1OD6A

The crystal structure of phosphopantetheine adenylyltransferase from thermus thermophilus in complex with 4'-phosphopantetheine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
155
Chain Sequence
MHVVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLENQYLFSAEERLAIIREATAHLANVEAATFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE
publication title Structure and Implications for the Thermal Stability of Phosphopantetheine Adenylyltransferase from Thermus Thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 57
structure length 155
sequence length 160
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2003-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1od6A00
2DUMA 3PNVA 3QTBA 1M8GA 3INNA 4NAUA 2EL7A 4MVYA 1VBKA 1KQPA 1G8HA 2PXHA 2X1LA 2IJGX 1J70A 1K4KA 5H16A 3K32A 4G5FA 2WQ6A 3IMCA 2JA2A 3X1KA 2A1UB 4I6JA 4ZCPA 4EG5A 2E18A 1N2EA 4U63A 2V0CA 1WXFA 1J20A 2E21A 1GZUA 4MW0A 1OBCA 2DETA 1TQ8A 1KP3A 1ZH0A 3VRHA 4ZCTA 1MRZA 1A8HA 4JZYA 3IMGA 4ZT4A 3QE4A 3CLRC 4A91A 1N78A 1M83A 3FHJA 1V47A 5LFAA 1H3FA 3FNRA 1PG2A 2QJFA 4UZFA 1PFYA 3G5AA 4R2MA 4YP5A 1O96A 3RFFA 1TYBE 5AHWA 2DPLA 1N2HA 1K97A 1WOYA 3G6KA 4CDMA 1WXHA 1IHOA 1WZ2A 5KWVA 1EE1A 1PFWA 3TS1A 2I1LA 4HJRA 4ZCSA 1NP7A 5JBNA 2Z3VA 2X3FA 4MUIA 4XSVA 1JECA 5KHAA 3NBAA 3DPIA 1M1ZA 2XRYA 1KH1A 2HZ7A 3KT3A 2A84A 3OTWA 3P0IA 3ISJA 4G6ZA 1FFYA 1QQTA 4R0NA 1KAMA 3C8ZA 5BNZA 1ZH6A 2DLCX 2RE8A 1U7DA 1MC1A 1WKBA 3UK2A 1YIAA 3A04A 1MOPA 3MLBA 2DERA 2QTRA 5IHXA 2H2AA 3AL0C 4HPWA 1QU3A 3CLTC 4P2BA 2J4DA 4KKVA 1GN8A 1KKUA 2JANA 5IJXA 4QREA 3A05A 4AS1A 4ARIA 1IQUA 2A88A 4ZT6A 2V0GA 1PG0A 5HG0A 3IOEA 1T6YA 2YXNA 1N77A 1JGTA 1NUTA 3TQIA 1H3EA 1COZA 2R5WA 3X1MA 2IELA 4MVXA 1Q11A 3ZIUA 1NUPA 2Z09A 1H3NA 1O0BA 3GLVA 1I2DA 1O95C 1GLNA 2WB2A 1F7UA 4G5YA 1U7XA 1YUMA 1VL2A 2D54A 4F3RA 1QU2A 2QTNA 5J5AA 2E89A 1IQRA 3DO8A 1X6VA 3K9WA 1IVSA 1S4MA 3OP1A 3U1VA 1G8GA 3TZEA 3IMEA 4DDMA 4MVWA 1QJCA 4MWEA 3M5WA 1EFVA 4ARCA 4CT0A 4BWVA 2X1MA 1QTQA 1XNGA 1M8JA 2IP1A 1V8FA 3ND5A 2CYAA 1N1DA 3L93A 2B7LA 1GPMA 1HYBA 1N75A 1WQ4A 3N9IA 3FOCA 1OWPA 5EKDA 5LM3A 1EUYA 2TS1A 2CV0A 1Q19A 4WSOA 4XFJA 1OBHA 2VTBB 1LI5A 2CYBA 3KT8A 3FDXA 3CLSC 3FI0A 4EG6A 1QRUA 2PIDA 3KT0A 1YUNA 3H9BA 4K0RA 4RUKA 4MVCA 1NZJA 1JZSA 3SEZA 1QNFA 4S1OA 3CVWA 4JXXA 1H1TA 1NUSA 4WNYA 1IFXA 3IVCA 2QJTA 2J07A 1O6BA 1OWMA 2NSYA 2CT8A 1QRTA 3ZGZA 3IUBA 4EFKA 2GM3A 2CYCA 3COVA 1EUQA 3L92A 4KPUA 2WQ7A 3MUEA 3CLUD 1NUQA 3IOBA 3Q10A 1F9AA 1KAQA 4MW5A 1IQ0A 4QRDA 1O5TA 1WQ3A 1UFVA 4I6GA 3S3TA 3N05A 1F7VA 3Q12A 4JFAA 1O97D 5DASA 4YP6A 1NURA 1OWOA 4XFDA 3COYA 4CQNA 1EJ2A 1R6TA 1J1UA 1LW7A 1Q15A 1VBMA 4F4HA 1Q77A 3IOCA 2A1UA 3H97A 1EFPB 4NZPA 5HUJA 1EXDA 1KQOA 3HMQA 1JIJA 4EG3A 4MAFA 3FY4A 1ZUNA 4NX2A 1D2RA 3IVXA 4OUDB 2RD2A 3FWKA 2Z08A 4KR7A 4MW1A 4MUJA 1M8KA 1TYDE 2ZUEA 2PZBA 4MUNA 1T9GS 5KCMA 4AQ7A 1XJQA 2JAXA 5TGTA 3RBAA 1VBNA 1JMVA 4JYZA 3ELBA 2A7XA 1JIKA 2J09A 3PNBA 4TS1A 4PBRA 1NUUA 3I05A 4DDKA 3MMXA 2YY5A 3LCJA 3A2KA 2AG6A 2GOYA 1LI7A 5FNZA 3QTTA 3VGJA 2PZAA 1KQNA 3ZUGA 3ND7A 3PXUA 2ZUFA 3SEQA 1OD6A 1MB2A 3UOWA 3ZXSA 1O94C 2CSXA 3MLAA 1IRXA 1NSYA 4MLPA 4L2IB 4PY2A 1DNPA 4DDHA 3AFHA 4Q93A 2YWBA 4KR9A 4EGAA 4MUFA 3P0JA 1GTSA 2QUJA 3A4IA 2YWCA 1Y42X 3ZJUA 4MQ6A 4DJAA 1J09A 2OQ2A 1CT9A 2X0KA 1B6TA 5DB4A 1N2OA 3AG5A 3F3MA 3NV7A 4ZT5A 3AKZA 4EG4A 3DLAA 1JZQA 1MAUA 4ZT7A 5TS2A 1MJHA 2QTMA 3IUEA 1R6XA 1WXIA 1O0CA 4EG7A 1ULHA 2D5BA 4DLPA 4MW2A 1T9GR 2QUIA 4OJMX 2ZP1A 3P52A 3SZ3A 3ILVA 3RK1A 5K0TA 2DR2A 2PFSA 5DK4A 1SURA 4Q16A 5K0SA 1RQGA 1P7PA 3TNJA 3CLUC 1J1ZA 1F4LA 1O95D 3N2YA 3GUZA 5TEWA 3COZA 4J75A 1QRSA 2C5SA 3RK0A 1O97C 1BS2A 1G59A 1JEDA 2QUKA 1U3DA 4MUEA 3ZJTA 3UY4A 2BYTA 3CVUA 1JHDA 1WXEA 4MUKA 5FO1A 1J21A 3ND6A 3SP1A 2AZXA 3COWA 2DXIA 1WY5A 3D6VA 4J76A 1M8FA 3MXTA 4GU5A 1MB9A 3TQOA 1KORA 2VTBA 2CV2A 3N8HA 4ND6A 1MAWA 3D6UA 3FH0A 1X8XA 1O96B 4R2LA 5J58A 1U0BB 4KR6A 4GRIA 3UMVA 3IH5A 3IVGA 2EJCA 4U7JA 1PFUA 1I6KA 3H05A 1TYAE 4HK4A 1ZJWA 3Q4GA 4YBRA 2A1TR 1OWLA 3CLSD 2G36A 4MW6A 3CVXA 2A86A 2D13A 3KT6A 3LE8A 1T6XA 4MWDA 3RHSA 1YI8A 1N2GA 2BTEA 2CFOA 4NAHA 1PFVA 4U8HA 5H7XA 1I6LA 4H3SA 4MW9A 1G8FA 1K4MA 4YMIA 3KFLA 1GTRA 2GKSA 1TYCA 3AIIA 1TFUA 4MUHA 1ILEA 3SZGA 3DV2A 2J5BA 1N2IA 3FETA 3CLRD 3RJZA 1EFPA 3JXEA 4ZCRA 1XNHA 1K92A 2WSIA 3SDBA 3P0HA 4CDNA 4X0EA 4ZT2A 4DNXA 2A4MA 3PNYA 4OUDA 3VU8A 1JIIA 2OV4A 2PZ8A 2QJOA 4YP7A 3CR8A 3H99A 1MBZA 4ZCQA 1NI5A 5TEVA 4UZEA 2VXOA 1OWNA 3BL5A 1KR2A 3CA8A 3HGMA 2DEUA 1VLHA 4MWBA 4MWCA 1KH2A 1JEEA 2O8VA 3PRHA 4MW7A 3E27A 1R6UA 4ND7A 1N2BA 3IODA 2E0IA 1U3CA 4MULA 2AKEA 3FIUA 4HJXA 5FO0A 3NBKA 2A1TS 4RPIA 5DEOA 4EF6A 3TZLA 4PBTA 1EFVB 2CUZA 4E1AA 2J08A 4MUGA 3HFJA 3SYTA 1N2JA 1WXGA 3GMIA 3CLTD 4QBTA 3G59A 4MW4A 2XRZA 3ZJVA 4L2IA 2PG3A 4DE5A 4EG8A 1TEZA 1T6ZA 1NYLA 1KP2A 4PBSA 5HUHA 3HZRA 4NDAA 3HV0A 3LOQA 3X1JA 1O94D 3H9CA 1YIDA 1M8PA 1GAXA 3CVVA 1YULA 3AG6A 5F23A 4ZT3A 1WJGA 3CVYA 3UC5A 3IDFA 2HMAA 4FZJA 4JXZA 1I6MA 1KH3A 1IH8A 4NATA 5J59A 2O5RA 2NZ2A 3FG9A 1N3LA 3ZXIA 4K03A 4EG1A 4KPUB 2H29A 3HL4A 4I6EA 1XNJA 1FYDA 2HGZA 2QUHA 2CV1A 1JILA 5LLTA
