 5E75A 3FHEA 2WVIA 2VQ2A 3W9FA 2CHZA 4LNUD 4J8FA 3FU0A 4UQXA 2I9CA 1AP7A 4C48B 2WXOA 2PQRA 3F6QA 2F8YA 3PEUB 3ZFWA 3Q47B 2NYJA 2B0OE 4X8QA 4HLEA 4WWOA 4TUUA 4BX8A 3HIZA 4U63A 2LXMA 3MX3A 2VSYA 4UWFA 2CFUA 1H6PA 4UWGA 3ZW3A 3CV0A 3UMVA 4N3AA 2DIWA 1S64A 3ABKE 1EPUA 1V54E 1NL4A 1N54A 2BTDA 4BETA 4CDMA 3DSVA 3AG4E 4GCOA 3ZPJA 5AJDA 4PS7A 3DEPA 2RFAA 1OWMA 3CLJA 4AV7A 1IYGA 2ZXWE 4B0ZA 5KJKA 4XEIG 2M63A 2Y3AA 3E32A 4RG9A 4Z68A 2R17C 4J6IA 5FZQA 4APFA 2RFMA 3DSSA 3NQPA 3SD5A 2F37A 3UT4A 3HDXA 2EILE 2XCCA 4DX7D 5CBNA 2F0YA 5ANRA 1H2UA 4LNGA 3L22A 5KCMA 1OY3D 2PNNA 3EUVA 3FU5A 1PC2A 3PREA 4R7LA 2XPYA 3KEZA 4GTTA 1RW2A 3EHRA 4HOUA 3FH5A 2I1JA 1G3NB 2LXLA 3RIBA 3Q73A 2OVBA 1OCOE 4JPSA 3CQGB 4DPRA 3KSLA 2H6IA 2V5QC 1HXIA 3NZSA 3ISMC 2BF0X 4GTMA 1FPPA 4ACKA 3DPDA 1HS6A 2V5FA 3ULEG 3PZ4A 4U07A 2C0LA 1NI1A 4BT9A 4HB5A 3AG1E 2JLBA 3LXUX 3Q4AB 3QB2A 1OCRE 2DWZA 1N95A 4MKTA 3Q5MA 2R5SA 4C0MA 3RU0A 3VTXA 5CCLA 3J5QB 3APCA 2AJAA 3B7BA 3ZHEB 3LS8A 4FU3A 3UKRG 1IHBA 2JABA 2RD0A 4A1GA 2WMOA 3D9KA 4GZ3A 5FJYA 1BD8A 2WB2A 2KBXA 3EIJA 5LFAA 5EX0A 4DI4A 1S70B 2KCVA 1O1TA 4GZ5A 4GTRA 1QNFA 4YDEA 4UI9J 4YDWA 3AAAC 5ITZF 1L5JA 1DCQA 1N94A 3R9MA 4B8AA 4QFVA 1ZU2A 3NOCD 3BEEA 3DSUA 3FUKA 2IJGX 3LY8A 5ENSD 4RSYA 4MBGA 3BG0B 4N2QA 5M72A 1YCSB 4AJWA 5G55A 3TGOA 3ASNE 4UQZA 2XEVA 4JHKA 5JJTA 3J5PA 4J8EA 1N4PA 3HYMB 1Y6IA 5BV1A 4XI0A 1N52A 3L16A 3D9PA 5AIJA 2IFUA 3FTYA 1OT8A 3L13A 4JB8P 3GZ2A 4GA2A 4UWHA 2CHXA 2BUGA 3E37A 3PNLB 5C2YA 3C5RA 2ZIRA 3ZN3A 2GRPB 3MYVA 1A5EA 2GRQB 1OCZE 4B94A 1SQMA 3C3RA 2BEDA 2P9IG 4AP2A 4TRQA 3QK0A 4NACA 2WXLA 3CVVA 2HE0A 2KZTA 1JPLA 4GU5A 4WNEA 2KZTB 2AW6A 4U0UA 3U4TA 4LERA 3EU9A 2P9NG 3SHFA 1HH8A 3TG4A 1MJ0A 1A17A 2ONDA 1FCHA 4FHJA 3OXLA 3L6AA 2WXGA 1TN7A 4MS6A 2WQ7A 2C0MA 4XKBA 3QWPA 4KXKB 3LPZA 2IOLA 4ZHBA 3ASFA 3HG0D 4HNAD 5LX8A 4XE0A 3NF1A 4JEUA 3MA5A 3MGBA 1UN8A 3WG7E 5BXOA 4KYOB 1H2VC 1HO8A 4ANVA 4UI9C 1HG5A 3E30A 4EQFA 1KPSB 5CEAA 3FEXA 3BG1B 4OVUA 3ZYMA 1N0RA 2LNIA 4I2WA 3Q9NC 4GAAA 3LY7A 3DSTA 3C3OA 5CCMA 3CSTA 1KT1A 4DK5A 1S0PA 1UJJA 2VGYA 3LVRE 5J08A 5EIDA 4AIFA 2L0TB 3C98A 3PH0C 4Q96A 2AXZA 4HBDA 3ZVVA 3CIAA 2BKGA 2X6IA 5BNWA 5ENPD 3ML9A 1YA0A 1HX8A 4JA7A 4C9BB 3ZYQA 4IN3B 4BERA 4O1PA 3VLEA 1Z3YA 4NRHB 4PH4B 1DVPA 4U0ZA 5FQ6A 2DVWA 3GW4A 2GRMA 1KZPA 3AU5A 1E7VA 4ACLA 1K1AA 2MYOA 4CYMD 2CG2A 3RAUA 3ZIMA 1SW6A 