1OCZE

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
b'SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1oczE00
3ASNE 5B1AE 5B3SE 2EILE 2OCCE 2Y69E 1OCOE 1OCZE 3AG4E 3AG1E 3ABLE 3WG7E 5B1BE 3AG3E 1OCRE 1OCCE 2DYSE 3ASOE 3AG2E 1V55E 3ABME 2EIME 2ZXWE 1V54E 3X2QE 2EIJE 5IY5E 2EINE 3ABKE 2EIKE 2DYRE
chains in the Genus database with same CATH superfamily
3CVQA 2WXGA 1BI7B 4DX5D 3VLDA 4H7XA 5KJKA 4GTPA 5BXOA 4TRQA 3D9MA 2L6BA 5KJNA 4GMLA 4YVQC 2ZIRA 3PZDA 4BERA 4LNGA 1E8WA 5B1AE 4HLEA 3TG5A 5AN8A 3P2BA 1SZ9A 3ESKA 4GTRA 5LCWJ 1ELKA 4ILIA 4WWOA 2F8XK 3NAWA 4IYPA 2QYUA 3MGBA 3UKUG 4OAVB 2KXPC 4BX9A 4PDXA 5ENSD 3HXEA 5JA4D 4BETA 2WQHA 4QFVA 1OWLA 3Q49B 4K5CA 4HRLA 5ANLA 4KBQA 3CHOA 4ATGA 3PREA 3E34A 4BSZB 4DK5A 4CDRA 2DYRE 4U8HA 4AV7A 3KSLA 1HG2A 2WXNA 1NL4A 4M3OA 5EX0A 3ZIMA 2WVIA 3IEGA 3C3QA 2XEVA 4PUCA 1L5JA 2X6KA 1YMPA 3CK9A 4JHKA 2PQRA 3V2OA 3PE4A 2WXOA 3GW4A 3QDNA 5JHBA 5EKQD 2OEWA 4I2ZA 4FHJA 5EX3A 4RLYA 4HI8A 4A1SA 4APOA 3T5XA 1FVFA 5AARA 4U63A 4GZ6A 3AU4A 2DYSE 2C2LA 3SY2A 4IN3B 4BX8A 5KJMA 4G11A 1FVHA 2VGXA 4U0SA 3JCKC 3QWPA 5H7PA 3AS8A 3FEXA 5A6CA 3FH7A 2EIJE 2GGFA 3ABKE 4DPRA 4A1GA 4W9RA 4B94A 3CHMA 5FQ7A 2XHEA 3HYMB 2LUHA 1HX8A 3APCA 1TNBA 4EECA 3UQ3A 3CVVA 2VYIA 3RKVA 3V2XA 2P9PG 2UY1B 3EHMA 3RU0A 5KWDA 1RZ4A 4GZ3A 3RO3A 4ABNA 4L9PA 3BG1B 4Z68A 3L22A 3Q7AA 2XS8A 2L9BA 3FTVA 3ZXPA 3RRUA 2QC9A 4M7CA 4HORA 4BEPA 3ASNE 4H7YA 5AQ9A 5AQAA 4KVOA 4ZFHA 3CR3A 5AENA 3HG0D 1INZA 3DEOA 3ISMC 2RFMA 4WNFA 1OCCE 2V5QC 2EIME 4J8YA 3LS8A 3PRZA 5EIDA 3MEKA 2P9IG 5IY5E 4F6RD 1H2UA 5FQ8A 1S64A 4FLHA 4I1OB 3DSXA 5FZRA 4RG9A 3FU3A 1XNFA 5CMWA 3TXNA 1TNOA 4K03A 4BFRA 3DSWA 3DSSA 2GRPB 4ANUA 4DUIA 1IKND 3PEUB 3KEZA 4LCTA 2XCCA 5AAOA 4B93B 4UWFA 1DNPA 3ZHEA 4GZDA 4ACLA 1EYHA 4XI9A 2P9NG 4DLQA 4PS8A 4YDEA 5LP0A 4HRMB 3CSTA 3FU0A 3ULEG 2P58C 3G2UA 1U3CA 1PAQA 4DX1A 3TWVA 1H0AA 4EZLA 2XRYA 2IOLA 2BKKB 1N11A 2WXRA 5G05C 4G1TA 2FF4A 3TL5A 3B95A 1UN8A 4XIFA 3TGOA 2Y1LE 4JVSA 2KBXA 3LXUX 3ZUVB 4CDNA 3DPDA 4I6JA 1TEZA 3LYAA 1MYOA 4BTAA 3ZPJA 3IKOB 3FTZA 3IV0A 2WXHA 5CBNA 2KM4A 3HVEA 1NP7A 1ELRA 4UWGA 5FZSA 5EYLA 1KPSB 4OYSA 3I3NA 1SZAA 2CHXA 5ITZF 5E75A 3IHVA 3PUJA 2MRIA 2J4BA 3MKQA 4YNDA 3MJWA 5CRUA 3UM1A 4HOQA 3SNXA 3PUKA 4RQIA 5G55A 2X3MA 3UPVA 3D9OA 3E33A 4G26A 5BPPA 3QJZA 1E8XA 3PDNA 4GMJA 2XZDG 2LXLA 4B8CB 4NIKA 3TXMA 5A23A 1H2TC 1O1SA 3L17A 4I6EA 1IHGA 2X6IA 4LSZE 5ARFA 1Q2ZA 4IULA 3UT4A 3D9LA 4NURA 1E7UA 1S0PA 3FUKA 3Q75A 3FTWA 2XZTG 4JEUA 2LO6A 4WAFA 5KBAA 4FJZA 3C5RA 3LPZA 5LOZA 3CSFA 2NC9A 3B13A 4A55A 4LERA 1TN7A 2XPIA 3SHFA 3ASGA 2R2LA 1LTXA 4XKBA 4DX7D 3SBTB 3EJNA 4JC8A 5BNWA 3W9FA 3ZGQA 3CEQA 2LAIA 2XCBA 2JABA 4NQ0A 4PH4B 3QNKA 1IYGA 1JCRA 2HO1A 1IHBA 2FO7A 3U9WA 3FTUA 4GZCA 1X5BA 4O1OA 3EDTB 5JMND 3SFXA 2WM9A 5LFAA 4FHKA 1EF1C 1BI8B 4LNBA 4CYMD 1YA0A 3NZUA 4LEUA 1FCHA 1K8KG 5FZQA 2YINA 2PQNA 4CCAA 3BEEA 2VSNA 3ML8A 3NOCD 4EQFA 