chains in the Genus database with same CATH superfamily
3O4FA 1L8XA 2QSJA 2Q6IA 4F3TA 4MRMA 3B1JA 1CJBA 1MKYA 1TCBA 1VRWA 2VTVA 4PNHA 4QEZA 1VBKA 1G8YA 1QZZA 3AR3A 5EMHA 1WP9A 1KDOA 5BR4A 3O0TA 4AN4A 4MWOA 1DRJA 1NY6A 3JZFA 3TLEA 3X1KA 4EI7A 3CEHA 1UAAA 1C3OA 2JVKA 3IQXA 2G1KA 1D9XA 2BFBA 1B16A 4LXYA 1LV8A 3JQPA 4NVRA 5AK0A 5EWMA 1XALA 4YVFA 5JWOA 4IV0A 1BQ4A 1AA9A 1N6OA 3FNQA 3T7DA 4GI2A 3HB7A 2IIVA 4PANA 4GPD1 4IFBA 4RSRA 2OPHA 1Z36A 1QE5A 3DB2A 3FFAA 3H16A 3JVDA 2C7OA 5FJIA 4J2TA 4M9ZA 1W6RA 1ENOA 2VJPA 3D2BA 3S1SA 1ONSA 2C4HA 1BG6A 3B38A 3IMGA 4JIMA 2XGSA 1QB7A 4F4JA 1NBIA 4R1PA 3CLRC 1E3DA 1YHYA 5CEFA 1V47A 1DKRA 3EVNA 3R3WA 5DNVA 2H4XA 2NTJA 1RFGE 4QLOA 2HPVA 3HR4A 3OKAA 1DQSA 2ISQA 1SEPA 3EXHA 2HSGA 3GLIE 3EGOA 4QGFA 4BS9A 4B83A 4B6FA 1TYBE 2H65A 2H1CA 2QL9A 4L8LA 2QYSA 2G4CA 4ZAVA 3UAGA 4OBXA 5L7TA 2G1PA 1Z38A 3ROXA 1LSSA 4GXRA 4D9GA 2Q5JA 4DV4B 2I1LA 4BQFA 1K7YA 5FWXB 3ETCA 1Z0DA 3E9NA 2DOKA 3C6YA 3ZDXB 4QTUB 3BGOS 3K8ZA 1KIAA 4ENPA 3SHWA 1WDWB 5CA1B 3MB8A 3S2GA 1IONA 1JSCA 1V16A 5J1SB 2EIHA 2ZAYA 1QHEA 2WDZA 3VH2A 1R88A 3DHVA 4BMCA 4YGYA 1GZVA 4II7A 1VHLA 1X0VA 1YB5A 2QW1A 1VKOA 3U1BA 4OI1A 4CMKA 2Q6VA 3M6MD 4QBHA 4NECA 5IAGA 4CLDA 2WZQA 3EPJA 1XYYA 3UMCA 3LTNC 1I3KA 4RD3A 4TMKA 5G0WA 4LBYA 1G66A 1ZIOA 2EDCA 2GFHA 2K87A 1HE1C 2ADFA 3C5HA 1ORHA 3ORQA 2PL1A 2H2AA 3H11B 4PTYA 2RHLA 3M4YA 1IULA 3K9LA 4O08A 3E81A 3KPVA 3T3DA 3UW3A 3CF0A 4A8TA 1TZKA 2XMZA 3MUOA 1NWHA 3OFNA 3I1YA 4U0JA 3RIGA 5HJ5A 2XXAB 1K75A 2GKOA 5DPMA 4ZEOA 3RREA 3WL5A 4CQMA 1F2TA 1Y1TA 4P92A 2JIZD 4C5BA 1Z2EA 1KSJA 4NMWA 3BA1A 2VT3A 1GGNA 1L5MA 4PLPA 5LN1A 1M1YE 2ZJ3A 2DWCA 3C15C 3NBMA 3M33A 1L8QA 4XIFA 2FSGA 5K1ZA 3GAZA 3VR3A 1C1XA 1QCYA 4OSEA 3NATA 4WVLA 3ORYA 4IMRA 1R37A 3LW8A 1AB5A 3GCWA 1SGWA 4JLKA 1E6KA 3FPKA 4FX5A 5F21A 1WW8A 1X39A 2GAJA 2Y3IA 2Z9DA 4KIUA 2VJQA 2GM4A 3E53A 1YUMA 4B4UA 1II8B 2XQJA 5CT9A 3FSRA 5IN4A 4B3XA 1S4MA 1IVSA 3STYA 1Y8QB 3GEBA 3FUUA 4YRCA 3RTDA 1TQ2A 3EG9B 4G8BA 3U3MA 2WI8A 4RNDB 3F78A 4K3VA 4KXYA 4RXTA 4ZU6X 3T6KA 3W4KA 1Z5UA 4GPIB 3S28A 1XKLA 3LC0A 2ESRA 3ZGYA 1VCIA 2E55A 2IEBA 3RBXA 3L77A 4KXNA 2EJBA 4WBSA 3Q0TA 4EDHA 2FWAA 4JL5A 1ZW6A 2VA8A 2H08A 3UWDA 3R9WA 4CDGA 1RMTA 1ISIA 2JLSA 3U4QB 2O8EA 1OYWA 2AJDA 4HG2A 4J2HA 3ECSA 3BJRA 3GDFA 3L93A 1LB1B 1XXHA 1GPMA 1ZONA 2B7LA 2F00A 2FWIA 3MFYA 4O33A 3T34A 5LM3A 2XQFA 3S7ZA 1WL8A 2CV0A 1HMPA 5D7NA 3D8TA 5JNVA 4LAFA 1GPUA 4DILA 1QNLA 3DBRA 3W9YA 1M5RA 4DPLA 3IEMA 3IXLA 1UT5A 1NZJA 3PXAA 4CZ2A 3K70C 1O6ZA 2P9QA 3DE6X 1QNFA 4XASA 1UBUS 2FZ5A 1JB1A 2Q99A 3O4IA 4IDOA 3NYQA 1KMCA 2BONA 3C1TA 5EMJA 4EUSA 1H5QA 1C0EA 2WAXA 3ADOA 4KXMA 2QR3A 5FOUA 3U81A 2BHTA 3WHKA 3UGJA 2P2SA 1RYYA 3EGDA 1EXWA 4Z8XA 4GGPA 1WNTA 2AC7A 4G0UA 2NSDA 4GECA 1NUQA 1J6UA 2CD9A 2QEQA 2C5HA 1JKJA 1WQ3A 3BCSA 3ICOA 3OOWA 4JQZA 4MS3B 2Z4SA 2XIJA 3FLEA 4DEXA 4KZKA 5EXSA 3KKKA 2FR8A 1QAOA 1YBVA 1OIXA 2E4YA 2Z56A 3EMDA 4B2IA 1NBME 4F84A 1IN1A 4AURA 1KI8A 1U8UA 3BE5A 3SF8B 3QG1A 1RWQA 2C5AA 4YJ2B 1GQFA 1BNCA 1EEXB 2PA0A 4O25A 1CFZA 1JG1A 4QAJA 5KTNA 4ZOLF 1Q7CA 3AEUA 1LVUA 4K28A 2QP3A 4PAMA 4AP9A 4NZPA 1AQJA 2IVFA 2P77A 4OXKA 1W7AA 2NP7A 5CJPA 3W90A 1R3DA 3A1VA 3B1FA 3E22A 5DGCA 1HZJA 3OPQA 5IM5A 1UWLA 2PWAA 2BCJQ 1QSGA 2Q27A 3GMSA 2DUUA 4BNDB 3ZDDA 4OTZA 3PLNA 1Z25A 2ERXA 2Z2JA 3DMHA 3E9YA 2ZUEA 4FZ5A 2QHXA 3UWPA 1PNRA 1TA0A 3FTFA 2VNJA 4UM9D 2FDRA 2ORVA 4JUDX 1UOPA 5KCMA 2R7KA 5EJ9A 2RAVA 5AW2A 4LXQA 1XTZA 4JD5A 1ATZA 4UCFA 1GUDA 4PNEA 1T9HA 1KO4A 8AT1A 4QFDA 1K88A 1EQUA 2EKQA 3PNBA 4P4TA 1DLJA 3HYLA 1G41A 2GPTA 1JR2A 3PFHA 2ZYRA 1UOOA 2AG6A 2H17A 4RDXA 5FNZA 2NU7A 2JH8A 3C3XA 1REQA 2IEAA 3HB9A 4HP8A 4IR7A 4J0JA 4JLDA 4P7BA 4RVOA 1BKYA 3WYNA 3ZJ5A 4DDUA 4M1EA 3BHIA 3LECA 3J80A 3ZW7A 2O6LA 5EXEA 4WDRA 4AJEA 3ND7A 5FTNA 5REQA 2ZUFA 8ATCA 3SEQA 1N3YA 1BW9A 2ZJAA 3THRA 2ZYSA 5EHXA 2REXB 5F78A 1RC8A 3I2HA 1RXSA 1KI2A 3MG9A 1PJRA 4GOXA 4U2GA 4PY2A 1MX3A 2VK8A 2ZR9A 3ILXA 2PX5A 4OQEA 4ZPJA 1PE0A 5FPPA 6LDHA 4H60A 1XPJA 1RBMA 2NU9A 5HRAA 5CCBA 3SG0A 1U1IA 3GGSA 2YVKA 3CV3A 2FPOA 1L5ZA 3DL7A 3QMMA 3IDOA 1VLZA 4TV9B 1TO6A 1OLXA 3GA7A 3P0JA 4EY3A 2WFLA 3TSYA 2QUJA 2WYUA 3HBNA 4D3FA 1BE1A 2DTDA 3JQDA 1SKYE 4DVJA 1DIRA 2K6GA 1C29B 4ETMA 1VJ5A 2H2WA 4UQOA 1FF9A 1S01A 4PLFA 4QZVA 2CCJA 3TLMA 1S2DA 3BDVA 1V1RB 3WDLA 2BFPA 3RKUA 3VPXA 3DMGA 1XDWA 1H93A 4OGKA 3TEMA 2A7QA 3BB4A 3Q85A 4U6QA 1AQNA 1SOUA 4EFLA 5BR7A 4OQXA 1DRVA 3B70A 4I55F 3V32A 3TM5A 4BBJA 1O94A 1I0ZA 4R05A 5H82A 4LZNA 1MAUA 3BB3A 3G9UA 4BLWA 2CHVA 5ADUS 2OHXA 4EGJA 4LZAA 5JEEA 1TUBA 3TD2A 4BO6A 2CL0X 4QPDA 3K0KA 1TX4B 3SNKA 4KRXA 4G5RA 4YMSA 3AVPA 4KC0A 3OKCA 4FE3A 1T9GR 4O4IB 4CI0B 3P52A 1F0NA 3BA6A 3UUGA 1AKQA 1XCGB 2NTYC 2YIDA 3BK7A 4MRMB 3ZHRA 5FPKA 7ADHA 1P75A 2GN9A 1KC1A 2BDUA 3GXOA 1Y1LA 3IP8A 1T2AA 5K03A 5KX5F 4MKGA 3QX7A 2GRUA 3AT1A 4UXIA 4MYDA 4FHFA 4B35A 3QENA 2WFMA 3P2OA 2P9GA 1QHFA 1C3OB 1L4BA 4JBNA 5DHRA 1IE3A 2BFBB 5EWMB 3OESA 5B3JA 1UWVA 3EDQA 1C80A 2IV2X 3U40A 1DJNA 3KC2A 2WD9A 3PEUA 3OOEA 3KKNA 4N6OA 4FDVA 3OD1A 5K3SA 3W6NA 4JHXA 5LP6C 5IBRA 