1OD6A

The crystal structure of phosphopantetheine adenylyltransferase from thermus thermophilus in complex with 4'-phosphopantetheine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
155
Chain Sequence
MHVVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLENQYLFSAEERLAIIREATAHLANVEAATFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Implications for the Thermal Stability of Phosphopantetheine Adenylyltransferase from Thermus Thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE
total genus 57
structure length 155
sequence length 160
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2003-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1od6A00
4ZCRA 1UFVA 1JECA 2A1UA 1IQ0A 3DO8A 4YP7A 5IHXA 1PG2A 1FYDA 1QU3A 3ZJVA 3CLTC 1N2JA 4I6EA 2WQ6A 5TGTA 4MW0A 3IOBA 2HMAA 4GU5A 1MRZA 2CFOA 3ELBA 3SZGA 1R6XA 2NZ2A 3A4IA 4H3SA 1N2OA 2EJCA 4Q93A 4HK4A 3FNRA 3CVUA 1N78A 1HYBA 4XSVA 5J58A 2IJGX 3IMCA 1KP2A 1WXIA 3HGMA 2QJFA 1N1DA 1T6YA 3COYA 3N9IA 4EGAA 1K4MA 3COVA 4YP6A 5DEOA 2DEUA 3AG5A 4DJAA 4MUKA 3KT3A 1T9GS 4ZT2A 1K97A 1MOPA 1XJQA 4ZT5A 2J09A 3A05A 1O0CA 4EG4A 1EUYA 3D6VA 4KPUB 1J09A 4ARCA 3RHSA 2CYBA 3H05A 1H3EA 5TS2A 2CYCA 4ZCSA 3N05A 1G8GA 1OWMA 3Q12A 5K0TA 3IODA 2AG6A 1WQ3A 1KP3A 3CLTD 1ZH6A 3CA8A 1R6UA 3LE8A 4MW2A 2J4DA 3HV0A 4FZJA 1KAMA 3D6UA 3GUZA 3IVXA 2VXOA 2E89A 5JBNA 1U7XA 1IRXA 4DE5A 4WSOA 1LW7A 1TQ8A 3CVYA 4EFKA 1VL2A 2PXHA 1F7VA 4KR9A 2HZ7A 4MWDA 2IELA 4NATA 2DETA 1J1UA 4MVWA 3HMQA 4DDHA 3QTTA 2QTMA 4I6GA 2PG3A 1G8FA 3JXEA 1WJGA 3TZLA 1LI5A 3L92A 1OWNA 3H99A 4U8HA 4MULA 1M8PA 1XNHA 3AG6A 1P7PA 3IMEA 4U7JA 1H3FA 1WY5A 1NUUA 1JZSA 2WQ7A 2BTEA 1MBZA 1PFWA 4F4HA 1H3NA 2Z3VA 1M8FA 4MVCA 2RD2A 2A84A 4I6JA 1ZUNA 4DLPA 3FDXA 4MUFA 1EFVA 2H29A 3HFJA 2I1LA 4EG6A 2CSXA 2CYAA 3DV2A 5DASA 3NV7A 4NAHA 4OJMX 4HJXA 4P2BA 4S1OA 3SYTA 3ZJTA 1JIIA 2O8VA 2QJTA 4MW1A 4CDMA 3BL5A 1MAWA 1V8FA 2CV1A 1LI7A 2OV4A 3N8HA 1G59A 2DR2A 4MUJA 3NBKA 1PFYA 1OWLA 3UOWA 1MB9A 1Q15A 2A1TS 1O0BA 1GAXA 3COZA 1U3DA 1M8KA 3C8ZA 4JFAA 1QRUA 1N77A 3SEQA 5K0SA 3SEZA 1KORA 3Q10A 1T6XA 3KT8A 3VGJA 4RUKA 3TZEA 1GZUA 4MWCA 1R6TA 3DPIA 2A86A 3SDBA 2A4MA 4NZPA 1KH2A 1KQPA 3FI0A 4ZCPA 2AZXA 1FFYA 2V0CA 2QUKA 3CLUD 3MLBA 1EFVB 5TEVA 4DNXA 1IQRA 1I6LA 2E18A 4G5FA 4YBRA 3FIUA 4PBSA 3CLSC 4QBTA 4F3RA 1O96B 1ZH0A 3K32A 1M1ZA 2V0GA 2Z08A 2YWBA 3RBAA 1N2EA 2GKSA 1QU2A 2TS1A 3E27A 4MAFA 1NYLA 3QE4A 3CLUC 1KH3A 1ILEA 5J5AA 3MXTA 4MUEA 5LLTA 4XFJA 4X0EA 2OQ2A 2J5BA 3PNYA 3FWKA 3HZRA 3QTBA 3RK0A 2VTBA 2CV0A 2J07A 3PXUA 3IVCA 3IUBA 3CVXA 1VLHA 2H2AA 3ND6A 3PNVA 4MUNA 3ZUGA 5IJXA 2XRYA 3INNA 1WZ2A 2R5WA 4KPUA 2EL7A 4TS1A 3I05A 4J76A 2CUZA 2YY5A 1H1TA 3PNBA 4NAUA 1B6TA 1ULHA 2X3FA 2QTNA 2CT8A 3OTWA 4OUDA 1CT9A 4HPWA 4MW6A 1XNGA 4MW7A 4EG3A 1S4MA 2O5RA 1O95C 1IFXA 1NZJA 1OWPA 1N2IA 1GPMA 1TYDE 2A1UB 5BNZA 3CLRD 1U3CA 2QUIA 3SP1A 4AS1A 2E21A 4PBRA 1TYBE 2YXNA 3Q4GA 4Q16A 1WOYA 3FHJA 1OBCA 5LFAA 1V47A 1F7UA 3FY4A 1SURA 3L93A 1GN8A 3N2YA 1NUPA 3ZIUA 3CLRC 4MUGA 1MAUA 3TS1A 3X1KA 3AIIA 3ZJUA 1K92A 1T6ZA 4L2IB 2PZ8A 4CDNA 1O5TA 4UZFA 3HL4A 1NUSA 1WQ4A 4NDAA 3VRHA 4CQNA 1YUMA 4K03A 3IH5A 3ND7A 4EG1A 1COZA 4KR7A 3A04A 1Y42X 3H9BA 3RK1A 1J70A 1QJCA 1T9GR 3F3MA 1N75A 2PIDA 2D54A 2JANA 1JZQA 1KAQA 4E1AA 1MJHA 4MVYA 3CVWA 4PY2A 2DLCX 2DUMA 3UY4A 1F9AA 1JMVA 2A88A 4QREA 3H97A 4EG8A 1YIAA 4J75A 5FNZA 2ZUFA 4JYZA 1ZJWA 4AQ7A 2ZP1A 3ND5A 3VU8A 4EG7A 2VTBB 2X1LA 5FO1A 4K0RA 1U7DA 2B7LA 4JZYA 1N3LA 3P0IA 1A8HA 1XNJA 2QJOA 1YUNA 4ZT7A 2WSIA 4JXXA 4MW9A 4KKVA 2XRZA 3IDFA 4QRDA 4MW5A 3AFHA 1PG0A 2G36A 3GMIA 1PFVA 1YI8A 5LM3A 1K4KA 3FH0A 2BYTA 1M8JA 1O94C 1QTQA 3LCJA 4ND6A 1J20A 5DB4A 3FOCA 1I6MA 1WXFA 1NP7A 1J21A 3ZXIA 3RJZA 3CVVA 4ZT4A 2QUJA 2D5BA 5TEWA 1TEZA 3G59A 2C5SA 3A2KA 2J08A 2D13A 4WNYA 1MC1A 3S3TA 1DNPA 5KCMA 1EFPB 3IOEA 5HUJA 2Z09A 1KH1A 2YWCA 1YULA 3COWA 2IP1A 1WXEA 1Q19A 3H9CA 2CV2A 2GM3A 1JHDA 1NUQA 1M8GA 1IH8A 4R2MA 1Q77A 5FO0A 4OUDB 2DERA 2GOYA 1G8HA 4G5YA 3ZGZA 2DPLA 3ISJA 5F23A 4L2IA 4DDMA 3KT0A 3P0JA 2QTRA 1EFPA 3UK2A 1N2BA 2X0KA 4EG5A 1JGTA 1JEDA 1O94D 1EE1A 1OWOA 1TYAE 2ZUEA 2PZBA 1YIDA 4ARIA 1KQOA 1TFUA 4R0NA 4G6ZA 3DLAA 1X8XA 4EF6A 1VBNA 3FETA 3M5WA 1VBMA 4GRIA 1WXGA 4MLPA 5H16A 1OD6A 2JA2A 3ILVA 3UC5A 3K9WA 3KT6A 3X1MA 3RFFA 1QRTA 1WKBA 3P52A 5KHAA 4ZCTA 1PFUA 2AKEA 3X1JA 4UZEA 1N2HA 3NBAA 1D2RA 3U1VA 1QQTA 1KKUA 1WXHA 1Q11A 3GLVA 4A91A 1JEEA 4MVXA 3TNJA 1EUQA 4XFDA 1M83A 3KFLA 1BS2A 1NURA 1X6VA 4HJRA 4YMIA 1GLNA 1MB2A 3TQOA 4MWEA 5AHWA 3G5AA 1KQNA 2PZAA 4JXZA 1EXDA 1QNFA 1O96A 2HGZA 4MW4A 4CT0A 3CLSD 1GTSA 4KR6A 1O97D 5EKDA 5HUHA 3SZ3A 4R2LA 5HG0A 4ND7A 1N2GA 1GTRA 4RPIA 1TYCA 4MUIA 2DXIA 4U63A 2A1TR 2WB2A 2PFSA 1JIJA 4BWVA 1IHOA 4MUHA 3AL0C 1JILA 2JAXA 2A7XA 2E0IA 1I6KA 3FG9A 1RQGA 3PRHA 1J1ZA 4PBTA 5KWVA 1JIKA 1O97C 3OP1A 3P0HA 3AKZA 3IUEA 3TQIA 2X1MA 3G6KA 3LOQA 4NX2A 2NSYA 3MUEA 4MQ6A 3IOCA 3ZXSA 1EJ2A 4YP5A 1NUTA 1NSYA 2RE8A 1KR2A 2QUHA 3UMVA 3CR8A 1QRSA 1I2DA 1IVSA 3MLAA 4MWBA 4ZT3A 5H7XA 1O6BA 4ZCQA 1IQUA 5J59A 4ZT6A 1VBKA 1NI5A 3MMXA 1U0BB 1F4LA 4DDKA 1O95D 1OBHA 5DK4A 3IVGA 3IMGA
