1ODFA

Structure of ygr205w protein.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
286
structure length
280
Chain Sequence
SKTVLDYTIEFLDKYIPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHLMEKYGGEKSIGYASIDDFYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVLNTIFNQDTVVLPKYDKSQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNPILQGIENNDLLTGDMVDVNAKLFFYSDLLWRNPEIKSLGIVFTTDNINNVYGWRLQQEHELISKVGKGMTDEQVHAFVDRYMPSYKLYLNDFVRSESLGSIATLTLGIDSNRNVYSTKTRCIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Ygr205W Protein from Saccharomyces Cerevisiae: Close Structural Resemblance to E.Coli Pantothenate Kinase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Yeast protein
molecule keywords HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2 INTERGENIC REGION
total genus 96
structure length 280
sequence length 286
ec nomenclature
pdb deposition date 2003-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1odfA00
5DNYB 2OT3B 1P9WA 3GFPA 5AUOB 4MA4A 1W46A 4PANA 1FZQA 2VH5R 1KNXA 2A5JA 2OFXA 4WZ6A 1SULA 4IRUB 2JLSA 3BRWD 4BFVA 2YKGA 2WICA 4G5GA 4CDGA 1E2MA 1TEVA 1V5WA 4PQYA 4D4MA 5HZHA 3T1OA 2V4ZA 4M0LA 4EDHA 5C18A 2ANCA 2IUSA 2LWIA 3DO6A 4JVLA 5CM9C 1NVXQ 3IHLA 1QHHB 4IDNA 2GESA 3NIBA 2CBZA 3KTAA 2HLDA 1PUIA 5FUVA 1TL7C 1PV4A 5B58C 3GLGB 5JBQA 1CP2A 3RLFA 3GLIA 2DWQA 1RFLA 3AH8A 1Y63A 3OFND 2PL3A 3W5IA 1P60A 3THXA 2BOVA 1IHUA 1ZD8A 1LF5A 4C0HA 1E94E 4CT4B 5AUNB 1KMHB 4QGGA 4RZ2A 2Q21A 4Q66C 3NBYC 3MJRA 4G3XA 2GZAA 5IK2D 1JR3E 1Q22A 1ZVQA 2ZRMA 2ZI4A 2ZE5A 1GRQA 3QJYA 5IK2A 3Q7PA 4A9AA 3ZYCA 4A15A 1ZM3A 4M1OA 4R2HA 3K0CA 1XZPA 2IEYA 4DT1A 1GAJA 1JXMA 1XD8A 3WYAA 4WZBE 2DFTA 2WWIA 4XD7D 5HR5A 2ZSFA 3FKQA 4KFSA 2JDIA 1TQ6A 1XTIA 4G5SA 4Q7KA 4EPWA 1SXJA 1TF5A 3CO5A 2AWOA 2ZITA 1EGAA 1IY0A 3ZS9A 1ZAKA 4W9MC 5DGXA 2X2EA 4KAXA 4L9WA 4NDZA 5F2EA 1UKEA 1VG1A 3LLMA 4DSOA 3SQXA 3FHOA 4TMKA 1LVGA 3LAWA 1J8YF 2ZSAA 2WTUA 4MRNA 2ZREA 1EFTA 2IW3A 1JQJC 1N6IA 