1H6BA 4A6EA 2IV3A 1H2HA 3SP1A 2H0AA 3CKLA 2HQRA 3MS2A 4Q1VA 3UK6A 1DKQA 1P4GA 1WY5A 1WW3A 2H9YA 2VF8A 3DE3X 5IZCA 1BXZA 1JYSA 1Y0BA 1Z29A 2ANBA 2J4FA 3BJEA 3I04M 4BQEA 1ZGHA 2XB2A 3OU7A 2AA3A 4MK4A 2WMYA 4LA4A 4ND6A 3CWCA 4IUYA 5BO5A 4XD7D 3TRJA 1UQTA 1RR6A 1X8XA 4N5DA 1V41E 5FAKA 4LHSA 3MIIA 1NRXA 2VDOB 3CUSA 2XQIA 3VVCA 5KINB 4GQBA 5FOSA 1ML4A 1R2QA 4MB6A 4B4VA 4M7PA 1T4DA 4QX6A 4X65B 2EJCA 1ZOLA 1J24A 1DDOA 3UAXA 4L8VA 2I03A 2QG9A 4GMDA 2H2FA 3H65A 3NEAA 5DLDA 5FV7A 5U4QA 2GCIA 3C3BA 2Q50A 4YC7A 2A86A 5CVEA 5HM8A 1IDOA 1T6XA 4MWDA 1Z2PX 4HNQA 1CJUC 1MNAA 1N7HA 3PDUA 4JSTA 3CM0A 1NONA 3SHQA 1MG5A 3WL7A 2E4UA 3WKDA 4AZ3A 4BOYA 3NAQA 4BEWA 1V16B 4WERA 2UXBB 3ZG6A 4U4AA 1NW5A 4BB5A 4BCDA 1LGYA 5EHIA 4MDFA 5IDQA 2HGSA 3TIVA 3VZCA 1LPSA 3UPTA 1HYEA 3UXMA 2J4CA 3ONVA 2EQ5A 4FKZA 2UZ1A 2Q3DA 2XGJA 1FSZA 4UBIA 3AIIA 3SF0A 3O2SB 3BRCA 1PR4A 2ZVDA 5JAIA 2GZ2A 1FFBA 1RWNA 4H1HA 2NAFA 4AF7A 1XMOB 1GTL1 1YI1A 2GARA 4FNGA 1QLWA 5DWQA 2JFQA 3S1LA 1UEIA 2Y27A 2W83A 3PYXA 3F7OA 1N9GA 3W2EA 3RS4A 2NV6A 3RJZA 4ZYWA 3C97A 4ITUA 1Z7EA 2OC4A 1MEEA 4IDNA 1K6EA 4PG4A 4TVBA 5F76A 3SDBA 3ZCUA 5KJFA 1E6WA 1F2TB 1DI0A 1THMA 1XZEA 2LXNA 4GMXA 4N5IX 1QVAA 4WE3A 4WJZA 4KFCA 2O7VA 3T41A 2BLLA 4M1ZA 5LLSA 4GKVA 2WOOA 2W2OA 1H0KA 1C1XB 4ZMRA 1GUYA 3RAEC 1DXQA 3TUJC 2ZUCA 4AY2A 1R66A 1CIVA 5DJ5A 4E6EA 3AI1A 1HURA 1JFRA 2XUOA 4I99A 4QXMA 3O4HA 2BR3A 2JCXA 2NZJA 3BL5A 2JJQA 2OBBA 3VR2D 4G65A 5BW8A 4C01A 2X8JA 1RKXA 1E1QA 2LVBA 1XI2A 4QVGA 4EHFA 1SBIA 3GEEA 4KLZA 3QY9A 3DLCA 4MV5A 2JGRA 1MTOA 4LYJA 3E1GA 5AOVA 3TB4A 4BVJA 1P33A 1ORDA 2L19A 3PRJA 4MLDA 5EQFA 2VQFB 4C4TA 3C3WA 2G08A 2AVNA 3N8IA 1Y4ZA 5KVCA 1GPNA 3VR4D 4XD2A 3V34A 2TYSB 3W6ZA 4NE2A 4UREA 2VVTA 4ZVTA 4C14A 4JT8A 3G0IA 1U6JA 1UK7A 5E3IA 3ITNA 1D3AA 3O2JA 4ILKA 4KE8A 4Q9NA 2PKQO 5JQWA 1GZHB 2YXLA 2O8EB 5I01A 3SFTA 3AUFA 1CK4A 2JATA 4AY5A 4ONEA 2NO1A 1N0HA 1N8KA 1XXHB 1UJ2A 4OIFA 1CUIA 3FFTA 3VYWA 4YMWA 1BSVA 3FDZA 2R4UA 1TVCA 4A0HA 5A5VA 2I1QA 1I4TD 3G13A 2FYTA 2X86A 2AFVA 4YP1A 3D7LA 3DBRB 4N01A 5CGQB 3C16C 1BH6A 4NLLA 3RS3A 5KOJA 4AL4A 3L0SA 5AVKA 1OGIA 3K9CA 2VAXA 3RSQA 2WF7A 4D4LA 2BY4A 1WJGA 4X60A 2GEFA 3LC1O 4HQKA 4NMHA 5IRCD 5EHZA 4BLPA 2IYTA 2BR4A 2WTAA 4DSUA 3TUZC 1IH8A 3SC4A 2HXYA 3GJTA 1S2OA 4QASA 3E3NA 2XYPA 4ITRC 5IDXA 4KLCA 3H0CA 4KTTE 4KQHA 3SHTA 1WCIA 1W4LA 3EGDB 3AERA 3ND9A 4UEWA 1YE8A 3RNLA 1L1RA 2PUJA 5JV5A 4EA6A 1NVMB 1JKJB 4AMGA 2W9XA 3KQMA 3RUFA 3BJIC 1N1EA 4NR0A 3HZHA 3MT8A 2B8EA 3QU4A 3HXTA 4PICA 1O8BA 2R25B 1G7TA 1RQNA 2A9PA 3OAAA 3WIOA 4CMGA 1NQVA 2G0NA 3WYDA 3PYMA 1Z3CA 1W5TA 4JJAA 2IBTA 4F6RA 3AM5A 1P18A 2FWNA 2DTEA 3C85A 1UODA 1U28C 3H5TA 2WTXA 2WQ6A 4QBGB 4R9VA 3PUHA 3AEUB 1MGOA 2ZWVA 4I6JA 3HXOA 3OPNA 1YONA 5EQDA 3GJ5A 1K2WA 3D5QA 3H3FA 3E22B 1ZVMA 2JS7A 1YKSA 2QENA 5ILGA 3AY0A 5K3EA 2VXYA 1ZH0A 2YYYA 4GXNA 2QVXX 3H9UA 1D8TA 4ZT4A 4V24A 2Y1GA 3RIYA 3QY0A 3ZV4A 1A7AA 3K1JA 2PPLA 3HR7A 4ZHQB 3ZNPA 3FCUB 1Y1RA 1LQ2A 2VF5X 1HETA 2GD2A 4KV7A 1SEVA 1BCSA 5EE1A 1GGKA 3NJRA 3QXXA 1P6XA 4OY3A 1AZSC 1ADFA 3B5IA 1MPXA 4NXMB 1FDOA 4PSVA 4RK0A 5HZGA 3WGMA 4TYWA 4L85A 2JBHA 5IVKA 1E89A 1CUHA 4OAOA 3H2YA 1D2GA 2NU7B 1REQB 1OH7A 2XNHA 3DGEC 1TI7A 5TC4A 2O0JA 3RHFA 3NW9A 3VJKA 4F8EA 4Q24A 1CRLA 4RKYA 1K7FB 1VKZA 1KH1A 3OTWA 2P9BA 4X97A 2VBIA 3L9XA 5REQB 1FFYA 1BW9B 1JSZA 4Q03A 2C77A 3WOVA 3D02A 4K9LA 3L7DA 1RM4A 1CJSA 2GWRA 2IIQA 2NQ2C 1VPLA 1KZGB 3AY7A 4O1MA 2W93A 2J0QA 4LSMA 1OROA 1R4ZA 3MINA 3ZHOA 1NQAO 1CUJA 1WUKS 4G07A 4DR4B 1SY7A 1L7MA 2G7ZA 2NU9B 2HA7A 2PXCA 5CA0F 4YCSA 1EBBA 1VE5A 2XLCA 3WGLA 4ZCLA 3KOXA 3GRAA 1VDMA 1OLXB 3FZGA 4RKEA 5G1NA 2WFLB 3IL2A 2PXAA 3SS7X 4BE9A 2AMJA 1B0UA 1Q16A 2RIRA 1BRMA 2BDEA 3TCXB 4QXQA 3VR5A 5KNCD 3UGKA 1LDYA 5BNFA 1XDDA 4LKRA 2FG6C 2ECOA 1NLFA 4WBNF 1PR3A 2Q5HA 1Y4AE 3F7NA 3N75A 1K4YA 121PA 1TRKA 2POQX 2HSEA 2NV0A 3S8YA 1NUTA 1MJGA 3G5TA 3ON5A 4LQLA 4EHIA 1DQYA 1Q1GA 3PDCA 4G2TA 2C8VA 4X5OA 3JD3A 1AUVA 3CNQS 3GR6A 3KS9A 4Q01A 1TUBB 2XMRA 1UANA 2DFTA 3RVNA 3X1XA 1W48A 3ABIA 3U7HB 2HMYB 3CEPB 3TNLA 1FRQA 2EZ9A 1IBSA 1UBJS 1BXRA 2IXBA 4G1FA 4NYIQ 3AVOA 4D7AA 4OVKA 2WU3A 1U1GA 1EKXA 3JD0A 3WWOA 4PGMA 4KK4A 2NAPA 3ZWCA 1X7YA 2W48A 2J9YB 4YDRA 2UVDA 3E6AA 4NIMA 4HOYA 1TGYA 4NOLA 1J0BA 4DDMA 4F06A 1SOVA 1NW8A 4EYOA 1GGHA 3KELA 3JYNA 4MGHA 1G9SA 1MCZA 1SXHA 1YZTA 2Y4OA 1X8JA 3DKIA 4KH0A 4BP9A 1UBRS 2FSSA 3FB4A 4B6QA 3TSOA 4KVFA 4BO1A 4E2XA 2DFKB 3K73O 1EWRA 1ZW1A 1M75A 2GDZA 3P2JA 5JATA 2PMKA 4F8JA 1Z7WA 4DC1A 1K0UA 3WQSB 3B5JA 2HMUA 3EZ2A 4LX8A 1TMYA 1HYBA 4PCVA 1CY2A 1NVEA 2WJ3A 1Y3DE 2OO5C 2XYGA 2Z57A 2E37A 1N6NA 3C3AA 4TLMB 4W5TA 1USIA 5TVKA 4DBZA 2O2CA 4QUDA 3HRIA 1G8JA 4MYHA 2F1HA 2H85A 3HCNA 2F67A 3ACCA 5KKNB 2JC3A 4JYBA 4PVCA 1Z2OX 3GWZA 1B0ZA 4BVGA 2DKNA 3GLSA 4E7OA 4W9NC 3MRSA 1C4KA 2IT1A 2A9QA 4X6LA 3WHLA 1MR3F 4YRTA 3K70B 3H2JA 3A2LA 1T5OA 2D0PB 1EFLA 1S7CA 4D46A 1M9NA 2ZUWA 2NZVG 1OREA 3MTEA 3ABZA 1SAYA 3CZCA 3IVCA 2FOXA 1JH8A 1BMTA 1Z16A 4QDOA 5IDVA 5JJ5A 5AI0A 2QYTA 5KQGA 4V0ME 4CTNA 2CT8A 4NK5A 4I9FA 5KYGA 4AZ3B 3P9QA 2CL7X 5SICE 4BX3A 5C51B 2UUAB 3TQRA 4NBUA 5F7XA 