1WAO1 3P1UA 2VSOE 2J07A 1MJ0A 5D0OD 2WXJA 4JA9A 2R59A 4GYWA 4HOTA 3EHRA 1Z3XA 3KAEA 3E37A 3T5VA 4N3BA 4C0EA 2X6FA 2Y69E 5CCMA 2VJ8A 2HM8A 5G05J 4EHMA 5EDSA 4G24A 3SD5A 2XPZA 3CHRA 3D3MA 3NZSA 4ZHBA 4Y6CA 4BESA 1QQEA 1U2VG 3AG1E 4JL0A 1KT0A 4HOUA 1GW6A 3CVNA 3JXJA 2X6HA 3CHQA 4YDWA 3HXCA 3Q9NC 3AS4A 4EZKA 1QYMA 5KCMA 2ILRA 4WNGA 2XGSA 3FUHA 4K5BA 4G25A 4K5AB 4I1AA 2ETBA 4I1MA 3UTMA 4UQYA 2NYJA 3E4BA 4N5CA 2J09A 1TYQG 3DSTA 4LNUD 4CGWA 3ASFA 2P9KG 4G2VA 3S7DA 1BPOA 3AG3E 3MZLB 1E7VA 3G2TA 2Y4UA 4JPSA 2EQXA 3TWRA 2WXMA 3NQPA 3MX3A 3UIPC 1Y6IA 3CHPA 1BLXB 1N9AA 5HRYA 1DVPA 5C2YA 1P5QA 2VGEA 5FIOA 2VGYA 4HB5A 3ZVVA 3O4ZA 1O1RA 3ZW3A 2KATA 2I9CA 3FDHA 2FO1E 4DI4A 4LUNU 4GTOA 1N4PA 3EHQA 4KZ0A 2F0YA 3S7JA 3TWQA 3ONKA 4L2LA 1JPLA 3DWLG 5T8IA 4CGVA 1WG0A 3PVLA 1G3NB 4XZ4A 4UI9C 3D9IA 4B0ZA 3PZ4A 3JXIA 3GZ2A 3OXLA 4GAAA 2EIKE 1KZPA 4I9EA 5E76A 3PE3A 1Z3YA 1WM5A 1MHQA 4CT0A 2IJGX 2ZU6B 2BTDA 3CKBA 3BG0B 3CHSA 3ZN3A 3FY4A 3QKYA 3Q73A 2KCKA 1N94A 1D9SA 1JUQA 3AU5A 4O1PA 3C72A 3FFLA 4ILGA 3UT8A 5CRVA 4HLLA 4GA0A 1Z5SC 3KEAA 2R02A 3TWUA 2HE0A 1HS6A 3FHEA 4CZ2D 4OVVA 4F53A 2VTBA 3FUNA 4AY5A 2Y3AA 1MQSA 3GZSA 3L08A 1RW2A 2WXFA 3TAXA 4GZ5A 4XEIG 2KC7A 2XS1A 4G23A 2IQCA 4OVUA 1QNFA 5ENRD 1KT1A 1E96B 4CDMA 2J8SD 1HE8A 2I6HA 3ONLA 3IBEA 3E32A 4BTBA 5D0QD 2IFUA 5CMYA 2H6FA 2WB2A 2WQ7A 3EIJA 4I2WA 3N71A 2CFZA 2ZISA 4GU5A 3AS5A 1MX6A 2Y0BG 3EUVA 4U04A 2FULA 5D2MC 2IO3C 3OAWA 3APFA 2RKKA 1LD8A 3BU8A 3ZXSA 4AY6A 1SA5A 1S63A 4N3CA 1D8EA 4ANXA 4KXKB 1SA4A 4AVXA 3UM2A 3MV3B 4G8LA 3I4RB 3CVUA 1TNYA 2XRZA 4ILHB 3FUDA 3RRMB 4KVMA 3C98A 2GRNB 4NACA 3C3RA 3EU9A 2RD0A 4MBGA 1AP7A 3ZHEB 3DSUA 4GTQA 4URKA 4Q69A 5J08A 2XPYA 2P9SG 4GTMA 1K1BA 3MYVA 2WXIA 3JQ0A 3TWTA 3FUFA 3FUMA 1S70B 3B7RL 2LSUA 3JUEA 4J8FA 1E90A 4O60A 3SFYA 4UWLA 5HQ8A 3TWXA 3HXBA 5HI7A 5ARGA 3SZ7A 1ELWA 3QK0A 3QAQA 4BT8A 2XGOA 3OTNA 3U66A 2CG2A 5DIZA 2P9UG 4CT4A 3V79K 1VDYA 4RG6A 3RRNB 4I6GA 1OT8A 1HZ4A 4L7TA 2CHZA 3HVEB 3VTYA 3FTYA 3ASOE 4XI0A 3ESLA 2QFCA 3SFZA 5AJLA 4JHJA 1WY6A 4UI9J 1KZOA 4GMRA 3QC1A 4BWRA 1LF8A 1UG3A 4DI3A 3CIAA 2PM7A 3QB2A 5CHEE 3PZ1A 3MKQB 3Q4AB 3IXEA 3HXFA 5CCLA 2AXZA 4KZCA 3PNLB 4V3IA 4GCOA 4GYOA 2GRLA 3IHYA 3WXXA 4YVOA 3I5PA 1E8YA 2C0LA 2OVFA 4GPMA 2YHCA 5FQ6A 1FT2A 5G04C 4J8DA 3HHMA 3ZFWA 4TV3A 2AWIA 3B7UX 4FC8A 3GZ1A 3ASHA 3ASDA 5BT1A 4C0MA 3R7QA 5J90A 2VSYA 1TNZA 2GROB 4B89A 2GRRB 4WUYA 4U95D 2AXUA 1U3DA 2C0MA 2Q7FA 4BT9A 1H2VC 5CEDB 2X6JA 1NA3A 3DXKG 3FUEA 1V55E 2CHWA 3FUJA 4JW1A 4K0RA 1OWOA 4HS2A 3UUXA 1JCSA 4BY6A 3S7BA 3TG4A 4MS6A 3MV2B 1K3ZD 1N52A 2NXPA 5EN5D 3KD7A 3CVYA 3GYZA 4JEHA 1HFAA 3Q5MA 4WWPA 5BW8C 4PS3A 2BEDA 4ANVA 2PZIA 2MHKA 5D66A 2WXPA 3PZ3A 2AXVA 1IQUA 1SVXA 5AIJA 1WDYA 1N4RA 3UX4A 3SF4A 3SI5A 3NBNB 3B7BA 5HS0A 5KJLA 2DZNA 1EPUA 1PY1A 2OOEA 2QYJA 2A5EA 3Q78A 1O5MA 4U96D 3D9KA 2BF0X 4FLBA 3CK7A 4CRWA 4I17A 2HYZA 2WXKA 5B1BE 2KCLA 4KT6B 3LVRE 2FBNA 4B8AA 