2JAQA 4ZCIA 3T12A 3NTUA 4MKFA 3I61A 2VHUA 2NZ8A 3JVUA 5AR1A 1M1YE 3RRYA 1P6XA 4V02A 1N0UA 3CKLA 4TMTA 1YU9A 3KL4A 4JLJA 4NE2A 1DAKA 4BLOA 4MH0R 1CR2A 3AUXA 2F43A 2A2ZA 5F3WB 4UJ5A 2JJ2D 1OYWA 2UZ3A 1G3MA 1P9NA 1YZTA 1ZYUA 4B48A 1GNPA 4HI0E 1L4YA 2AN9A 2HXYA 1UBFA 4ZCLA 3WHKA 4YMUA 2ZRCA 4HAYA 4PXAA 3WYGA 3L0PA 1ZIPA 2ZRNA 1W4AA 4NCNA 3TSWA 2DFKB 2FSGA 4FCVA 2REXB 4JBXA 2FGJA 4GDFA 2Q3MA 3IIKA 1A2BA 2PT5A 2W2VA 3A1SA 3UG6A 2OAP1 4PAMA 4HYYA 3SFVA 1P73A 4RD2A 5AJZA 4B6EA 4LJ5A 3W9YA 3ZVNA 1IN8A 1ZD1A 1ZRHA 3AVVA 5EQTA 1KI8A 2VP5A 4BFWA 1W36B 4PPFA 4WXRA 5J40A 1Z63A 2Z4SA 4TLDA 5HE8A 1BH2A 1YRAA 4BWYA 1AZSC 2V7QD 4TN1A 5F98A 1TUIA 1KSFX 1Z0FA 1YZNA 3LNCA 4CZ2A 1R7RA 4HB0A 1VHTA 5FBRB 3X1YA 3M0EA 5AUPB 3KXKA 1DTSA 2HF8A 1KK2A 2WWXA 3BORA 1T5LA 2FE4A 4QJ5A 2GETA 1E2IA 2GJAA 2I1VB 3LBIA 2XZLA 4HB3A 3IO3A 3W90A 1A82A 3RSLA 3FHTA 4US0R 2XNDA 2WPDA 3Q8XB 4HAVA 4RKEA 1RE0A 3A1TA 3C5HA 1R8SA 3GEIA 4FMBB 3BH6A 1FPMA 2VYFA 3I4LA 2AD5A 3L43A 5CB6A 5DYIA 4DT1B 3HJNA 3A4NA 2P3SA 1E2PA 2C04A 1P5ZB 5ELXA 2ZRPA 1E9AA 5FL7D 3GEEA 3NBZC 3R9IA 1R2QA 3SOPA 4N0EA 1P4SA 1ZM9A 2P0EA 5C4MA 2WMOB 1G16A 3KJIA 2XSZD 3HDTA 3LQQA 2GXSA 2WIBA 3RS2A 5F9FA 3T1QA 4DSNA 4QXAA 4BASA 2WWWA 4E03A 5C1BA 1YR8A 2GAOA 5EXSA 3ZJYA 1W2HA 3WXMA 3AF0A 3KJHA 4Q4AA 5SZIA 2PMKA 1XTSA 4DLVA 4WOPA 2H18A 1TU3A 2QP9X 3KKOA 5FOWA 3IEUA 1QHHA 2DYKA 4YONB 1VYVA 4DDWA 1RJ9B 4KODA 4K8OA 4C2TA 2OBNA 1XEXB 3KJEA 2QT1A 1M2OB 4D4JA 1OW3B 1XJCA 4OQMA 2AD1A 2CJWA 4DLUA 2QRNA 2Z5FA 1KKMA 3KFVA 4F91B 1Z6AA 2Q9BA 2GILA 2RH5A 1E2LA 4A6XA 4ZDJA 4RD0A 1BS1A 3TQFA 5JCZA 3OEHA 2QMEA 3EW9A 2JCSA 2ZYVX 2PEYA 5LD2B 4RFSA 2JLUA 2IYWA 4B34A 1QBKC 1Z47A 1KIMA 3IPYA 1S1MA 3P1JA 3A4MA 4DWJA 3QPVA 2DWPA 2VP9A 2N1BA 4Q9LA 4KSCA 4ZPXA 4JMPA 4UNRA 1OIWA 3KTAB 1XCMA 2H57A 4LV8B 2RGXA 4JZKA 1XMVA 1YZQA 3ZZTA 1ZM4A 1XBTA 2CL0X 4QBHA 3EX7C 1Z5ZA 1P72A 2KBFA 2IBMA 2VO1A 2WSSD 4PSAA 3TR0A 1HA3A 2GCOA 4M1SA 1DO2A 1JR6A 2IL1A 1ZNZA 2B92A 2VQSA 1SVOA 