1DIGA 4HPXB 5C52B 4YJGA 3S3TA 2PEZA 3NONA 2V7VA 1N32B 5ADVA 4YP6A 4YMTA 1RWOA 1TGVA 1AS3A 2UZ1B 1H2YA 4YV0A 2NZYA 2QD3A 4MYCA 3MCAA 3MYYA 1A2BA 1KSFX 1KKMA 3EB9A 4MICA 3ZE6A 3ZIAD 2WWIA 2Y1OA 4F5EA 4Y3UA 4N18A 2FY8A 3ZU2A 4EL5A 3DLBA 1P80A 2GPWA 2JBWA 3QXHA 4KR3A 3O93A 1N9GB 3L46A 1S1CA 3OQJA 3HG7A 1MVNA 3LWZA 5HQJA 1LBTA 4D8XA 1EFCA 3O8BA 4P81A 3T7AA 3KQPA 3O2QB 1E7YA 2V7XA 1WUIS 5EJEA 1LLDA 2KYRA 3IKJA 4FR0A 5H02A 5IBQA 3FWKA 3BFKA 3HVIA 1VI5A 1SB8A 3ZY6A 3WFIA 3AR8A 4AC9A 4DKJA 3DV0A 1G5PA 3OIWA 4OP3A 2DWUA 2HKIA 1ECJA 1R5OA 2P6MA 2X7HA 4Z49A 1CUGA 3AO0B 4MTCA 2WM9B 4WZAE 3ZNOA 4G1UC 2PX2A 3T3MB 1D0SA 1JVNA 4OQDA 4AZSA 4KDFA 5K51A 4CMIA 4JYZA 4EEZA 4NMMA 2Z04A 3UM9A 3C3EA 5EUCA 2VP6A 2X8JB 2ZFUA 5E38A 3L40A 4L5AA 4IXTA 2JLXA 2ZETA 3MRXA 2DWPA 3COPA 4Q7MB 4TS1A 3FPJA 2JK1A 3B6IA 1UL1X 3FNBA 4M8SA 5EP1A 3SGLA 2AXQA 1E2IA 2FPGA 1H2AS 2JH9A 5D8DA 2IKSA 4IXMA 1BE6A 5AJVB 2RJNA 3HO8A 2FUNB 1W4AA 4YONB 4ZAGA 1A8QA 4NBTA 3SAJA 2W58A 1VLMA 2C9ZA 3PJDA 4TLDA 4ZJUA 4XUCA 4E4RA 1DFHA 3HI4A 2DR3A 4C20A 3A6LA 4U2EA 2ZXUA 2B8JA 2PHZA 2VYCA 3C5CA 3ITEA 1JU9A 4FE7A 2FKAA 4B74A 2V96A 1KHTA 1B2LA 3IO5A 3RGGA 1VJ0A 3W04A 4PO8A 4IIUA 4WOPA 3V9PA 3F5QA 4E5KA 2R11A 3MLAA 1I24A 4ZYVA 2O2XA 3GUVA 3PQ2A 2GJKA 4ZWNA 4YJ3A 3S0JA 1JDJA 1P2DA 5IABA 4PRYA 6YASA 1X9IA 3H9QA 3DB1A 4H31A 1J0CA 4XRRA 5E0OA 1JTFA 1QKJA 3NP7A 2D5IA 1QZUA 1U2ZA 2E4VA 4I4TA 3P2KA 4QARA 4URUR 4J90A 4MUYA 4B2YA 2H11A 5KOJB 5D6NA 1DT3A 3DDCA 2VNKA 4MQ6A 4R9NA 4EIWA 1ZGZA 3KZ1E 4QJ3A 1LDEA 3BTVA 1VCMA 4MO2A 2Q7XA 3SDSA 4MS4A 4U6SA 1QAQA 1KPIA 4Y2RA 4BX2A 3ZWDA 1N2OA 2XD4A 3D1VA 2GHIA 1CR1A 4KQ2A 4MYSA 4R68A 3PWZA 4NS1A 4PAQA 4CIWA 2BDTA 4NPHA 3ZJ4A 4I3HA 3QBEA 5DE3A 5ES4B 4NBRA 2G72A 3UQYS 5JAPA 3EZ9A 4ZT7A 1Q0RA 1WCIB 4JMLA 1EGAA 3A6DA 3AERB 1TYEB 3INRA 1RYMA 1UJ4A 3A31A 4RWZA 5FXMA 4JI8B 4XWKA 4O4JF 2WUVA 2H9AA 4OHZA 4DLPA 2HADA 3PCRB 3K72B 1ZSNA 4PLYA 4LRYA 4BKRA 3VQTA 1CKEA 5CXUA 3Q11A 4FW8A 3R7BA 4F6RB 1WSBA 2PZKA 1SWVA 3DC2A 2OBNA 2YS7A 4D5GA 5LUBA 2JARA 2V6GA 1NXTA 4ZK6A 4U2KA 4BC1A 3D8UA 1NMEA 4G0VA 4Y9DA 4OHFA 3ZY5A 4WAUA 1HORA 3I9LA 2ZT5A 1U90A 1O97C 2NOAA 1FJ2A 1Y8RA 2QUKA 5ES3A 3JWJA 2OHIA 3CIOA 4PAGA 5L45A 5JSUA 4LWOA 4LC9A 1XDGA 2E4AA 2DQZA 1DX9A 1X15A 5FO1A 2Q0SA 1W52X 4BQPA 2AZXA 4Q82A 3PV0A 1G7CA 2HA4A 2A94A 2P27A 3IPCA 4P4NA 4U9HS 4XJVA 1SVNA 1A5AB 3D6VA 3QNWA 1TCAA 4IIBA 1FJHA 5FOWA 3T7IA 4A5OA 1NU6A 4PSCA 3LK6A 4INAA 1K5GA 4M0EA 4GR4A 1A8SA 1SQ0A 2O0LA 1OFUA 5ELMA 1ADYA 5KTSA 1GDDA 1BCSB 2J6HA 5JFTA 5SY4A 1EGQA 1TW3A 3VBCA 4MEAA 4MAMA 2XR1A 4NCNA 2W6ID 5F1KA 2ZQ5A 3GFPA 4X1KA 4HWKA 4LOLA 3D7MA 3M3DA 4DVGA 4QGHA 2GETA 3EF3A 1OYVA 1LCIA 1WO8A 2Y1DA 4IICA 1JLKA 4CGZA 1S3FA 2OGSA 2BSQA 3GCXA 5DWVA 4L08A 3L7BA 1XDSA 2QTAA 3AJ9A 1JKMA 1LBHA 3LYAA 2PRZA 1V8ZA 1WLYA 2WJZB 3HR8A 1KA9H 4JOQA 1KTIA 3FMFA 1XZJA 2IBSA 4U8HA 2GKGA 4G4IA 3KHSA 5ENVA 2JGEA 3I64A 3Q2IA 3KOOA 1MV5A 4TTAA 4X3OA 2CXUA 4ZU3A 4G4JA 4ZU1X 1QGYA 2ID9A 3ZCSA 4D74A 2IEDA 3MINB 1LF0A 3DDNA 1X1DA 3DHYA 1HSZA 1MA0A 1X1QA 1ZRHA 2AMLA 1V8DA 3LLVA 2JAHA 2PUTA 4JUIA 2FN7A 4ZZ2A 8ABPA 1XRMA 3L0PA 3CX3A 4RZSA 1U4OA 5HVNA 2VSFA 1EK2A 2X5KO 3X2FA 1ZMXA 1VRVA 2ISSD 4C22A 1XNHA 4ZAWA 1K1EA 4KL8S 4CL2A 2C4UA 3L18A 2Q1XA 1IVNA 1OASA 2LCIA 2J5QA 2YX1A 3GLGE 1SK9A 2CLCX 3LQ1A 3L0BA 3EWNA 5MFPA 1NA5A 1PCXA 1DWQA 3O26A 5LQDA 2PUCA 5K4HA 4RHFA 5JADA 5EFOA 2R7NA 2OV4A 4R51A 5GJCA 2DWQA 4B31A 1CEEA 1KZ9A 3A9WA 2B7CA 2YY7A 3LPLA 4LK2A 4W4TA 8MHTA 5JJKA 4J0KA 5AM4A 1CF9A 2F3PA 1GAWA 3M4XA 5JSQA 1WQ1R 4KE7A 3RSZA 2CCKA 1BXRB 4L4UA 3NBUA 1OIWA 1ST2A 1WTCA 3T1HB 1FTQA 4UCXA 2I22A 1PEDA 2Q7DA 1U3FA 3FPSA 2W2LD 4IJMA 1UC8A 4MIYA 1X7YB 2EEZA 4M1WA 1CU1A 3V8BA 2AW5A 1E7QA 2JH3A 3MJFA 3DO5A 3R41A 3TN7A 1SQGA 1TZJA 1Z33A 4ARBA 2CXNA 3WMGA 5KSPA 5KOYA 3L1JA 3KEOA 3IQGX 1ZM7A 2Z2IA 4KXQA 1FFSA 1ADCA 3L4SO 1HYGA 2AI1A 4OBWA 5IBPA 4TT8A 3THSA 5KNDD 3DMRA 2CUZA 4KQ6A 4NYIR 1NLYA 5FADA 1DIBA 2P2LA 1V5IA 2GVNA 1AKYA 4QBTA 2X1HA 5KOHA 3WBJA 4ZTZB 5G02A 4IX9A 4G0ZA 4R1UA 3KKLA 1VP3A 2BT4A 4XIYA 2W70A 3W7VA 3LWBA 1EFHA 5MDHA 1D6SA 1XCJA 3NBYC 1VYUA 2HF7A 5IZ4A 4L9RA 4ERXA 2Z2KA 2OP0A 3JZIA 3BTSA 3FWZA 1TAQA 1ZEJA 2MT9A 4O29A 4D56A 5C80A 5B1EA 5E6UA 5FD8A 3GDOA 1YFLA 3PKZA 4RELA 1C4OA 2EW8A 4QM7A 4PHTA 1QIHA 3LP6A 2IEIA 1M2FA 2V7UA 2BN4A 4M1SA 1I10A 2J9RA 4LIPD 4Q9LA 5ALUA 4BJ6A 3L0DA 3VVBA 4DWWA 4EH1A 3FCYA 4GICA 3RC2A 4DYDA 4YQFA 1LDBA 5CCDA 3GIDA 1GGMA 1XEFA 2Q2OA 1O4WA 2GLUA 4IJWA 2A5DA 4YREA 2D7CA 3VU9A 3TX2A 2HRBA 5ECWA 2BMJA 3I9KA 1WCYA 2MYPA 3CF6R 4Y6LA 4DBVO 4QTYA 1VSVA 2BFCA 1YL5A 1D1PA 4M37A 2Y9PB 3JQAD 4Q19A 5EI5A 4EB0A 2XUAA 2A0XA 4D0SA 1XZLA 5CR9A 4B9AA 1OHHA 4YJGB 2RGNC 1C8KA 3HUEA 1JL3A 5DGTA 3UUWA 4ARZA 3B89A 3PGLA 3PQDA 1P2SA 2BJVA 4PO3X 4F4UA 5LLTA 4ZO9A 5A5DA 2FE4A 3UHPA 3W05A 3T9EA 1GG9A 3QLEA 3VYTB 3FAKA 2VZ8A 4EQ6A 4M7OA 4DMCA 3KU4A 1J70A 3F1LA 4M7RA 1GUAA 4LF9B 4NXNB 4CU2A 1RLIA 2Z5VA 5E1DA 4XTCS 1XN1A 5KWJA 3REGA 4EG5A 3GFOA 2QAJA 1QF7A 2QRNA 5KTYA 4KRGA 4R1TA 5L9AA 4U63A 3DMYA 3N8KA 3AEKA 5B58T 2QD2A 3Q9NA 3L4KA 3NS7A 1VPTA 3DS8A 4S3MA 3NQ41 