1OCZE

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1oczE00
3X2QE 3AG4E 3ABKE 2EILE 3ASNE 3AG2E 2DYSE 1OCOE 1V54E 2EINE 2ZXWE 2OCCE 3WG7E 1V55E 5B3SE 3ABME 2EIKE 3AG3E 1OCCE 3AG1E 5B1BE 2Y69E 3ABLE 1OCZE 5B1AE 1OCRE 3ASOE 5IY5E 2EIJE 2EIME 2DYRE
chains in the Genus database with same CATH superfamily
2UWJG 3TWXA 4CDNA 3NOGD 2FO7A 3FH5A 5KJLA 4N3AA 2AWIA 3TXNA 4ANXA 4DI3A 4ABNA 4GYYA 4U0UA 1WY6A 4UQXA 2AXZA 3CVQA 4O1OA 5LOZA 2V4HC 4GMLA 4WNDA 5C2YA 4M3OA 3G2SA 3CHRA 2VSYA 3UM3A 3PE3A 4J8FA 3HYMB 3UX4A 1LF8A 4GU5A 4AJWA 3ZFWA 2VGYA 1WAO1 2V0PA 2WMNA 1AP7A 4I1MA 2ZU6B 4IYPA 4OYSA 3UT7A 4EZKA 1V54E 1UJKA 1V55E 5AQ7A 3IHYA 3TWVA 1PY1A 5G2NA 2R2LA 4JXTA 3CVUA 3QNKA 5FWQA 4BX8A 3QWWA 1IKND 5ENOD 3IXEA 4RG6A 4ATGA 5EX0A 5BW8C 1NA3A 3AG3E 2PL2A 3EJNA 1YMPA 4YDYA 5ENQD 4E6HA 3L08A 2FF4A 3FTYA 2VTBA 3ZN3A 2LSVA 2R05A 4EHMA 1QNFA 3VTXA 4H7XA 3UTMA 4Y6WA 3ZXPA 4FJYA 3PH0C 2WXHA 5AYWD 1U3DA 3NZSA 2QZAA 5AENA 3WXXA 4GZ3A 2YNQA 3DWLG 3ML9A 3TWWA 4BERA 3UI2A 1UN9A 3QAQA 5D0OD 5CHEE 3UM2A 1K3ZD 4BETA 1BPOA 3CVPA 2Y0BG 4O1PA 3FUEA 3CHQA 4UWHA 4ACLA 1DVPA 3KEAA 2OVBA 2XEVA 3D3MA 3RO3A 2AVPA 3AS5A 1D9SA 3NF1A 4BSXA 2KM4A 2MYOA 2XPZA 3QWVA 3EHQA 1IXVA 5AAOA 3FTVA 2WXMA 3VLFA 3W9GA 1SZAA 5FINA 3LDZA 2LXLA 2J9QA 3E33A 1HG5A 3S7FA 3MA5A 3RJVA 1N4PA 2RFMA 3B7TA 5FQ4A 3ZYKA 4UWLA 4XEIG 3EU5A 4JPSA 4U8HA 4AVXA 1XGWA 1HE8A 2EIKE 3Q7AA 3VTYA 4XKBA 1H6KA 4GTRA 2LAIA 4C9BB 3L17A 3PNLB 5JJ7A 4I43A 5JHAA 1RW2A 2XS8A 2DZNA 3RKVA 3R7RA 4UUCA 5BPPA 1WG0A 3U9WA 2IO3C 3EU9A 5ITZF 3D9MA 4ANUA 3O48A 3ASHA 3SGHA 4I6GA 4FADA 5LCWJ 4JD2G 1H2VC 4AM9A 2XRZA 5FIOA 1EF1C 2WVIA 4IULA 3T5XA 3VLEA 2L9BA 1KT0A 3C3RA 3ZRHA 2VGXB 3CVWA 3APFA 3BU8A 3EHMA 1FT2A 3CLJA 4RSYA 5ARGA 1PAQA 5KJNA 4EQFA 4LNGA 5LP0A 3UXGA 3FUIA 4FP7A 3BUAA 1QZ2A 2HYZA 2WXLA 3MYVA 2WB2A 1N95A 4GA2A 4U8VD 3IKOB 2KCLA 5CEAA 1U2VG 2I2OA 2BUGA 5H7PA 3WG7E 1NA0A 3F6QA 3LY9A 2V8SE 4GPKA 4HS2A 2KZTB 4NQ0A 3C3QA 4I1OB 3LXUX 5AQ9A 2IOLA 2H6IA 2ETCA 4XKCA 3CSFA 1HH8A 3ZU7B 1HXIA 3LVQE 1FCHA 2PQNA 2QC9A 2WPVA 4LNUD 4O6FA 3ZEFA 4G24A 3ASDA 1MHQA 5CERB 2AXUA 5AQBA 2P2CP 5ARFA 2LNIA 3HG0D 4GZCA 2MHKA 5ENRD 2IEJA 4GPMA 1HG2A 2CHWA 3ULEG 3CQCB 3ONKA 5EYLA 2RKKA 4W9RA 1IQUA 3PS6A 3SFYA 2I9CA 4DLQA 1E8WA 1E8ZA 3TWUA 1ZB1A 1OWLA 3KSQA 5E76A 2DBAA 4KBQA 3MCXA 5JA4D 4HFGA 3VLDA 1E90A 3FEYA 4I9EA 2LSUA 4GTVA 2KATA 2I6HA 5KCMA 3ZYQA 1QQEA 3L9TA 3AS8A 4BT8A 4YVOA 2YINA 2VYIA 3MJWA 3SBTB 2AJAA 1TNOA 3RIBA 4KZ0A 4A3TA 4Y6CA 2I1KA 3U64A 4G23A 1FPPA 5HS0A 4F1SA 3FTZA 1D8DA 2WXPA 3W9FA 4I17A 1TNBA 4BSZB 3CK7A 3ESLA 4NACA 4AEZC 3KEZA 2YHCA 4JHRA 3MEKA 3SY2A 4UI9C 3UT8A 4MLPA 2VSOE 3PUKA 1G3NB 3D9KA 1TYQG 1S0PA 1JWFA 5IY5E 3AJIA 1QYMA 4GMJA 1PC2A 3UT4A 3MV2B 4F7AA 2CHZA 4B93B 3DSXA 3FWVA 2XS1A 2PZIA 4JEHA 4ME2A 3UKRG 2QYJA 4C48B 3PVLA 1OCCE 2ETBA 3FUDA 4NIKA 4DK5A 4KVMA 3BG1B 2LXMA 3FH8A 3S7BA 2KBXA 2VGXA 4HQDA 4B89A 3E34A 