2J49A 3QARA 3DRAA 4FULA 4HQDA 1N0QA 4U0ZA 2UWJG 4GTSA 4LG6A 5ENTD 4X8QA 3FWVA 2KZTA 3O48A 3UMVA 2J4DA 2J9QA 3FH8A 4QQIA 2DBAA 2M63A 3ML9A 4TXRA 1N0RA 3URZA 3Q47B 4U07A 1TN6A 4ATZD 2WPVA 2OCCE 4P29A 1N4SA 4WWNA 1LD7A 4UQZA 3LY7A 1JWFA 4HRNA 2V5FA 2A5UA 4FU3A 2IU1A 3PS6A 2KCVA 3W9GA 5FWQA 2XEEA 4J8SA 2WXLA 5T3RA 4UWKA 2AW6A 2B0OE 2IY0C 4U7EB 3R9AB 1MZCA 2FEZA 4FADA 2OVBA 1HG5A 3DBSA 3AAAC 4YDYA 3ZYQA 3OXGA 3JUIA 3J5QB 3QWVA 5LX8A 1KLXA 5EYPF 4KYOB 2ZGDA 3JYSA 3DXMG 3ZNGA 4DX6D 3PH0C 2PNNA 3VLEA 3RK6A 3ABLE 1FPPA 3CQCB 4GCNA 5EILA 4DLOA 1N4QA 3BUAA 4XE0A 5M72A 3L16A 3L82A 3Q15A 1IQRA 4FA6A 1DCQA 2OV8A 4RSYA 3Q9UC 5G04J 2OEVA 3RIBA 2I2OA 3VLFA 5AQBA 1UOHA 1UN9A 4JD2G 3MCXA 3ZYLA 4E6HA 5DBKA 4N39A 3B7SA 5BV0A 5FQ4A 1OUVA 1H19A 3LJNA 5FT9A 4PS7A 2QY7A 4JHRA 1HH8A 3G2SA 1EDUA 4GB9A 3AJIA 5ANRA 2XQ0A 2V8SE 1SQMA 3U3WA 3EHNA 2DIWA 1ZB1A 4EBAA 4F1SA 4Y6WA 1OY3D 1JWGA 4LRZA 4OAUC 3B7TA 5KNHD 3AG2E 4A3VA 3ABME 4GPKA 2IONA 3D9NA 3VTXA 4ME2A 3ZU7B 5CECB 1A17A 2WXQA 4AIFA 3DEPA 4L23A 2IF4A 3V31A 3ULQA 5T4YA 3V30A 2V4HC 5FJYA 5AQ7A 2VGXB 4F3VA 1X81A 2H6GA 5CBOA 3L13A 3SO8A 5JJTA 2CG3A 5AJDA 3FU6A 4I9CA 2DCPA 2YNQA 4JXTA 4F7AA 3UM3A 3Q7FA 5FTPA 1HF8A 3ZKJA 3D9HA 3LJ3A 3PEVB 2XGMA 2VQ2A 2ETCA 2I1KA 2PL2A 1O1TA 3T8MA 1Y8MA 2A4ZA 2VTBB 2UY1A 2IO2C 3FULA 1H6PA 4EBAG 2BUGA 3UI2A 5C1DA 2FI7A 4FJYA 4O6FA 4D10C 4TXQA 3UINC 2JEKA 5ENOD 5KNGA 3NOGD 4JZYA 5ENPD 1OXJA 1H6KA 5CEAA 2IOSA 1V54E 4MRUA 1PC2A 2GW1A 4AM9A 4DX2A 4N5QA 3UT7A 4AP2A 1HXIA 2WMNA 1N95A 1JCQA 4HXIA 2DZOA 2DWZA 3L54A 4TXPA 4U8VD 3G2WA 4Q96A 3Q79A 3EU5A 2WQ6A 4GA2A 3TWSA 3PNTB 5BUZA 3T8KA 4YDOA 3CV0A 3LCAA 1DC2A 3OXFA 3WG7E 4EZJA 3D9JA 3HIZA 2YHEA 5BV1A 1NI1A 2VSXE 3ULYA 3PZ2A 3HDXA 5AYWD 4UQXA 3R7RA 4J6IA 1ZU2A 3ENEA 4G8KA 4HBDA 2PM6A 3LY9A 4GTVA 1A5EA 2E0IA 1OWMA 1DCEA 3T9KA 3FEYA 2ONDA 1TR4A 4HVBA 3DSVA 2HR2A 3G2VA 1NA0A 3R9MA 3EIQC 3NF1A 4JA7A 3QWWA 1NFIE 4J7WA 1TN8A 4ANWA 3LVQE 3CQGB 3FTXA 2ZXWE 3RO2A 2AVPA 3JQ1A 4N2QA 2XEHA 2L0IA 1QZ2A 4AJWA 1MX4A 4WNDA 1HU3A 3CVXA 1SW6A 4N2SA 1OCRE 1W3BA 4UWHA 1UW4B 3SQVA 1TNUA 2L0TB 4F1PA 2J08A 3ZYMA 5EIBE 4E85A 1YYHA 3RSEG 4JB8P 5A7DB 3K9IA 3L9TA 2LNIA 4WNEA 4NRHB 2L6JA 3F6QA 4DJAA 1ZBPA 4U0UA 4XKCA 2R03A 2IEJA 5B3SE 1B89A 4GYYA 2CFUA 3AG4E 1UJJA 2H6IA 5LCWC 1BU9A 1H6OA 3U4TA 3ZRHA 1Z6TA 1IXVA 3APDA 5JHAA 2LAHA 2DVWA 2YQ8A 3X2QE 3LDZA 3UKRG 4GTTA 2P2CP 3CVLA 2ZGGA 4J8EA 2XENA 4XX5A 1HO8A 4IRUA 3CK8A 3NB2A 3FU5A 3CVPA 5HKPA 4N3AA 3LKUA 5JJ6A 1OWPA 2RG8A 4GA1A 3CLJA 2EINE 4MLPA 2WMOA 2JLBA 3E30A 4A63B 3FUIA 4TUMA 3D9PA 1BD8A 1TJFA 3CKCA 3KSQA 3LY8A 4HFGA 1E8ZA 2ETAA 4C48B 2GRQB 1D8DA 3DPYA 5G2NA 3FH5A 1YCSB 2B6CA 4I43A 4HOSA 5CERB 3RAUA 3UIOC 2F8YA 2F37A 4UI9K 4L1BA 3TWWA 1UJKA 4C9BB 1QBQA 3UXGA 3MA5A 3HRAA 2R05A 4BSXA 1FT1A 3ZYKA 3U64A 3HXDA 2I1JA 2R5SA 3C3OA 4HNAD 2MYOA 1NZNA 3UM0A 2RFAA 2V0PA 4U8YD 1XGWA 5ENNA 4ACKA 4RVBA 4J0UA 2NSZA 3I4GA 3RJVA 2LXMA 3MKRA 4UUCA 5JJ7A 4HI9A 5FINA 2R17C 4DRXE 2P9LG 3SBSA 2GRMA 5BXUA 3SGHA 4MKTA 2KZTB 2X38A 2QZAA 2E2EA 3LEWA 1OCZE 4FP7A 1TJCA 4A3TA 3ZEFA 1MX2A 2LSVA 4Q94A 1N54A 3KS2A 4L2YA 3BQOA 4CEMA 3L6AA 1OWNA 2Y4TA 3CVWA 2BKGA 4AOFA 3FP3A 2H6HA 3FTSA 3TJPA 4EPZA 2EILE 1K1AA 1OCOE 3S2AA 3J5PA 3CGHA 3QOUA 2MOWA 4APFA 4TUUA 4AXHA 5ENQD 2AJAA 4KMOA 4R7LA 3S7FA 4AEZC 2V4LA 1AWCB