2NIPA 3LX8A 1T4GA 3L2OB 3OESA 3ZVLA 4XIGS 2ORVA 1AS0A 3WHLA 1AS3A 2NO1A 2CDNA 2OXCA 4LSGA 1AKEA 4HLDA 2ZUDA 3C8UA 3QOFA 5FR1A 1NSFA 4C4PA 4D4LA 4HDQB 3GPLA 4BLPA 4NP6A 3CWQA 1JR3A 1NLZA 2CMKA 4Q1DA 3TKLA 3J81k 3VKGA 1N2CE 4DLXA 1COWA 5JI2E 4TTQA 5DI9A 1IM2A 1MO6A 5AWFC 3HR7A 2Q3FA 2PZEA 1FTSA 5M04A 1SXJB 4BLQA 2QP4A 2IWRA 1VCIA 1GNQA 1I2MA 4IDOA 2JJ1A 4QKQA 1W36D 4LI0A 2NO6A 1OFHA 4Y0VA 1XJ0A 1MT0A 3PUZA 4GT1A 5FTKA 1Q57A 2VF7A 4BLTA 2JLYA 1DOAA 2EWVA 5G40A 4JYBA 2IWHA 2BDTA 1ODFA 1CR4A 4RD1A 3B5JA 3P20A 1CJTC 3BB3A 5FL3A 3KQKA 3WYFA 1GNRA 2QP3A 3PUXA 5DISB 2ONJA 3W6OA 4B3GA 2HT1A 3DEFA 3MJHA 1JBKA 1KO4A 2HUPA 5EZ6B 3ZQJA 2RKOA 5LPNA 4DLZA 5SZHB 1NJGA 4GRAA 2BEKA 1N5KA 1D2NA 4CEJA 4LPSA 1HT1E 2ODNA 1DS6A 5DO9A 5G41A 2GXUA 3RRMA 1RVDA 2OBMA 3CR8A 2RHMA 1XEWY 4UKDA 1UDXA 5JS7A 2ZE8A 3QKSA 2YOGA 4YMWA 4DJTA 3F8TA 2R9VA 3FKSD 1E2EA 5JJLA 3I62A 2G83A 1YHNA 2CE2X 5FL7A 2KSQA 3LRPA 4C3ZA 1SKYE 1R4AA 2HCJB 2ZYUX 3K0CC 3GJ5A 4DDVA 3JZMA 2OXRA 5JZVA 5KDOA 3GD7A 2XZPA 1XD2A 3K53A 5FTJA 1GITA 1U90A 1Q0UA 2ZPTX 3Q5DA 2CLSA 1Z0AA 1WB9A 4LHVA 3I8SA 4M22A 3QEOA 4X8LA 1E6CA 1G5TA 3C5CA 4G5OA 4QGFA 4YLGA 1WDTA 4JLMA 2GBLC 3GLFB 2JDID 3OAAD 2FEOA 3ETLA 2VP6A 4LRWA 4BRUA 1ZM2A 1ETUA 1V43A 2DB3A 2ZXUA 1NBME 2XZOA 2NGRA 4C30A 3RS4A 2WJJA 1NIJA 3SJZA 4GL2A 1W0KD 5FBLB 2UKDA 3BJIC 4LUCA 4MYHA 2CXXA 4B3XA 2O8DB 4QHSA 4Q9KA 1XXHA 5HZKA 2OESA 5E4FA 2FU5C 3PIRA 5HKKD 1NBMA 4A0FA 4GBMA 4NYIR 3ADDA 2V54A 3HU3A 3MWJA 1Q21A 1W7AA 4KBGA 6Q21A 1E99A 4Q19A 1S8FA 4LJAA 3IQWA 2BEJA 1EX6A 1TU4A 1LB1B 4S35A 4F92B 4AI6A 4TZ6A 1GRNA 1G8PA 1KO5A 1RW4A 1WCV1 3K9NA 3IHWA 3QSYA 4CEHB 5GVSA 2OCYC 2J7PA 1XWIA 2P65A 1KMQA 1AGPA 2A5YB 1E9EA 1L8QA 4HZIA 4M4SA 2YOHA 2P6RA 5J4VA 1K5GA 1GP2A 1Q3TA 3O8DA 2KWIA 5FUYA 3QBVA 1DVRA 1GOTA 1NIPA 2O8BA 4KVGA 1FMJA 2QSYA 3C16C 3CWZA 4OI2A 1EESA 5J4HA 1XTJA 3R8FA 4HLQB 3CRRA 4UNNA 1TAGA 2BMJA 4DCTA 4XWOA 1EFHA 2QBYA 3EIQA 1KYIA 4LC1A 4KVAA 2V8OA 3B60A 4MKGA 1R0ZA 1WQ1R 