2I1JA 4FLHA 1N4SA 4JHJA 4HORA 5BV0A 2P9IG 4DX7D 3ZPJA 2C2LA 4GCNA 4UWKA 3EUVA 1N52A 2WXFA 4J8SA 4JEUA 2X3MA 3X2QE 4DLOA 4B94A 4B8CB 3APCA 4IN3B 3FTUA 4WWOA 3D9LA 2NYJA 2KZTA 3DEPA 5BXOA 3SBSA 1OWPA 4XIFA 1ELRA 2GRRB 2F8XK 4DX1A 3JCKC 3B7BA 1JWGA 3RK6A 4I6JA 4LG6A 2ZISA 3QC1A 1NI1A 1TN8A 4KMOA 3FY4A 4KVOA 3CV0A 1FVHA 4CGVA 2J09A 2GRPB 3GZ1A 2NSZA 3ULQA 1HF8A 3NZUA 2EINE 1HFAA 5D2MC 1EPUA 2BKKB 4HLEA 4C0EA 4FULA 1OXJA 4GTQA 1A5EA 2IU1A 2YHEA 3V31A 4ACKA 3CK9A 3Q4AB 5M72A 2EILE 4UQZA 3AG2E 4L1BA 3CGHA 3IEGA 3BG0B 3QKYA 3CK8A 2DIWA 4G1TA 1N4RA 3OAWA 4UQYA 3I5PA 1B89A 2WXNA 3ISMC 2R02A 3LCAA 4DX2A 3IV0A 3CVYA 4K5AB 1Q2ZA 5EN5D 1MZCA 3ASOE 4OVUA 2R5SA 2ZIRA 3FULA 4HI8A 5KJMA 1TNZA 4DRXE 4HB5A 1SQMA 2VSXE 4QFVA 1BLXB 3E37A 2KC7A 3PEUB 3RRMB 3T5VA 4CZ2D 2XZDG 4DPRA 4GTOA 5BXUA 4CDMA 3B13A 3AS4A 2FBNA 2AW6A 4N3CA 3K9IA 1WM5A 3PREA 2V5FA 1OCZE 1ELKA 3SHFA 2R03A 4X8QA 3L13A 5EDSA 3Q15A 3MX3A 2L6JA 3TWRA 4LRZA 5T8IA 4N39A 5ENPD 1H19A 4WNEA 5EKQD 2R59A 3G2WA 4HOTA 3ZKJA 5AJLA 4F53A 3P1UA 2WXGA 1OCRE 4TXPA 2L6BA 2CFZA 4DI4A 4ILHB 3DEOA 3PEVB 2Y1LE 4EPZA 1N4QA 5AJDA 4I2ZA 2DYSE 2A5EA 2XEEA 4HOUA 5A6CA 2A4ZA 2IJGX 1NP7A 3UPVA 2J8SD 3TXMA 3NB2A 1DCQA 4K5CA 4R7LA 4BEPA 3E30A 3V2XA 3PZ4A 2X6IA 3CVVA 3DSTA 3QWPA 4Z68A 3FUMA 4L2YA 5CECB 4HXIA 3DXKG 3CHOA 5D0QD 3AAAC 3C5RA 2IO2C 1NL4A 3RRUA 2P9PG 4MBGA 4GAAA 3UQ3A 3L82A 2DZOA 2VGEA 3KSLA 2P9LG 2XZTG 4TXRA 3V30A 4EECA 2XEHA 1MX6A 4LSZE 3MGBA 4B8AA 3CR3A 4I9CA 5D66A 3RAUA 1TNUA 3EHRA 1YYHA 5EIDA 4UI9K 1JCQA 4G25A 4QQIA 1HU3A 3ZXSA 4DX5D 3CSTA 2CHXA 2GGFA 5DIZA 5FJYA 5A7DB 3SNXA 4XE0A 1Z3XA 4ILIA 4TRQA 1GW6A 5T4YA 3HDXA 5ENSD 3T8KA 3TWTA 4M7CA 4J6IA 2P9SG 2DVWA 3RSEG 2ZGDA 3IBEA 2WQ7A 5JMND 3ABME 4KXKB 4JL0A 4HOSA 3ZYLA 3EIQC 4CEMA 1IYGA 3JUIA 2LUHA 5HRYA 5HQ8A 5J08A 4PH4B 3N71A 3FTSA 1UW4B 4G26A 2FULA 3MV3B 3SFXA 5ENNA 5KNHD 4URKA 1S70B 1L5JA 5FZRA 1Z6TA 2X6KA 4GTPA 3SZ7A 3D9HA 1MX4A 4BY6A 5G04J 3LS8A 1JCSA 2CG2A 3FTXA 3LJNA 3CVXA 4I2WA 4G8KA 4WWNA 2H6GA 4N5CA 3NBNB 3CKBA 3ONLA 2WXKA 1ELWA 3CHPA 2HM8A 3LEWA 5JJTA 4AXHA 3AU5A 4FA6A 2XPYA 2XCCA 4RG9A 3FUFA 1TEZA 1K1BA 3OXLA 3CKCA 4HRLA 3C72A 4GZ5A 3S7JA 2B6CA 3URZA 2J08A 3HXDA 2AXVA 3IHVA 4GZ6A 2NXPA 3OXGA 3FHEA 1E96B 1A17A 1O1RA 4NURA 2FEZA 4LCTA 3PZDA 3APDA 3D9OA 4GYOA 2CG3A 3AG4E 2XENA 1UN8A 4XI0A 2B0OE 3TL5A 1UG3A 3GZSA 3BEEA 4JA7A 2PQRA 3DPDA 2RFAA 3JQ0A 2L0IA 2M63A 5KWDA 3LVRE 5KNGA 4RVBA 4UWGA 4LUNU 3HXEA 1IQRA 3DBSA 4FHJA 4YDOA 4E85A 5CMWA 4MKTA 1MX2A 3Q79A 2NC9A 4GB9A 4GTTA 3EHNA 1H0AA 3ABLE 3LY7A 4NRHB 4APOA 2ETAA 3FFLA 2C0LA 4JVSA 4EBAA 5LFAA 3KD7A 4GTMA 2DWZA 3QJZA 2J4DA 3UUXA 5CRVA 1YCSB 1FT1A 4U04A 4G11A 1UOHA 2L0TB 3V2OA 4ZHBA 3ENEA 3UIPC 4AOFA 3E32A 2QYUA 1TJFA 2GRLA 4ANWA 3HRAA 4V3IA 5AQAA 4A1SA 3CVLA 4TUMA 5CBOA 5FQ7A 4I1AA 1VDYA 4PUCA 3QB2A 5LCWC 3OTNA 4K5BA 4K0RA 2MRIA 2WXJA 3PZ3A 2V4LA 3GYZA 1TNYA 3PZ1A 3D9JA 5G05J 3SFZA 3I4RB 