3RRUA 3D9NA 3PRZA 4JC8A 3TWTA 2ZGDA 3DEOA 3HXDA 1B89A 2L6JA 3B7TA 5ARFA 4JEHA 3HXBA 3T5XA 1OXJA 3CEQA 2PM7A 3CVUA 2V4LA 3C3QA 1SA5A 1TNZA 3CHRA 3T8KA 3CVXA 3JUIA 3CVWA 5CMWA 4M3OA 3UM3A 3CVQA 4WWNA 2QC9A 4K0RA 4NIKA 3T8MA 4N5CA 2QYUA 4K5AB 2J4BA 1TN6A 2VSNA 4OYSA 2KATA 2WXMA 5CERB 5A23A 4H7YA 4J8DA 3JXJA 3I4RB 1NP7A 1HZ4A 4J7WA 3OAWA 4GMLA 4FHKA 4A55A 3V30A 5KNGA 4QQIA 2J09A 4WWPA 3Q7AA 1UOHA 1K8KG 4HOTA 2QFCA 4A3TA 3ESLA 3S7JA 1D9SA 3CGHA 3FEYA 4YDYA 4YNDA 2X6JA 3SNXA 4U7EB 1O1RA 4GCNA 3ASDA 2HR2A 3IBEA 4B93B 4AVXA 3TJPA 1Q2ZA 2F8XK 3UT7A 2QY7A 3BU8A 5ENNA 2P9PG 3V79K 2RKKA 3SY2A 4GA1A 1RZ4A 1IKND 4ANWA 3E4BA 2XEEA 2IF4A 1Z5SC 3Q75A 4DI3A 4WNGA 4FADA 4HOQA 1EDUA 2HO1A 3B13A 5DIZA 3SI5A 2WQ6A 3CVPA 1FVHA 2XRZA 1N4SA 1H0AA 1UJKA 4RG6A 5AAOA 2OV8A 5FQ4A 4G2VA 2KXPC 2I1KA 1E8YA 4L2YA 2YHEA 4I6GA 3NBNB 2UWJG 1ELWA 5ENTD 2PM6A 1WAO1 3RK6A 2MOWA 4G23A 5JA4D 3TXNA 1MHQA 3TXMA 4I1OB 2JEKA 4CCAA 4ANXA 1E8XA 4GTQA 2FI7A 4XZ4A 2XPZA 3ESKA 1NA0A 3UXGA 3LDZA 5D66A 4HXIA 5C1DA 4I6EA 4APOA 5FQ8A 3QNKA 5BUZA 4XIFA 5FZRA 3TWUA 1XNFA 4I1MA 1WY6A 5CBOA 2GRRB 3SFYA 3R7RA 4L23A 4UQYA 3FH8A 1MX6A 2QZAA 2OEVA 2IQCA 3PE3A 3UTMA 1KLXA 2NSZA 3PZ2A 4L7TA 5FTPA 1VDYA 2HM8A 3MV3B 2ETAA 5G04J 3G2WA 4LEUA 4U8YD 4HI8A 3E34A 3D9OA 3L08A 5B1AE 4TXPA 1N11A 1O5MA 2P9KG 5KBAA 3D9MA 4GPKA 2FULA 1LF8A 1DC2A 2ETCA 2ZISA 3PVLA 4KT6B 2VTBA 3EIQC 1BU9A 3AS8A 3U64A 4L1BA 2AXUA 3GZ1A 2XGMA 4N3CA 1INZA 4I9EA 3LJNA 4HS2A 5LP0A 2DCPA 3AG3E 3QWWA 2VSOE 4G8LA 3CSFA 3CKCA 1QQEA 2NC9A 3ENEA 5T8IA 4P29A 3MKQA 3B95A 2NXPA 1BI8B 5ANLA 2I6HA 3MJWA 4U8HA 3FTWA 3TWXA 3V2XA 5A6CA 4JL0A 1OCCE 3FUIA 1HG2A 3DWLG 4GTOA 2XRYA 3ZRHA 2RG8A 5T3RA 3LYAA 4WNFA 1D8DA 2MHKA 2CHWA 2KM4A 4GZDA 3W9GA 4IRUA 3UUXA 4J0UA 3I5PA 2VGEA 3B7UX 2LO6A 2VGXB 3KAEA 3TL5A 3CVYA 3FP3A 3MKRA 3QKYA 3KS2A 1ZBPA 4PS8A 4EZLA 1KT0A 3FFLA 3FUJA 1BPOA 1JUQA 4FC8A 3CR3A 2WXNA 1BI7B 2GRLA 5KNHD 5HQ8A 3NOGD 3EU5A 3O4ZA 5HI7A 3LKUA 4J8YA 3PS6A 1H2TC 3T9KA 1TNBA 2P9LG 5FQ7A 4FJYA 3JCKC 3I4GA 2V0PA 4U8VD 2VSXE 2LSVA 4JA9A 1OWOA 3CHSA 2L6BA 1IHGA 2QYJA 4KZCA 4F6RD 2Y4UA 3EHMA 3QARA 3D3MA 1E96B 2UY1A 1N0QA 3RO2A 4BFRA 3CK7A 4E6HA 4KVOA 2H6FA 3RJVA 4EBAA 4XKCA 3V2OA 4NURA 1MX2A 5FT9A 3CVNA 3ML8A 3QC1A 1EF1C 4PDXA 4HLLA 4U95D 4DLQA 1E90A 5DBKA 5AARA 4FLHA 1KZOA 4GZCA 4JHRA 4U04A 3MEKA 4GMJA 4EECA 3T5VA 2XZDG 2A5EA 2KCKA 2FBNA 4CGVA 5EILA 2J08A 5HRYA