chains in the Genus database with same CATH superfamily
2WMDA 2F8LA 5GMOA 3WRXA 3BG5A 4TSFD 1IM2A 4TRJA 2RJNA 2IOYA 3C6KA 3E23A 1GCAA 3A6LA 3K92A 3OM8A 4YP7A 3IELA 2J67A 1XVAA 1U1GA 4PZEA 2FGKA 1FDIA 3KQQA 3STVA 4OQEA 3EIQA 1DUIA 3Q72A 1KARA 4FYVA 4K0KB 1QONA 3IXMA 2FEPA 2XVZA 3FUVA 1YZTA 4PX5A 2IGTA 1XK7A 3IAHA 3TD9A 3IMFA 1DJMA 1U4SA 1QO9A 2D1FA 3QUQA 3GJ4A 3G2NA 1DUVG 3KU1A 1Y8RB 3HGMA 3MN1A 5KNCD 5HKKD 1W49A 3ZCXA 1GQYA 3SICE 5LZ5A 3RYFB 3Q6IA 2ZIAA 3VUEA 5EJ4A 3H8JA 2BD0A 3P9KA 4H17A 3ESCA 2OAP1 5DEOA 3PQ8A 4TUYB 1W0KA 1EQUA 2ZYDA 4MUKA 4ZJZA 4W63A 4EJ0A 1PLLA 1WLYA 2C2BA 3FF4A 3NORA 1UC5B 3VKVA 1P72A 2ANCA 1CPYA 3LRXA 3PVZA 3L0PA 3RSOA 4BNUA 1Z5OA 4C4OA 1MO2A 4YFVA 3VZCA 3ICWA 4FXOA 4Y2UA 4DFDA 4B7ZA 4MSUA 2CLHB 5L45A 1H2YA 3GNQA 4JI0B 2LUOA 3NW9A 3U3XA 1VB3A 4MUBA 5E6UA 2J8ZA 4HX5A 2VZ8A 1FTNA 2HO5A 4HDSA 4Z6KA 2R6GA 3MS4A 3K0AB 3F6EX 2VPTA 3FVWA 2EXXA 2BTOA 3EGVA 2LRHA 1BE0A 4Z1MD 2Q6VA 2R8EA 3DV0B 1LUAA 1AX9A 2OZLA 3LPCA 4HEA1 3KZNA 5IAAA 2EX0A 4IV8A 4UW9A 1T8SA 4PIMA 1OFVA 3SR3A 4TKUA 4XB2A 3T52A 3O75A 1NLFA 1YC5A 3D6UA 1GDTA 2B20A 421PA 3G89A 5DTEA 2BDTA 1MJ5A 2WIAA 1NMZA 4QO7A 1HORA 2IYVA 2YYYA 2QA5A 3VTKA 4DXAA 5L3SB 4E3ZA 2AXEA 1XTBA 2ZUDA 2W6MA 1TTTA 1V8PA 4PEVA 1CR4A 3NKFA 2WPNA 1KIMA 5ALTA 5HJEA 1BN6A 2WYUA 4QQ8A 4QXPA 3OOEA 3UJNA 4WKCA 5JAMA 1AQNA 3AUKA 1SZJG 2VNSA 3JQGA 2BGMA 5K3SA 4RELA 1AV6A 1VGRA 2GAAA 2D7DA 2HHAA 5FLKA 2O5CA 3WMRA 2HDNB 2JI4A 2QVYX 2B61A 3ED5A 1T9KA 3AFIA 1RWBA 4F4UA 5KTRA 1G5QA 1SXJC 3DL7A 3OQVA 1ZQ9A 1Q12A 2XT6A 4Q3CA 5E1OA 5BSHA 3VNUA 3T3NA 2KLBA 2BEUB 1RWQA 4U4AA 2X1HA 1M33A 1PYOA 4O59O 3P26A 1WY5A 3VU1A 4ZVKA 2FZEA 4MS1A 2BTEA 2X76A 3ZW7A 1T6BY 1YJ5A 4IZHA 3GLGA 3G3EA 4LEIA 4PGFA 3RROA 3W9SA 4RFSB 1HEYA 1KNXA 3L07A 5D00A 3RYIA 4J91A 2DJ5A 2RHJA 3CLKA 4EENA 1JFFA 1Z5ZA 2GCNA 2WU3A 5JHGB 4V2UA 5E4JA 1EFVA 4PO1A 4QXQA 3TF5A 3UA3A 3SMVA 4UXJA 1A2QA 2WAMA 5BV8A 2HU2A 3C24A 2X3UA 1GGEA 1Z6TA 1KMMA 2F3QA 2DHQA 8MHTA 2XECA 3BL5A 3H0EA 1MAWA 3NC0C 4CRWB 1WM1A 1LI7A 1EQ2A 3VBCA 4E14A 4RZHA 5JPCA 2HCTA 2FTKE 1KDVA 4O4JA 1RYZA 3ZWVA 1OWLA 1OIWA 1Q15A 3OU2A 1ADJA 4DNOA 1A4IA 1J0BA 3GZJA 4GL2A 2CY0A 5EQTA 3GJQA 3JV7A 3SFVA 3HM9A 1G8YA 3RC9A 2XDQB 3R5FA 1XMQB 4OQDA 4CF6A 3B85A 3R3WA 2V6IA 4HDSB 5TDHA 4DQUA 5BNWA 1CZRA 4JIMA 3AR5A 2ACWA 2V5VA 3GPCA 1IY9A 4CIBA 3AEUA 3DCJA 1F60A 1E4YA 2GBLC 3IBFA 3F71A 2JHAA 1MU0A 2H5JA 3AOEA 4X6LA 1GUZA 3E8XA 1GL3A 4WZ6A 1QVZA 5B1IA 1I7QB 4H27A 1NVGA 1QRRA 3JYOA 1QTNA 2IZZA 1DAEA 3QBTA 1E2LA 1NF2A 4MV9A 4ZODA 5JLAA 4YCMA 2EWMA 5JCOC 3S8YA 1JEQB 1XU4A 2A4MA 1DXYA 2VPIA 4DREA 3CRVA 5KQRA 1FC0A 1KRWA 5CMLA 4DMRA 3NEPX 1KMNA 5LQSA 1FFYA 4B32A 3LLUA 1O3YA 2VSFA 2XXJA 4BQEA 2DY0A 1R74A 5ALMA 4HS4A 1QAOA 3H2SA 4M99A 4R40A 4QBTA 1WO8A 5DTQA 3PUHA 1YB6A 1LDYA 4AP5A 2H11A 4LK2A 5DIFA 2R8YA 3LO5A 1KU6A 1S8OA 1OC4A 1W581 4RE6A 3MJRA 4Q48A 3E27A 4ZARA 5C4IA 4LFCB 5IK2D 3WV4A 1N1EA 3GAAA 3HSYA 4NZ9A 2FPWA 4GOLD 4EI9A 5IF9A 1URPA 3Q3IA 4X6XA 4WJKB 1KKMA 3BE8A 4ZZ2A 4FYJA 4JYAB 1MPTA 2RG7A 2DUWA 2WZCA 3AY6A 1J00A 1XLVA 3GNSA 4L3VA 4X45A 1JDSA 5F35A 1NPYA 2R7KA 3EFOA 1L7MA 1I4OA 1OX5A 2ODAA 4JL5A 1NN0A 3OZUA 1S02A 1YR8A 5EUCA 1OH8A 3TH5A 1YNSA 4RVOA 2OV6A 4WLUA 3JRWA 3WYEA 1WDLA 2FLWA 2XGSA 3OC0A 4ZDJA 4QVIA 4ZTZB 3WX0A 4LXTA 2CV0A 1CQIB 4FP9A 4EHLA 1U9JA 1OLUA 3O6VA 3RBXA 2VP2A 1F8YA 5CM2Z 3CVJA 2OAQ1 2OFFA 1E7MA 3UQYS 5MFZA 4WZZA 1NG9A 3FKSA 4TS1A 3GY0A 3AM3A 1U5AA 1BU5A 4L08A 3PNBA 3X1XA 3UAVA 2GK7A 5F7XA 4HY3A 4BCCA 3ER8A 3TQCA 4CDRA 5EIHA 1CZOA 2C4VA 3FPHA 4D42A 1ZKDA 1IU9A 4AURA 4ZN6A 4JSRA 1Z6XA 3DBHB 4NY1A 1EP2B 3L79A 4E7PA 4LTNA 4C06A 4FDTA 5I9LA 3AUTA 2IOQA 2E4ZA 4KAJA 4RTNA 1I1OA 4NFYA 1EG7A 2RGGA 1H4SA 2OORC 4D0GA 2O2EA 5EWJA 2GAFA 5DF1A 2P4UA 3HKEB 4C0AC 2XB2A 1DWQA 1CS4C 1XZHA 2F1OA 4PZPA 2X9QA 4C4XA 1X92A 4BNFA 3ASZA 4PAGA 4EJMA 3CH5A 2M6KA 3V2IA 1EFAA 5D5HA 5GWXA 1CUGA 1U1FA 3HN6A 3RSHA 2I2FA 4J7XA 4JX8A 3DM5A 2PGLA 2FVYA 1EFCA 3EMVA 3FFBA 5B6PA 4RVGA 4Z49A 5A2QA 2JLQA 5BVGA 1MPXA 1R4NB 3HZOA 4LNAA 5LA6A 2HFJA 1KSHA 2OFWA 2QRVA 3ETEA 4PLWA 3IPAA 1GNLA 3KV3O 4DADA 2H1LA 3AI3A 1HYEA 1LXCA 1T6ZA 2FXIA 2PZ8A 2ZSIA 1G3IA 3G0GA 4IUCS 4L2IB 2KBFA 2X0JA 1O5TA 2W93A 4ON9A 4YJDA 1E3TA 4YLGA 2VOJA 1TJ5A 1D7OA 2HRRA 1YVUA 2PXAA 2VRNA 3IVAA 4S0XA 1BW9B 3T1HB 2NZVG 4G5OA 5D01A 1KDOA 3COSA 1QGOA 2QUAA 1D9ZA 2BZ1A 1UP4A 2BMJA 1E9AA 1E2MA 4YCNA 1Q92A 2CNKA 3LSYA 5B1EA 5KSWB 2O2DA 2OENG 4ETWA 1ZGBA 4LMAA 5H1YA 3WMWA 1KAQA 3A9CA 1LCIA 5HIMA 3EYAA 3OESA 2VLBA 2UZIR 2G76A 4O08A 4INJA 4QSHA 3C7AA 4GGMX 4OMUA 4JCCA 2ES4A 3B12A 4NYMR 4EFMA 2E1RA 1MQSA 2WIKA 3CXUA 1XPUA 5IYZA 2J9YB 4FC6A 3T7TA 3SYMA 1JDBB 1EHIA 1IN6A 3FGNA 2B7LA 3R6DA 7ABPA 4WLOA 1CQJB 2ZJOA 1XNJA 2J7PA 1KY5A 3NVMB 3W7AA 4ZIRB 2PPVA 2IWRA 4Q37A 7YASA 3FNHA 2VJQA 3SE7A 3I0ZA 5HRCA 3F90A 5FAXA 4I99A 4FD2A 4INPA 4MGZR 2QEQA 4C7VA 2M98A 3BWBA 3BWCA 4DA9A 4X00A 2KWIA 1EFUA 2QORA 3I58A 4HNHA 3H2KA 3N6RA 1RQPA 2SKEA 3HEAA 1CF4A 1HLDA 5D7NA 1L1FA 3AP2A 2DBYA 5CFPA 5DNUA 3RANA 5DHAA 3MS2A 2G9RA 1RYBA 2JARA 5K51A 3U5TA 1GNVA 2B1IA 1NN1A 3ORYA 