chains in the Genus database with same CATH topology
3ASNE 5B1AE 5B3SE 2EILE 2OCCE 2Y69E 1OCOE 1OCZE 3AG4E 3AG1E 3ABLE 3WG7E 5B1BE 3AG3E 1OCRE 1OCCE 2DYSE 3ASOE 3AG2E 1V55E 3ABME 2EIME 2ZXWE 1V54E 3X2QE 2EIJE 5IY5E 2EINE 3ABKE 2EIKE 2DYRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASN E;  5B1A E;  5B3S E;  2EIL E;  2OCC E;  2Y69 E;  1OCO E;  1OCZ E;  3AG4 E;  3AG1 E;  3ABL E;  3WG7 E;  5B1B E;  3AG3 E;  1OCR E;  1OCC E;  2DYS E;  3ASO E;  3AG2 E;  1V55 E;  3ABM E;  2EIM E;  2ZXW E;  1V54 E;  3X2Q E;  2EIJ E;  5IY5 E;  2EIN E;  3ABK E;  2EIK E;  2DYR E; 
#chains in the Genus database with same CATH topology
 3CVQ A;  2WXG A;  1BI7 B;  4DX5 D;  3VLD A;  4H7X A;  5KJK A;  4GTP A;  5BXO A;  4TRQ A;  3D9M A;  2L6B A;  5KJN A;  4GML A;  4YVQ C;  2ZIR A;  3PZD A;  4BER A;  4LNG A;  1E8W A;  5B1A E;  4HLE A;  3TG5 A;  5AN8 A;  3P2B A;  1SZ9 A;  3ESK A;  4GTR A;  5LCW J;  1ELK A;  4ILI A;  4WWO A;  2F8X K;  3NAW A;  4IYP A;  2QYU A;  3MGB A;  3UKU G;  4OAV B;  2KXP C;  4BX9 A;  4PDX A;  5ENS D;  3HXE A;  5JA4 D;  4BET A;  2WQH A;  4QFV A;  1OWL A;  3Q49 B;  4K5C A;  4HRL A;  5ANL A;  4KBQ A;  3CHO A;  4ATG A;  3PRE A;  3E34 A;  4BSZ B;  4DK5 A;  4CDR A;  2DYR E;  4U8H A;  4AV7 A;  3KSL A;  1HG2 A;  2WXN A;  1NL4 A;  4M3O A;  5EX0 A;  3ZIM A;  2WVI A;  3IEG A;  3C3Q A;  2XEV A;  4PUC A;  1L5J A;  2X6K A;  1YMP A;  3CK9 A;  4JHK A;  2PQR A;  3V2O A;  3PE4 A;  2WXO A;  3GW4 A;  3QDN A;  5JHB A;  5EKQ D;  2OEW A;  4I2Z A;  4FHJ A;  5EX3 A;  4RLY A;  4HI8 A;  4A1S A;  4APO A;  3T5X A;  1FVF A;  5AAR A;  4U63 A;  4GZ6 A;  3AU4 A;  2DYS E;  2C2L A;  3SY2 A;  4IN3 B;  4BX8 A;  5KJM A;  4G11 A;  1FVH A;  2VGX A;  4U0S A;  3JCK C;  3QWP A;  5H7P A;  3AS8 A;  3FEX A;  5A6C A;  3FH7 A;  2EIJ E;  2GGF A;  3ABK E;  4DPR A;  4A1G A;  4W9R A;  4B94 A;  3CHM A;  5FQ7 A;  2XHE A;  3HYM B;  2LUH A;  1HX8 A;  3APC A;  1TNB A;  4EEC A;  3UQ3 A;  3CVV A;  2VYI A;  3RKV A;  3V2X A;  2P9P G;  2UY1 B;  3EHM A;  3RU0 A;  5KWD A;  1RZ4 A;  4GZ3 A;  3RO3 A;  4ABN A;  4L9P A;  3BG1 B;  4Z68 A;  3L22 A;  3Q7A A;  2XS8 A;  2L9B A;  3FTV A;  3ZXP A;  3RRU A;  2QC9 A;  4M7C A;  4HOR A;  4BEP A;  3ASN E;  4H7Y A;  5AQ9 A;  5AQA A;  4KVO A;  4ZFH A;  3CR3 A;  5AEN A;  3HG0 D;  1INZ A;  3DEO A;  3ISM C;  2RFM A;  4WNF A;  1OCC E;  2V5Q C;  2EIM E;  4J8Y A;  3LS8 A;  3PRZ A;  5EID A;  3MEK A;  2P9I G;  5IY5 E;  4F6R D;  1H2U A;  5FQ8 A;  1S64 A;  4FLH A;  4I1O B;  3DSX A;  5FZR A;  4RG9 A;  3FU3 A;  