chains in the Genus database with same CATH topology
2DYRE 3ASNE 2ZXWE 5B1AE 2OCCE 3ASOE 1V55E 3AG1E 2EIJE 3X2QE 1OCOE 2Y69E 3ABKE 1V54E 3ABME 2EIKE 1OCRE 5B3SE 3AG2E 2EINE 1OCCE 3AG3E 5B1BE 1OCZE 3AG4E 2DYSE 2EIME 5IY5E 3ABLE 2EILE 3WG7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYR E;  3ASN E;  2ZXW E;  5B1A E;  2OCC E;  3ASO E;  1V55 E;  3AG1 E;  2EIJ E;  3X2Q E;  1OCO E;  2Y69 E;  3ABK E;  1V54 E;  3ABM E;  2EIK E;  1OCR E;  5B3S E;  3AG2 E;  2EIN E;  1OCC E;  3AG3 E;  5B1B E;  1OCZ E;  3AG4 E;  2DYS E;  2EIM E;  5IY5 E;  3ABL E;  2EIL E;  3WG7 E; 
#chains in the Genus database with same CATH topology
 2IU1 A;  4HOR A;  3VLF A;  3IHY A;  4ATG A;  4GTV A;  4ME2 A;  1ZB1 A;  3IXE A;  2LSU A;  1TYQ G;  2WXR A;  2WXQ A;  3JYS A;  2XQ0 A;  4N5Q A;  2X38 A;  5ENR D;  4U96 D;  3ONL A;  2L0I A;  3KD7 A;  4Q94 A;  4F53 A;  3CKB A;  3LVQ E;  1Z6T A;  4KZ0 A;  3S7B A;  4YDO A;  1V55 E;  5CMY A;  4DX1 A;  3LJ3 A;  3PDN A;  2FO7 A;  2LAI A;  3X2Q E;  2FEZ A;  4LNB A;  4GTP A;  2V4H C;  3NZU A;  3RRN B;  2IO3 C;  1N9A A;  3FY4 A;  1U3D A;  2J07 A;  3Q7F A;  5IY5 E;  3ABL E;  5ENQ D;  2OEW A;  5D0Q D;  2H6H A;  3D9L A;  2CFZ A;  5EYP F;  3WXX A;  2MRI A;  5AQ9 A;  4O6F A;  4OVV A;  5LOZ A;  3PZD A;  2XGO A;  1WM5 A;  4BWR A;  3RRM B;  1OWL A;  3FUL A;  4JW1 A;  4GYY A;  2XEH A;  4WND A;  2XPI A;  3JXI A;  4YVO A;  2ILR A;  1FVF A;  4EPZ A;  3D9H A;  3MKQ B;  4TV3 A;  3HXE A;  1QZ2 A;  2R05 A;  4I9C A;  2DYS E;  2Y4T A;  3L9T A;  1LD8 A;  1IQR A;  1P5Q A;  3S7D A;  4GPM A;  3OXG A;  4FA6 A;  1E8W A;  2EIN E;  4HRN A;  2VYI A;  4HRM B;  3RO3 A;  4ZFH A;  2GGF A;  2WXF A;  4OAU C;  1K1B A;  4KBQ A;  3B7S A;  2CG3 A;  4LSZ E;  5JHB A;  5KJM A;  4DX6 D;  4GB9 A;  1MQS A;  1YMP A;  3PUK A;  3HRA A;  3FTV A;  4WAF A;  4F1S A;  5B3S E;  2R02 A;  1AWC B;  4XI9 A;  1X5B A;  4B89 A;  4D10 C;  2KC7 A;  4HRL A;  3IKO B;  5E76 A;  1TR4 A;  1NA3 A;  4F1P A;  3PZ3 A;  5CHE E;  5EYL A;  1MYO A;  1TN8 A;  5EIB E;  4G25 A;  3AU4 A;  3HVE B;  1ELK A;  5G2N A;  3DSW A;  4GYW A;  3NAW A;  2GRN B;  2XEN A;  1IXV A;  1GW6 A;  5EDS A;  5CRU A;  4F3V A;  3G2U A;  4TXQ A;  4G26 A;  4AM9 A;  4M7C A;  3SO8 A;  3BQO A;  1UG3 A;  3FUM A;  4HOS A;  2PQN A;  3DXK G;  2H6G A;  1H6K A;  3SZ7 A;  3K9I A;  4F7A A;  3HXC A;  4HVB