3U3WA 4XI9A 1LD7A 3TGOA 2QY7A 3RO2A 1IHBA 3TG5A 3QARA 5LX8A 3CIAA 1IHGA 3TG4A 2X38A 5AN8A 1NFIE 4Q94A 3JXIA 4EZJA 3FU6A 4A55A 2JABA 2JLBA 2Y4TA 3ZW3A 2XGMA 4UWFA 3J5QB 4GTSA 3TJPA 4HRMB 4N2QA 2ONDA 5FT9A 3J5PA 5FZSA 1X5BA 4JHKA 3LY8A 5EX3A 3ZYMA 3NQPA 5CMYA 4BTBA 1TN7A 3R7QA 1H6OA 3T8MA 3JQ1A 4K03A 5EIBE 1BI7B 3QOUA 4A63B 2KCKA 3I4GA 1TN6A 2VSNA 3HXFA 4C0MA 2E2EA 4JC8A 4YNDA 3O4ZA 3Q75A 4XZ4A 2HO1A 4A3VA 4F1PA 5JHBA 3CVNA 3ZNGA 4F3VA 2P9KG 1ZBPA 1JCRA 3SQVA 4AY6A 2Y4UA 3Q9UC 5BUZA 2OCCE 2KXPC 4WWPA 3FUKA 4RLYA 3U4TA 1DNPA 3TAXA 4BWRA 1O1SA 1Z3YA 2EIME 1Z5SC 2JEKA 3FUJA 4CYMD 5DBKA 1OWNA 4AIFA 3ABKE 4ANVA 3TWSA 2RD0A 3PDNA 3Q7FA 3FUHA 2GRNB 4N2SA 2WXRA 4J8DA 3Q73A 3ZIMA 1MQSA 3B7RL 2OEWA 3UM0A 2MOWA 3BQOA 1K8KG 3FP3A 3R9AB 3PUJA 5E75A 4N5QA 5ANLA 2QFCA 3V79K 3S7DA 4ATZD 3HVEB 3E4BA 4J0UA 4WAFA 3PNTB 4JW1A 2X6HA 4EZLA 3T9KA 2H6HA 3FTWA 4D10C 2PM7A 1DC2A 2IONA 4BESA 3AU4A 3NOCD 4L7TA 2FI7A 3MZLB 3U66A 2EQXA 5B3SE 2HE0A 4YVQC 3ZUVB 1BD8A 3ASGA 3ZGQA 2LO6A 3DXMG 1JPLA 5CRUA 4MRUA 4GA0A 4BFRA 3UKUG 1SW6A 2P9UG 3DSUA 4Q96A 4HI9A 4PS8A 3TWQA 4AY5A 1S63A 2J4BA 4PDXA 3AG1E 1RZ4A 5G05C 5FTPA 4JA9A 3UM1A 3SD5A 4LNBA 2EIJE 4MS6A 4UI9J 4FC8A 2Y3AA 4CRWA 4FHKA 4GZDA 2OOEA 1Y6IA 2ZXWE 1H6PA 3ML8A 5C1DA 2PNNA 4L2LA 2KCVA 2Q7FA 3FU5A 1MYOA 3ESKA 3FH7A 4GCOA 2C0MA 4IRUA 2VJ8A 4HLLA 2A5UA 2PM6A 1EDUA 2X6JA 4L23A 1QBQA 4LEUA 5BNWA 2H6FA 1KZOA 2UY1B 4N3BA 3G2UA 3FUNA 4EBAG 4CT4A 4KZCA 3QK0A 3FU3A 3SO8A 5AARA 3ZHEB 3CHSA 1SA5A 2ILRA 4HRNA 3Q49B 4DX6D 4FJZA 2WXIA 1S64A 4YDEA 1LTXA 1Y8MA 2F0YA 3DSWA 4U7EB 3SI5A 4KT6B 5JJ6A 2IFUA 1OCOE 3G2VA 3MKQB 3LYAA 2IQCA 1BI8B 3B95A 4BT9A 4JB8P 2GW1A 3GW4A 5G55A 4WUYA 4GMRA 1HX8A 3MKRA 4O60A 1X81A 2FO1E 4FU3A 2IY0C 3KS2A 4APFA 2XGOA 4U07A 1TJCA 3FEXA 3B7SA 3ZVVA 3ASFA 2ZGGA 3HVEA 1AWCB 2GROB 3ULYA 2HR2A 1OY3D 4PS3A 3HIZA 1BU9A 4U96D 1H2UA 4H7YA 4OAVB 3CHMA 2LAHA 1SA4A 3PRZA 1E7UA 5BT1A 3L6AA 5EILA 2OV8A 3R9MA 1U3CA 5A23A 1ZU2A 4G2VA 4HNAD 3DRAA 3FU0A 2Y69E 3QDNA 1FVFA 1JUQA 3HHMA 4U63A 4CGWA 5CEDB 1OWMA 4AV7A 4J7WA 3C98A 3NAWA 4WNGA 4P29A 4J8EA 1UJJA 5CBNA 1HZ4A 3L54A 2WXQA 4AP2A 1O1TA 2V5QC 2WXOA 4A1GA 4GA1A 1DCEA 4U8YD 1H2TC 4HBDA 1N0QA 2BTDA 1SZ9A 2OEVA 4U95D 3P2BA 2F8YA 4RQIA 4G8LA 1OWOA 3Q5MA 4I6EA 1NZNA 3B7UX 5J90A 1INZA 1E8YA 2WQHA 2GRQB 3Q47B 3EIJA 3JXJA 1KT1A 4CDRA 4CT0A 5FQ8A 1TR4A 3LKUA 2J49A 2IOSA 3GZ2A 4TXQA 1SVXA 3UMVA 1O5MA 3Q78A 2P9NG 4LERA 5FZQA 3UIOC 2DCPA 3ASNE 5CCLA 3LPZA 5FQ6A 2XCBA 3Q9NC 2YQ8A 3D9NA 3CQGB 3DSSA 2WM9A 4L9PA 4TUUA 4OVVA 3KAEA 3JUEA 1E8XA 4YDWA 1E7VA 3FDHA 2R17C 5B1AE 4U0ZA 2UY1A 2J07A 1N0RA 1YA0A 2VQ2A 3L16A 4KYOB 5EYPF 2VTBB 2X6FA 5HKPA 2CFUA 3D9PA 1N11A 4HOQA 3PE4A 3ZHEA 3RRNB 4WNFA 5ENTD 1KPSB 4ZFHA 4GYWA 3DSVA 4BTAA 1HS6A 2XRYA 1KLXA 1W3BA 2XHEA 4XX5A 3HXBA 4BX9A 3C3OA 1N54A 4CCAA 4Q69A 1EYHA 1HO8A 3LJ3A 3MKQA 5T3RA 3HXCA 3EDTB 2BKGA 1D8EA 1WDYA 4FLBA 3SF4A 4OAUC 3G2TA 1MJ0A 3CEQA 4TV3A 2BF0X 4DJAA 4JZYA 4DUIA 2OVFA 2RG8A 2BEDA 2GRMA 1N9AA 4J8YA 5KJKA 1OT8A 1OUVA 5BV1A 5ANRA 1XNFA 5KBAA 3DPYA 4PS7A 4U0SA 2XPIA 3S2AA 1LD8A 5AIJA 3RU0A 5B1BE 3OXFA 3D9IA 2P58C 3JYSA 1KZPA 2F37A 5HI7A 4ILGA 1P5QA 3UINC 2WMOA 3I3NA 2XGSA 2IF4A 1N94A 1K1AA 5G04C 2XQ0A 4F6RD 2WQ6A 3PZ2A 4HVBA 2E0IA 3L22A 5CCMA 2DYRE 4B0ZA