3WP1B 2ZRGA 1Z6YA 4D0LB 4NU0A 2A5GA 4Q21A 1UBCA 4LYHA 3E1SA 3OIUA 3QG5A 1N3BA 2WKPA 4F4JA 2IC5A 5J4KA 5JMTA 4NYMQ 4A0RA 3G0HA 1IN6A 4F7WA 1E1QA 4Z1MA 4POAA 2V7QA 5SZKB 3HR8A 2NMVA 1T0HB 4YC7A 2ODEA 1IXSB 2J59A 5EXXA 2HJVA 3AVUA 1CR1A 1TF2A 3LV8A 1N6RA 2JLRA 3GP8A 1PUJA 2LKCA 5FPKA 4AY2A 5CM8B 1R6BX 2CHQA 1YZKA 3EZ2A 4PHHA 3AF4A 3GLHB 2ORIA 3CH4B 4OL0A 4M1KA 4NYIQ 3EWAA 5FTNA 1G8YA 2AK3A 1AQUA 1KGDA 2A30A 1GL9B 2XNDD 3TR5A 3AF2A 4W5HA 2CCKA 3DOFA 3UMFA 1G64A 2IF0A 1KY2A 4ZDKA 1A1VA 2B8WA 3DMDA 5HTKA 4MRPA 1YQTA 3PFIA 1CJMA 4XVQA 2JLVA 1J7KA 3X1DA 2B7CA 1US8A 3AP2A 4KHZA 4LJ7A 2FZ4A 3C4JA 3ZS8A 4ZIRA 5BN4A 3U7EB 1AIPA 2CHVA 4HEJA 1ZC4A 3HPRA 1NSTA 3A4LA 1AN0A 4TT3D 4C2UA 3RNLA 4KJZA 2F6RA 2XOKA 4PC3A 3ADKA 1BOFA 3T15A 2GRJA 3GLIB 1GDDA 2GNOA 3H4MA 1OV4A 4PZLA 5AK0A 1YKSA 3V9PA 3ZVRA 4ZV4A 1F2UB 2TMKA 3U7FB 4HZUA 5GADl 2FFQA 2AHOA 1N6HA 1T5IA 3QE0A 4B2PA 5KTYA 4KFTA 1E2GA 5JECA 1ZIOA 1C1YA 2Y8EA 1GVNB 2R6DA 3M6AA 3SZRA 2J0UB 2ZJOA 4JT2A 3U61B 5DIFA 2CEAA 3FVQA 5CYOA 4BFTA 2QMUA 1LF0A 2Z83A 4JLPA 4DUGA 4IEIA 4MYTA 2ZJAA 4YMTA 2RGGA 1EFRD 1XD9A 1RKBA 4JL5A 2DY1A 4EJSC 4TL9A 2Z4RA 1LW7A 4PPNA 5B30A 4JJKA 4ESVA 2VHQA 5BN3A 3HYRA 4DRZA 5JSZB 2QAGA 4AKHA 4H9GA 3BFXA 5L8VA 5DLQC 1D6JA 2W2XA 5IRCD 2QORA 2GBLA 3WNCA 5JEDA 1OXTA 5H70A 1YR7A 1S9DA 2E1RA 1KI2A 1TEXA 2F1JA 4QM7A 3I32A 2P6UA 2PZGA 4PC2A 4Q7JB 3PVSA 1KSJA 1DG3A 2OFOA 2EYQA 4GFDA 4HDOB 1AA9A 2DR3A 4HUQB 5KNCA 5H68A 3UANA 2J7PD 1MV5A 1ZJ6A 3QF4A 4Q02A 4CEIA 2QE7A 5DI3A 4LDJA 3EA5A 3MAAC 4E07A 3KUCA 4PZZA 2CNWA 1T91A 4MUAA 1J70A 3DOEA 5J47A 2DFNA 3LO5A 4TTPA 1Q1ZA 4DLWA 4MDEA 2JA1A 3ASZA 3N5CA 1M6NA 1JALA 4W7SA 1HY3A 4TYQA 1KJYA 1KAGA 3FB4A 4HUTA 1OXXK 1XRJA 3P26A 1FOEB 3WP0A 3KQHA 2VPPA 2YC4C 2ZS9A 3UMRA 1WMSA 5SZJA 3Q9LA 1OPXA 5TARA 421PA 1OT3A 2RGAA 3GFTA 4I1UA 2QRZA 2KJQA 2BKEA 3N70A 4TMXA 3RSOA 3VTKA 1W44A 3CBQA 1F6BA 2ZAMA 2ZVPX 4LCBA 1U0HC 1LFDB 1G7CA 1R0WA 2P5TB 5ANRB 3RHFA 4PSVA 1QHSA 1GG2A 2ZJ8A 3CPHA 