A;  5AEN A;  1TJF A;  4I1A A;  2VJ8 A;  4O1O A;  3UKU G;  4AOF A;  2GW1 A;  4BSZ B;  5KJN A;  4A1S A;  4BSX A;  2WXI A;  3TG5 A;  5AQB A;  1IQU A;  1TNO A;  4E85 A;  2OCC E;  3EHQ A;  4EBA G;  3Q15 A;  3SFX A;  3MV2 B;  2X6H A;  3PZ1 A;  3QOU A;  4RVB A;  1JCQ A;  5FWQ A;  3ONK A;  1MZC A;  2DYR E;  4G1T A;  4GYO A;  3CHQ A;  3MZL B;  3LCA A;  4CEM A;  1NFI E;  4CT4 A;  3Q78 A;  1WG0 A;  3SFZ A;  4ILH B;  4RQI A;  4KMO A;  3ZNG A;  3L17 A;  1S63 A;  3GZS A;  4EZJ A;  1JWG A;  2YNQ A;  1HU3 A;  1FT1 A;  1TJC A;  3EDT B;  2L9B A;  2B6C A;  1QYM A;  1Z3X A;  2YQ8 A;  4N2S A;  4UI9 K;  3VLD A;  3TWW A;  3VTY A;  3APD A;  5FIN A;  3R9A B;  4UWL A;  5LCW C;  5D0O D;  3HHM A;  2E0I A;  4K03 A;  3ZKJ A;  3DSX A;  1JCS A;  4GMR A;  3SF4 A;  1TEZ A;  4JXT A;  3R7Q A;  5EX3 A;  3CHM A;  1SZA A;  1W3B A;  3DBS A;  4I43 A;  2DZO A;  2WPV A;  3URZ A;  3FUF A;  2ZU6 B;  3L54 A;  2PZI A;  3QWV A;  3ZHE A;  4L2L A;  5FZS A;  3FUH A;  2VTB B;  4GTS A;  3RKV A;  4HI9 A;  1U2V G;  4TXR A;  1LTX A;  2AXV A;  5BXU A;  2GRO B;  4PUC A;  3UM1 A;  4CGW A;  4IYP A;  3OXF A;  4EZK A;  4BES A;  5CED B;  3UM0 A;  3ZGQ A;  1NZN A;  1WDY A;  2DZN A;  3ZXP A;  2EIJ E;  3MCX A;  5A7D B;  3P2B A;  1H19 A;  3OTN A;  2IO2 C;  3EJN A;  5JJ6 A;  2Y0B G;  3G2T A;  3S2A A;  1K3Z D;  2XS1 A;  1ELR A;  4CT0 A;  3UT8 A;  3U9W A;  2DBA A;  1OWP A;  4Q69 A;  1XGW A;  4OAV B;  5AQ7 A;  5EKQ D;  2P9S G;  1JWF A;  4CRW A;  4DRX E;  4ANU A;  3UI2 A;  3CK8 A;  3AJI A;  4URK A;  1SZ9 A;  3BUA A;  5G05 C;  1PY1 A;  1PAQ A;  3FH7 A;  2P58 C;  2ETB A;  4XX5 A;  1JCR A;  4K5C A;  5AYW D;  1YYH A;  2AVP A;  4Y6C A;  2FO1 E;  1UW4 B;  3FTX A;  2VGX A;  2J4D A;  3FU6 A;  4BT8 A;  3Q9U C;  5T4Y A;  2I2O A;  2WXK A;  3JUE A;  3SGH A;  4G24 A;  3AS4 A;  4CDN A;  4FUL A;  4FP7 A;  5AJL A;  4JD2 G;  3O48 A;  1OWN A;  4GZ6 A;  4LRZ A;  3ZU7 B;  3AG2 E;  5ARG A;  4AY5 A;  1O1S A;  3B7R L;  4O60 A;  2LUH A;  2OVF A;  4PS3 A;  2R59 A;  4RLY A;  3N71 A;  3ZUV B;  2Y69 E;  3FDH A;  2Y1L E;  3QDN A;  3GYZ A;  1Y8M A;  2EIK E;  3DRA A;  2A4Z A;  3TWS A;  3IEG A;  3FWV A;  5CRV A;  4LUN U;  3P1U A;  2WQH A;  2X6F A;  1HF8 A;  4ATZ D;  3ZYL A;  3G2V A;  4HQD A;  2R2L A;  5BW8 C;  4JHJ A;  3UIO C;  4B8C B;  4ABN A;  4N3B A;  4TUM A;  3ASG A;  3JQ1 A;  4DUI A;  4A3V A;  3ZEF A;  3TAX A;  1TNU