chains in the Genus database with same CATH topology
3X2QE 3AG4E 3ABKE 2EILE 3ASNE 3AG2E 2DYSE 1OCOE 1V54E 2EINE 2ZXWE 2OCCE 3WG7E 1V55E 5B3SE 3ABME 2EIKE 3AG3E 1OCCE 3AG1E 5B1BE 2Y69E 3ABLE 1OCZE 5B1AE 1OCRE 3ASOE 5IY5E 2EIJE 2EIME 2DYRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Q E;  3AG4 E;  3ABK E;  2EIL E;  3ASN E;  3AG2 E;  2DYS E;  1OCO E;  1V54 E;  2EIN E;  2ZXW E;  2OCC E;  3WG7 E;  1V55 E;  5B3S E;  3ABM E;  2EIK E;  3AG3 E;  1OCC E;  3AG1 E;  5B1B E;  2Y69 E;  3ABL E;  1OCZ E;  5B1A E;  1OCR E;  3ASO E;  5IY5 E;  2EIJ E;  2EIM E;  2DYR E; 
#chains in the Genus database with same CATH topology
 2UWJ G;  3TWX A;  4CDN A;  3NOG D;  2FO7 A;  3FH5 A;  5KJL A;  4N3A A;  2AWI A;  3TXN A;  4ANX A;  4DI3 A;  4ABN A;  4GYY A;  4U0U A;  1WY6 A;  4UQX A;  2AXZ A;  3CVQ A;  4O1O A;  5LOZ A;  2V4H C;  4GML A;  4WND A;  5C2Y A;  4M3O A;  3G2S A;  3CHR A;  2VSY A;  3UM3 A;  3PE3 A;  4J8F A;  3HYM B;  3UX4 A;  1LF8 A;  4GU5 A;  4AJW A;  3ZFW A;  2VGY A;  1WAO 1;  2V0P A;  2WMN A;  1AP7 A;  4I1M A;  2ZU6 B;  4IYP A;  4OYS A;  3UT7 A;  4EZK A;  1V54 E;  1UJK A;  1V55 E;  5AQ7 A;  3IHY A;  3TWV A;  1PY1 A;  5G2N A;  2R2L A;  4JXT A;  3CVU A;  3QNK A;  5FWQ A;  4BX8 A;  3QWW A;  1IKN D;  5ENO D;  3IXE A;  4RG6 A;  4ATG A;  5EX0 A;  5BW8 C;  1NA3 A;  3AG3 E;  2PL2 A;  3EJN A;  1YMP A;  4YDY A;  5ENQ D;  4E6H A;  3L08 A;  2FF4 A;  3FTY A;  2VTB A;  3ZN3 A;  2LSV A;  2R05 A;  4EHM A;  1QNF A;  3VTX A;  4H7X A;  3UTM A;  4Y6W A;  3ZXP A;  4FJY A;  3PH0 C;  2WXH A;  5AYW D;  1U3D A;  3NZS A;  2QZA A;  5AEN A;  3WXX A;  4GZ3 A;  2YNQ A;  3DWL G;  3ML9 A;  3TWW A;  4BER A;  3UI2 A;  1UN9 A;  3QAQ A;  5D0O D;  5CHE E;  3UM2 A;  1K3Z D;  4BET A;  1BPO A;  3CVP A;  2Y0B G;  4O1P A;  3FUE A;  3CHQ A;  4UWH A;  4ACL A;  1DVP A;  3KEA A;  2OVB A;  2XEV A;  3D3M A;  3RO3 A;  2AVP A;  3AS5 A;  1D9S A;  3NF1 A;  4BSX A;  2KM4 A;  2MYO A;  2XPZ A;  3QWV A;  3EHQ A;  1IXV A;  5AAO A;  3FTV A;  2WXM A;  3VLF A;  3W9G A;  1SZA A;  5FIN A;  3LDZ A;  2LXL A;  2J9Q A;  3E33 A;  1HG5 A;  3S7F A;  3MA5 A;  3RJV A;  1N4P A;  2RFM A;  3B7T A;  5FQ4 A;  3ZYK A;  4UWL A;  4XEI G;  3EU5 A;  4JPS A;  4U8H A;  4AVX A;  1XGW A;  1HE8 A;  2EIK E;  3Q7A A;  3VTY A;  4XKB A;  1H6K A;  4GTR A;  2LAI A;  4C9B B;  3L17 A;  3PNL B;  5JJ7 A;  4I43 A;  5JHA A;  1RW2 A;  2XS8 A;  2DZN A;  3RKV A;  3R7R A;  4UUC A;  5BPP A;  1WG0 A;  3U9W A;  2IO3 C;  3EU9 A;  5ITZ F;  3D9M A;  4ANU A;  3O48 A;  3ASH A;  3SGH A;  4I6G A;  4FAD A;  5LCW