2H16A 4Q4LA 2VSFA 2NQ2C 4JLOA 5E7MA 3NXSA 3GEHA 3Q3JB 1ELOA 1OYYA 1SXJD 3BS4A 3K0FB 5E7JA 3AVQA 4DDTA 4PAOA 3CZQA 4FIDA 4L4UA 2R62A 2Z43A 3GJ4A 2QG6A 1AK2A 2BCGY 2NPIA 2X1VA 3MMPA 4UNSA 2IYZA 3NBFA 1SVMA 4OYHA 4JLNA 1S1CA 1SVLA 4KYUA 1N6KA 3B1ZA 3WMFA 1G18A 2PJRA 2YINC 3GFOA 5G53C 4NTZA 1E2JA 2FOLA 3DPUA 3EAQA 1N5JA 2F3RA 2QM7A 1VDZA 2ZRFA 1J2JA 4PHGA 2AK2A 1E79A 1O87A 3SR0A 4RSGA 1ZCAA 1W49A 2EU8A 4FMDB 1SHKA 3U3JA 2AX4A 4BFSA 4US1R 1JAIA 3QG1A 3ICQB 1M7BA 4ARZB 5KO2A 2WIAA 4TYWA 4KYIB 2GCNA 5DN6A 4M53A 1WBBA 1SVWA 3BB4A 1R0XA 4H1VA 1C9KA 4BRWA 2J41A 3PEYA 1U94A 2C9CA 5LD2C 3LY5A 2EYUA 2NG1A 4TYYA 4L15A 2J0QA 5L3SB 2RGEA 4O3MA 4R7ZA 1ZD9A 2QTHA 1N6NA 2V6IA 4BEJA 3VX4A 2WAYA 1F5NA 1II8B 1NJFA 3DKPA 4MKIA 4RFVA 4U02A 2G1KA 5FPSA 1T6NA 2VP2A 3EIEA 4KXFB 3TVTA 1KZGB 1XU4A 1US8B 3EZFA 1IN5A 4D25A 4Q4AB 4B35A 3THWA 3C14C 2HCBA 4OQNA 5EUQB 4Q4JB 2QA5A 3OE7A 1NMXA 4FD2A 3VFDA 3NVAA 4Z8XA 1WRBA 3QVVA 2IF2A 4ZKDA 1F2TB 3N2EA 4C0BA 5J4LA 3QPWA 1OH8A 1G9XA 1Y3AA 3SE0A 1UFQA 4MGIR 221PA 4TLBA 1KK0A 1H8EA 3A1UA 2YC2C 2QGZA 4LHYA 1B0UA 1AJEA 4Q01A 3B2EA 4A92A 2O8FB 4OHWA 1E1RA 1A2KC 4PO9A 2QY9A 2D2EA 2O8EA 4V0LA 3THOA 4BFUA 2GAAA 3BFVA 4L9SA 4MITA 2W58A 4CYMA 2IYSA 4U7DA 1CXZA 3W3AA 3EPLA 2ZETA 3RRZA 1KI7A 1YJ5A 1K6MA 3C15C 1SKQA 3GJ6A 4KLZA 3UWKA 2QAGB 4OBEA 1NG9A 3NHAA 1W4BA 3IUYA 4TQUS 1DEKA 1JPNA 4GZLA 2LCFA 2Q9AA 721PA 2H1LA 2IEZA 3G82C 4FMCF 2XJ4A 4QRHA 4DSTA 4YXWA 1CLUA 3MCAA 4IOKA 3QUSA 1E69A 4OKSA 1KTVA 4EKDA 2AKYA 1NKSA 3L82B 2GZHA 1COWD 5AJVB 2XTNA 2P5SA 4OHYA 4MRRA 1KMHA 1P7CA 1LV7A 2C98A 2ZS7A 3DM5A 5JJIA 4DCUA 5DHAA 5DI3B 1E1QD 1R0YA 2QPTA 4Z1MD 3UKDA 1XJQA 3MG9A 5TDHA 3VMFA 4OHZA 4S2EA 2H5EA 3KZ1E 1I4TD 3AVTA 4JBWA 3F5FA 3GLGE 4MRVA 2NO9A 3QKRB 1FFHA 3ND9A 2ZI6A 2ZI3A 1G291 4PR0A 3TSOA 2KBEA 3KFXA 1D9ZA 3AVXA 2C9YA 4HLUC 4CEHA 2KE5A 3N2IA 5AJXA 5P21A 121PA 2ASEA 2IXEA 4MGYR 4QBIA 2Z6VA 1UF9A 3D8BA 1VYUA 3ASYA 4TLCA 2D06A 2D7CA 4Q1AA 4URWR 3T1VA 5BW8A 1CR0A 3PXGA 4D80A 2GVZC 1X3SA 1IY2A 4PPQA 5A4JA 5GJWC 2QMHA 3EC1A 2GXQA 3T34A 4JLVA 3VR2A 1E9RA 1XPUA 2QT0A 2J1LA 2YWGA 3FMPB 2WM9B 3K09A 3B1XA 2EFDB 2L0XA 1UDWA 2HYDA 1LS1A 3FHCB 1A7JA 3H84A 3PR1A 3RWOA 4O2RA 4QL3A 1X8KA 2ZEJA 3P4YA 4ESHA 2IYXA 2VLIA 5K8IA 3GJ7A 2I3BA 3CX8A 1P2UA 4B76A 1G19A 1FP7A 3D31A 2I4IA 3X2SA 1MO3A 4XWKA 4FWTA 1G17A 3X1WA 2C8VA 2W6IA 1GFIA 3KKNA 2A3RA 4IXNA 4V0NA 1Q44A 4PC1A 3U3RA 4HAWA 1I4LD 4B75A 2QPAA 3TH5A 1U9IC 5FUWA 1FMLA 1MH1A 2QTVB 4GMXA 4G01B 5DSZA 3RVBA 3VR1A 1YR6A 4OQLA 4C0QC 3PENA 3I5XA 3KKQA 1UEJA 4DCVA 1E98A 4LGMA 4DUGD 2VA8A 1Z83A 3R20A 1FQJA 2C2HA 1EFRA 5KSZA 4A4DA 2FN4A 3I3SR 2BVNA 2JJ1D 1N0VC 2XXAA 1W5TA 1GKUB 5KDLA 1OXVA 1XZQA 2DFLA 2OUKA 1FNMA 4TMVA 3A1WA 2WSMA 3CRVA 3LH5A 5FPTA 5KYKA 1CKEA 1HE8B 3SS8A 2OAQ1 2ZROA 1KDPA 2YWFA 2MSEB 1H8HA 2B7BA 4P0TA 4RJLA 5JRJA 4URXR 4LJ8A 1GZSA 1U81A 5TXGA 5JLJA 3FPAA 2X8AA 2J0VA 5L3QA 3I72A 4XVUA 4IXMA 1CJVC 3ZZ0A 5KU1A 3TUJC 1MO4A 3H86A 4D26A 4A0HA 2O8CA 5FOVA 3SNHA 4HATA 1Q1BA 1ZW6A 2C95A 1KJZA 2O5VA 4IOLA 3WNDA 3CB4A 3U6BA 1PLJA 2FNAA 2E87A 1XPRA 1BMFD 1E0SA 1NL3A 4BECA 3LWNA 1DAFA 4M1YA 2NZJA 3Q72A 4D82A 4YXWD 2F1IA 1E2DA 3OHMA 4DIEA 2QQ0A 3NKVA 5JWOA 1HH4A 2IYYA 1JB1A 1ZU4A 2YYZA 4AKIA 4H1UA 3MUFA 1HQCA 2ZYWX 4LBYA 3TAHA 3BERA 4DKXA 1KDRA 3EXAA 4D6PA 3AKEA 2ZR7A 3T1TA 4JSTA 2OCAA 3IDQA 2GZDA 4V0ME 1XEXA 3M1IA 1PZNA 4BZPA 4DSUA 3EPJA 1EWQA 3THYB 2GDJA 1VCOA 2V9PA 3FMFA 1GL6A 2IS6A 5B57C 2ECKA 2REBA 1Z29A 3SJCA 3K0SA 2IUUA 4RCYA 3KJGA 4PZYA 3BK7A 3LVRE 3DKVA 2BIFA 2FSHA 3VQTA 1RYHA 4UQOA 1Z06A 2WZQA 1KI4A 2VEDA 4OI4A 1DAEA 4DLTA 4EFLA 3AKCA 3PITA 2CL7X 1LNZA 3QPUA 5CLLA 3W5JA 2FMXA 5DE3A 4RFSB 5HE9A 1FUUA 1E2QA 1W0KA 3VNVA 5AJYA 2RGCA 4A2QA 3TSZA 4ZI3A 1PLLA 3LW8A 3BH7A 2A5DA 3RRNA 3A37A 5HKKA 1X6VA 1XB2A 3OEEA 2O0HA 2JLZA 4KV9A 1OIVA 4JKIA 4Q5IA 5K8UA 4RY2A 4M8NE 5D3MA 4X8MA 2WOOA 4BFYA 2QZ4A 1W4CA 4GMDA 3R8CA 4LHWA 4YQFA 2F55A 4IVPA 3NBXX 1VTKA 2BMEA 2R44A 1HYQA 4KFRA 3IQXA 1K5DA 