4GZLA 4BVEA 4CF4A 1D6NA 3HU1A 4FYYA 1YR1A 1NR1A 2GRUA 1Z5NA 2WM9B 3OT1B 1PZMA 2LR0A 4WNYA 2B1JA 4QOFA 1SAYA 4R9NA 4TMVA 4NCJA 2OILA 1EGQA 3AF0A 4AZ0A 3FCOA 3TD2A 1EFPB 1OTXA 2HNKA 5HUJA 2Q4BA 2QR2A 2W58A 4ZV4A 1SXJD 2BP7B 4YI3A 3HVKA 1VJTA 3C70A 3S5JA 3DKIA 3T7DA 1A4XA 4PC1A 1QLJA 1KJZA 5ALFA 4P3KA 2IIVA 2P9GA 1RRVA 1L5RA 3OQNA 3RC8A 5HIIA 1RYHA 4ZMSA 1U0RA 2FW8A 5BSFA 1E3WA 1MTZA 1PJAA 5ILOA 3C6ZA 4RYDA 2UYQA 4HAYA 2A59A 4L4ZA 5J4HA 2AK2A 5B6JA 1VPVA 1Y6RA 1SCUB 2KBEA 1NFQA 5KOYA 4MRMB 2NVBA 1DQPA 2H1IA 1OILA 2PD3A 5JARA 2G63A 1U65A 2LV8A 3L46A 4Y2GA 1PJZA 3WLOA 2AJBA 3SLKA 3TKYA 3JU3A 3N8NA 3RQSA 3FMIA 1FP4B 4JLNA 4XQ9A 1SFRA 1OXKB 5FTJA 3OFKA 1KKLA 4NS1A 5ICCA 1TZBA 4CDGA 3QLTA 4R0NA 1UBHS 4UCXA 4ADSG 4K9KA 4PLCA 3WGMA 1HRKA 4NU6A 1A72A 3A9WA 3UENA 2H5IA 2VDNB 1BXKA 3MWDA 2PCJA 4NONA 1NTOA 2WAOA 2C7QA 3DV9A 4A92A 5AM4A 5SZHB 1TJNA 4LNUB 1YASA 2HSJA 1MW8X 2VJPA 4B4DA 3DXXA 2O8CB 2NYAA 4G1UC 4M8SA 3K2QA 1GKUB 1XTRA 1PFUA 2YBEA 4QBHA 4WN9B 3OCCA 3SLGA 1RHRA 3K70D 3L4BC 4TWZA 1QVAA 3RHFA 3MOGA 1QQTA 3U09A 2OMKA 2OV1A 2OHHA 3A9SA 2AZTA 2R6DA 5H0IA 3T5AA 5DM70 1SVNA 1M54A 2G6BA 4UM8B 4OLBA 5TR9A 5T64A 3UM9A 3QLVA 2ZBQA 1GCIA 1NUAA 4JEIA 4JENA 4XLZA 3A9UA 4RMNA 3EBLA 1KFCB 4TROA 4MICA 3TQOA 4DSTA 4E5DA 4YLYA 1IUOA 4H7KA 4L50A 2BGJA 1M76A 2OBFA 2R8XA 2ODEA 4EJSB 1XMVA 1SCAA 3GGGA 1EVKA 4KRXA 4KR6A 1A7KA 3QKIA 4YRDA 3WWCA 3WGQA 4WGFA 5F3WB 2I5PO 1J0CA 2PAAA 4M1SA 1DIHA 3VOAA 2IX9A 1PV2A 3H2JA 4PRYA 1VJGA 1NR5A 5KNDH 4NYIR 2UAGA 2GPYA 4N48A 4XW2A 2MSCB 1WB6A 1JLKA 5F12A 4REQB 3ADDA 1D9XA 5G1NA 1TTPB 2JKYA 4LY9A 5MGBA 2RH9B 3T06B 3LL4A 3RVRA 4C08A 2BFFB 4KXXA 1O5OA 1UFRA 3F9RA 3IUJA 5JFOA 1UK6A 2V7PA 5LBTA 5DV9A 3FYUC 5A4AA 4WAUA 4O02B 5A05A 2BM8A 4CLRB 4BZZA 3EC2A 3M9LA 3ZHOA 4MVJM 1ZD3A 2NYRA 3TW6A 3VVCA 4GLJA 1GHTA 2IDMA 1EIWA 1GUBA 4DT1A 1NQTA 2W6ID 2BR4A 4G37A 5LU9A 3TEFA 4BB9A 4D8VA 4AKHA 3G82C 3OLXA 4D25A 2ZM5A 1E6KA 1ZRMA 1KZ9A 2ZAMA 1CRLA 4NVRA 4TTJA 3VVBA 4TYWA 1KI3A 1FQKA 1DO0A 2QX8A 3ECAA 2IDKA 2IZ1A 3AKCA 2QYSA 2CLLB 3CNLA 2OXTA 4UTPA 1QRSA 1CUHA 5BXYA 3QWBA 4QARA 2RJ3A 4OGGA 1UMDA 1TEVA 3H9JA 5HDBB 3HRHA 3D7NA 1ORTA 5EMLA 5EFOA 5CU7A 3HKDA 3P9CA 3IGFA 4G0PA 2ZI3A 2B25A 2JHFA 2QY6A 4HNSA 1ZR4A 1V41E 1F4LA 1KXJA 3BMXA 3OLZA 2B1RA 2QPLA 4M38A 3I32A 4NH4A 1MFPA 3ZBTA 2I54A 4LJYA 5AO9A 4LJAA 3REGA 3PJGA 1Y4SA 1YKFA 3SOZA 2CNWD 4Z7NB 1FRFS 2ZUSA 3I6BA 3OBIA 4LHYA 4UBMA 1FYEA 1FYDA 2FVXA 4O1MA 4B45A 3DE4X 1DAGA 1SHKA 1M2NA 2H51A 2IH2A 2EZ4A 4D9CA 4Z4HA 2HMAA 1TE2A 2ZITA 4B34A 5L95A 5T6MA 1Z7WA 2R6AA 4OFZA 5TF0A 3PT5A 4NMWA 4FFVA 5DCYA 4CM4A 3EIHA 5CFOA 3PS9A 4F60A 1XTVA 2XI4A 2Q7XA 4UHBA 4CM8A 4COOA 5IC4A 2XA1A 4DV0B 2WZBA 3M34A 1FVHA 5CIQA 4DC9A 3QSYA 2A8YA 4IDDA 1M5RA 1Z16A 1VMKA 5LYJB 3EA0A 3O4GA 1XRNA 4BMSA 4EGAA 5KPDA 2I7TA 4LHEA 4L4SA 2J3QA 2KM1A 3MW8A 4Z4IA 3STWA 3GO4A 1E7QA 1EPUA 1P0CA 4ZT2A 4HDNB 4LWQA 3VDMA 4C0QC 4YT8A 3BXGA 2YY7A 3V6MA 5JALA 4Y9UA 2XKJE 1HT3A 5AM3A 5A3QA 5A3RA 1FP7A 5B1SA 1RLMA 2GJKA 5AOCA 4LXGA 4HATA 3U9SA 5ISMA 4LZAA 2ZZNA 1UK9A 1EFTA 3F6YA 3OI7A 2G1UA 1W1UA 1UH5A 2YWFA 2OE2A 2CYBA 2YZ2A 3PFIA 3PVCA 3CUVA 1CNMA 2OZEA 4B0PA 5DDIP 4BMCA 1EA5A 3I9LA 1E2FA 1LZLA 3Q12A 3MGGA 2IYUA 4JLWA 4QDOA 1K89A 4UAVA 2EWVA 2PL9A 4YAKA 5K20A 4YP9A 4OGLA 5ARBA 1WQ3A 4XAQA 4BKOA 3DJFA 2WLTA 2DT8A 3VH3A 1PT8A 5JASA 3M1LA 2HIMA 3G0HA 1CF2O 3E5NA 2P9BA 3L1IA 1BGXT 5ICEA 2R0QC 2ZQ5A 4EB8A 2X7HA 3LE8A 1LPOA 3HV0A 4UMFA 3ZE8A 4GI7A 2WWWA 1H2EA 4F11A 2P6PA 4ZVRA 2ZTVA 2XDAA 3JZIA 2EP8A 3R09A 2QD5A 1AGXA 2OAEA 3VNRA 5B3KA 1DTWB 5L6LB 1BX1A 3VJMA 2J85A 1KSGA 4NV1A 3VDRA 1LW7A 5CB4B 4UHHA 1V6AA 3TINA 4F4JA 2F48A 2RDMA 1JHVA 3PKZA 5CNKA 2X40A 1R8XA 4HVAA 2QYOA 2EKZA 3OUUA 4LY0A 3FZGA 4FW9A 4I8DA 3PNLA 4DA7A 3ZU4A 3CWQA 3KJHA 4EYEA 5HZMA 3QOWA 4FFPA 3DMDA 4G4JA 1MQAA 4LYGA 4E5UA 2D2VA 4A6PA 3QTTA 1MIOA 4QGFA 4QBIA 1AXEA 1F8GA 1SQSA 5H9VA 1FX0B 2ZSHA 2QZSA 2VTDA 3ABIA 5LP1A 2OVFA 2NUTA 1WCIA 3AR8A 2WWGA 5CXSA 3OZBA 3AJ8A 3KD3A 4EB0A 5F64A 1IEQA 2ZROA 1YZHA 1KEZA 3QVUA 4DZTA 4H7JA 4RNDB 1Z18A 2I6QA 2WJ3A 4FKBA 2J9GA 4P54A 1RWMA 2F43B 2W7TA 2PKQO 4DANA 5IANA 1U8XX 5JY1A 5BYAA 1SVWA 1NP3A 4B4KA 1GD1O 4NEQA 4HDMB 1V2HE 3V7YA 4DOMA 4TVSA 3GRFA 4DLPA 3FDXA 2DR3A 1DBSA 1F12A 2H29A 2XMSA 1MZVA 3H13A 3IUSA 4URHA 5AHOA 4S2EA 3K0CA 4GPIB 5FBLB 3BEOA 1EVYA 2NU6B 5DASA 3ZNPA 2JLVA 3JVUA 4C14A 1GPAA 4FWBA 4RHUA 1CJCA 4FGSA 4D9FA 3S2UA 3HCCA 1SKUA 4OGFA 1TKBA 1W94A 3U4CA 2I87A 4GSYA 5EKUA 4ANFA 5A9SA 1CYEA 4AWXA 3QLEA 3U39A 3ZEIA 1B43A 2JGAA 2AR7A 3R9WA 2HYDA 1ACJA 1NVMB 4JLMA 3GVIA 4HDQB 1F8UA 3S68A 1A9PA 1IMJA 1QZTA 5ALOA 1MEOA 1UIRA 4MQLA 4MV6A 1N77A 4EUSA 1U94A 5K0JA 4WA7A 4MEBA 3LT2A 3H7IA 3OLCX 4IDGA 4IY1A 4FJ2A 3U3KA 3KKMA 4KVFA 1T9CA 5AXDA 5DMHA 3EXG2 5C7IO 4QM7A 4IXNA 4X1YB 5B37A 4Q7QA 4PLZA 1WUJS 3KVOA 3TTSA 4FHDA 1AUQA 1ARZA 3BF8A 4ZYLA 1XN4A 1NJ8A 1NNEA 1E94E 1JQ3A 3KC2A 4G5RA 4TT3D 1T2VA 2DY1A 2IYNA 5PGMA 5AFSA 1KH2A 1KQPA 5CITA 2C5EA 2M9MA 4RVFA 2CLMB 4AZVA 1R4AA 3KVRA 4JNKA 2NO9A 2P27A 2PRKA 4C29A 5HW0A 2P40A 1KVSA 3A6KA 4XX0A 1IQRA 3TIGA 4F1WA 4ZZ0A 