J;  4JD2 G;  1H2V C;  4AM9 A;  2XRZ A;  5FIO A;  1EF1 C;  2WVI A;  4IUL A;  3T5X A;  3VLE A;  2L9B A;  1KT0 A;  3C3R A;  3ZRH A;  2VGX B;  3CVW A;  3APF A;  3BU8 A;  3EHM A;  1FT2 A;  3CLJ A;  4RSY A;  5ARG A;  1PAQ A;  5KJN A;  4EQF A;  4LNG A;  5LP0 A;  3UXG A;  3FUI A;  4FP7 A;  3BUA A;  1QZ2 A;  2HYZ A;  2WXL A;  3MYV A;  2WB2 A;  1N95 A;  4GA2 A;  4U8V D;  3IKO B;  2KCL A;  5CEA A;  1U2V G;  2I2O A;  2BUG A;  5H7P A;  3WG7 E;  1NA0 A;  3F6Q A;  3LY9 A;  2V8S E;  4GPK A;  4HS2 A;  2KZT B;  4NQ0 A;  3C3Q A;  4I1O B;  3LXU X;  5AQ9 A;  2IOL A;  2H6I A;  2ETC A;  4XKC A;  3CSF A;  1HH8 A;  3ZU7 B;  1HXI A;  3LVQ E;  1FCH A;  2PQN A;  2QC9 A;  2WPV A;  4LNU D;  4O6F A;  3ZEF A;  4G24 A;  3ASD A;  1MHQ A;  5CER B;  2AXU A;  5AQB A;  2P2C P;  5ARF A;  2LNI A;  3HG0 D;  4GZC A;  2MHK A;  5ENR D;  2IEJ A;  4GPM A;  1HG2 A;  2CHW A;  3ULE G;  3CQC B;  3ONK A;  5EYL A;  2RKK A;  4W9R A;  1IQU A;  3PS6 A;  3SFY A;  2I9C A;  4DLQ A;  1E8W A;  1E8Z A;  3TWU A;  1ZB1 A;  1OWL A;  3KSQ A;  5E76 A;  2DBA A;  4KBQ A;  3MCX A;  5JA4 D;  4HFG A;  3VLD A;  1E90 A;  3FEY A;  4I9E A;  2LSU A;  4GTV A;  2KAT A;  2I6H A;  5KCM A;  3ZYQ A;  1QQE A;  3L9T A;  3AS8 A;  4BT8 A;  4YVO A;  2YIN A;  2VYI A;  3MJW A;  3SBT B;  2AJA A;  1TNO A;  3RIB A;  4KZ0 A;  4A3T A;  4Y6C A;  2I1K A;  3U64 A;  4G23 A;  1FPP A;  5HS0 A;  4F1S A;  3FTZ A;  1D8D A;  2WXP A;  3W9F A;  4I17 A;  1TNB A;  4BSZ B;  3CK7 A;  3ESL A;  4NAC A;  4AEZ C;  3KEZ A;  2YHC A;  4JHR A;  3MEK A;  3SY2 A;  4UI9 C;  3UT8 A;  4MLP A;  2VSO E;  3PUK A;  1G3N B;  3D9K A;  1TYQ G;  1S0P A;  1JWF A;  5IY5 E;  3AJI A;  1QYM A;  4GMJ A;  1PC2 A;  3UT4 A;  3MV2 B;  4F7A A;  2CHZ A;  4B93 B;  3DSX A;  3FWV A;  2XS1 A;  2PZI A;  4JEH A;  4ME2 A;  3UKR G;  2QYJ A;  4C48 B;  3PVL A;  1OCC E;  2ETB A;  3FUD A;  4NIK A;  4DK5 A;  4KVM A;  3BG1 B;  2LXM A;  3FH8 A;  3S7B A;  2KBX A;  2VGX A;  4HQD A;  4B89 A;  3E34 A;  2I1J A;  4FLH A;  1N4S A;  4JHJ A;  4HOR A;  5BV0 A;  2P9I G;  4DX7 D;  3ZPJ A;  2C2L A;  4GCN A;  4UWK A;  3EUV A;  1N52 A;  2WXF A;  4J8S A;  4JEU A;  2X3M A;  3X2Q E;  4DLO A;  4B94 A;  4B8C B;  3APC A;  4IN3 B;  3FTU A;  4WWO A;  3D9L A;  2NYJ A;  2KZT A;  3DEP A;  5BXO A;  3SBS A;  1OWP A;  4XIF A;  1ELR A;  2GRR B;  2F8X K;  4DX1 A;  3JCK C;  3B7B A;  1JWG A;  3RK6 A;  4I6J A;  4LG6 A;  2ZIS A;  3QC1 A;  1NI1 A;  1TN8 A;  4KMO A;  3FY4 A;  4KVO A;  3CV0 A;  1FVH A;  4CGV A;  2J09 A;  2GRP B;  3GZ1 A;  2NSZ A;  3ULQ A;  1HF8 A;  3NZU A;  2EIN E;  1HFA A;  5D2M C;  1EPU A;  2BKK B;  4HLE A;  4C0E A;  4FUL A;  1OXJ A;  4GTQ A;  1A5E A;  2IU1 A;  2YHE A;  3V31 A;  4ACK A;  3CK9 A;  3Q4A B;  5M72 A;  2EIL E;  4UQZ A;  3AG2 E;  4L1B A;  3CGH A;  3IEG A;  3BG0 B;  3QKY A;  3CK8 A;  2DIW A;  4G1T A;  1N4R A;  3OAW A;  4UQY A;  3I5P A;  1B89 A;  2WXN A;  3ISM C;  2R02 A;  3LCA A;  