2BHLA 5CYFA 5D5PA 2O06A 4MINA 5COBA 1ZVKA 2CMGA 2IPLA 2OP1A 3H9JA 4KR2A 3STUA 1OI3A 1LS6A 2Z9CA 3OEYA 3MJ4A 1DAFA 3DV0B 4O4LF 1R0LA 4R84A 4XA8A 3U6BA 3LDGA 3DHNA 1WVMA 5FUBA 4LG1A 3HKDA 2WMNB 2J32A 1STOA 2ZSAA 4CKBA 1L7RA 1KJZA 1YGPA 2B94A 5K4AA 5ALRA 3F6SA 4CMIB 1V1JA 1ZCZA 2DUWA 1FMJA 2JI7A 1E2FA 1NDUA 3BIXA 4QQFA 5AKIA 3NGMA 2PGLA 2FEPA 2WVAA 2F4VB 1T8UA 2R6R1 2YOGA 1FEZA 4HTFA 4R3NA 1ZN8A 3JALA 3PG5A 1VSBA 1ENZA 1Y34E 2FPGB 1E4VA 3OUUA 3UMJA 4YUAA 4UTZA 2VSQA 4ABTA 1F6BA 3IXMA 3PFNA 3E2MA 4MRSA 5D01A 4TYQA 4Z7QB 4HFRA 2ZRQA 4RVGA 1QVZA 5LZ2A 3QI7A 3ZHQA 4EJ6A 3MJHA 3QFTA 5AW7A 3V4VB 4JB8A 1V0JA 1IZ7A 1JBKA 1IXYA 2QXUA 3OWOA 4U3JA 3E5NA 2A84A 2JJ2A 3F5DA 1JLLA 4I2NA 4YTEA 3L8HA 1RKBA 1J9GA 2ZSBA 4WFJA 3SOPA 4A4DA 5CVUA 4HLNA 1U1DA 5ALJA 2J3KA 4ZOBA 4FT4A 3MS7A 3ZHTA 1JALA 4CLOA 2OCPA 2P9YA 4YJ3B 3VR6D 5E4YA 1ZK0A 2BE7A 3E84A 1MOPA 1KI9A 1UBNA 2NU6B 1NLZA 4J8PA 2IHYA 2IH5A 4GHWA 2AOTA 4N5MA 3V2HA 4ENVA 2R48A 2Q9BA 3OX4A 4I4TB 5FWDA 3FUTA 2VJDA 4TYNA 4KPFC 4P3NA 2A0YA 4MVJD 3KHTA 3S70A 1VCNA 3EGIA 3FB1A 1RYZA 3EVFA 1QFYA 2QXYA 3HABA 2P8SA 3KZNA 3O8NA 3GRCA 3E7XA 3KQUA 3WL3A 4MS4B 4KNWA 1T5SA 3TZBA 4XCQA 4KUHA 1P1HA 2FP3A 2GDJA 3QPAA 3UKOA 4B46A 5IWCA 1I4LD 2WSBA 4E31A 4J6EA 3CW2A 1RYHA 3OFJA 3O73A 1N77A 3DZBA 4OLAA 4RPKA 4E3WA 3TJRA 3GVHA 2R7LA 1M2VA 4WCDA 1AB6A 1IEVA 1DFIA 1Q7RA 2P7HA 1VE1A 3DDSA 4OJNA 3S44A 4BFYA 4WBNA 3D4PA 2GEUA 3KYDA 3UIEA 3KD3A 3WQRA 3KZXA 3SR3A 3NIFB 3SC3A 4DFDA 5GV7A 4TS3A 5G1PA 1J90A 4RAOA 3GZJA 1ZL0A 4NDZA 4B4WA 1GLNA 2ACVA 2MOKA 1L5QA 3AGPA 3FW1A 4A82A 1V3QE 1AS0A 4D3DA 5FUQA 4IVNA 1LNQA 3TLYA 1HEIA 3LPCA 4O63O 3RS0A 4Z51A 2JEZA 2I29A 2WV9A 4ZQEA 2QV0A 2ZCUA 5F3WB 2YIVX 4QQRA 3V4OA 5J43A 1E1RD 1F06A 2EAUA 4OM8A 3IMEA 1ID1A 1JTEA 4XX1A 4M9UA 3VKFA 4GSLA 5H9WA 5KIAA 3M82A 3W5CA 2GLTA 3A4NA 1WMDA 3BH7A 3FWNA 3A2NA 4V0RA 5L7WA 1FNDA 3TL3A 1NVFA 3R6LA 1HGXA 4KKXB 4L78A 3UXYA 4A8HA 4HRVA 3GBPA 1HEUA 3GHHA 3OTGA 1JPVA 4IIHA 4LNUA 3ND5A 4BMYA 4FOTA 5L40A 2OILA 1L7NA 1X13A 1VLVA 4FLFA 5C2JB 4LHXA 4V1CB 1D6NA 3RYIA 2HREA 1JEJA 1JEQA 4P4GA 2VH1A 5ARBA 3WA7A 4JVOA 4L5BA 2WP0A 3DONA 4BKPA 4KYVA 2GRJA 4RLSA 3VDXA 2G5GX 3FYHA 4UE3S 3LWDA 1RACA 2ID4A 4WIAA 3R3ZA 1GHTA 3NOOA 5MF6A 4X1KB 2Q5EA 4BZWA 2WUWE 5LDDC 1X1TA 3QHQA 2ZB8A 2YDYA 1XELA 3GMTA 2DSNA 1AQYA 5AXAA 3U39A 4EITA 4X8HA 4Q34A 2JZNA 3TQHA 1EIZA 3D0RA 4Z4EA 2IU4A 3QZUA 2EW2A 5GJVC 3OMWA 4FT2A 2GD0A 2PJUA 4K9NA 1FPQA 1KDZA 4DDVA 4RMGA 3O7WA 2I7VA 3GFSA 1NIJA 2RC5A 3COVA 3CZQA 3EK2A 1QHNA 3R5JA 3KQQA 2G17A 3O4VA 3WDSA 4EA9A 1UDAA 5CM8B 4KAAA 5DT2A 3I9V6 3Q10A 4EMTA 3QWIA 1J49A 3OICA 1U9IA 4WOJA 2R8EA 2IQ5A 5EL0A 2RGNA 3OZTA 4OJYA 4FSHA 4CT4B 1UXHA 4BTLA 1KYQA 1JQLB 1OWOA 2WWVD 1YAJA 2EQBA 1YFZA 1KMNA 2EQAA 2PFKA 3HJBA 4CQNA 3H17A 4D82A 2CLFB 1XQ6A 2AC4A 5L95A 4MJLA 5JZMA 2NP6A 4DY4A 3VZPA 2X0EA 1WU8A 1V4BA 1ZN9A 4Q37A 4E22A 1I7PA 2XRMA 3OU6A 2BFOA 2RHGB 1L1EA 1GFIA 2ASVA 2O3JA 4UEJA 4XLLA 3PC3A 5HUJA 4FHCA 2G25A 3UKJA 5A4FS 2OENG 1PQ4A 1ILWA 2ZWAA 2P35A 4U7PB 2ZT8A 3K5HA 3SS9X 1ZNZA 1KR5A 3OO1A 3ULKA 1ZUNA 1YTLA 1JQDA 1O77A 2VJOA 2YN2A 4LYEA 4TPKA 4EKYA 2REBA 3AIMA 2J0SA 1R5NA 4RJLA 1TVMA 1SIBE 3VNUA 3JYPA 3I9JA 4HDOB 1U11A 1W75A 3T5TA 1R8SA 1PYDA 2CVFA 1U7HA 2P4QA 3MRVA 3ZEIA 1VKNA 4ZVSA 4H7DA 2WJ4A 4AQ7A 1XZMA 2O05A 3TLGA 3ISVA 4BO3A 1N92A 5DHUA 5E2BA 1N34B 3Q8KA 4YYZA 1JIKA 1TMKA 1C0PA 2PDAA 3K5PA 3MUNA 3OEEA 1YBFA 3PGJA 4Y0NA 5P21A 3U4HA 3K9QO 3ZZUA 4FEYA 3R3VA 4XM0A 5TQ0A 1WBDA 3I05A 3REOA 4JP5A 4MEJA 4UOQA 1KE1A 1RCUA 2GOYA 3TI7A 3WICA 5JI2E 1Z8DA 1B76A 2OTCA 4W5HA 5DK6A 1NR1A 1I32A 3D4BA 2PV7A 3L0IB 4IOMA 3SBXA 3VGJA 2CXRA 4IDEA 4OHVA 4U39A 3RKRA 4BNMA 1F5SA 3ZE2B 3TBKA 2CNDA 2P67A 2JFWA 2YVAA 1ZSVA 5FBKA 3LI2A 5KTKA 5WRFA 1K6JA 3N2NA 5KOHB 3S5UA 1JG4A 4J0FA 5H83A 3UOWA 1AKTA 2RC6A 5JAOA 2CSXA 2IX9A 3P9SA 5DX0A 5JANA 1P5ZB 1DNPA 3P2YA 3HMKA 4Q93A 2HNAA 1NF3A 1RMYA 3GBSA 4G0XA 5ERYA 1XVVA 1P91A 4JLVA 4UDOA 5C35A 5DT9A 3T9DA 2VCYA 3GJ4A 3NC4A 4LJYA 2OXIA 3C3KA 1CUXA 3VNBA 1U31A 4MHSA 1OFUX 1AQIA 2QM3A 3O5AA 4QEKA 5E6UB 3W2TA 1E2LA 4DJAA 1C8LA 5E8RA 2I6XA 4JYMA 4PM4A 2PMEA 2VXBA 4WZBE 4MA0A 1U2QA 2BSXA 3DR3A 4W7HA 4Q02A 1YE3A 5TMEA 2VDNB 5I9TA 3WRXA 1AGPA 5JMWA 1ARZA 3DULA 3W34A 1DIAA 1OTYA 4G1EB 1H0HA 3FX2A 3VU9B 4QT4A 1ADBA 2A30A 2Q3BA 3LQ2A 1YJ8A 2BFCB 4J6FA 3TW8A 1RQ7A 3I12A 4FFPA 3QHAA 4NOJA 5FI3A 1Q21A 3D2LA 3JAKA 1D0VA 4F2DA 2YCLA 4GSYA 1L6IA 4HWPA 4GVXA 4CKYA 1GA1A 4XR4A 4EY5A 2OYSA 4ARZB 4XFKA 1GTG1 1I33A 1H2FA 2LP4Y 4ZI7A 3FYUC 2C9YA 1PJCA 2IS4A 2GPYA 5E4FA 4H7KA 4BLRA 3LDFA 4EQ6B 1IIBA 4O4JA 1XTUA 3UH1A 1VMDA 4Q4JB 4AQYB 1Y7LA 2F2TA 4H7JA 3TNJA 1W4ZA 2IQIA 1F4LA 1LDGA 1RWVA 4L95C 4ND4A 3X0DA 1BGWA 1TFRA 1JNXX 1RRMA 1NW6A 1D09A 2Q3JA 2ZE8A 3NM4A 3LVFO 4AX4A 1A8UA 2TMYA 5KZMB 4JI3B 1I7QB 3L8ZA 4MTLA 5AI9A 3T3NA 1Y63A 5IULC 4C87A 4MH0R 2E85A 2LKDA 4P7GA 1E8DA 3AEKB 7REQA 4B48A 4HXGA 5FQOA 4RTMA 3CVUA 1PJTA 1N6PA 3LOPA 4CG2A 2AQHA 1FFHA 3ND6A 1AC5A 4MVJI 2XEXA 4RSGA 3JX9A 4UHHA 3WO0A 1XQYA 2GPSA 1OZGA 1RI4A 2IYPA 2DKFA 3RPEA 2IPMA 4IZIA 3AUXA 4LE0A 4LXGA 4CKBB 2Q1WA 