3CLSC 2XOKD 5AOVA 1DXQA 2IEYA 3TQHA 3MTEA 4DHEA 1GYPA 3DZHA 1YZNA 3KS9A 4J90A 4LMRA 5DYIA 3JYNA 2YHIB 1B1CA 4BB0A 4E12A 6YASA 4YMTA 1ZHFA 3R6TA 4RSMA 1N2EA 1XVUA 3I4CA 3PXDA 1JSCA 4BQIA 3CLUC 1KH3A 4BJ3A 1TZ2A 3BF7A 3FOBA 2EARA 4L8FA 1Z4QA 3WADA 5AQEA 4D3XA 4JQOA 2Q28A 2R25B 1IYZA 5IARA 2WEKA 4CMBA 3LQKA 3BIXA 3QFFA 3C14C 4DCOA 2C7RA 4DR6B 2DKNA 2J5BA 3QVOA 5DHPA 5E8RA 3H0CA 4XQEA 2VTBA 2GLXA 3CW8X 2EZ9A 3AY0A 2XUFA 3MBKA 3DDCA 4S24A 1KYQA 3IUBA 3EF0A 4JB2A 3WYCA 4EPXA 2R6ZA 4FIDA 1Z17A 4FFWA 1G2IA 2IL1A 4Q9JA 2NTVA 3T5CA 3ROKA 4CM7A 2JK1A 2ECQA 3GGSA 4DQDA 4ZIRA 2SICE 2R5WA 3VR2A 1VSBA 1G5TA 3TE7A 4YT5A 1XMIA 2JFHA 4NXMB 1AS2A 1U5CA 5C4MA 1GZDA 4LXHA 1B6TA 2C7PA 4MMZB 3BTOA 5E6UB 3U7HB 2A5LA 1AV7A 4KX5A 4D8XA 4AKIA 1I1NA 4OUDA 4TTIA 1L7QA 2C9BA 3EZXA 2HH9A 2P2ZA 1Y1RA 3RE1A 4L5JA 4LG1A 4MEAA 3WRXC 4C07A 2O5RA 3OZDA 4A8TA 4DLAA 4PLVA 5CA1A 2XLBA 3VTFA 2WYWA 1HV8A 1JLRA 3QWHA 1JALA 2OZLB 2WD8A 1X7WA 2MTBA 1U3WA 3OZ7A 4PBRA 4Q16A 2QP3A 4RXTA 4C0SA 4JJIA 3FOFC 2WTMA 4WBNB 4GMXA 1X94A 3HXOA 1TEHA 4ETIA 4U0KA 1XIVA 2VQSA 3PF8A 1PGJA 4BHTA 1D2AA 1E1RD 3I9KA 3H5VA 1ST3A 4RSRA 5FOSA 2J3DA 5EMMA 2VYCA 3WLQA 3FY4A 4Q4HA 2IODA 5MGNA 4QTYA 2WFMA 3ECCA 4KNVA 3VR2D 4X91A 1O6CA 1NW9B 2I99A 2V0NA 3NTUA 1XZMA 1U8ZA 1UFKA 4K40A 4L6CA 4U7DA 3F74A 5A62A 3ZJUA 4KE8A 2IYAA 4KXFB 3AR6A 1VP3A 3AIKA 3DMNA 4L3WA 4ENTA 4HN4B 4AU1A 3CF0A 1PK8A 3HKBB 5EE0A 4PZZA 1WQ4A 2QP9X 1KDPA 1H2AS 1MW9X 1ZWKA 2X5JO 1XRJA 3F5MA 3H16A 2I1VB 2UV8A 3LKZA 1G3RA 3PITA 4R41A 9GPBA 2AWOA 1AQUA 3UO8B 2YVUA 4DYVA 1GPBA 1QJCA 2OHXA 2WOOA 1SBCA 2AE2A 1PSDA 1Y3AA 3KK0A 3PJEA 3I9MA 2QV0A 4QGAA 1V37A 3B3QA 4PSVA 5LA6F 5FAKA 4BO3A 1DAPA 1LW6E 1TX4B 1E6CA 1QRDA 1JKXA 1JLMA 3LPLA 3ACBA 3IE2A 4ZVOA 4MVYA 5CD9A 5IZ4A 3HYSA 2PAFA 1CJUC 4IZOA 2F3PA 5CXUA 3G79A 2P2NA 1CZHA 1HLFA 2AE1A 2NOAA 4KYIB 1KU0A 2YRFA 5EWLB 4MGYR 4BLSA 4D9IA 2BGGA 5J2TB 4H1HA 4GXNA 2O8NA 2JLBA 5H3LA 3TEMA 1BDMA 1DQZA 2OC9A 4QTXA 4A0RA 1XEWY 2I29A 4E32A 5LP6F 2AN5A 1RRPA 1X8LA 3MOIA 2VPYA 4P7JA 1BQ4A 4KXQA 2ZWAA 1YQDA 4X95A 1HDIA 1SQFA 4PYOA 5ABPA 5HUQA 2P4HX 4TMZA 1HF3A 1U6KA 1U7HA 1PWYE 1W88B 3AFHA 3MTDA 4HVCA 2GPSA 5AVXA 2HA2A 2FK7A 5IBCA 4H31A 3LLSA 4XUCA 1M2HA 1WBJB 4Y6GB 4K9DA 3DE0X 1CHNA 1J06A 1I1HA 4B9EA 1GT6A 1G17A 3I1IA 3Q7EA 3U3ZA 3QX9A 5L3SA 3DLTA 1KI6B 4HV4A 5DP2A 3KTAA 1PR0A 4IAOA 1SJ9A 5DNEA 5TEWA 1R9MA 4B31A 1IJEA 4OP3A 2C8VA 5IVHA 4B43A 4CU2A 1YHNA 1NMSA 3P9NA 4MRMA 1J22A 2IHNA 1FQOA 2VYNA 2BGTA 3GRAA 3L0DA 4R8SA 3O74A 4IIDA 3AX6A 1ZK2A 4B8ZA 3JALB 2VG8A 1NQWA 3DFIA 4IDCA 2G0NA 3TFQA 4YCDA 2BFEA 3G2MA 3BSFA 4E03A 1CKEA 4FFSA 1CQWA 2XKAA 1R12A 3LIPA 4GKBA 4CJXA 4PLHA 3TNYA 4DLTA 2AFIE 3EF3A 2WHRA 5A5FA 1I33A 3U37A 4XD7A 3G85A 3ABQB 4LI0A 4Q21A 5K3FA 2FCRA 1UBOS 2OK8A 4B2PA 5KQGA 5EKTA 1ZRHA 3KOXA 2WJ6A 3GEGA 1DJOA 2BKEA 3CMMA 1WVIA 1WW3A 4LY3A 4OLJA 4IQFA 2B5OA 4K9RA 3FUCA 1AKVA 1VPEA 4ZO6A 4DWWA 1DHRA 1NLUA 2D0DA 5SZKB 4DXHA 1DX6A 3K05A 2FPGA 1TYAE 3HWSA 4PHHA 3JW8A 3KLOA 1MDBA 2NVWA 5JSZA 2PZBA 3HCAA 1HKUA 1YIDA 3HJUA 2V3VA 1P19A 1XUOA 1T5DX 1PDOA 1XQ6A 1JMYA 2CKDA 2GR9A 4MQMA 1TTQB 4NAVA 2ZZMA 3GH1A 3GIWA 3OE7D 5BSUA 4RS4A 3QWFA 1ZWLA 3VX4A 3ZH9B 5AM2A 1QCYA 5AUQA 3SXJA 1J2RA 3M5WA 4LA4A 4YWJA 4J0IA 3REQA 4NOKA 4WACA 3DCNA 5BW8A 1A77A 1YDFA 2ZZKA 3RRZA 5CA0F 3AUSA 4BFZA 4Q1CA 4ZKDA 1NJ2A 2DPHA 4OA5A 4QG7A 3BVPA 4GRAA 1ECCA 3GLFA 1LDBA 2W98A 4UUPA 1EINA 5DH9A 2VAWA 4AG6A 1SUDA 2VK8A 2W5UA 3JAWB 4M7WA 1E9BA 3QUTA 2B6HA 2WWIA 1JS1X 3K4HA 4XSGA 3RUPA 4DJEC 3V42A 1AO0A 3QF4B 1E7YA 1DGQA 3CXRA 3NBAA 4OREX 3RIEA 1P2GA 3RJMA 4EL0A 2D6FA 2QN3A 3L40A 1TVKB 1FB5A 4G8JA 1ZMOA 4QJIA 3ZI0A 4Q1FA 1UDRA 3S4YA 1BJRE 2PIAA 4RHXA 3TNJA 1EUQA 4XFDA 1TM2A 3K53A 2ODPA 3KZ1E 5FDFA 4OYHA 4S1VA 2FDXA 1X6VA 2GBLA 3C45A 4UNRA 2ZXEA 3DMYA 2HWUA 3P9XA 5LZ2A 1QR2A 2RI0A 3QBEA 5CX4A 3VKGA 3K9NA 3MPOA 5FWYB 2XXAA 1QV7A 1EXNA 3GFOA 2Q2QA 2V8BA 2VJMA 2ZUVA 1WW8A 3HJBA 4CLRA 5K09A 1TW3A 2DOKA 3AHEA 3FDJA 2Q3DA 1TCCA 1FF9A 2VZ9A 3PFKA 2A78A 5LQUA 1TLTA 1ESMA 3A7EA 1GR1A 4KTVE 1XG5A 3KLBA 3KWJA 5EKDA 5HUHA 1E96A 1DIBA 5BWNA 3S2YA 3GYBA 1GTRA 1TQHA 4CZ2A 4BLOA 1NIJA 4KBYA 2KQUA 2BBTA 4BXOB 3PTZA 1L5NA 5BNIA 2GD1O 3GEPA 5F2EA 1G6HA 1M1YA 4C4YA 4C4AA 1KOGA 2CGEA 4DBZA 5LQRA 3OSUA 4JJ8A 4ITVA 4OMCA 3U44A 3JQEA 1RQ2A 1NQAO 3CN7A 4EVSA 3DZIA 5FOVA 1PJ2A 1KQGA 2YV3A 4ENUA 1C0KA 2XTMA 3DFFA 3UFBA 2SHKA 3OP4A 3P0HA 3JZAA 1CUIA 1C3OA 2IYYA 3N1UA 2DBQA 3G6KA 1JFSA 2VPPA 4N5DA 4OYYA 3B8HA 1XRRA 2QZPA 2Z57A 4RKYA 4XVHA 4WXYB 4ER5A 4J8PA 1Z7YA 1WA5A 4NNJA 1LBSA 1GSAA 3IOCA 3GJRA 1HDEA 3TQSA 4EA8A 1C81A 1GCGA 3PB3A 4N8SA 4DNFA 5A03A 1LPPA 2JVJA 4EI7A 2WWYA 3VR3A 4RVUA 3EW9A 3HNRA 1E1LA 2ONCA 1KR2A 3KEOA 3QP9A 4G0YA 3UHOA 3PR3A 1XDDA 3L05A 3WB1A 5ES4B 2QE7D 3EUWA 1T5BA 3WMGA 1GA6A 3D9QX 3DWIA 3BE5A 4P93A 1G291 2OXIA 1LVHA 1DKRA 3KZMA 3GFQA 5K99A 1XTKA 1YZVA 4HH0A 1WW2A 2ZYSA 4JJKA 3QVVA 4G0OA 4KYVA 3K70B 3ZWDA 3TOCA 1PO7A 5H81A 2OGWA 4Q3EA 4BV3A 5KYNA 3T9EA 3ZE6A 4Q4AB 1NBMD 2OO3A 4YJHB 1UFVA 5KJ6A 1P31A 3ZDCA 2A0WA 2VFAA 1RFLA 1SELA 2ADMA 1COWA 1A9XB 4D80A 1SWVA 3RJTA 