1XNF A;  5CMW A;  3TXN A;  1TNO A;  4K03 A;  4BFR A;  3DSW A;  3DSS A;  2GRP B;  4ANU A;  4DUI A;  1IKN D;  3PEU B;  3KEZ A;  4LCT A;  2XCC A;  5AAO A;  4B93 B;  4UWF A;  1DNP A;  3ZHE A;  4GZD A;  4ACL A;  1EYH A;  4XI9 A;  2P9N G;  4DLQ A;  4PS8 A;  4YDE A;  5LP0 A;  4HRM B;  3CST A;  3FU0 A;  3ULE G;  2P58 C;  3G2U A;  1U3C A;  1PAQ A;  4DX1 A;  3TWV A;  1H0A A;  4EZL A;  2XRY A;  2IOL A;  2BKK B;  1N11 A;  2WXR A;  5G05 C;  4G1T A;  2FF4 A;  3TL5 A;  3B95 A;  1UN8 A;  4XIF A;  3TGO A;  2Y1L E;  4JVS A;  2KBX A;  3LXU X;  3ZUV B;  4CDN A;  3DPD A;  4I6J A;  1TEZ A;  3LYA A;  1MYO A;  4BTA A;  3ZPJ A;  3IKO B;  3FTZ A;  3IV0 A;  2WXH A;  5CBN A;  2KM4 A;  3HVE A;  1NP7 A;  1ELR A;  4UWG A;  5FZS A;  5EYL A;  1KPS B;  4OYS A;  3I3N A;  1SZA A;  2CHX A;  5ITZ F;  5E75 A;  3IHV A;  3PUJ A;  2MRI A;  2J4B A;  3MKQ A;  4YND A;  3MJW A;  5CRU A;  3UM1 A;  4HOQ A;  3SNX A;  3PUK A;  4RQI A;  5G55 A;  2X3M A;  3UPV A;  3D9O A;  3E33 A;  4G26 A;  5BPP A;  3QJZ A;  1E8X A;  3PDN A;  4GMJ A;  2XZD G;  2LXL A;  4B8C B;  4NIK A;  3TXM A;  5A23 A;  1H2T C;  1O1S A;  3L17 A;  4I6E A;  1IHG A;  2X6I A;  4LSZ E;  5ARF A;  1Q2Z A;  4IUL A;  3UT4 A;  3D9L A;  4NUR A;  1E7U A;  1S0P A;  3FUK A;  3Q75 A;  3FTW A;  2XZT G;  4JEU A;  2LO6 A;  4WAF A;  5KBA A;  4FJZ A;  3C5R A;  3LPZ A;  5LOZ A;  3CSF A;  2NC9 A;  3B13 A;  4A55 A;  4LER A;  1TN7 A;  2XPI A;  3SHF A;  3ASG A;  2R2L A;  1LTX A;  4XKB A;  4DX7 D;  3SBT B;  3EJN A;  4JC8 A;  5BNW A;  3W9F A;  3ZGQ A;  3CEQ A;  2LAI A;  2XCB A;  2JAB A;  4NQ0 A;  4PH4 B;  3QNK A;  1IYG A;  1JCR A;  2HO1 A;  1IHB A;  2FO7 A;  3U9W A;  3FTU A;  4GZC A;  1X5B A;  4O1O A;  3EDT B;  5JMN D;  3SFX A;  2WM9 A;  5LFA A;  4FHK A;  1EF1 C;  1BI8 B;  4LNB A;  4CYM D;  1YA0 A;  3NZU A;  4LEU A;  1FCH A;  1K8K G;  5FZQ A;  2YIN A;  2PQN A;  4CCA A;  3BEE A;  2VSN A;  3ML8 A;  3NOC D;  4EQF A;  1WAO 1;  3P1U A;  2VSO E;  2J07 A;  1MJ0 A;  5D0O D;  2WXJ A;  4JA9 A;  2R59 A;  4GYW A;  4HOT A;  3EHR A;  1Z3X A;  3KAE A;  3E37 A;  3T5V A;  4N3B A;  4C0E A;  2X6F A;  2Y69 E;  5CCM A;  2VJ8 A;  2HM8 A;  5G05 J;  4EHM A;  5EDS A;  4G24 A;  3SD5 A;  2XPZ A;  3CHR A;  3D3M A;  3NZS A;  4ZHB A;  4Y6C A;  4BES A;  1QQE A;  1U2V G;  3AG1 E;  4JL0 A;  1KT0 A;  4HOU A;  1GW6 A;  3CVN A;  3JXJ A;  2X6H A;  3CHQ A;  4YDW A;  3HXC A;  3Q9N C;  3AS4 A;  4EZK A;  1QYM A;  5KCM A;  2ILR A;  4WNG A;  2XGS A;  3FUH A;  4K5B A;  4G25 A;  4K5A B;  4I1A A;  2ETB A;  4I1M A;  3UTM A;  4UQY A;  2NYJ A;  3E4B A;  4N5C A;  2J09 A;  1TYQ G;  3DST A;  4LNU D;  4CGW A;  3ASF A;  2P9K G;  4G2V A;  3S7D A;  1BPO A;  3AG3 E;  3MZL B;  1E7V A;  3G2T A;  2Y4U A;  4JPS A;  2EQX A;  3TWR A;  2WXM A;  3NQP A;  3MX3 A;  3UIP C;  1Y6I A;  3CHP A;  1BLX B;  1N9A A;  5HRY A;  1DVP A;  5C2Y A;  1P5Q A;  2VGE A;  5FIO A;  2VGY A;  4HB5 A;  3ZVV A;  3O4Z A;  1O1R