2FH5B 3EASA 2IHBA 3CNLA 1ONBA 2IYUA 4M1MA 4XVRA 1XCGB 1NI3A 2PJZA 2OG2A 3B85A 5EE9A 2WJYA 1S4QA 4AG5A 3LFUA 3UWOA 1GRRA 1N6OA 1U98A 4RZXA 2EFGA 1ZUHA 4AC9A 4MQBA 4ERNA 1Z6TA 1G20E 4HAZA 4JSYA 1OSNA 4PX9A 5EP2A 3QVUA 1G7SA 1EG7A 2R6GA 1J99A 4ACAA 1OH5A 2GEUA 2WJHA 3AVYA 3UATA 1E2KA 5EXTA 3FMIA 4EQ6A 4NZYA 1NMZA 1T8UA 3RDPA 3I5YA 1XMIA 1U2RA 3SBDA 3EG5A 4C0SA 3KQNA 4MDFA 4HB4A 1ZU5A 3SJAA 3GLHE 1KJWA 1WP9A 3WY9A 4EPVA 4ZDIA 4D4KA 1CULC 1KO8A 5LBIA 3LBHA 1JI0A 2OO7A 4D0NA 3GMTA 5G3YA 1E2FA 1XTQA 1YZLA 5GJCA 2YWHA 2OSBA 1XTRA 2AFIE 3PJRA 1SGWA 5EE0A 2AXNA 4IOMA 4URVR 4B32A 4DEXA 4LV5B 1EK0A 2CVFA 2HEIA 3SBEA 4BGDA 3AKDA 5CK4A 4PC7A 2X77A 3HPQA 4OI1A 2VRWA 3UK6A 5L3SA 2QE7D 3BH0A 4JBYA 2CNWD 2XAUA 3QXXA 1W0JD 3EPKA 2JGNA 2WJGA 2D62A 1KI6A 3MRSA 2WWFA 4AKGA 1WE2A 1P61B 3AVPA 1QHIA 3LBNA 5FI0B 1KY3A 1OHHD 3EPHA 3OFNA 3REFA 1KZ7B 1NKTA 2JATA 1EXMA 4M9ZA 3UIEA 3QXSA 2J87A 4Z51A 2JJ8A 1N6LA 1YVDA 2H7VA 4TT3A 1U0JA 8OHMA 4XSHA 3F3YA 2B6HA 4I1OA 4LX0A 4M9XA 3LW7A 5L3QB 2ORWA 4URYR 1H65A 1Z3IX 4TZ0A 4Q4HB 4LC0A 4BFXA 5J4YA 1M7HA 3PG5A 1OF1A 2VHCA 4F93B 3P32A 1XXHE 2ZR9A 3VU9B 2AL7A 3SU8A 1SKYB 1U8ZA 3KX2A 1E3MA 4QHYA 4AG6A 1XTKA 2ZRIA 1QG4A 4CIDA 2HYIC 2F9LA 2XTMA 5BXQC 1QG2A 2PT7A 4JLKA 4JVSB 4JIMA 2W0MA 4C0JA 1DE0A 3K1JA 3THXB 4E22A 4G5RA 3U4QB 3GQBA 2ODWA 3GJ0A 2ZRJA 1IN4A 2IYVA 2OFWA 5FOUA 1R5OA 3TLXA 2H17A 3K0FA 1QHYA 2ERYA 3PUWA 2YJTD 2F1HA 3ZQ6A 3QXHA 5KNDA 1VCMA 1UJ2A 5TMPA 3KQLA 3OEED 4L5BA 4EPYA 2JIZA 1P2SA 1XEWX 2FPMA 2O0JA 3AEZA 1JJVA 4JL6A 3WRYC 2IS2A 3K9GA 2Q3HA 1Z2AA 2JIZD 2QN6A 3GLFE 4KI0A 4BQSA 3NDPA 3H1TA 4P33A 2BMFA 4JLDA 4URUR 3VHXA 3NH6A 2ZANA 2VSOA 3T61A 1Z22A 3R9XA 4Q1FA 1G8GA 1WF3A 1O3YA 2QPOA 1U8YA 4K81B 5F9HA 2O8DA 3U3OA 1XXHB 3QKUA 1ZUNB 1KSHA 4GNKA 1Q3HA 5JFGA 1P2VA 1AS2A 1ZMXA 2YVUA 3FMOB 2ZI7A 1VG8A 5FOXA 2HV8A 4PPGA 1D2MA 4IW3B 4IKEA 3H0KA 1DARA 2G6BA 5D3MB 5CJPA 1E9BA 4E5UA 2PEZA 1F2UA 2GTPA 3GJXC 4Q9JA 1DAHA 821PA 1TQDA 3CRW1 3OE7D 5FBWB 1II0A 