1U2EA 1GRNA 3B1KA 1N5RA 1UP7A 4MJXA 4QODA 4AFNA 4WXMA 5EN4A 3K15A 3W8DA 3CPEA 4F21A 3ZS8A 3WNVA 1TVCA 3BDVA 3RVLA 1WKVA 3CNOA 5H68A 4ZRNA 1WIWA 4BL5A 1YJCA 3M4XA 3T8YA 2WU4A 1U2SA 5CD1A 1FIUA 2BR5A 2UUCB 1N78A 1FSZA 2BF4A 2HMTA 4H4EA 3C39A 4RLQA 3QPAA 1NQ5A 4WTOA 1N1DA 3AF2A 4FGUA 2FZLA 1SUEA 4OM8A 5ECDA 5AT1A 2P6OA 5GONF 3RASA 2AKYA 3GPDG 2OZKA 1C3XA 1JB9A 5MN4A 3FTDA 2VXBA 2GVNA 3HCNA 2FPUA 4ZT5A 1F4PA 3K0CC 5HRUA 3MD0A 4O2RA 1IBLB 1PF7E 2VF2A 2X4GA 4UAJA 3ELUA 1IB6A 5K9ZA 4P34A 1OH5A 1J09A 4F6LA 1CVLA 1J5PA 1HFWA 1C7QA 4IJUA 3MTIA 4JOSA 3O8QB 4TYNA 1H3EA 1YS7A 1YT5A 1XDWA 1KDYA 1Z75A 2OV2A 4IIBA 4BC0A 2IBTA 4V0ME 2PUTA 5ETJA 4PG7A 2X5XA 3BMQB 1TCVA 2YHSA 2AG6A 2JASA 1ZH6A 2M1XA 2JCVA 4BKPA 3BHNA 5L3QA 4QJ3A 4GEKA 5EA2A 1M7BA 3JD0A 1YK0A 3MBOA 4O4IB 4Z0HO 3ZJYA 4CLHA 2OA0A 1LFAA 3AHGA 4PPNA 4MB0A 3RRJA 1CQJA 2BFPA 5IWAB 4KQHA 4P7FA 1NIPA 4EHBA 5A0FA 1SVMA 1CE8A 3KKEA 4RSHA 1C7EA 3RR2A 1Q7TA 1A5TA 2FWMX 1XAIA 1P9NA 2JNWA 2OCLA 3Q7SA 2PT7A 1X1EA 1SBQA 3MFQA 4UVGA 1ZXLA 3M33A 2R8OA 3KQTA 3N6XA 2XCIA 4QTUB 1PZNA 1HEUA 1EJ6A 3WJ7A 3WFIA 4QEDA 4LQ4A 1DKLA 3H0KA 2VUHB 3C1UA 1SKYE 1FTQA 2REOA 2V58A 3BDIA 3FWYA 1UBJS 1TOAA 3L9WA 4BQOA 4WOKA 4B6OA 1Z4IA 4GOJA 2DETA 2HMUA 4OBEA 5LOVB 1MA3A 1Z07A 1KK0A 4YJHA 5ENDA 1ZSVA 5FUWA 4RJTA 4MVWA 5ENVA 3O7MA 1KTVA 1VCMA 2CVOA 1PNTA 1G55A 2C4TA 2GYWA 2PA3A 4J0JA 3NGXA 1U9IC 1OWNA 1W36C 2DRIA 1JVBA 1RSZA 4HGQA 4YMUA 1K7SN 3HB9A 3E8SA 2V8OA 1EWYA 1SHUX 3F5QA 1KI1A 1P45A 2YXDA 2QTVA 2BVNA 3LP8A 3P19A 1VL6A 4HGRA 5E0KB 3FIJA 1PDVA 4JI1B 2VDWA 1QZZA 1XZDA 4Q9HA 1XAJA 2I7CA 2VNAA 2CHVA 5I7RA 2R87A 3T3EA 2ZRAA 4HB3A 2I4TA 1WNTA 4UFOA 1I4EB 2Z3VA 3GRCA 4N65A 4NARA 3AEQB 4B6EA 1DHTA 3W7BA 4JVNA 5F51A 4AZWA 2PRZA 2FSGA 4CV0A 2QM0A 3A2NA 3HFJA 3HI6A 2ISSD 4XIJA 3MJFA 1Z63A 2CYAA 1IN5A 1D3AA 1JHUA 1ETUA 1Q5PA 2GTHA 2RH8A 4NECA 3A4YA 4OJMX 1F6DA 4PCLA 4R2XA 3SYTA 5IJ0B 3W5UA 4MDEA 3DBOB 4MW1A 2RK4A 2WA1A 4AY3A 1TMYA 2OV4A 2FSUA 4XZ3A 1USGA 3AV3A 3TCXB 3N2LA 2HDWA 4F97A 2HAEA 3VV3A 5ER9A 3W2IA 4PC2A 1D2CA 3ETCA 1USVA 1U3GA 4RENA 1NBAA 5HMLA 4LX0A 3ES9A 3VO9A 3AR7A 5SZIA 2ZB7A 3M6AA 3OFSA 1FNMA 2JIMA 5FBQB 2DZDA 4HCJA 3TSWA 3V4VB 3DAFA 3FCXA 1Z62A 1PVDA 5KYGA 3N70A 1XQYA 2HQSA 2V74B 5AOBA 1CY8A 2QGNA 3E22A 3EXEB 3CZMA 3DAPA 3GI1A 1OFGA 2P30A 2LWIA 4B09A 1BEZA 3UHPA 3E9CA 2UXCB 4PWZA 1N0IA 4GKAA 1MRSA 4TUYA 3KFVA 4IDOA 2IV7A 1UJ5A 1A9QA 5A3VA 2O8FB 3EGDB 3QE0A 1A7JA 4LHWA 2FF7A 3F67A 4OHKA 3TDKA 4PC6A 5DN9A 1IAQA 4MS1B 5LOVF 3H2YA 3D6TB 2VI5A 3A3PA 1ATZA 2P7HA 2OBBA 3PYMA 3VYRB 1OV6A 3AUXA 5TY0A 3EAFA 5JJ5A 4IDFA 5CM8B 3PICA 5ALVA 5SYMA 4BWGA 1L4GA 2AUTA 2GZHA 3WKEA 4KGXA 2VAVA 5SZJA 4J16C 5AK5A 1G6Q1 2UVPA 2J31A 2J48A 2WJYA 2YVKA 4D44A 3VJRA 2FUCA 4GUAA 2RHRA 2ZRCA 1ODTC 1LS6A 1K4YA 4J9VA 4DMKA 4Y0VA 1BSVA 3O4HA 4KO8A 1B6GA 4X3PA 3LDUA 3Q1LA 1QU2A 3ET4A 4R8KA 4U6NA 5KINB 5BYJA 3G0CA 2PU7A 2QZ4A 3NOOA 3K2IA 4HHEA 5K8VA 4TKUB 4G36A 1YDMA 2C4UA 3P2OA 4REQA 3S99A 1X1QA 4M9QA 2KLHA 3OOWA 4IHJB 2IYRA 2WUVA 3N7AA 1QM5A 4KQWA 2GT1A 4AKEA 2OHIA 2L18A 5LLDA 2VF8A 4QGBA 5IDVA 4D74A 3FYUA 5HDQA 3LT5A 5AI4A 2B7BA 1NC1A 3GNTA 5ARDA 5HFAA 5ALRA 3LXRA 4ER7A 5LMZA 1D5WA 3BD6A 4WZBE 1UKBA 1U9ZA 4A73A 4AKTA 4M9XA 4X9XA 2OO7A 2BKVA 3WBJA 5C3MA 3LPDA 1WVGA 4EECA 2MSKA 3INNA 3FTNA 1XZAA 1Q0RA 3SHFA 3GLQA 2GCOA 1BDBA 3VSCA 1R0CA 1CZNA 1EEXB 2R1UA 1QOZA 3DP7A 5DOVA 1OA0A 3BWEA 4US2R 3NT4A 1NNI1 1HZZC 2YFHA 3AXSA 4GX2A 3AI1A 4XYEA 2O2YA 4JBXA 5JQGF 3EPLA 2JFVA 5ESDA 4KUHA 5DHRA 2O0KA 4QQRA 4KXYA 4Q4JA 1GDDA 2O7SA 5J40A 1NZJA 3R6GA 4U7HA 5JRDS 2QS9A 3JSAA 3L6EA 3VZRA 3O4IA 3GWZA 1WXQA 1SPXA 2I6GA 4OEHA 5CVVA 4O4HB 4ALIA 1G8MA 1G4UR 4KQJA 4DDVA 4EJ2A 4K5QA 3NAQA 3G23A 4DMMA 3B3FA 3FLEA 2PGDA 3GIDA 1Y5MA 1O57A 1THMA 3IAXA 2A5FA 4MI9A 4GPZA 3NVKI 4MGKR 4LJ9A 5IZCA 4HDKB 3ITKA 3PQ7A 4IKOA 2OD2A 3EGDA 1SURA 3HU3A 3L93A 2C9YA 3LQYA 4TRMA 3EVDA 3ZHXA 4AJKA 5DI3A 5SICE 4HEHA 2NGRA 4IM7A 4Q01A 3STUA 4LDRA 4H6XA 3F6SA 4WXHA 5I3CA 4D8YA 3DO5A 2BAGA 4J0DA 1U31A 1K5DA 1TM5E 1U8AA 2VJCA 3H2HA 3KJXA 4GP6A 5TJ9A 4ZZ3A 3I37X 3FMGA 5JMWA 2R85A 4WVLA 2W6NA 4CQMD 2HPVA 3I34X 2PMFA 3WIUA 1SUCA 3A04A 1DFIA 3DMTA 1BMFA 4BO1A 3BWMA 1EH5A 4C05A 1V96A 2WT4A 4E31A 3JQ7B 3F3KA 2CXSA 2PH7A 1E64A 2XH8A 1Y3BE 5KC9A 3UC9A 5AJUA 1MJHA 3EZ7A 2PKYX 1KE2A 1KPIA 4L3OA 1OFIA 1U0JA 2CMGA 3PUWA 1P2FA 4TGLA 4AJOA 5ITZB 2DLCX 4EG8A 1EXMA 1ZJJA 2G08A 2RI1A 3AM5A 4J0CA 4R6WA 4AN0A 4LV6A 2X1LA 3B20A 3C3YA 3MRTA 2PJUA 1S8NA 4JZYA 1SHJA 3LT1A 3SC2B 1RLJA 1BKYA 2RGCA 4J2TA 3EGWA 4KXWA 3T9DA 4ZGGA 3Q0TA 4YLEA 5COQA 3GZ4A 1KDTA 2BJWA 4ZHQA 5JJLA 4OGWA 1BJTA 1NM5A 5LVAA 2QOEA 3DKPA 1IB0A 1FSSA 3RIYA 1ZGZA 4O4HF 1PD1A 2GTPA 2BFAA 3ACDA 3TTYA 1J21A 2FEOA 4H7DA 4N6GA 5B58T 3ZXIA 7MHTA 4L1KA 5CJ2A 3O95A 1Y7LA 3BJRA 3WLPA 2IV3A 1UOPA 2D5BA 3L8CA 1N0UA 2HPAA 1AUOA 4WKNA 1BW9A 2UXDB 1ZGAA 2I55A 1ECLA 1YZLA 4G2NA 3TPFA 3ZZMA 1G42A 2RGWA 1OKKA 2QUZA 5KCMA 1JR6A 2IYTA 2ZREA 3IR5A 4P8RA 3I0MA 3UTDA 4MR8B 3WL7A 2ZAOA 4CMGA 1YCGA 4OAOA 2K7FA 1KH1A 1ECPA 4DV3B 2F9LA 5HM8A 3CT4A 4TLEA 4FMDF 3I2IA 3PUJA 3QYFA 1RD4A 3FHTA 