A;  3ZW3 A;  2KAT A;  2I9C A;  3FDH A;  2FO1 E;  4DI4 A;  4LUN U;  4GTO A;  1N4P A;  3EHQ A;  4KZ0 A;  2F0Y A;  3S7J A;  3TWQ A;  3ONK A;  4L2L A;  1JPL A;  3DWL G;  5T8I A;  4CGV A;  1WG0 A;  3PVL A;  1G3N B;  4XZ4 A;  4UI9 C;  3D9I A;  4B0Z A;  3PZ4 A;  3JXI A;  3GZ2 A;  3OXL A;  4GAA A;  2EIK E;  1KZP A;  4I9E A;  5E76 A;  3PE3 A;  1Z3Y A;  1WM5 A;  1MHQ A;  4CT0 A;  2IJG X;  2ZU6 B;  2BTD A;  3CKB A;  3BG0 B;  3CHS A;  3ZN3 A;  3FY4 A;  3QKY A;  3Q73 A;  2KCK A;  1N94 A;  1D9S A;  1JUQ A;  3AU5 A;  4O1P A;  3C72 A;  3FFL A;  4ILG A;  3UT8 A;  5CRV A;  4HLL A;  4GA0 A;  1Z5S C;  3KEA A;  2R02 A;  3TWU A;  2HE0 A;  1HS6 A;  3FHE A;  4CZ2 D;  4OVV A;  4F53 A;  2VTB A;  3FUN A;  4AY5 A;  2Y3A A;  1MQS A;  3GZS A;  3L08 A;  1RW2 A;  2WXF A;  3TAX A;  4GZ5 A;  4XEI G;  2KC7 A;  2XS1 A;  4G23 A;  2IQC A;  4OVU A;  1QNF A;  5ENR D;  1KT1 A;  1E96 B;  4CDM A;  2J8S D;  1HE8 A;  2I6H A;  3ONL A;  3IBE A;  3E32 A;  4BTB A;  5D0Q D;  2IFU A;  5CMY A;  2H6F A;  2WB2 A;  2WQ7 A;  3EIJ A;  4I2W A;  3N71 A;  2CFZ A;  2ZIS A;  4GU5 A;  3AS5 A;  1MX6 A;  2Y0B G;  3EUV A;  4U04 A;  2FUL A;  5D2M C;  2IO3 C;  3OAW A;  3APF A;  2RKK A;  1LD8 A;  3BU8 A;  3ZXS A;  4AY6 A;  1SA5 A;  1S63 A;  4N3C A;  1D8E A;  4ANX A;  4KXK B;  1SA4 A;  4AVX A;  3UM2 A;  3MV3 B;  4G8L A;  3I4R B;  3CVU A;  1TNY A;  2XRZ A;  4ILH B;  3FUD A;  3RRM B;  4KVM A;  3C98 A;  2GRN B;  4NAC A;  3C3R A;  3EU9 A;  2RD0 A;  4MBG A;  1AP7 A;  3ZHE B;  3DSU A;  4GTQ A;  4URK A;  4Q69 A;  5J08 A;  2XPY A;  2P9S G;  4GTM A;  1K1B A;  3MYV A;  2WXI A;  3JQ0 A;  3TWT A;  3FUF A;  3FUM A;  1S70 B;  3B7R L;  2LSU A;  3JUE A;  4J8F A;  1E90 A;  4O60 A;  3SFY A;  4UWL A;  5HQ8 A;  3TWX A;  3HXB A;  5HI7 A;  5ARG A;  3SZ7 A;  1ELW A;  3QK0 A;  3QAQ A;  4BT8 A;  2XGO A;  3OTN A;  3U66 A;  2CG2 A;  5DIZ A;  2P9U G;  4CT4 A;  3V79 K;  1VDY A;  4RG6 A;  3RRN B;  4I6G A;  1OT8 A;  1HZ4 A;  4L7T A;  2CHZ A;  3HVE B;  3VTY A;  3FTY A;  3ASO E;  4XI0 A;  3ESL A;  2QFC A;  3SFZ A;  5AJL A;  4JHJ A;  1WY6 A;  4UI9 J;  1KZO A;  4GMR A;  3QC1 A;  4BWR A;  1LF8 A;  1UG3 A;  4DI3 A;  3CIA A;  2PM7 A;  3QB2 A;  5CHE E;  3PZ1 A;  3MKQ B;  3Q4A B;  3IXE A;  3HXF A;  5CCL A;  2AXZ A;  4KZC A;  3PNL B;  4V3I A;  4GCO A;  4GYO A;  2GRL A;  3IHY A;  3WXX A;  4YVO A;  3I5P A;  1E8Y A;  2C0L A;  2OVF A;  4GPM A;  2YHC A;  5FQ6 A;  1FT2 A;  5G04 C;  4J8D A;  3HHM A;  3ZFW A;  4TV3 A;  2AWI A;  3B7U X;  4FC8 A;  3GZ1 A;  3ASH A;  3ASD A;  5BT1 A;  4C0M A;  3R7Q A;  5J90 A;  2VSY A;  1TNZ A;  2GRO B;  4B89 A;  2GRR B;  4WUY A;  4U95 D;  2AXU A;  1U3D A;  2C0M A;  2Q7F A;  4BT9 A;  1H2V C;  5CED B;  2X6J A;  1NA3 A;  3DXK G;  3FUE A;  1V55 E;  2CHW A;  3FUJ A;  4JW1 A;  4K0R A;  1OWO A;  4HS2 A;  3UUX A;  1JCS A;  4BY6 A;  3S7B A;  3TG4 A;  4MS6 A;  3MV2 B;  1K3Z D;  1N52 A;  2NXP A;  5EN5 D;  3KD7 A;  3CVY A;  3GYZ A;  4JEH A;  1HFA A;  3Q5M A;  4WWP A;  5BW8 C;  4PS3 A;  2BED A;  4ANV A;  2PZI A;  2MHK A;  5D66 A;  2WXP A;  3PZ3 A;  2AXV A;  1IQU A;  1SVX A;  5AIJ A;  1WDY A;  1N4R A;  3UX4 A;  3SF4 A;  3SI5 A;  3NBN B;  3B7B A;  5HS0 A;  5KJL A;  2DZN A;  1EPU A;  1PY1 A;  2OOE A;  2QYJ A;  2A5E A;  3Q78 A;  1O5M A;  4U96 D;  3D9K A;  2BF0 X;  4FLB A;  3CK7 A;  4CRW A;  4I17 A;  2HYZ A;  2WXK A;  5B1B E;  2KCL A;  4KT6 B;  3LVR E;  2FBN A;  4B8A A;  2J49 A;  3QAR A;  3DRA A;  4FUL A;  4HQD A;  1N0Q A;  4U0Z A;  2UWJ G;  4GTS A;  4LG6 A;  5ENT D;  4X8Q A;  3FWV A;  2KZT A;  3O48 A;  3UMV A;  2J4D A;  2J9Q A;  3FH8 A;  4QQI A;  2DBA A;  2M63 A;  3ML9 A;  4TXR A;  1N0R A;  3URZ A;  3Q47 B;  4U07 A;  1TN6 A;  4ATZ D;  2WPV A;  2OCC E;  4P29 A;  1N4S A;  4WWN A;  1LD7 A;  4UQZ A;  3LY7 A;  1JWF A;  4HRN A;  2V5F A;  2A5U A;  4FU3 A;  2IU1 A;  3PS6 A;  2KCV A;  3W9G A;  5FWQ A;  2XEE A;  4J8S A;  2WXL A;  5T3R A;  4UWK A;  2AW6 A;  2B0O E;  2IY0 C;  4U7E B;  3R9A B;  1MZC A;  2FEZ A;  4FAD A;  2OVB A;  1HG5 A;  3DBS A;  3AAA C;  4YDY A;  3ZYQ A;  3OXG A;  3JUI A;  3J5Q B;  3QWV A;  5LX8 A;  1KLX A;  5EYP F;  4KYO B;  2ZGD A;  3JYS A;  3DXM G;  3ZNG A;  4DX6 D;  3PH0 C;  2PNN A;  3VLE A;  3RK6 A;  3ABL E;  1FPP A;  3CQC B;  4GCN A;  5EIL A;  4DLO A;  1N4Q A;  3BUA A;  4XE0 A;  5M72 A;  3L16 A;  3L82 A;  3Q15 A;  1IQR A;  4FA6 A;  1DCQ A;  2OV8 A;  4RSY A;  3Q9U C;  5G04 J;  2OEV A;  3RIB A;  2I2O A;  3VLF A;  5AQB A;  1UOH A;  1UN9 A;  4JD2 G;  3MCX A;  3ZYL A;  4E6H A;  5DBK A;  4N39 A;  3B7S A;  5BV0 A;  5FQ4 A;  1OUV A;  1H19 A;  3LJN A;  5FT9 A;  4PS7 A;  2QY7 A;  4JHR A;  1HH8 A;  3G2S A;  1EDU A;  4GB9 A;  3AJI A;  5ANR A;  2XQ0 A;  2V8S E;  1SQM A;  3U3W A;  3EHN A;  2DIW A;  1ZB1 A;  4EBA A;  4F1S A;  4Y6W A;  1OY3 D;  1JWG A;  4LRZ A;  4OAU C;  3B7T A;  5KNH D;  3AG2 E;  4A3V A;  3ABM E;  4GPK A;  2ION A;  3D9N A;  3VTX A;  4ME2 A;  3ZU7 B;  5CEC B;  1A17 A;  2WXQ A;  4AIF A;  3DEP A;  4L23 A;  2IF4 A;  3V31 A;  3ULQ A;  5T4Y A;  3V30 A;  2V4H C;  5FJY A;  5AQ7 A;  2VGX B;  4F3V A;  1X81 A;  2H6G A;  5CBO A;  3L13 A;  3SO8 A;  5JJT A;  2CG3 A;  5AJD A;  3FU6 A;  4I9C A;  2DCP A;  2YNQ A;  4JXT A;  4F7A A;  3UM3 A;  3Q7F A;  5FTP A;  1HF8 A;  3ZKJ A;  3D9H A;  3LJ3 A;  3PEV B;  2XGM A;  2VQ2 A;  2ETC A;  2I1K A;  2PL2 A;  1O1T A;  3T8M A;  1Y8M A;  2A4Z A;  2VTB B;  2UY1 A;  2IO2 C;  3FUL A;  1H6P A;  4EBA G;  2BUG A;  3UI2 A;  5C1D A;  2FI7 A;  4FJY A;  4O6F A;  4D10 C;  4TXQ A;  3UIN C;  2JEK A;  5ENO D;  5KNG A;  3NOG D;  4JZY A;  5ENP D;  1OXJ A;  1H6K A;  5CEA A;  2IOS A;  1V54 E;  4MRU A;  1PC2 A;  2GW1 A;  4AM9 A;  4DX2 A;  4N5Q A;  3UT7 A;  4AP2 A;  1HXI A;  2WMN A;  1N95 A;  1JCQ A;  4HXI A;  2DZO A;  2DWZ A;  3L54 A;  4TXP A;  4U8V D;  3G2W A;  4Q96 A;  3Q79 A;  3EU5 A;  2WQ6 A;  4GA2 A;  3TWS A;  3PNT B;  5BUZ A;  3T8K A;  