4DX2 A;  3IV0 A;  3CVY A;  4K5A B;  1Q2Z A;  5EN5 D;  1MZC A;  3ASO E;  4OVU A;  2R5S A;  2ZIR A;  3FUL A;  4HI8 A;  5KJM A;  1TNZ A;  4DRX E;  4HB5 A;  1SQM A;  2VSX E;  4QFV A;  1BLX B;  3E37 A;  2KC7 A;  3PEU B;  3RRM B;  3T5V A;  4CZ2 D;  2XZD G;  4DPR A;  4GTO A;  5BXU A;  4CDM A;  3B13 A;  3AS4 A;  2FBN A;  2AW6 A;  4N3C A;  3K9I A;  1WM5 A;  3PRE A;  2V5F A;  1OCZ E;  1ELK A;  3SHF A;  2R03 A;  4X8Q A;  3L13 A;  5EDS A;  3Q15 A;  3MX3 A;  2L6J A;  3TWR A;  4LRZ A;  5T8I A;  4N39 A;  5ENP D;  1H19 A;  4WNE A;  5EKQ D;  2R59 A;  3G2W A;  4HOT A;  3ZKJ A;  5AJL A;  4F53 A;  3P1U A;  2WXG A;  1OCR E;  4TXP A;  2L6B A;  2CFZ A;  4DI4 A;  4ILH B;  3DEO A;  3PEV B;  2Y1L E;  4EPZ A;  1N4Q A;  5AJD A;  4I2Z A;  2DYS E;  2A5E A;  2XEE A;  4HOU A;  5A6C A;  2A4Z A;  2IJG X;  1NP7 A;  3UPV A;  2J8S D;  3TXM A;  3NB2 A;  1DCQ A;  4K5C A;  4R7L A;  4BEP A;  3E30 A;  3V2X A;  3PZ4 A;  2X6I A;  3CVV A;  3DST A;  3QWP A;  4Z68 A;  3FUM A;  4L2Y A;  5CEC B;  4HXI A;  3DXK G;  3CHO A;  5D0Q D;  3AAA C;  3C5R A;  2IO2 C;  1NL4 A;  3RRU A;  2P9P G;  4MBG A;  4GAA A;  3UQ3 A;  3L82 A;  2DZO A;  2VGE A;  3KSL A;  2P9L G;  2XZT G;  4TXR A;  3V30 A;  4EEC A;  2XEH A;  1MX6 A;  4LSZ E;  3MGB A;  4B8A A;  3CR3 A;  4I9C A;  5D66 A;  3RAU A;  1TNU A;  3EHR A;  1YYH A;  5EID A;  4UI9 K;  1JCQ A;  4G25 A;  4QQI A;  1HU3 A;  3ZXS A;  4DX5 D;  3CST A;  2CHX A;  2GGF A;  5DIZ A;  5FJY A;  5A7D B;  3SNX A;  4XE0 A;  1Z3X A;  4ILI A;  4TRQ A;  1GW6 A;  5T4Y A;  3HDX A;  5ENS D;  3T8K A;  3TWT A;  4M7C A;  4J6I A;  2P9S G;  2DVW A;  3RSE G;  2ZGD A;  3IBE A;  2WQ7 A;  5JMN D;  3ABM E;  4KXK B;  4JL0 A;  4HOS A;  3ZYL A;  3EIQ C;  4CEM A;  1IYG A;  3JUI A;  2LUH A;  5HRY A;  5HQ8 A;  5J08 A;  4PH4 B;  3N71 A;  3FTS A;  1UW4 B;  4G26 A;  2FUL A;  3MV3 B;  3SFX A;  5ENN A;  5KNH D;  4URK A;  1S70 B;  1L5J A;  5FZR A;  1Z6T A;  2X6K A;  4GTP A;  3SZ7 A;  3D9H A;  1MX4 A;  4BY6 A;  5G04 J;  3LS8 A;  1JCS A;  2CG2 A;  3FTX A;  3LJN A;  3CVX A;  4I2W A;  4G8K A;  4WWN A;  2H6G A;  4N5C A;  3NBN B;  3CKB A;  3ONL A;  2WXK A;  1ELW A;  3CHP A;  2HM8 A;  3LEW A;  5JJT A;  4AXH A;  3AU5 A;  4FA6 A;  2XPY A;  2XCC A;  4RG9 A;  3FUF A;  1TEZ A;  1K1B A;  3OXL A;  3CKC A;  4HRL A;  3C72 A;  4GZ5 A;  3S7J A;  2B6C A;  3URZ A;  2J08 A;  3HXD A;  2AXV A;  3IHV A;  4GZ6 A;  2NXP A;  3OXG A;  3FHE A;  1E96 B;  1A17 A;  1O1R A;  4NUR A;  2FEZ A;  4LCT A;  3PZD A;  3APD A;  3D9O A;  4GYO A;  2CG3 A;  3AG4 E;  2XEN A;  1UN8 A;  4XI0 A;  2B0O E;  3TL5 A;  1UG3 A;  3GZS A;  3BEE A;  4JA7 A;  2PQR A;  3DPD A;  2RFA A;  3JQ0 A;  2L0I A;  2M63 A;  5KWD A;  3LVR E;  5KNG A;  4RVB A;  4UWG A;  4LUN U;  3HXE A;  1IQR A;  3DBS A;  4FHJ A;  4YDO A;  4E85 A;  5CMW A;  4MKT A;  1MX2 A;  3Q79 A;  2NC9 A;  4GB9 A;  4GTT A;  3EHN A;  1H0A A;  3ABL E;  3LY7 A;  4NRH B;  4APO A;  2ETA A;  