2ZJ0A 4Q3NA 3L49A 3H1EA 2VTBA 2AD5A 4DIDA 3NIWA 2X23A 2V7QA 1W47A 3U5ZB 3RO7A 1ISHA 4RZHA 3D2CA 4P3KA 1U0BB 3GFQA 4HTFB 2HV9A 1FX0A 2FDCA 3GI1A 2FWMX 1KMQA 3JALB 4MUBA 1YGYA 4QHSA 4FC7A 3KXPA 4QE3A 3I53A 2HK9A 1AG9A 1I0IA 1ZIPA 1T3GA 2HD4A 2C9DA 2GJAA 1YD7A 5HE8A 2ZI7A 4GRAA 3MBOA 4HQ6A 1L5LA 4MKXA 1LDNA 1DCKA 4U3JB 2XKKA 1JLLB 1KE2A 2RHDA 3BSSA 2EX0A 3DEFA 3LX5A 3NWBA 5E2IA 1HY3A 3CCFA 3KEGA 4M1KA 1JG2A 4JKIA 2GYWA 4KI7A 4BWFB 3RABA 2CBZA 1LPMA 4CLOB 2V8BA 2NIPA 4XB2A 1I5EA 4M0MA 2JFZA 3W5HA 3I4LA 4MDHA 4I8IA 2VUHB 4H08A 1EP1B 4D57A 3RR2A 3NYWA 2G63A 3G8AA 1QMPA 1NBAA 1ZDMA 3MIZA 5B6IA 4KQFA 4XWGA 1HDZA 4JLOA 5AK6A 2QZPA 2ZS7A 2RKBA 4PAWA 4MUHA 2AOTB 4QA9A 3I5MA 1NL3A 1Q6ZA 1A9XA 1MU0A 2H1VA 3LCMA 1DC4A 3DDHA 1KVRA 2QPLA 4K2HA 2ONKA 4PYKA 2ZJ4A 2HBQA 3PENA 3TWOA 2GAOA 4ZMBA 1C0LA 3BXFA 1MEOA 2BMWA 1RJWA 3IAXA 2P3SA 3GYBA 4FIZA 4JBWA 1KVSA 2WYIA 3JYOA 1AV6A 1X8LA 1QX4A 4OGFA 2PMWB 2VWQA 3OVMA 4WCVA 4YCDA 4RY9A 4CKWA 3OQIA 1M2VB 1KRXA 2O3UA 2HMWA 4Q1EA 2QVCA 3TO5A 4E5YA 4WBNB 3K3PA 2JJYA 5CUQA 5KEIA 2ZB7A 3GJXC 3KYDB 3QKWA 4LCJA 5K8LA 1ECFA 4KXWA 4G09A 1UOEA 2ADOA 2OMEA 3JRWA 3PIIA 5JC1A 1GUFA 2Q4DA 1KR2A 5K0CA 5LNK6 3ZDRA 3E3AA 1XCMA 3NLLA 4P84A 1G0OA 2ZTLA 3EQ2A 3HCRA 4LJ8A 2XE4A 5FBWB 5JE8A 3HVJA 1ODJA 4H1UA 1YCGA 5AUQA 4F1WA 3BL8A 2GJ4A 5GWXA 5JWHA 3HZOA 1HQKA 4BYMA 1KH2A 1R27A 2YWFA 4FUTA 4W63A 2EYUA 3A70A 2O6HA 5BV8A 4OBEA 1C9KA 3QUAA 2AZTA 4V0SA 1WLSA 1KWGA 3WVNA 3PICA 4DA8A 1M7GA 4JI6B 3P94A 2FLWA 4G84A 4PQGA 2RDMA 3JQ8A 5T3UA 4H1WA 3EEOA 3WK8A 3LBHA 4GKJB 2JA1A 3FDJA 3O21A 1XTJA 2J08A 4F2WA 3F6PA 4IQFA 1N2JA 1JFSA 1K8RA 1FDRA 1NW3A 3CPJB 3M6XA 4LNUB 4ZGGA 4B45A 3UH0A 3KETA 2HA2A 4C0XA 3AUYA 4B2LA 1IUOA 1ZZGA 1RYNA 3UMFA 2IVZA 4ND8A 1OJ7A 3RYIB 2P4SA 1VXRA 2IC5A 1JEQB 2PX3A 3D7SA 4L02A 4N3GA 4Z86A 2O3QA 2X42A 3RM3A 5THXA 1XMSA 1EWVA 2YN0A 1ID8A 4J1SA 1Y3AA 4JLWA 4EP1A 1Z73A 1DBSA 3LOQA 3I9MA 2IZ6A 5FTKA 5BW6B 4NENB 1ZO8A 2H06A 1NC1A 2HHLA 1P2BA 2P7IA 3Q15C 3ERCA 3O8LA 5AW9A 2XECA 1GAXA 4BGIA 2Z5FA 4U0KA 1XDUA 4JBHA 4F4DA 2PWYA 2E3JA 2HB6A 1R9MA 2A8YA 4XIJA 3WTBA 1C8BA 1QK5A 3SIRA 3L84A 3QFRA 4N4AA 5C7IO 2VNHA 2VLBA 3L7CA 1UBEA 3TFOA 1MUUA 3QEJA 2L42A 4QBKA 3O90A 2O8BA 1YDEA 4RJKA 1DO8A 1GEEA 1R0CA 1SUWA 2F90A 3DT6A 2AX4A 1HA3A 4KDCA 4R2XA 2POCA 1UEJA 4PCAA 4E12A 3CXRA 4LGYA 1YA4A 5EZSA 4YRJA 3FPCA 3KXIA 2CV1A 2BGTA 4XEUA 4URZR 3Q41A 3TE6A 3FYUA 5AOAA 1M6WA 3T4EA 2WVHA 2AXEA 4CM6A 3PZBA 2XNDD 3VSDA 1FRFS 1UXKA 2GN0A 1YQUA 3KXKA 4LVOA 1JNYA 1GNLA 2CC2A 4DMFA 2O50A 4S0XA 5JCOA 3ESRA 2XT9A 3BE8A 3QSGA 2QTGA 2W11A 3VISA 1V11A 3N58A 3W06A 5AKHA 4TM7A 3GFBA 3RC7A 1YMQA 2QLBA 1N2EA 1YS9A 3PZRA 4NJOA 4A8JC 3NT2A 4UM7A 1GZUA 4L76A 4Y2TA 5EZYF 2OORC 1ZUNB 3SQMA 1QUEA 2WP8J 2REOA 1IUNA 4QYTA 1E60A 3N5CA 2G07A 1HZZC 2ODAA 1ZXXA 3JQCA 3L79A 3NUGA 1SQ6A 3TVDA 5CFOA 2QMHA 1TTHA 4FFDA 4LCBA 3F7TA 4ZEVA 1ZWLA 4OQMA 3MERA 1Y5RA 1Z4PX 5B2FA 1PG2A 3TLGB 2D1RA 2PT7A 4FMDB 4ZV9A 1Q2XA 4NV0A 1QCZA 2OAQ1 3DCYA 1HEYA 1J2TA 4O4LA 1I6WA 1WOYA 2ZYVX 4YK7A 1C7ZA 5TQ0B 3G6KA 5HTKA 5TR9A 3R4VA 2BKVA 2Q3LA 2FSVC 4DV6B 1M2JA 1ORWA 1CW2B 1XEXA 3N0WA 4N7RA 5FUVA 5KHAA 4OB8A 1BWPA 3G2IA 2HH9A 2XRYA 4FC6A 4R81A 3LF2A 1PWHA 3KT3A 1J0DA 3L8YA 5E95A 2GPAA 3I04A 2OYRA 2CF5A 2O54A 3BWEA 3G0OA 2JJ1A 3BH6A 3BD7A 1KAMA 4FQ7A 3PWTA 3I6QA 3QKUA 1G4HA 4PQRA 5KTRA 2D0IA 4D26A 3A4LA 1CJMA 2VTBB 2PLNA 4TL9A 3UYKA 2J30A 3O3CA 5A5FA 4M60A 3F46A 3I8OA 4YO7A 5ALDA 2DERA 4KQWA 5CBPA 2FEKA 2C2GA 1LK5A 3NHWA 3GFRA 4DA6A 1Y33E 3IDAA 5EVJA 3P4XA 2YASA 2Q28A 4Q1BA 1OUMA 4G2NA 2WYWA 4QQKA 1LBSA 2HJRA 4Q3BA 2RGRA 2PRKA 5JZBA 1DKPA 1R1DA 1CDOA 1IQUA 2F62A 1Y1KE 2FSHA 1E77A 3HCDA 5EIFA 3ZOKA 2CFCA 4QNMA 9LDTA 2OECA 5EJMA 4PG5A 4V38A 4I4LA 5AYVA 3ZDEA 1BFUA 5CFPA 1U9ZA 3R77A 3V8RA 1DQNA 1K8QA 3S2EA 3HGTA 4M1YA 1FP6A 2DHCA 1T26A 2IELA 4MRPA 4AAYA 1R8XA 3TW8B 2WWHA 4XYLA 1X42A 3BG5A 3DR5A 2PGDA 3JAKB 1D0IA 3C6ZA 4J0DA 1FCJA 1V39A 2DT8A 1Y3IA 2W6ZA 1YAHA 1X1EA 2ZBQA 4TXMA 4XQ9A 5AJYA 5JD5A 2E1RA 3TINA 4FM9A 4ZI7B 1S4QA 5EERA 2OBFA 3EVBA 1XNRB 1U7XA 2D54A 1YS2X 3WK9A 4BEJA 3SHVA 1T8YA 5J5AA 2EWWA 1U8CB 2PX0A 1T9AA 1X6VA 4HX2A 1Y7PA 4O4JB 3DZCA 1IN7A 3OA2A 3E8XA 3EC1A 4YI3A 5ALXA 2C20A 3IC5A 2VJKA 2P2YA 1HDXA 4F5DA 4Q66C 3EISA 4RYDA 2Q5CA 3EWIA 2WJHA 3I6IA 1CY1A 1GQRA 3EDRA 1F6DA 4TWAA 3EW9A 1AKVA 3H1AA 1JDPA 3R44A 3O82A 3HL0A 5BXQC 4LXIA 4Q3LA 1I4DD 1RVDA 1E32A 1QRAA 4Y9RA 7REQB 3A1TA 3ZS8A 1IJFA 4M8KA 3LIPA 4Z9XA 3VMMA 2QK4A 3OY2A 1HNXB 3SY8A 1L1QA 2P2ZA 3FPFA 1MIOA 4D02A 2ZBDA 4P22A 1NXXA 4A2CA 4M6WA 1A69A 2QU7A 2VHYA 3C1OA 3OG9A 4G0OA 3OETA 5KOIA 4DCUA 4G5GA 4NYMQ 4BAUA 5CFLA 4MQEA 2E82A 2HJHA 3H8SA 3BOSA 2ZANA 1PNQA 1LI5A 1Q0UA 2VPIA 3FOWA 3GNTA 2D4AA 3LXRA 4J1QA 3U4DA 3I5YA 2B8TA 2BSAA 1O5OA 2FPRA 3KT8A 3IEUA 1T2FA 1LEHA 3KTOA 3W6UA 3L07A 4NRDA 3QH4A 2R60A 4H17A 4PF1A 2COEA 4BDSA 3RT7A 1NI3A 5FYDA 2YHUA 1HFWA 4U1RA 5HM6A 1FX0B 4EENA 4ZARA 1U7WA 1JYEA 1Y6RA 3ENNA 1C0KA 4WFIA 1IOLA 1XYVA 1ZLXA 3B2EA 3QU2A 4HDAA 4C6RA 4F1JA 4OYLA 1CR6A 1S5PA 2AMFA 1E62A 1KFJB 1OW3B 4URFA 5K3BA 3UYLA 5L6LB 1SBQA 2BGKA 1I2AA 