3OHSX 2B2CA 2VEOA 1MD9A 1VGVA 1L3CA 4FYPA 5I9BA 3FE2A 2J0UB 3MCWA 5DXJA 2VDRB 1YRHA 5EC8A 5JAIA 4F7DA 4K88A 2A9JA 4G09A 2PJRA 1EBBA 2R4UA 4S1WA 4WZAE 3NUGA 4WLNA 5ALYA 1RAEA 3A4VA 3LNCA 1GTG1 3VQTA 4EYQA 3W2HA 2IUYA 4DVGA 5BT8A 5GADl 1M2WA 2OCGA 2R7NA 4FXPA 4BJ1A 1RABA 4KXVA 4EG5A 2JCBA 4IFBA 4R0VA 3RIGA 1TLLA 1EDZA 4D57A 5BV1A 1HE3A 4BP9A 1JWAB 3PFBA 4CI9A 4WINA 3KXPA 3UFXB 5ICMA 5INTA 3H5WA 3ETGA 3LCCA 1WABA 2C5FA 1SUBA 2XDWA 1I13A 2AVDA 1A3CA 3TLCA 3ZLTA 4ZEXA 5JH7A 4MVJH 5FUQA 2ILVA 2ZTUA 3BJIC 3C3AA 1UUFA 4GXRA 3I4LA 1LJ8A 1PI3A 2JFXA 3K20A 1OFHA 1ZH8A 4DGSA 4JVOA 2BSQA 1KPHA 3P52A 4L5AA 2QRZA 4DIDA 1G5PA 1VYVA 2Y27A 3VMMA 4YJFB 2A3RA 2ERCA 2KW5A 3O93A 3CKMA 3SSOA 1W4LA 3U1VA 5EXDA 3MPUA 3QXXA 3I6IA 4OUKX 5CVCA 1Q11A 3U4QB 2A9RA 1FCJA 1CUBA 1DDOA 5LNK1 1XKXA 1E60A 5LQMA 2FSHA 1PR3A 1DG1G 1LTHR 1SQ0A 5LKAA 1P6QA 1NURA 4FQ7A 4RA6B 2WYVA 4K2HA 3UWMA 5EUQB 4U7WA 4HJRA 4ETNA 4EVQA 2HTFA 8GPBA 1A9SA 2PGXA 2O0JA 1NVFA 2V9CA 5C18A 4MWEA 5CA1B 3PP8A 1W0JA 1E4EB 2VZLA 2VJNA 4LSGA 2BEKA 3Q5DA 2UUPA 1XHFA 4ID3A 4CGZA 1XPOA 5M7EA 2B92A 2YIDA 1P7VA 3QGMA 1Y33E 2G9NA 4BNJA 2IUSA 4CT0A 1I3NA 1XZNA 4JLOA 4O63O 2W8BA 3R7WB 5L51A 1HR0B 2E5LB 4B7UA 4EW1A 2X0RA 1UZNA 1XJWA 1E3EA 2DWUA 4MUIA 4WX2B 4DRXA 2RH5A 2HEIA 3RYCA 1RXVA 4HAUA 1PEAA 1AUXA 2ONJA 3FPAA 4IH9A 3L77A 4M8KA 4YGXB 4BKRA 1HTWA 3ROPA 3BRWA 5B1HA 1Y7PA 2IU6A 3F3SA 2ZCJA 1KSJA 2O3RA 2G04A 3NDJA 4ZOBA 2GVDC 5KQMA 4J0KA 4Y9RA 1MTOA 4URYR 3BHIA 2PSDA 2VCEA 2VNIA 5ED0A 1HMPA 2VP0A 1YR9A 3OP1A 4Z7JA 4FW8A 4IWYA 3W2GA 1QQBA 2DWPA 3P5SA 1FU4A 3UN1A 4F71A 2XCOA 1OAOC 1P8AA 3MB5A 4FBGA 3RTDA 1NYRA 3WWEA 1V0JA 4XIIA 1YS4A 4WBSA 1EZ1A 1EJ2A 2RKWA 1I5OA 1BMTA 4ISBA 4NFSA 4MOWA 4RF2A 1WEHA 1RYNA 1Z2PX 1BFUA 2A5JA 2A6PA 4HWSA 4OI0A 3G9TA 2V7QD 3RVDA 3JYQA 3IP5A 4JB8A 5D6OA 4PYLA 3C5HA 4V0KA 1DBWA 2D7CA 3F7TA 4I9GA 2FZGA 2FFHA 2QNRA 5DTJA 4KWCA 1RTKA 3QYJA 3J7AC 4IKPA 3V4PB 2BFDA 4YYEA 4DV2B 3ZWWA 1N7IA 2N47A 3MGBA 1DMSA 1GNQA 3BWXA 3RH0A 3UWKA 5LU8A 4BNNA 4D6XA 4YONB 4N0MA 1OBHA 1T43A 2VATA 2HGSA 3E1KA 3OUZA 4TMYA 3UHJA 3BSYA 2FCAA 1UMKA 4B2LA 1ZUIA 2BFOA 4MV7A 2YIJA 4C1BA 1SXPA 2GSWA 1GM5A 3PXAA 1DLJA 4DLSA 2PL1A 1T2EA 2PQ2A 1DRKA 4QDUA 1NE7A 4FFRA 3KTFA 5J9FA 1TMOA 2F9FA 1LJUA 1M2KA 1D09A 4DJTA 1TMKA 3JVIA 3QVWA 3EQ7A 3D4PA 3E9DA 1W85A 3A1NA 4XCQA 5FR2A 3S55A 5FUVA 1Z6AA 2HDHA 4CCYA 1QK5A 4FDMA 3VDXA 2FOIA 4LRSB 1TECE 3QXSA 2B5VA 1KO4A 2W2KA 1KMHB 2P9QA 5SYAA 3SZGA 2BH2A 2NU7A 4RPJA 1UPCA 4JUAA 2BEJA 3DLPX 4L76A 2QTTA 3SF0A 1W4CA 1NXVA 1II8B 3WIEA 4LGMA 5TQVA 3N2GB 1GWNA 1PNOA 1WZNA 2JGRA 4G41A 2ZSAA 4M1QA 5JEEA 2XCSB 1ZK3A 1JAHA 1HI9A 2I4NA 2I80A 2VJOA 1KAHA 2YFQA 4LC0A 1EWVA 4DLNA 3COVA 1DZIA 2XY4A 2I71A 3JALA 4DR2B 4M46A 3F96A 1FU8A 1E2GA 1G2PA 4QYMA 1E59A 3S2GA 1K63A 1WXXA 4P22A 5FFNA 1QYWA 3E84A 4YCJA 2HRCA 3SQNA 5FTKA 4LJSA 4K9NA 1NX6A 4G1BA 2EEZA 2IU3A 3B36A 1A7UA 3KG2A 2WHXA 4P98A 1Q7CA 2V97A 4TLLB 1SXQA 3B52X 3HR8A 4FCWA 3A11A 1FTGA 3G8CA 1EU1A 5BYBA 3TEJA 3EUFA 3HCFA 4M0PA 1E2QA 3UOAB 3PRYA 3EJ6A 4XARA 3FTCA 4C43A 3ANLA 4GI3A 1P77A 1P5JA 1Z34A 4WLVA 3IT3A 4H15A 2PH1A 4C4TA 3PDCA 4ALJA 1JR3D 1DTSA 2O1WA 4NSNA 1XYGA 2AR0A 1U0TA 4G1MB 4UBKA 3RS4A 3B9RA 4EHJA 5B3LA 1OLSA 2FJPA 2Q5CA 3B9BA 3PZRA 2D1YA 1R6UA 2XAUA 2GCEA 3TLGA 2I3ZA 3EN0A 2MINB 2CDNA 3D59A 3EB9A 1IULA 1KFBB 4K1XA 5THKA 2NQ8A 1UC4B 4ZYVA 5JTTA 2VXOA 1HL7A 1ECFA 3DZJA 1G4HA 2B83A 2Z1DA 4YBZA 5JSUA 4FFDA 4MV8A 3NZEA 3PL5A 1Y1TA 5ANRB 5AW1A 5BW4A 1Q1AA 2WLSA 1UMBA 2BE9A 3J81k 1L5GB 4BLQA 1TNDA 2ZRMA 2FSVA 4F85A 2WNSA 3LU1A 2QM8A 1JDZA 1JFLA 2EJTA 4J16A 4O0LA 3UBMA 2FAXA 1V11A 4DIOA 1RQ7A 3CW9A 3HMQA 5F52A 5IH3A 4I6GA 3ESAA 5ALPA 3L4JA 1G8FA 4G0MA 1LI5A 2FJ0A 1IDN1 2IHUA 4QBKA 1EK2A 3JRXA 4MULA 1C3EA 5ESRA 3ZNOA 3AG6A 3AB8A 2J0EA 5B3JA 3WGJA 1I9GA 3IMEA 1LA2A 2X7JA 3LOPA 4BNXA 3Q2OA 4OLHA 1ODFA 3R41A 4RK1A 1YZQA 2AOWA 2CLIB 1XO1A 3AFNA 4CKEA 1HXHA 3WSWA 3H6HA 4M9ZA 1WVMA 3LGSA 3GBSA 3HYTA 3QVMA 1Q83A 4I6JA 3G2JA 2ATXA 4QUHA 3G2OA 2Y93A 3BA6A 2O9JA 2XOXA 3HUTA 2YJTD 3IIJA 3SSAA 2VYVD 3UMYA 2C2GA 4R1NA 3VOBA 5DWDA 1M1YB 1W0CA 2ZI5A 2O6HA 3GHYA 1JIVA 3TFOA 2QD1A 3HR7A 2D59A 3SHOA 2Z1MA 3I53A 5CVTA 1D1QA 4H7HA 1USWA 3W9BA 4CDMA 4QLAA 2XBUA 2XLCA 4N3AA 1G59A 1T4BA 4URFA 1MOQA 4JB0A 4C3VA 5G0VA 4FDLA 1X80A 2K7ZA 4MEJA 2I6FA 3UOWA 4BWYA 4JYBA 1TO1E 5CRIA 2B4QA 3CEAA 3H9QA 3IJ5A 1OXXK 3PFCA 3M1IA 4C3ZA 4RKFA 1PJQA 4MR7A 1JPJA 3TSAA 3A2MA 3DTYA 4BTLA 7ADHA 3GLFB 2ZIUB 3X2SA 2X2PA 3FBGA 1L6RA 2P5YA 1E4OA 1GZ7A 2QTCA 4YQYA 2FE4A 3GHHA 5D1NA 4QJ5A 1GUYA 4FOPA 3BQ9A 5C5DA 3U4IA 2WVGA 4FOOA 2DKOA 3UXEA 5A1TA 4Z5XA 5EE1A 3E6AA 4UU8A 4DBLE 3U7GA 3ZDQA 1GR0A 1R50A 2DTXA 3D54D 4HWRA 4Y67A 3EEOA 4UEKA 3F8SA 2JCXA 1NA5A 3NI2A 2IYOA 1VPDA 5JFGA 4OJYA 1TC2A 4KTTE 4ZCPA 3K0FA 5CK4A 1KOFA 4RF4A 3CLUD 3JQCA 2PUEA 3G2QA 1BD3A 2Q9BA 1XDBA 2P8SA 5E7IA 2HCBA 1JVSA 2NU6A 1L3BA 3BXEA 4KAFA 2CHGA 2E6KA 4KQKA 2QD3A 3U4GA 5J4YA 3MTJA 5E6SB 1JIQA 3SKXA 2FZCA 3QF7A 1Y4ZA 4U9UA 5KEIA 1R3UA 2VF4X 3KM0A 4CKBB 1E6EA 5HA5A 5IAKA 5IT9A 1U8EA 1YE8A 4EL5A 1QHHA 4DPLA 2BE7A 3SHWA 4YQZA 