3FFL A;  2C0L A;  4JVS A;  4EBA A;  5LFA A;  3KD7 A;  4GTM A;  2DWZ A;  3QJZ A;  2J4D A;  3UUX A;  5CRV A;  1YCS B;  1FT1 A;  4U04 A;  4G11 A;  1UOH A;  2L0T B;  3V2O A;  4ZHB A;  3ENE A;  3UIP C;  4AOF A;  3E32 A;  2QYU A;  1TJF A;  2GRL A;  4ANW A;  3HRA A;  4V3I A;  5AQA A;  4A1S A;  3CVL A;  4TUM A;  5CBO A;  5FQ7 A;  4I1A A;  1VDY A;  4PUC A;  3QB2 A;  5LCW C;  3OTN A;  4K5B A;  4K0R A;  2MRI A;  2WXJ A;  3PZ3 A;  2V4L A;  3GYZ A;  1TNY A;  3PZ1 A;  3D9J A;  5G05 J;  3SFZ A;  3I4R B;  3U3W A;  4XI9 A;  1LD7 A;  3TGO A;  2QY7 A;  3RO2 A;  1IHB A;  3TG5 A;  3QAR A;  5LX8 A;  3CIA A;  1IHG A;  3TG4 A;  2X38 A;  5AN8 A;  1NFI E;  4Q94 A;  3JXI A;  4EZJ A;  3FU6 A;  4A55 A;  2JAB A;  2JLB A;  2Y4T A;  3ZW3 A;  2XGM A;  4UWF A;  3J5Q B;  4GTS A;  3TJP A;  4HRM B;  4N2Q A;  2OND A;  5FT9 A;  3J5P A;  5FZS A;  1X5B A;  4JHK A;  3LY8 A;  5EX3 A;  3ZYM A;  3NQP A;  5CMY A;  4BTB A;  1TN7 A;  3R7Q A;  1H6O A;  3T8M A;  3JQ1 A;  4K03 A;  5EIB E;  1BI7 B;  3QOU A;  4A63 B;  2KCK A;  3I4G A;  1TN6 A;  2VSN A;  3HXF A;  4C0M A;  2E2E A;  4JC8 A;  4YND A;  3O4Z A;  3Q75 A;  4XZ4 A;  2HO1 A;  4A3V A;  4F1P A;  5JHB A;  3CVN A;  3ZNG A;  4F3V A;  2P9K G;  1ZBP A;  1JCR A;  3SQV A;  4AY6 A;  2Y4U A;  3Q9U C;  5BUZ A;  2OCC E;  2KXP C;  4WWP A;  3FUK A;  4RLY A;  3U4T A;  1DNP A;  3TAX A;  4BWR A;  1O1S A;  1Z3Y A;  2EIM E;  1Z5S C;  2JEK A;  3FUJ A;  4CYM D;  5DBK A;  1OWN A;  4AIF A;  3ABK E;  4ANV A;  3TWS A;  2RD0 A;  3PDN A;  3Q7F A;  3FUH A;  2GRN B;  4N2S A;  2WXR A;  4J8D A;  3Q73 A;  3ZIM A;  1MQS A;  3B7R L;  2OEW A;  3UM0 A;  2MOW A;  3BQO A;  1K8K G;  3FP3 A;  3R9A B;  3PUJ A;  5E75 A;  4N5Q A;  5ANL A;  2QFC A;  3V79 K;  3S7D A;  4ATZ D;  3HVE B;  3E4B A;  4J0U A;  4WAF A;  3PNT B;  4JW1 A;  2X6H A;  4EZL A;  3T9K A;  2H6H A;  3FTW A;  4D10 C;  2PM7 A;  1DC2 A;  2ION A;  4BES A;  3AU4 A;  3NOC D;  4L7T A;  2FI7 A;  3MZL B;  3U66 A;  2EQX A;  5B3S E;  2HE0 A;  4YVQ C;  3ZUV B;  1BD8 A;  3ASG A;  3ZGQ A;  2LO6 A;  3DXM G;  1JPL A;  5CRU A;  4MRU A;  4GA0 A;  4BFR A;  3UKU G;  1SW6 A;  2P9U G;  3DSU A;  4Q96 A;  4HI9 A;  4PS8 A;  3TWQ A;  4AY5 A;  1S63 A;  2J4B A;  4PDX A;  3AG1 E;  1RZ4 A;  5G05 C;  5FTP A;  4JA9 A;  3UM1 A;  3SD5 A;  4LNB A;  2EIJ E;  4MS6 A;  4UI9 J;  4FC8 A;  2Y3A A;  4CRW A;  4FHK A;  4GZD A;  2OOE A;  1Y6I A;  2ZXW E;  1H6P A;  3ML8 A;  5C1D A;  2PNN A;  4L2L A;  2KCV A;  2Q7F A;  3FU5 A;  1MYO A;  3ESK A;  3FH7 A;  4GCO A;  2C0M A;  4IRU A;  2VJ8 A;  4HLL A;  2A5U A;  2PM6 A;  1EDU A;  2X6J A;  4L23 A;  1QBQ A;  4LEU A;  5BNW A;  2H6F A;  1KZO A;  2UY1 B;  4N3B A;  3G2U A;  3FUN A;  4EBA G;  4CT4 A;  4KZC A;  3QK0 A;  3FU3 A;  3SO8 A;  5AAR A;  3ZHE B;  3CHS A;  1SA5 A;  2ILR A;  4HRN A;  3Q49 B;  4DX6 D;  4FJZ A;  2WXI A;  1S64 A;  4YDE A;  1LTX A;  1Y8M A;  2F0Y A;  3DSW A;  4U7E B;  3SI5 A;  4KT6 B;  