4YDO A;  3CV0 A;  3LCA A;  1DC2 A;  3OXF A;  3WG7 E;  4EZJ A;  3D9J A;  3HIZ A;  2YHE A;  5BV1 A;  1NI1 A;  2VSX E;  3ULY A;  3PZ2 A;  3HDX A;  5AYW D;  4UQX A;  3R7R A;  4J6I A;  1ZU2 A;  3ENE A;  4G8K A;  4HBD A;  2PM6 A;  3LY9 A;  4GTV A;  1A5E A;  2E0I A;  1OWM A;  1DCE A;  3T9K A;  3FEY A;  2OND A;  1TR4 A;  4HVB A;  3DSV A;  2HR2 A;  3G2V A;  1NA0 A;  3R9M A;  3EIQ C;  3NF1 A;  4JA7 A;  3QWW A;  1NFI E;  4J7W A;  1TN8 A;  4ANW A;  3LVQ E;  3CQG B;  3FTX A;  2ZXW E;  3RO2 A;  2AVP A;  3JQ1 A;  4N2Q A;  2XEH A;  2L0I A;  1QZ2 A;  4AJW A;  1MX4 A;  4WND A;  1HU3 A;  3CVX A;  1SW6 A;  4N2S A;  1OCR E;  1W3B A;  4UWH A;  1UW4 B;  3SQV A;  1TNU A;  2L0T B;  4F1P A;  2J08 A;  3ZYM A;  5EIB E;  4E85 A;  1YYH A;  3RSE G;  4JB8 P;  5A7D B;  3K9I A;  3L9T A;  2LNI A;  4WNE A;  4NRH B;  2L6J A;  3F6Q A;  4DJA A;  1ZBP A;  4U0U A;  4XKC A;  2R03 A;  2IEJ A;  5B3S E;  1B89 A;  4GYY A;  2CFU A;  3AG4 E;  1UJJ A;  2H6I A;  5LCW C;  1BU9 A;  1H6O A;  3U4T A;  3ZRH A;  1Z6T A;  1IXV A;  3APD A;  5JHA A;  2LAH A;  2DVW A;  2YQ8 A;  3X2Q E;  3LDZ A;  3UKR G;  4GTT A;  2P2C P;  3CVL A;  2ZGG A;  4J8E A;  2XEN A;  4XX5 A;  1HO8 A;  4IRU A;  3CK8 A;  3NB2 A;  3FU5 A;  3CVP A;  5HKP A;  4N3A A;  3LKU A;  5JJ6 A;  1OWP A;  2RG8 A;  4GA1 A;  3CLJ A;  2EIN E;  4MLP A;  2WMO A;  2JLB A;  3E30 A;  4A63 B;  3FUI A;  4TUM A;  3D9P A;  1BD8 A;  1TJF A;  3CKC A;  3KSQ A;  3LY8 A;  4HFG A;  1E8Z A;  2ETA A;  4C48 B;  2GRQ B;  1D8D A;  3DPY A;  5G2N A;  3FH5 A;  1YCS B;  2B6C A;  4I43 A;  4HOS A;  5CER B;  3RAU A;  3UIO C;  2F8Y A;  2F37 A;  4UI9 K;  4L1B A;  3TWW A;  1UJK A;  4C9B B;  1QBQ A;  3UXG A;  3MA5 A;  3HRA A;  2R05 A;  4BSX A;  1FT1 A;  3ZYK A;  3U64 A;  3HXD A;  2I1J A;  2R5S A;  3C3O A;  4HNA D;  2MYO A;  1NZN A;  3UM0 A;  2RFA A;  2V0P A;  4U8Y D;  1XGW A;  5ENN A;  4ACK A;  4RVB A;  4J0U A;  2NSZ A;  3I4G A;  3RJV A;  2LXM A;  3MKR A;  4UUC A;  5JJ7 A;  4HI9 A;  5FIN A;  2R17 C;  4DRX E;  2P9L G;  3SBS A;  2GRM A;  5BXU A;  3SGH A;  4MKT A;  2KZT B;  2X38 A;  2QZA A;  2E2E A;  3LEW A;  1OCZ E;  4FP7 A;  1TJC A;  4A3T A;  3ZEF A;  1MX2 A;  2LSV A;  4Q94 A;  1N54 A;  3KS2 A;  4L2Y A;  3BQO A;  4CEM A;  3L6A A;  1OWN A;  2Y4T A;  3CVW A;  2BKG A;  4AOF A;  3FP3 A;  2H6H A;  3FTS A;  3TJP A;  4EPZ A;  2EIL E;  1K1A A;  1OCO E;  3S2A A;  3J5P A;  3CGH A;  3QOU A;  2MOW A;  4APF A;  4TUU A;  4AXH A;  5ENQ D;  2AJA A;  4KMO A;  4R7L A;  3S7F A;  4AEZ C;  2V4L A;  1AWC B; 
#chains in the Genus database with same CATH homology
 3ASN E;  5B1A E;  5B3S E;  2EIL E;  2OCC E;  2Y69 E;  1OCO E;  1OCZ E;  3AG4 E;  3AG1 E;  3ABL E;  3WG7 E;  5B1B E;  3AG3 E;  1OCR E;  1OCC E;  2DYS E;  3ASO E;  3AG2 E;  1V55 E;  3ABM E;  2EIM E;  2ZXW E;  1V54 E;  3X2Q E;  2EIJ E;  5IY5 E;  2EIN E;  3ABK E;  2EIK E;  2DYR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...