3BFPA 3LCRA 3SXPA 2QJRA 2JBWA 2XUAA 2Q2NA 2R6JA 3T34A 5BN1A 5KSZA 3KKOA 1A9TA 5CDFA 1IXKA 4Z3DA 3T5MA 5IUNC 4MYCA 4OYRA 4CKEB 5BVHB 1X77A 2PO5A 2D8MA 2OHFA 4K87A 4BN5A 4RKRA 4AJLA 1E9EA 1JZTA 4IQGA 3KOOA 4ZC8A 4HB4A 5F1KA 5JYCA 3V3TA 5BR8B 2FMHA 3HFSA 1FYFA 3JD1A 4FMPA 3CVXA 4QFCA 1E2EA 4H1VA 1IPEA 2HADA 1Q1ZA 2RAFA 2C1EA 1WSAA 3ZUGA 3OWXA 2XRYA 3OX2A 1D2NA 3LY8A 5JY6A 1P9RA 2FEWB 1TZMA 3JWEA 3K9CA 1N2CB 3D6MA 3MJDA 4FGWA 4J76A 2YY5A 4G24A 5F1YA 3FLMA 5IW8A 3U3JA 3VAYA 4CFZA 2RGEA 5AESA 1S4QA 1OHHA 4JJ7A 2CT8A 1Y9AA 3CRQA 4XYBA 1ZJYA 3W5JA 2WC1A 3U49A 2ISQA 2AR9A 1X80B 1KS9A 1JJ7A 1E98A 1BO6A 2Z9CA 4MKGA 2QTBA 4HQRA 4Z86A 4EJFA 4Z0PA 1NW7A 3JWHA 1A0OA 1TFRA 4X8MA 1QBKC 3DEAA 2XZOA 2EQAA 2C57A 2E21A 3MD9A 4Y2RA 2IT1A 3LYUA 2OCYC 4Q4AA 1HT2E 3SGLA 2XGGA 5GV7A 3TBFA 3K8YA 1APBA 2FEMA 2PS1A 4BZXA 4C6TB 4UPDA 3D1VA 3C97A 3ZHCA 4F2PA 4UQLA 4N0PA 1W2WB 3U1TA 3WWPA 1GY8A 2RARA 4F9GA 3GLIB 2W2NA 2WF5A 2I8CA 4IIEA 4R69A 2BDUA 4RFLA 5HHTA 3HE3A 1AJEA 3K6KA 2A5GA 3N0RA 4TXLA 3K7EA 1E5XA 1DADA 2DPYA 2GILA 3SZRA 1E0JA 2F64A 3BZWA 1OROA 3GR6A 4MUGA 2P0AA 4TSKA 3OIYA 3NYIA 5A4FS 5KYXA 2GPBA 4LZNA 1DCFA 1AN9A 1ES9A 1NYQA 4GMGA 2ZB4A 5EJ2A 1SM4A 4FI3F 4C0KA 5ITSA 1RCTE 2CHEA 1EXWA 1MV8A 4IG9A 4CDNA 5GONB 5KTMA 1GAJA 1YUMA 2R2GA 3HEMA 2WE8A 3ZGZA 1SVUA 2JAQA 2ZG6A 3E2PA 3ZWOA 1FP6A 5FPTA 3U61B 3QUCA 1FNBA 1QDEA 3I42A 4UM5A 3NTLA 1DCKA 2PYIA 4JUDX 3O8CA 1EGVB 4RVSA 1VCNA 2PIDA 1XQXA 4EHKA 4ZMBA 3GFPA 1SD1A 4YAEA 5CT5A 3S7ZA 3B48A 2C4HA 4MA0A 4F92B 3LHKA 4JBGA 5KDDA 4Y2QA 4LCBA 1SHLA 3O0TA 4OMDA 5JJKA 3DBIA 1TRHA 1BHJA 2QZJA 3O8QA 1I80A 3V8RA 3N0TA 1FVOA 5IFKA 1X7WB 2CUTA 2QTLA 3L0CA 4IUDS 4N18A 4EG7A 1YB5A 2NLOA 3AHDA 4Y6OA 4EVRA 4KJZA 1XJ5A 4BGDA 1BXRB 5LCXA 1U8UA 1EMDA 1E2HA 2W83A 2I2DA 4KKVA 4Z53A 4X7BA 1ONNA 2BISA 3RF7A 4D56A 3PGXA 4JMLA 5FUMA 1AY0A 2HJHA 1E9CA 2J6BA 1Y6GA 3A1CA 2UYYA 3OZXA 4JT8A 3ZU5A 4YV7A 2GDZA 2ONKA 2QMHA 2GD6A 1PJCA 1YHZA 1GEEA 4MPRA 3SYNA 5DB4A 4QXMA 4ZK6A 3SX2A 4M2LA 1K8QA 2QLLA 1OZ0A 4GGOA 3ZW9A 3R0VA 5C52B 2VUSA 3ANYB 3OLYA 1WPRA 2WP0A 1FVXA 3RJZA 3IXLA 5P21A 2WTNA 1Q0TA 1C41A 4RPKA 3F6RA 3AEXA 2SCUA 3KEQA 1VBFA 2F55A 4QNRA 4IF4A 1TK3A 6NULA 1W96A 3F4BA 2H4FA 3PQ6A 3P7MA 1QZXA 3QENA 3NIFB 5L4NA 4Q66C 1ZCJA 1E9FA 1JA1A 1JR2A 1YI1A 1QHSA 2QKYA 3G5MA 4M22A 4ZVTA 4K46A 1OBVA 3Q7TA 3CF4A 2IU4A 1P0MA 5AKEA 4Q1EA 5AUOB 3QJGA 4J7CA 4EZEA 2BFCB 3HPRA 5T67A 1MVLA 3K5HA 1NM5C 2E4AA 2OLEA 4XM2A 1Z0FA 4A6DA 2CMKA 1RXWA 2SKCA 5FPSA 4Q5IA 4OUDB 1ZO8A 1QK4A 2PNFA 3FAZA 5MHTA 1LF0A 5BW5A 3TUZC 2YUTA 3L02A 1KRXA 5KX5B 3TRKA 4KACA 1G19A 1XSEA 4EKNB 4EY7A 1MAVA 1UEXC 1WZUA 2O2CA 1ESCA 1PJTA 1SB9A 1X2EA 2X0KA 3DL0A 3DKKA 2B30A 3KQVA 3LY7A 4RZIA 4YB8A 2ZUEA 4MYHA 4IHQA 3IULA 1OZAA 3NRCA 3HV2A 4II3A 5CLFA 2YYSA 1GRVA 3DMPA 1J6UA 1X3LA 3QHPA 4Y0AA 4I55F 1A76A 4Y9DA 4BTEA 3JQDA 3S44A 1KO7A 3DE5X 4U6QA 3V9PA 1DC3A 3FETA 4OLAA 3VC2A 3KTAB 1OB5A 3PUVA 1U4NA 4URXR 4YJ3B 3KAJA 4LTMA 4C5BA 1NKVA 2PSEA 4TV9B 3IEIA 2X8JA 2ECPA 3HCBA 4TM7A 5K8TA 2HF8A 3ZWNA 3HB7A 2RGYA 4ZQEA 1EVZA 1KO5A 3HL0A 4XGQA 3R40A 1U5BB 1VIDA 2Z04A 5TT0A 4CTOA 5DTRA 3X1JA 1NDUA 4RK4A 3DGEC 4B46A 3KZOA 5BQ3A 2AZDA 4IFTA 2PZLA 1GDHA 2Q5JA 3GCXA 3TW0A 4EO7A 4QGHA 5H3HA 2HT1A 4JEHA 1F1BA 3G1WA 2P9JA 4PN7A 2WD9A 3V80A 5IEBA 1R5NA 4Q7MB 4LJLA 1CRPA 1Y6ZA 3U3RA 1IHDA 3OAAA 4BMDA 3HDTA 4IH4A 1K6JA 2JLAA 3EFOB 4IILA 5TNXA 1UBNA 1MB2A 3P94A 3D6JA 1PJSA 3G5AA 1NVDA 1RACA 3LFTA 1RTTA 3PNPA 3BL6A 3GMTA 4BDSA 3T7SA 2ZYUX 4C22A 1P4HA 5MN6A 2ST1A 1IPFA 5CX1B 5KVQA 2WIDA 5CCDA 5LUBA 3ZZ1A 3HI4A 1F2DA 3DR5A 5K6AA 2EQBA 5JNWA 5ARCA 1G6OA 1P5ZB 3G88A 4XB6B 5DP1A 1CRZA 1MMFB 3QU4A 3W34A 1L7PA 2NU8B 3ZZNA 3O21A 1GADO 3FPBA 3DZKA 4TLAA 1IONA 2JAXA 4LGVA 3S7TA 4LY6A 1XBTA 5FYDA 3P9YA 2FP3A 1ODJA 1UWVA 2VDVE 3AERA 3B6ZA 1ULSA 3M2TA 1MP0A 1JKIA 4OHZA 3ANMA 3IKLA 3RVNA 5K0GA 2R47A 3TGPA 4MX8A 4FYWA 2YWHA 4MRAA 1NRWA 1RT9A 5EWJB 2IU0A 2AA3A 2P9TA 3RB8A 2RBEA 3AFMA 3EZYA 3LRTA 2FPXA 3O9ZA 1T6NA 4HBGA 1AXGA 3SHTA 4B3SB 1HK7A 4PU0A 2OG1A 2C20A 4WESA 4KB5A 4QOHA 3ILSA 2ZI6A 3UNXA 2NWQA 3C87A 2AQKA 5EOVA 1L5QA 3EPRA 2NUAA 2HU8A 5CR9A 1S96A 3BDAA 3MLAA 2WM3A 4I50B 4MVJG 4ZCLA 4IOMA 4U3JB 4R98A 5DWQA 2FUG1 1BWPA 3DT6A 2ZJ2A 2AMVA 5IVDA 4PNHA 4C2UA 1B0PA 2AWNA 1Z0KA 5I5GA 5M3BA 3RLFA 1U0BB 3OQPA 5CLQA 3H1AA 4IXMA 1VI6A 2ZEJA 1NOKA 2I66A 3E3NA 3FNIA 3PPXA 2WY2D 5K3FB 3R76A 2P2CA 1NWCA 3OCJA 4HZUB 4HH3C 4DSAA 4YRNA 4KJXA 3HB1A 2X41A 5IWCA 3AHHA 4RIFA 3RADC 3VC3A 2C5LA 3IBSA 3KHTA 2OSVA 3EISA 5K2MA 3UZUA 2GN6A 3NH6A 1M74A 3NALA 4IV0A 3VYSB 4E2FA 5B64A 5IF3A 4BOYA 4DJ5X 4MW0A 1N6OA 1FK8A 3ESBA 4X92A 1PT5A 3BIWA 1D2HA 4RL4A 4LHSA 5GP1A 2GYYA 1U7PA 4ZTBA 3LCUA 4XWTA 5EHIA 3BGVA 3G0OA 4WK6A 5DX0A 3MRSA 2PX4A 1E9SA 4HNAA 4LISA 3UPDA 4PG5A 5AVVA 1K8YB 2ZU0C 4W9RA 3JWGA 5I7HA 3B1FA 4EMBA 1DRWA 1KFJB 2MHCA 2PNJA 5BWCA 2JPDA 3ZVNA 1Q21A 4KN9S 3EFEA 2OHJA 2PYDA 2BDEA 1RP7A 4YALA 3K9LA 5C8YB 5HF5A 5EFZA 5DNYB 2Y1FA 4MB2A 1YRQA 3ULKA 2QGFA 3QPUA 4FINA 1RI1A 4QECA 3L84A 1SC3A 5J2TF 4DLZA 3GA7A 3KOMA 4OM7A 3QF4A 4XTRA 5FCDA 2VO1A 3AESB 3O8NA 1HSOA 