5JJ6 A;  2IFU A;  1OCO E;  3G2V A;  3MKQ B;  3LYA A;  2IQC A;  1BI8 B;  3B95 A;  4BT9 A;  4JB8 P;  2GW1 A;  3GW4 A;  5G55 A;  4WUY A;  4GMR A;  1HX8 A;  3MKR A;  4O60 A;  1X81 A;  2FO1 E;  4FU3 A;  2IY0 C;  3KS2 A;  4APF A;  2XGO A;  4U07 A;  1TJC A;  3FEX A;  3B7S A;  3ZVV A;  3ASF A;  2ZGG A;  3HVE A;  1AWC B;  2GRO B;  3ULY A;  2HR2 A;  1OY3 D;  4PS3 A;  3HIZ A;  1BU9 A;  4U96 D;  1H2U A;  4H7Y A;  4OAV B;  3CHM A;  2LAH A;  1SA4 A;  3PRZ A;  1E7U A;  5BT1 A;  3L6A A;  5EIL A;  2OV8 A;  3R9M A;  1U3C A;  5A23 A;  1ZU2 A;  4G2V A;  4HNA D;  3DRA A;  3FU0 A;  2Y69 E;  3QDN A;  1FVF A;  1JUQ A;  3HHM A;  4U63 A;  4CGW A;  5CED B;  1OWM A;  4AV7 A;  4J7W A;  3C98 A;  3NAW A;  4WNG A;  4P29 A;  4J8E A;  1UJJ A;  5CBN A;  1HZ4 A;  3L54 A;  2WXQ A;  4AP2 A;  1O1T A;  2V5Q C;  2WXO A;  4A1G A;  4GA1 A;  1DCE A;  4U8Y D;  1H2T C;  4HBD A;  1N0Q A;  2BTD A;  1SZ9 A;  2OEV A;  4U95 D;  3P2B A;  2F8Y A;  4RQI A;  4G8L A;  1OWO A;  3Q5M A;  4I6E A;  1NZN A;  3B7U X;  5J90 A;  1INZ A;  1E8Y A;  2WQH A;  2GRQ B;  3Q47 B;  3EIJ A;  3JXJ A;  1KT1 A;  4CDR A;  4CT0 A;  5FQ8 A;  1TR4 A;  3LKU A;  2J49 A;  2IOS A;  3GZ2 A;  4TXQ A;  1SVX A;  3UMV A;  1O5M A;  3Q78 A;  2P9N G;  4LER A;  5FZQ A;  3UIO C;  2DCP A;  3ASN E;  5CCL A;  3LPZ A;  5FQ6 A;  2XCB A;  3Q9N C;  2YQ8 A;  3D9N A;  3CQG B;  3DSS A;  2WM9 A;  4L9P A;  4TUU A;  4OVV A;  3KAE A;  3JUE A;  1E8X A;  4YDW A;  1E7V A;  3FDH A;  2R17 C;  5B1A E;  4U0Z A;  2UY1 A;  2J07 A;  1N0R A;  1YA0 A;  2VQ2 A;  3L16 A;  4KYO B;  5EYP F;  2VTB B;  2X6F A;  5HKP A;  2CFU A;  3D9P A;  1N11 A;  4HOQ A;  3PE4 A;  3ZHE A;  3RRN B;  4WNF A;  5ENT D;  1KPS B;  4ZFH A;  4GYW A;  3DSV A;  4BTA A;  1HS6 A;  2XRY A;  1KLX A;  1W3B A;  2XHE A;  4XX5 A;  3HXB A;  4BX9 A;  3C3O A;  1N54 A;  4CCA A;  4Q69 A;  1EYH A;  1HO8 A;  3LJ3 A;  3MKQ A;  5T3R A;  3HXC A;  3EDT B;  2BKG A;  1D8E A;  1WDY A;  4FLB A;  3SF4 A;  4OAU C;  3G2T A;  1MJ0 A;  3CEQ A;  4TV3 A;  2BF0 X;  4DJA A;  4JZY A;  4DUI A;  2OVF A;  2RG8 A;  2BED A;  2GRM A;  1N9A A;  4J8Y A;  5KJK A;  1OT8 A;  1OUV A;  5BV1 A;  5ANR A;  1XNF A;  5KBA A;  3DPY A;  4PS7 A;  4U0S A;  2XPI A;  3S2A A;  1LD8 A;  5AIJ A;  3RU0 A;  5B1B E;  3OXF A;  3D9I A;  2P58 C;  3JYS A;  1KZP A;  2F37 A;  5HI7 A;  4ILG A;  1P5Q A;  3UIN C;  2WMO A;  3I3N A;  2XGS A;  2IF4 A;  1N94 A;  1K1A A;  5G04 C;  2XQ0 A;  4F6R D;  2WQ6 A;  3PZ2 A;  4HVB A;  2E0I A;  3L22 A;  5CCM A;  2DYR E;  4B0Z A; 
#chains in the Genus database with same CATH homology
 3X2Q E;  3AG4 E;  3ABK E;  2EIL E;  3ASN E;  3AG2 E;  2DYS E;  1OCO E;  1V54 E;  2EIN E;  2ZXW E;  2OCC E;  3WG7 E;  1V55 E;  5B3S E;  3ABM E;  2EIK E;  3AG3 E;  1OCC E;  3AG1 E;  5B1B E;  2Y69 E;  3ABL E;  1OCZ E;  5B1A E;  1OCR E;  3ASO E;  5IY5 E;  2EIJ E;  2EIM E;  2DYR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...