1O6BA 4IH1A 3CINA 2PBFA 2PH5A 1I30A 4GKAA 2FFJA 2CWWA 1L5FA 1KEUA 4INZA 3OZUA 5AHXA 5D3ZA 4KOEC 3MUEA 1Y5LA 2Y0DA 3QVUA 5BY2A 2L69A 2OMKA 1E5LA 1W73A 3CWZA 3QPCA 4Y2YA 1CY4A 1FS5A 4XSHA 2NX2A 2Q3EA 4AB1A 3IIMA 5CHEA 3WYBA 3U7FB 1HYHA 1PFQA 1LH0A 2P3LA 2WA2A 1ORRA 2HK6A 4GC5A 4QHTA 1XHLA 3N8GA 1AUPA 3BAFA 3G82C 4RSHA 4XFDA 5E9QA 3EZFA 1FFEA 5EJIA 1A9XB 2HX1A 3EOAI 4WXMA 3S29A 1ZA1A 1Z2CA 4HDRA 4F91B 2H4HA 4BLTA 4JQYA 3NZEA 1XAHA 3HP4A 2VDWB 4HX5A 2OD7A 1FTWA 2GK6A 3FSEA 3GFGA 2O07A 2CVHA 1T2DA 2X8AA 4ANFA 4E3ZA 5K6TA 3UV7A 3PUJA 4B17A 2WIBA 2JGNA 3DXXA 4G5QA 5AKGA 3LXUX 3QUBA 2C82A 2FZGA 3LFTA 1X7GA 1Z0FA 4Y0AA 2OORA 1XR3A 3CUYA 1GTJ1 4NX2A 4ARVA 2RD2A 1GNPA 3BGVA 3ZHVA 3OQIB 3ASUA 4JLNA 3ZX4A 1KETA 2OXTA 3COJA 3FCAA 3EEQA 3WZMA 1T9GS 2PYIA 4D3XA 4KPGA 1RJ9A 4JJ8A 1U02A 3ZI4A 2OSBA 3IUQA 4BLOA 5HUQA 1Q92A 4DR2B 1TEXA 2QYHA 2J09A 2WW8A 3ELWA 5K8CA 3K71B 2IGTA 3UZUA 4KHPB 2W2TA 1P4RA 1E9BA 4E08A 1FY2A 1TM4E 2PN1A 2GHQA 3L5KA 1Z2AA 4V0LA 1UOQA 1LI7A 1LNSA 4DDWA 1XT6A 2GSDA 4UVGA 4H7FA 1SFRA 5IH3A 3ASZA 3N2LA 4JJ7A 4QSHA 2OO3A 1JVBA 2CY0A 4KRFA 3JQ8B 5K6AC 2BTQA 3N2IA 3TQTA 3T1VA 1FFXA 1GGFA 2FEMA 3QVOA 3CUWA 5CFMA 3ZUGA 1XG5A 3A3YA 4HRYA 1M33A 2CZGA 2AEEA 1ABBA 1T0IA 4PRLA 4G0MA 5EESA 3SQWA 1RI5A 2O20A 5C5DA 3LUCA 1H2RS 1QO9A 4FK8A 5CPFA 3T38A 3WGQA 1Y7IA 5BXYA 1U63A 4QWMA 4DQDA 4ND8B 1D1TA 1PUIA 2WRZA 4L7VA 4DZTA 3CN7A 5AVYA 1Z83A 4K9KA 4JSYA 4LDNA 2O7NA 3E9QA 1OKKA 3ESDA 2AN4A 4ECAA 2DY1A 3VHLB 1WU7A 4N48A 3Q5EA 4B09A 1NJ5A 3E9MA 4N3BA 1OLUA 1E9VA 2FJ0A 2ZB2A 1FSPA 1VECA 1QXSA 3IT0A 2ONZA 2XTAA 4X93A 1AKNA 2CVOA 1P0FA 4XWAA 2OQ2A 3UWKA 4UATA 2NO5A 3NASA 2ACWA 1Z18A 1TVEA 3MWJA 1W9HA 5T57A 1NE2A 1YS6A 2VWGA 2XQKA 1IOZA 2GVZC 2QL5A 1NC3A 3CPHA 3MBKA 3NBXX 3NV7A 4FNAA 4XKJA 3TIGA 4ZZIA 1DDIA 2J33A 2Q6LA 3MOGA 5EYPA 1A71A 3GPBA 4HKTA 2O8BB 2V6MA 3EGVA 4B81A 1Z07A 2BFMA 4O2LA 1L5KA 4JB2A 4IILA 3FNEA 3GGCA 1O87A 4IWYA 3KEMA 4WRRA 1LTQA 2ZSDA 3L6OO 4HXYA 5KNBA 2E6KA 4I5GA 1HDGO 4TOIA 3OTHA 3C3DA 3AHDA 3GLFA 16PKA 3QX8A 1E0SA 1B2RA 1E9EA 2P40A 4IOJA 5E0KB 2UV8A 3VR4H 5L3RA 4BBZA 1Z2DA 1SCDA 1U0OC 3PDHA 1QLHA 3WV4A 5K01A 3FYUB 5J4VA 3ILVA 2H1WA 3IELA 5FEUA 1P7VA 4W1PA 4C7OB 4EFDA 1CDDA 4EBFA 3QGMA 1O58A 5DNEA 1J1ZA 5HZKA 4OOEA 3A26A 4HGQA 4JNKA 5TE9A 3OJCA 4D79A 3ZZMA 1JKXA 1GRCA 1V11B 3EZXA 1SHZA 3REFA 3Q8LA 3V2GA 3CNEA 3NFYA 4CMBA 2CHFA 1G1AA 4O8ZA 1E2EA 1KAEA 3DDOA 4CE6A 3D1LA 4PC7A 2D7DA 1KDRA 2QTCA 1NVVR 3E61A 3ZCQA 5HOQA 1G5HA 3I9V1 3HACA 4W1QA 4X3CA 3KUCA 3CUEF 1J21A 5LYYA 3WLLA 4Y6PA 2XUKA 4H15A 4EMUA 3P26A 3W0LB 1NAIA 3H5LA 5TQ2A 1E2UA 2Y2UA 4K3UA 5EPUA 4CV3A 5KQRA 4B43A 5ICFA 1WXXA 1XF9A 4IJUA 4TRRA 3RVMA 2I6GA 3GOQA 4QVKA 2Y0BA 5JPCA 3JR7A 2WTNA 5LDGA 4R9RA 4CKZA 3KQTA 2XZOA 2VAPA 4O3MA 1U2TA 1KQGA 3R09A 5J58A 1ESEA 3K9GA 2R7AA 3IPLA 3RGWS 2YZKA 4DEVA 4O4LB 1UZAA 3UWMA 1C3VA 5FHQA 1YQQA 3ED5A 1AE1A 3V7UA 2KE5A 1QP4A 5LC1A 2GCGA 3A1EA 3NKFA 4ISBA 1Q7GA 2D1QA 3AF4A 2HLNA 3HXKA 4KQXA 1G21E 5BOVA 3DHEA 1XEXB 4RKWA 1I01A 1XIVA 4JGBA 3RVRA 3TR0A 3M4NA 2FUG6 2XXBA 1KK3A 1YI0A 2WIKA 3HWRA 4IGFA 4MJ3A 1A4IA 5DWDA 3BN3A 4HS9A 3E15A 5AIBA 5H7XA 4UHJA 4Y6GB 2WJJA 3LBFA 1F3OA 4DV7B 1V5WA 2N9UA 1PZGA 1LLUA 2R1TA 4CF4A 4YMIA 2CEKA 1GVNB 2AZMA 3WKCA 4GOKA 1BU5A 3PGKA 4BECA 5C1BA 2XJ4A 4B80A 3ICVA 1E92A 3DMFA 5HK9A 3I9FA 2DULA 3N6VA 5CBPB 4D44A 3IVMA 3REQA 2PCJA 3OLZA 1H69A 2WKWA 3R5SA 4V0OA 3KYIB 3C3CA 4Q3KA 2CNLA 4OSPA 3ZOZA 3SM9A 4N49A 4Q3OA 5F2KA 2Q45A 3RD5A 2CVQA 3NDPA 2AZDA 1WPQA 4JJEA 4ZCRA 5CEJA 4PGHA 1K92A 2HNKA 2QQGA 3IIIA 1S2GA 3JR3A 1QG2A 4LV6A 5ER6A 4B71A 5BSVA 3QYJA 2QQFA 2ZRFA 3B2QA 3LUAA 3WHPA 3HLYA 2BMFA 2FSPA 4IQ0A 4JWTA 2Q5OA 4IHQA 4EW3A 1X1SA 1PL8A 3PNYA 2AN1A 2BP7A 1KJWA 1QOZA 4UUMA 4Y2QA 1CHDA 1PL7A 3K6RA 3GOHA 3DTYA 3H04A 3CEMA 4BQRA 5KHOC 1BMQA 1Z5ZA 3ES9A 4PWZA 4DSTA 1XEWY 2AN3A 2NU8A 4DMKA 3UB4A 1OFGA 1T9BA 3VR5D 3QPDA 4HS4A 2CE2X 3MCTA 2ZYDA 4UZEA 5DXFA 4GZLA 2EJTA 4FCWA 1LQUA 4HUJA 3NHLA 5IYZA 5J3JA 2F55A 1M54A 4RC9A 2RK3A 5FBZA 2I8LA 4FBGA 2J5KA 3A3KA 3GLRA 3LO5A 1KOJA 1GLVA 5BURA 1G1MA 2NT3A 3OE1A 5HKOA 4HWOA 4IKOA 3NALA 1N7JA 4NWIA 3TE7A 1N2BA 1T13A 2EFHB 1NJ1A 4ZRDA 2EBHX 2BUAA 1WZEA 2VPWA 3FMGA 4BO4A 5K6AA 2YCBA 3ZDCA 2ZJ2A 1CDZA 2IITA 3NP9A 5HF6A 4HVLA 3JAMA 3KSRA 1E5TA 3G23A 2SBTA 4I9NA 5HK8A 2XCRB 1YTUA 1ZICA 3JARA 4A2PA 4M1TA 3ZGXA 2RH8A 4RMNA 4I1UA 4QUBA 2AOUA 2P6RA 6GPBA 1MIOB 2XCUA 3FFBA 4FKMA 4V03A 5KNCH 1E3MA 4M6WB 4WXRA 2JLYA 4MKRA 1XCOA 1YZFA 5CVDA 4TZ0A 3Q6IA 4MQEB 3OCWA 3RUIA 2ZU0C 1U8XX 3VU1A 1Y9ZA 5BRNA 1GA4A 3K0CC 2XAAA 2I33A 5JS7A 2R5NA 3QVVA 4K9RA 3ICCA 1CF2O 3EWSA 1XRSB 4TQGA 5FEMA 2C4MA 3WKBA 2CVZA 2H0QA 5AM5A 4AO6A 1A5ZA 2PJRA 1U7UA 1FFGA 3OPMA 3ONDA 1Y9AA 4JBGA 5H4GA 4O0MA 1RJEA 4TXNA 1NMQA 4TLEA 4LMRA 4QTTB 1DIHA 2C78A 2JAPA 1OA0A 1Z28A 4E14A 5I5EA 4Z4GA 2ENUA 1HTWA 4OU4A 4X1OA 3TFQA 3VO1A 1HDOA 3HXMA 3IT2A 4CWAA 1GN9A 5G53C 1PRYA 2OFFA 2OPBA 4O6VA 1M67A 1A27A 1FYDA 1L4KA 3AF0A 4G9GA 5EIBC 3ICPA 4B4KA 3BEDA 1NU8A 4UAJA 5E7JA 2DUMA 2A58A 4BU0A 1PT6A 2ZWPA 1E1CA 1A9OA 1JDUA 1QRRA 2CFRA 3N2KA 2J3QA 2P9FA 4QUIA 3RFUA 