A;  4UWK A;  3NB2 A;  5FIO A;  5JMN D;  5BT1 A;  4U0S A;  4AXH A;  5JJ7 A;  1U3C A;  4HFG A;  4NQ0 A;  3FTU A;  4KVM A;  3UM2 A;  3ZYK A;  1OUV A;  2KCL A;  4UUC A;  4AEZ C;  1MX4 A;  3HVE A;  1SVX A;  1HFA A;  2J49 A;  3PUJ A;  3UPV A;  3U3W A;  3E33 A;  3ASO E;  3EHN A;  2EQX A;  3AS5 A;  3APF A;  3UIN C;  2XZT G;  3HXF A;  3TWR A;  2AWI A;  2ZGG A;  4A63 B;  2WXH A;  2YHC A;  3FTZ A;  3UIP C;  3IHV A;  2E2E A;  5G05 J;  4DJA A;  3Q49 B;  2XS8 A;  3CHP A;  1N4Q A;  2WXP A;  5G04 C;  5EN5 D;  3ZXS A;  1FT2 A;  2J8S D;  4AY6 A;  3QJZ A;  5D2M C;  4YVQ C;  4LCT A;  4J8S A;  2X6K A;  4C0E A;  4LG6 A;  2XGS A;  2UY1 B;  1E7U A;  5KWD A;  3S7F A;  4G11 A;  2XCB A;  5KJL A;  3TWQ A;  4N39 A;  5BPP A;  5CEC B;  4L9P A;  4IUL A;  1X81 A;  1HE8 A;  2P2C P;  2YIN A;  3PNT B;  3SBS A;  1LD7 A;  3UQ3 A;  5JHA A;  3ASH A;  3ABM E;  3CK9 A;  1BLX B;  1EYH A;  3QAQ A;  2EIM E;  3ULY A;  2IOS A;  4MRU A;  4CDR A;  2HYZ A;  4WUY A;  3LY9 A;  4G8K A;  5LCW J;  2OOE A;  4ILG A;  4DX5 D;  5HS0 A;  4W9R A;  5AN8 A;  5B1B E;  4FJZ A;  5ENO D;  2IY0 C;  2J9Q A;  4BTB A;  1N4R A;  3L82 A;  3JQ0 A;  2IEJ A;  3V31 A;  2BKK B;  3FUE A;  4CZ2 D;  3SBT B;  5H7P A;  3IV0 A;  1SA4 A;  3FU3 A;  4V3I A;  2R03 A;  3CVL A;  1D8E A;  4K5B A;  3I3N A;  3TWV A;  3Q79 A;  2LAH A;  4I2Z A;  2WM9 A;  4GA0 A;  5AQA A;  1QBQ A;  2PL2 A;  3DPY A;  3D9I A;  2C2L A;  3PEV B;  3G2S A;  1UN9 A;  4I6J A;  3DXM G;  4Y6W A;  3FUD A;  2Q7F A;  5J90 A;  4JZY A;  4I17 A;  4JVS A;  2P9U G;  4BTA A;  4DX2 A;  3U66 A;  3ULQ A;  3CQC B;  3FUN A;  3C72 A;  2ION A;  4MLP A;  2V8S E;  3SQV A;  2FF4 A;  4BX9 A;  1DNP A;  1E8Z A;  2X3M A;  3CHO A;  2WMN A;  4H7X A;  4EHM A;  3LEW A;  1TNY A;  2A5U A;  3FTS A;  1H6O A;  3KSQ A;  3D9J A;  2XHE A;  3PE4 A;  4DLO A;  5BV0 A;  2WXJ A;  1DCE A;  3RSE G;  4FLB A;  4ILI A;  3KEA A;  4BEP A;  5HKP A;  3UX4 A;  4BY6 A;  5E75 A;  3FHE A;  2WVI A;  2VQ2 A;  3W9F A;  2CHZ A;  4LNU D;  4J8F A;  3FU0 A;  4UQX A;  2I9C A;  1AP7 A;  4C48 B;  2WXO A;  2PQR A;  3F6Q A;  2F8Y A;  3PEU B;  3ZFW A;  3Q47 B;  2NYJ A;  2B0O E;  4X8Q A;  4HLE A;  4WWO A;  4TUU A;  4BX8 A;  3HIZ A;  4U63 A;  2LXM A;  3MX3 A;  2VSY A;  4UWF A;  2CFU A;  1H6P A;  4UWG A;  3ZW3 A;  3CV0 A;  3UMV A;  4N3A A;  2DIW A;  1S64 A;  3ABK E;  1EPU A;  1V54 E;  1NL4 A;  1N54 A;  