4JKYA 1PJRA 4Z9FA 5JI2E 1C2YA 4MRRA 4PXAA 2EGGA 2NU8A 4EG4A 2CZGA 3TTUA 2RGRA 3AIMA 1S8FA 3KQSA 2GBGA 3WYDA 3X1YA 5JI3E 3C15C 1EWRA 4M1WA 2GDJA 3WK5A 4KXUA 4MITA 4PXSA 3EIUA 3NMUF 5L53A 1W6RA 1G8GA 2CNWA 1P73A 2QW1A 1HGXA 5TSDA 3GVCA 3M81A 3QKSB 4XUDA 5I7AA 1U04A 3BHMA 3CNEA 4FEAA 4D2IA 2CXTA 3SQDA 4LYHA 2VJMB 3HLTA 4RETA 1R4ZA 1JQEA 2W48A 1ZLXA 4FMCF 1A4UA 3QFRA 1PFGA 4KUEA 3GH3A 3KXIA 4S35A 3R7FA 4EGCB 1V43A 2EGUA 1A04A 1P75A 1TCAA 1SQ6A 1XVIA 4OSPA 4BNWA 1Z8HA 2RG1A 4GD3Q 4CQMA 4EQ6A 4JBHA 2GEDA 3ZGNA 1DJLA 2P91A 1X13A 3GDFA 3L6OO 3KPVA 1ZUHA 3M82A 3OJ0A 1TIPA 4JGIA 1TK9A 1UT5A 3CX7A 4WSOA 3B7WA 4FHZA 5D3MB 3GT4A 2JEOA 3P4XA 1XALA 4J0GA 4B6RA 4QM6A 1J7KA 1E77A 3Q87B 4KR9A 4HGNA 3SX0A 1NXXA 3FUTA 1OYWA 5CFZA 4L0CA 3VO2A 1EDDA 3LZ6A 4R8VA 2IKQA 2DP4E 4HLCA 4Q19A 2PLAA 4EDHA 2AZMA 1TKRA 3KAQA 3LCMA 1WB4A 2DVMA 2PANA 3ICPA 3OTOB 3I6YA 1ESDA 2BUAA 2DLNA 3OEWA 3HMKA 4J1NA 2QTMA 2QX6A 1UBRS 3KB8A 4EKYA 2Y0BA 5ITVA 1B26A 1KEVA 2I67A 5BP7A 3ANTA 4RPGA 2B3DA 2B2NA 3H1EA 1OAKA 1JMKC 3B6IA 4RD0A 1EFRA 4G0QA 1M8PA 2Y3IA 3T35A 2Q4EA 3AEZA 2DFTA 5ECYA 2NO1A 5T4FA 3TIVA 4BO6A 2QBYB 3I62A 3DQZA 5ITWA 3JATB 4HYQA 1GXSB 2WU1A 4WI1A 1PJ3A 1SCJA 3N8IA 4KCGA 2A35A 1Y8RA 3B6EA 3LOUA 3PHCA 4IOKA 4UU1A 3L6DA 2N0SA 4UFNA 5HZGA 1F2TB 3DZGA 1N0VC 1D03A 1VPTA 4FUQA 4MVCA 3LX6A 5C0OE 1U3VA 1IJBA 1NSTA 2AOTB 1DC6A 1RZUA 5HTKA 4WBXC 1E1CA 5JMPA 1E1DA 3K9QO 3H17A 2YZMA 3FCUB 4QDKA 4OXRA 3RU9A 3SE0A 2JKZA 1JDBC 3CTPA 4MV4A 2IUUA 2D2XA 3TL2A 3I73A 1K6EA 3WIVA 5JIBA 3A1WA 1PFQA 4NE7A 5EEGA 1B4DA 5AJTA 1W93A 2X77A 4YRSA 3CM0A 3C3MA 1V8FA 3OCUA 3OPXA 9ATCA 5GIPE 2YWJA 1I3MA 3I6ZA 4PPGA 4UC0A 3IT1A 3ZNQA 4BU0A 3OE1A 2HREA 5FBVB 1MB9A 1Z36A 1KJ9A 4HKTA 4FWTA 2PMKA 1REQB 5U4XA 5G53C 4KP7A 2JFOA 3ISVA 2IVZA 2AOXA 1H23A 3C8ZA 1CLEA 1Z3IX 2WUWE 3DAOA 3Q40A 4RIIA 5COAA 4ESOA 1OY1A 3IB6A 2IWHA 1JKFA 3KJZA 3FOWA 1TIBA 4OL9A 2HI0A 1TPZA 1HETA 3M4NA 2Y05A 5E4YA 3Q10A 3E15A 2I2XB 1VHDA 2LVBA 3R3SA 1CJMA 1VZ2A 5EXPA 2QRMA 4XVQA 3VGJA 1YQEA 4A2CA 1FYXA 1THZA 1EA7A 3AOGA 2QDXA 3OJXA 4GS5A 4QXAA 5JEDA 1JDUA 1X7YA 2F90A 2ZBEA 3PDJA 3TSYA 1O6ZA 4UVEA 3V4SA 1J24A 1LV7A 2Y2VA 1LFDB 4ZOAA 2FB9A 1SA0A 2EKPA 2HK7A 1YVDA 4WY8A 1MOSA 4DUGA 1W5EA 2WT9A 1PJ4A 4OU4A 4GWGA 1BCSB 3V4ZA 1PCXA 4J2HA 3EHEA 2AFHA 4I55B 4INZA 1L7DA 1O96B 5KPJA 4G5HA 2GEVA 3HK2A 1TQ4A 1SULA 5FH9A 4RHTA 1R8YA 2OCKA 1ECGA 4HOYA 2ERYA 3JQAA 2DWQA 4ZYUA 1WUHS 5DWVA 1V1RB 2B8EA 3BB1A 3ET5A 3ILYA 4HQ6A 1MEEA 4OB8A 4PQFA 2FETA 4BVKA 2J9ZB 1V2GA 2WI8A 3DAYA 4DCVA 2ZE6A 3W90A 1HE1C 2PWZA 2XW6A 5TMEA 3CCCA 4CQLA 3R9XA 4L7QA 2IW1A 3EEQA 1T2DA 1JDVA 2PZKA 5AR1A 3AYZB 5LJIA 4D9KA 4QUEA 2QRLA 3LQFA 3HVRA 4OXXA 4TVBA 1SU4A 4G23A 4XFJA 1EGMB 4D96A 4JR0A 4KOEC 4L51A 3RK0A 3NYRA 4LCEA 1B23P 1E6UA 2O3QA 5K0FA 3WC4A 4PFQA 1OQAA 4JYCA 3R4VA 2KMLA 3IERA 3W5CA 3KZVA 2Z58A 1VLHA 5JJBA 4PLFA 1GQ2A 1JKJB 2JVKA 1LK5A 3HVIA 3M9WA 4KFTA 1WUTA 2GXUA 3KTDA 1EI9A 3W4IA 4UUOA 2H9AA 2NV2B 3C7KA 3M1AA 4ZJYA 1YU9A 3QBVA 4CV1A 4MP3A 1G3QA 1Q7GA 2Y77A 1V8ZA 4PLPA 5EAIA 4UUQA 1G1AA 5FI0B 1R0KA 4MUXA 3DC2A 3VXKA 4NENA 1FJHA 1RM3A 5JANA 3OF2A 5LN1A 2J4CA 3FCCA 4MW6A 1RHMA 1Y0BA 5MDHA 5KWSA 3JQ9A 4JUIA 4E22A 1VHJA 3KPWA 3RVPA 3CPJB 2IE0A 3E9MA 1CP2A 1J8YF 1JBQA 1HFKA 3D7RA 3I2YX 1U2GA 5LYJA 2ZRKA 2OWDA 1T1IA 1HYQA 721PA 1SY7A 3B6JA 5KVVA 5AK4A 4D4GA 1UPTA 5DO9A 3LM8A 4UCQA 4LBZA 1WOYA 1DEXA 3S1AA 1IN4A 1WY7A 1W9MA 2YS7A 3PHJA 5GOZA 4M0UA 3DLBA 4F3KA 1J5XA 5JLJA 2ZPTX 5BWOA 4P7BA 5KOJB 2GUGA 2QN2A 1UMBB 1YBMA 3ML1A 1NASA 4LSZA 2NW6A 1S0UA 4CIAA 4HDRA 3QFTA 4GF5A 2JAPA 3LUCA 4HZIA 3IXQA 2W71A 2FMXA 1SCIA 2ZT8A 4HQFA 2WWHA 1NN3A 3PV0A 5LMCA 4LFBB 2VPXA 2HF9A 1LV8A 5DGIA 1ETHA 5FBWB 2IDJA 2R97A 4REMA 3G9UA 4WN3A 5G1PA 3ON5A 1XNQB 3BBLA 2AFHE 2JGDA 4FMBB 2E3JA 3IAS1 4BNIA 2VDMB 1T9GR 3F3MA 1ONOA 2CK3A 4HN9A 3U9TA 2FW0A 4C3UA 1ZU5A 3BULA 3IBYA 4BRWA 3E3OA 2CLSA 4EJSC 3GP3A 3GFGA 2AMJA 3WHKA 3ZK9A 3DC7A 1R64A 2ID8A 1RP1A 1J49A 2DUMA 3IAM6 1F9AA 1DRUA 2FQQA 1VHLA 1VTKA 5HP4A 1WUYA 3C48A 1I7SB 2PMBA 3JVDA 3OPQA 4QEKA 3L7NA 1R0LA 3VTZA 1O6GA 1T0HB 4WXPA 4K0RA 1L4NA 2A33A 1I8TA 3MAGA 5IM4A 3WB0A 4ZT7A 1KYXA 3ASUA 3NCHA 4II7A 1Y8CA 4UDXX 1OE0A 4G8DA 3GMIA 2B78A 1OLSB 2JJ2A 4HRYA 2EERA 2HWWA 2NU9B 2AG5A 2FMFA 1O94C 2PBFA 1OI7A 3C2QA 3P9SA 5CVDA 3EZFA 1RMQA 2ID7A 2OYRA 1P9WA 3F46A 4L4YA 4IGAA 3KE9A 1LB1B 3QLVC 1ZOIA 3SSNA 1TUEA 3BGSA 5F5NA 4OO3A 5DTIA 5BRNA 1A2KC 2EW2A 2Y0PA 5KNCH 3PNKA 2H85A 2WM8A 3GQVA 3A58B 4XQGA 4Z9XA 1SR8A 3M70A 1PUJA 4NJEB 3AT1A 5AVTA 1VQ1A 4JITA 4JYMA 3TVDA 1M6EX 3OE5A 1EG2A 1JJVA 2FWIA 4UD6A 3C6YA 2ORWA 1UBKS 2OCDA 2ZETA 2QMUA 1PFKA 5DPMA 5B53A 4B5KA 4Y6SA 3ID6C 2IOFK 2J0SA 3EWAA 3IPRA 3IOEA 3R9IA 5ALSA 5B2EA 4GZMA 3N87A 2Q5HA 1KZ7B 2SNIE 3CR3C 5L7YA 1TVMA 2H0QA 1TGVA 4GG1A 2ZQYA 2QN6A 4OBWA 3RKUA 3TBKA 4BNDA 1GQOA 3EGIA 5EHZA 3BCUA 3D2BA 5CFNA 1J5EB 3A8TA 3ZKWB 4EY8A 1QHGA 1Q77A 5K7SA 3DE6X 2IS2A 2O8DB 2WSSA 3O94A 3ZR4B 3OURA 1G8HA 3C74A 3TD6A 4E5MA 2CN1A 1QGDA 3GV0A 1G8KA 2ABWA 3ZNNA 3EPJA 2XSZA 5B57C 3D31A 3HYRA 3JVVA 2ICAA 1T0BA 1R6AA 1YI0A 3EBOA 1U7ZA 1ZXXA <