3U9LA 2OESA 4IM7A 4YXWD 3K4PA 1FP4A 1JJAA 2B20A 2FUEA 2ZU6A 3QLJA 3EXEA 4JAVC 3BF8A 4RESA 1XPRA 4HDRB 2WUGA 1OR8A 5EKXA 4TMWA 1O9HA 4DHEA 1GPWB 1G3IA 4BO7A 4RHCA 3MMSA 4UHDA 5IF9A 1VPVA 3JY6A 5E1MA 3PC4A 1E9SA 2O5EA 1YZQA 4G23A 1PUJA 1T25A 1S9DA 4EHNA 3UK1A 1FQOA 3I3SR 3DEHA 1QMGA 1YS4A 2DGDA 4LTDA 5IUJC 4R8SA 2GBPA 1C7EA 3GEMA 2NVOA 3TXXA 1NNSA 5HP4A 1Q0TA 2BEVA 2I4NA 1KARA 5K0EA 5F7JA 5TVGA 1YZ3A 3DAYA 4XJTA 3RTEA 4BC0A 4YAWA 2OOSA 3JVVA 5JYDA 1N0VC 3FHJA 3PQ5A 2KQUA 5GPBA 5EZYA 4E2WA 1P9NA 1SBCA 5C31A 1WMAA 1RJ9B 1RXEA 1M34E 1VHJA 2J7PD 4CF6A 2WJPA 1I36A 1LUAA 2O3TA 4F21A 1K7EB 3OZXA 1T4BA 4UVDA 1DHRA 2DPLA 2P2DA 4KW7A 2Q46A 1N2HA 4YMGA 3DOJA 2CKMA 3R5XA 1DFGA 1RLJA 4CT5A 4EPWA 4TYMA 3AYZB 4O0LA 2REQA 2R47A 4RV4A 4RD2A 5JXWA 5J5VA 1ABFA 4KQIA 4S24A 3ANXA 3EZYA 3KTDA 3WRYC 4IIEA 2WVJA 2BTQB 2CB9A 3NBAA 2NNWB 3PKJA 3RBVA 1KI4A 1KXJA 2UVQA 3NVDA 2FEXA 3ECAA 4X85A 5IFLA 5L4LA 4F0JA 5LNK1 3RQSA 3BBPA 2FMTA 3WWZA 4ES6A 3KDSE 2OCIA 2FZKA 3UK2A 3A04A 4EELA 1E99A 2X4DA 2A67A 1IAQA 1ZBQA 4TV8A 5ALGA 4JJZA 4GYWA 5IHXA 1OLUB 1CWUA 2HU7A 2J4DA 3CJQA 3GJ8A 5IJXA 5HF9A 5C9ZA 3SC6A 1D4FA 4DXDA 4KIGA 1HLGA 2H6EA 3BD6A 3HDGA 3E5RA 1PAUA 3JQ9C 4REQA 4L5CA 2IHNA 3M5CA 3IVAA 4AUMA 5FL3A 1AHPA 5EYPB 3DLHA 3HH8A 4LWQA 2HU5A 4PZZA 5BV2P 3KLNA 3KQHA 3BJZA 1Q11A 3GEGA 4RDHA 2QRLA 4UBOA 4P31A 2HTEA 3MTAA 1H9AA 1J42A 3BGSA 3W8DA 5JHHB 1CRPA 3DL2A 1O0BA 2HA0A 3WS7A 5DN6A 3HB1A 3C6XA 3LMKA 1KPGA 1HQCA 3GLFB 2O48X 1O95C 1WE2A 1G3QA 2JIRA 4P4UA 1F7UA 2JLUA 2WHRA 2XT0A 3HUUA 5EE5B 5ICEA 1CP3A 1S3IA 1UT8A 3GRUA 2ZI4A 4TTVA 2CF6A 2E89A 3FNFA 4XVRA 1LTHR 2I2XB 5AI6A 3T9AA 2CNWA 3R9KA 4NF2A 5FOVA 3I2IA 1ZHFA 1E9DA 3GNQA 3GPIA 3ROEA 1YVPA 3STWA 4GPEA 3ZXYA 1QJCA 3CCCA 4MWEA 1XYGA 3SKXA 5TS3A 1JIUA 4MVJE 3TIFA 5B57C 1GNQA 1WPRA 1YQGA 1ISFA 4J4TA 5IXSA 3F67A 2PO5A 1ATIA 3ZU4A 3PITA 1NQXA 5LZ8A 2JFXA 5JSFA 5ARDA 2AWNA 3LT0A 4L57A 2F17A 1S96A 1P62B 3MCVA 5TQ2B 3BERA 3E8SA 2RHHA 1P2VA 1NY5A 3O1HB 3CRQA 3OZWA 4OA5A 1TTPB 3VKVA 1I94B 3WMFA 4UU8A 1U4SA 2VF2A 4XQEA 3OIVA 1V9CA 1DO2A 1NOJA 5BWNA 4ZVQA 4DAOA 4KFUA 3NH9A 3ONWA 1ITZA 4RF2A 3CG0A 5C37A 2AN9A 3WMXA 2XBLA 1FXWA 3ILHA 3D3NA 1EPUA 1Z4OA 4YROA 3D8HA 1GQYA 3ZWKA 1A3CA 1EM8A 3LIIA 3WNBA 3W5DA 4P38A 2OA0A 3I01M 3FRHA 3X1WA 3KPWA 4J0GA 3UUFA 4TSFD 5MN5A 5BVGA 1HE3A 1A5TA 2J0UA 2VDPB 3ZGLA 3R4CA 1HI9A 4YWJA 4GWGA 2DBYA 4D8TA 3U37A 1J4AA 1RYFA 3NANA 4RZ3A 4BV2A 3KJIA 1Z8NA 3EBLA 1U80A 5JAZA 3A4MA 3HCAA 2VKQA 3UG7A 4IOLA 3GP8A 1FYFA 2R1TB 3ANSA 3TTYA 4FYPA 1CZOA 4U8GA 3CLVA 3VYRB 3G5LA 4NE9A 1X3LA 5A4KA 2Q41A 4GDMA 1NI4A 4C2BA 1GFZA 2G5CA 1NYRA 5DGHA 5A1JA 3THWA 1H4SA 2R6HA 2P0YA 4ZJYA 4CL0A 3KZVA 1R0KA 3REQB 3PXEA 1LI4A 3TIXB 1W36D 3B1XA 3I34X 1EQAA 3AOEC 3KYCA 2KHZA 2Q1UA 4HNUA 1T36A 2QNRA 1GNSA 4RZUA 1PUXA 1QF9A 4HGYA 2I7TA 1KQOA 1U0TA 3ZWYA 2VEOA 1Z0JA 1TVKA 2OG2A 3TOZA 4YCLA 5HMMA 4KJXA 1JRLA 2LWIA 3NWJA 4R41A 4WPGA 2ATVA 4YQYA 4ZZ0A 1EQ2A 1A4RA 2VI5A 1Z5WA 2BP7B 2CB0A 3FUVA 3P9NA 5ADWA 1FDVA 2ZWOA 4K81B 1NG1A 3BWDD 4MW1A 4IPTA 4YJDA 3T94A 4EVQA 1EAMA 1YL7A 3LS2A 3RFXA 3WYCA 4MV7A 2NU8B 4TTTS 3GZ4A 2R4QA 1JXOA 2PZBA 3UV3A 1EH5A 1MQ9A 2HCBA 2IHJA 1HL3A 4MUNA 4TRNA 3PA6A 5DHPA 4FONA 3D6MA 1RT9A 2A57A 3GCZA 3W5UA 5TV2A 5LQRA 3B3AA 3G0HA 4JR0A 5TGTA 5IYZB 1WB6A 1HFKA 3TZCA 1J23A 1TIBA 3WNCA 3RB8A 2VRBA 5ALVA 1XWFA 4TWZA 5ALYA 3VSAA 2ZE7A 1Y6QA 2NZXA 3F6BX 2I2BA 4ZO8A 4R8MA 3O92A 4BFSA 2PNFA 1WPXA 2XZPA 2D2EA 4DDKA 1UXOA 1V9LA 1MO3A 1W19A 2A0WA 3ZY2A 1R5BA 1W4BA 3QTTA 4OAPA 4FS3A 3WRYA 4UBLA 3IS3A 1UPUA 3KBOA 4C3OB 5T64A 1O8CA 2R4TA 2PR7A 1YA6A 2HMTA 1J8MF 3G2MA 3OZCA 4E70A 2C57A 1CNEA 1OD6A 3JARB 3FROA 4BVFA 3ODGA 5C5CA 2AOUB 1XMIA 5DULA 1RPZA 1JG6A 1GR0A 2GCOA 5B2EA 1E1LA 1XZPA 4N7BA 4X00A 1JG3A 1EUCA 4NZZA 4G8CA 1QAMA 3MJSA 1XD8A 3BCUA 4K5QA 4L75A 4RD0A 3ZYZA 5I9BA 4D42A 4NV1A 4ZXFA 3A8TA 9LDBA 3ESAA 4RHXA 4KQCA 1J33A 4KR9A 4BHTA 4C08A 5ILOA 1EHYA 3NIBA 1EDZA 1PEKE 3EDMA 1ZA2A 4IHAA 5IANA 5EJFA 3ZCPA 1G6KA 1CB7A 2WYHA 4BFCA 3Q8MA 1FTGA 2WIGA 2NQTA 5TGDA 3UTCA 1I14A 2B1GA 2VG8A 5J2TB 1JLHA 5HE9A 2XTMA 1WMSA 1ZITA 4BPRA 1PJ8A 2P9EA 4JXKA 4LHVA 2H0RA 2IU6A 3NXSA 3AKEA 3QX9A 4IDCA 3W6PA 4BE4A 4ZYXA 1SMKA 5DGIA 4BMOB 1ZD1A 2BELA 1IXKA 2B0JA 4S2EA 5FBHA 3ZQJA 5YASA 5ALNA 4YXFA 3AF1A 1OPXA 2CW5A 1WXIA 2RGWA 1NWCA 5A7GA 4LZWA 5AVTA 1EWQA 4I81A 1CUAA 4B0PA 4EHJA 1DBRA 2XVZA 1RZUA 5KNDH 3A3PA 4BWYA 3W4IA 1P0QA 2P5YA 1E1CB 2VBGA 1AV7A 1JTVA 3N2KB 4KFTA 5K0TA 1J22A 1KC3A 1EK1A 4RH3A 5I7EA 5LVAA 2V5UA 1JR3E 1FP4B 1CULC 3A4VA 3EXEB 4DPMA 4EPXA 4AZWA 1KYYA 2ZIUB 4OG2A 4YV1A 1ZC4A 4QFCA 4WLOA 1O95D 3I76A 3PQCA 2FEOA 4OCZA 4HD8A 4XM1A 2BOVA 3TNDA 4IG4A 2Y76A 5TEWA 4QJ4A 4WD3A 5LDHA 2C5SA 4J0QA 4TKMA 4DQXA 3IAAA 3UCXA 4G63A 3SQNA 2ZE6A 1PNVA 2O4CA 3HB0A 2QRQA 3VVLA 5BMVF 5LB2A 1B3RA 1ODFA 2BEVB 4MUKA 3PQ3A 1R7RA 3EIEA 4PS1A 5B2ZA 1QH9A 1CUZA 4RTKA 1UF9A 4TUYF 2DSTA 1ZBDA 3EPRA 2BFAA 4KQ1A 4XQGA 4CN8A 2GFQA 4YAKA 3EW7A 5KJ6A 2GD6A 4PGGA 5EZYB 2C3MA 1Q0LA 2BRUA 1SCQA 4BP1A 2O8NA 5JZSA 1T6BY 1U6IA 2L2QA 3IMFA 3LTEA 3KKOA 2V9CA 2EDAA 1AOXA 4Y2VA 5ALQA 4JDUA