2BTD A;  4BET A;  4CDM A;  3DSV A;  3AG4 E;  4GCO A;  3ZPJ A;  5AJD A;  4PS7 A;  3DEP A;  2RFA A;  1OWM A;  3CLJ A;  4AV7 A;  1IYG A;  2ZXW E;  4B0Z A;  5KJK A;  4XEI G;  2M63 A;  2Y3A A;  3E32 A;  4RG9 A;  4Z68 A;  2R17 C;  4J6I A;  5FZQ A;  4APF A;  2RFM A;  3DSS A;  3NQP A;  3SD5 A;  2F37 A;  3UT4 A;  3HDX A;  2EIL E;  2XCC A;  4DX7 D;  5CBN A;  2F0Y A;  5ANR A;  1H2U A;  4LNG A;  3L22 A;  5KCM A;  1OY3 D;  2PNN A;  3EUV A;  3FU5 A;  1PC2 A;  3PRE A;  4R7L A;  2XPY A;  3KEZ A;  4GTT A;  1RW2 A;  3EHR A;  4HOU A;  3FH5 A;  2I1J A;  1G3N B;  2LXL A;  3RIB A;  3Q73 A;  2OVB A;  1OCO E;  4JPS A;  3CQG B;  4DPR A;  3KSL A;  2H6I A;  2V5Q C;  1HXI A;  3NZS A;  3ISM C;  2BF0 X;  4GTM A;  1FPP A;  4ACK A;  3DPD A;  1HS6 A;  2V5F A;  3ULE G;  3PZ4 A;  4U07 A;  2C0L A;  1NI1 A;  4BT9 A;  4HB5 A;  3AG1 E;  2JLB A;  3LXU X;  3Q4A B;  3QB2 A;  1OCR E;  2DWZ A;  1N95 A;  4MKT A;  3Q5M A;  2R5S A;  4C0M A;  3RU0 A;  3VTX A;  5CCL A;  3J5Q B;  3APC A;  2AJA A;  3B7B A;  3ZHE B;  3LS8 A;  4FU3 A;  3UKR G;  1IHB A;  2JAB A;  2RD0 A;  4A1G A;  2WMO A;  3D9K A;  4GZ3 A;  5FJY A;  1BD8 A;  2WB2 A;  2KBX A;  3EIJ A;  5LFA A;  5EX0 A;  4DI4 A;  1S70 B;  2KCV A;  1O1T A;  4GZ5 A;  4GTR A;  1QNF A;  4YDE A;  4UI9 J;  4YDW A;  3AAA C;  5ITZ F;  1L5J A;  1DCQ A;  1N94 A;  3R9M A;  4B8A A;  4QFV A;  1ZU2 A;  3NOC D;  3BEE A;  3DSU A;  3FUK A;  2IJG X;  3LY8 A;  5ENS D;  4RSY A;  4MBG A;  3BG0 B;  4N2Q A;  5M72 A;  1YCS B;  4AJW A;  5G55 A;  3TGO A;  3ASN E;  4UQZ A;  2XEV A;  4JHK A;  5JJT A;  3J5P A;  4J8E A;  1N4P A;  3HYM B;  1Y6I A;  5BV1 A;  4XI0 A;  1N52 A;  3L16 A;  3D9P A;  5AIJ A;  2IFU A;  3FTY A;  1OT8 A;  3L13 A;  4JB8 P;  3GZ2 A;  4GA2 A;  4UWH A;  2CHX A;  2BUG A;  3E37 A;  3PNL B;  5C2Y A;  3C5R A;  2ZIR A;  3ZN3 A;  2GRP B;  3MYV A;  1A5E A;  2GRQ B;  1OCZ E;  4B94 A;  1SQM A;  3C3R A;  2BED A;  2P9I G;  4AP2 A;  4TRQ A;  3QK0 A;  4NAC A;  2WXL A;  3CVV A;  2HE0 A;  2KZT A;  1JPL A;  4GU5 A;  4WNE A;  2KZT B;  2AW6 A;  4U0U A;  3U4T A;  4LER A;  3EU9 A;  2P9N G;  3SHF A;  1HH8 A;  3TG4 A;  1MJ0 A;  1A17 A;  2OND A;  1FCH A;  4FHJ A;  3OXL A;  3L6A A;  2WXG A;  1TN7 A;  4MS6 A;  2WQ7 A;  2C0M A;  4XKB A;  3QWP A;  4KXK B;  3LPZ A;  2IOL A;  4ZHB A;  3ASF A;  3HG0 D;  4HNA D;  5LX8 A;  4XE0 A;  3NF1 A;  4JEU A;  3MA5 A;  3MGB A;  1UN8 A;  3WG7 E;  5BXO A;  4KYO B;  1H2V C;  1HO8 A;  4ANV A;  4UI9 C;  1HG5 A;  3E30 A;  4EQF A;  1KPS B;  5CEA A;  3FEX A;  3BG1 B;  4OVU A;  3ZYM A;  1N0R A;  2LNI A;  4I2W A;  3Q9N C;  4GAA A;  3LY7 A;  3DST A;  3C3O A;  5CCM A;  3CST A;  1KT1 A;  4DK5 A;  1S0P A;  1UJJ A;  2VGY A;  3LVR E;  5J08 A;  5EID A;  4AIF A;  2L0T B;  3C98 A;  3PH0 C;  4Q96 A;  2AXZ A;  4HBD A;  3ZVV A;  3CIA A;  2BKG A;  2X6I A;  5BNW A;  5ENP D;  3ML9 A;  1YA0 A;  1HX8 A;  4JA7 A;  4C9B B;  3ZYQ A;  4IN3 B;  4BER A;  4O1P A;  3VLE A;  1Z3Y A;  4NRH B;  4PH4 B;  1DVP A;  4U0Z A;  5FQ6 A;  2DVW A;  3GW4 A;  2GRM A;  1KZP A;  3AU5 A;  1E7V A;  4ACL A;  1K1A A;  2MYO A;  4CYM D;  2CG2 A;  3RAU A;  3ZIM A;  1SW6 A;  3RRU A;  3D9N A;  3PRZ A;  4JC8 A;  3TWT A;  2ZGD A;  3DEO A;  3HXD A;  1B89 A;  2L6J A;  3B7T A;  5ARF A;  4JEH A;  3HXB A;  3T5X A;  1OXJ A;  3CEQ A;  2PM7 A;  3CVU A;  2V4L A;  3C3Q A;  1SA5 A;  1TNZ A;  3CHR A;  3T8K A;  3CVX A;  3JUI A;  3CVW A;  5CMW A;  4M3O A;  3UM3 A;  3CVQ A;  4WWN A;  2QC9 A;  4K0R A;  4NIK A;  3T8M A;  4N5C A;  2QYU A;  4K5A B;  2J4B A;  1TN6 A;  2VSN A;  4OYS A;  2KAT A;  2WXM A;  5CER B;  5A23 A;  4H7Y A;  4J8D A;  3JXJ A;  3I4R B;  1NP7 A;  1HZ4 A;  4J7W A;  3OAW A;  4GML A;  4FHK A;  4A55 A;  3V30 A;  5KNG A;  4QQI A;  2J09 A;  4WWP A;  3Q7A A;  1UOH A;  1K8K G;  4HOT A;  2QFC A;  4A3T A;  3ESL A;  3S7J A;  1D9S A;  3CGH A;  3FEY A;  4YDY A;  4YND A;  2X6J A;  3SNX A;  4U7E B;  1O1R A;  4GCN A;  3ASD A;  2HR2 A;  3IBE A;  4B93 B;  4AVX A;  3TJP A;  1Q2Z A;  2F8X K;  3UT7 A;  2QY7 A;  3BU8 A;  5ENN A;  2P9P G;  3V79 K;  2RKK A;  3SY2 A;  4GA1 A;  1RZ4 A;  1IKN D;  4ANW A;  3E4B A;  2XEE A;  2IF4 A;  1Z5S C;  3Q75 A;  4DI3 A;  4WNG A;  4FAD A;  4HOQ A;  1EDU A;  2HO1 A;  3B13 A;  5DIZ A;  3SI5 A;  2WQ6 A;  3CVP A;  1FVH A;  2XRZ A;  1N4S A;  1H0A A;  1UJK A;  4RG6 A;  5AAO A;  2OV8 A;  5FQ4 A;  4G2V A;  2KXP C;  2I1K A;  1E8Y A;  4L2Y A;  2YHE A;  4I6G A;  3NBN B;  2UWJ G;  1ELW A;  5ENT D;  2PM6 A;  1WAO 1;  3RK6 A;  2MOW A;  4G23 A;  5JA4 D;  3TXN A;  1MHQ A;  3TXM A;  4I1O B;  2JEK A;  4CCA A;  4ANX A;  1E8X A;  4GTQ A;  2FI7 A;  4XZ4 A;  2XPZ A;  3ESK A;  1NA0 A;  3UXG A;  3LDZ A;  5D66 A;  4HXI A;  5C1D A;  4I6E A;  4APO A;  5FQ8 A;  3QNK A;  5BUZ A;  4XIF A;  5FZR A;  3TWU A;  1XNF A;  4I1M A;  1WY6 A;  5CBO A;  2GRR B;  3SFY A;  3R7R A;  4L23 A;  4UQY A;  3FH8 A;  1MX6 A;  2QZA A;  2OEV A;  2IQC A;  3PE3 A;  3UTM A;  1KLX A;  2NSZ A;  3PZ2 A;  4L7T A;  5FTP A;  1VDY A;  2HM8 A;  3MV3 B;  2ETA A;  5G04 J;  3G2W A;  4LEU A;  4U8Y D;  4HI8 A;  3E34 A;  3D9O A;  3L08 A;  5B1A E;  4TXP A;  1N11 A;  1O5M A;  2P9K G;  5KBA A;  3D9M A;  4GPK A;  2FUL A;  1LF8 A;  1DC2 A;  2ETC A;  2ZIS A;  3PVL A;  4KT6 B;  2VTB A;  3EIQ C;  1BU9 A;  3AS8 A;  3U64 A;  4L1B A;  2AXU A;  3GZ1 A;  2XGM A;  4N3C A;  1INZ A;  4I9E A;  3LJN A;  4HS2 A;  5LP0 A;  2DCP A;  3AG3 E;  3QWW A;  2VSO E;  4G8L A;  3CSF A;  3CKC A;  1QQE A;  2NC9 A;  3ENE A;  5T8I A;  4P29 A;  3MKQ A;  3B95 A;  2NXP A;  1BI8 B;  5ANL A;  2I6H A;  3MJW A;  4U8H A;  3FTW A;  3TWX A;  3V2X A;  5A6C A;  4JL0 A;  1OCC E;  3FUI A;  1HG2 A;  3DWL G;  4GTO A;  2XRY A;  3ZRH A;  2RG8 A;  5T3R A;  3LYA A;  4WNF A;  1D8D A;  2MHK A;  2CHW A;  2KM4 A;  4GZD A;  3W9G A;  4IRU A;  3UUX A;  4J0U A;  3I5P A;  2VGE A;  3B7U X;  2LO6 A;  2VGX B;  3KAE A;  3TL5 A;  3CVY A;  3FP3 A;  3MKR A;  3QKY A;  3KS2 A;  1ZBP A;  4PS8 A;  4EZL A;  1KT0 A;  3FFL A;  3FUJ A;  1BPO A;  1JUQ A;  4FC8 A;  3CR3 A;  2WXN A;  1BI7 B;  2GRL A;  5KNH D;  5HQ8 A;  3NOG D;  3EU5 A;  3O4Z A;  5HI7 A;  3LKU A;  4J8Y A;  3PS6 A;  1H2T C;  3T9K A;  1TNB A;  2P9L G;  5FQ7 A;  4FJY A;  3JCK C;  3I4G A;  2V0P A;  4U8V D;  2VSX E;  2LSV A;  4JA9 A;  1OWO A;  3CHS A;  2L6B A;  1IHG A;  2QYJ A;  4KZC A;  4F6R D;  2Y4U A;  3EHM A;  3QAR A;  3D3M A;  1E96 B;  2UY1 A;  1N0Q A;  3RO2 A;  4BFR A;  3CK7 A;  4E6H A;  4KVO A;  2H6F A;  3RJV A;  4EBA A;  4XKC A;  3V2O A;  4NUR A;  1MX2 A;  5FT9 A;  3CVN A;  3ML8 A;  3QC1 A;  1EF1 C;  4PDX A;  4HLL A;  4U95 D;  4DLQ A;  1E90 A;  5DBK A;  5AAR A;  4FLH A;  1KZO A;  4GZC A;  4JHR A;  4U04 A;  3MEK A;  4GMJ A;  4EEC A;  3T5V A;  2XZD G;  2A5E A;  2KCK A;  2FBN A;  4CGV A;  5EIL A;  2J08 A;  5HRY A; 
#chains in the Genus database with same CATH homology
 2DYR E;  3ASN E;  2ZXW E;  5B1A E;  2OCC E;  3ASO E;  1V55 E;  3AG1 E;  2EIJ E;  3X2Q E;  1OCO E;  2Y69 E;  3ABK E;  1V54 E;  3ABM E;  2EIK E;  1OCR E;  5B3S E;  3AG2 E;  2EIN E;  1OCC E;  3AG3 E;  5B1B E;  1OCZ E;  3AG4 E;  2DYS E;  2EIM E;  5IY5 E;  3ABL E;  2EIL E;  3WG7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...