2HDNB 1UEIA 2Z0MA 3VR4A 4D81A 2ZRBA 3PEUA 3CNOA 5IT5A 4DDUA 2KI5A 3SJBA 4DBLC 5FOSA 3P4XA 2EFHB 2QBYB 1BIFA 4MYUA 1QHGA 1YZGA 1T9HA 621PA 3CPJB 4KFUA 5EP4A 3TVDA 1M74A 1GUAA 4F38A 2XEXA 1GILA 5FR2A 4FWIB 4IFEA 4TSFD 1OH6A 1G6HA 3ADCA 4QM6A 3BBPA 4KO8A 3U3KA 4TWZA 4HB2A 2ATVA 4CT5A 3BB1A 2BMDA 2ZI5A 2XX3A 3GLFA 4JKYA 4IHQA 5AUQA 1OKKD 3QI2A 1Z6XA 4BZXA 2FV8A 1W47A 2R2AA 2YNMA 2ANBA 2X19A 4FINA 2NO0A 2A78A 2WOJA 1Q1EA 2O8BB 1OJLA 1Q12A 1S9HA 3CPEA 1U9IA 4IEEA 2VHJA 1RRPA 2K5UA 5JWHA 3WRXC 2G88A 4IDQA 1NN5A 1E96A 2ZRDA 3B1VA 1QHXA 1YZUA 2C5LA 3A8TA 4XTCS 4NH0A 1IN7A 1FL9A 4AYTA 5KHOC 4AYWA 2IX3A 2XB2A 2XSZA 3AGPA 2LKDA 5KNBA 1UKVY 3G5UA 4MYCA 4TQAA 3FOZA 2RMKA 4CVNA 3E70C 1RYFA 3EZ9A 4PAQA 2EVWX 4PHTA 4Q9HA 3VHLB 3IPXA 4X8HA 1TMKA 1OXUA 4UXHA 5J5CA 2OZEA 4YMSA 5G3ZA 1X1RA 3L0SA 4OJKA 4C0AC 1NP6A 4FI3C 4QBFA 2P67A 1F48A 1F3OA 1RPZA 2IYQA 5UKDA 3GCGA 2ZJ5A 1IBRA 4RD3A 3X1ZA 2FJUA 4RD4A 3B7GA 3K9LA 4QOSA 2WWGA 3QNUA 4JYCA 4GP6A 1BYIA 2V55B 3GLIE 5B2ZA 4LJ9A 1HUQA 4RZ3A 2ZM5A 2NPFA 2GKSA 3KKPA 2XXAB 1FNNA 2OLJA 4I4LA 1GWNA 1G3UA 4IVQA 4NCKA 1G5PA 1G4UR 1SVIA 3KXIA 3QQ5A 1JNYA 1PJRA 1MABB 4WZAE 5KPDA 4HLUA 3E5HA 2H8KA 1VIYA 3HP1A 3NWJA 4Q00A 5FBQB 4B71A 1KI1A 3D6TB 3BOSA 3PCRB 3JVVA 1MRSA 2C03A 1NN3A 4WAUA 1T3LA 1WXQA 3TBKA 5FI1B 2H92A 2G0NA 5FUXA 1XP8A 1NY6A 2WSSA 3OIYA 1DAMA 2QAJA 1MRNA 3BIFA 3NC1C 5B64A 1S96A 2QQEA 4GOXA 2C96A 1MR3F 2C77A 2W00A 5TVKA 2WJIA 3FFAA 4N1AA 3U44A 2CL6X 5TV2A 4B2LA 2J5XA 4RZUA 1ZNYA 2GCPA 2RGNA 4F4IA 5FPHA 4EPTA 2ZAOA 1Z28A 1JR3D 3MWKA 4D0GA 1NVVR 5KOYA 4CGZA 2OCBA 1GL7A 2J0UA 1S3GA 4U00A 1CU1A 5GJVC 3WBKA 5JWRA 2J9RA 4QNRA 4EIWA 1TADA 5IHPA 4YMVA 3PUVA 2C99A 2D3WA 2VHTA 1IJFA 1K8RA 3VX3A 5BN5A 4DB2A 3AKYA 1D2EA 2DCUA 4MGKR 2OBLA 4Q1CA 4JLAA 4E09A 1J90A 1ZINA 2X2FA 3HWSA 4TLEA 1VPLA 2YZ2A 4A8JB 1N5LA 4LZZA 4UXJA 4R9UC 4U5XA 2BWJA 3RC8A 1UBGA 3K9HA 3LXXA 2F43B 3AP1A 1GM5A 2IUTA 1IXRC 3KDSE 4B2IA 4TSFA 3TNFA 3B78A 4WW0A 3CF6R 3BWDD 2QI9C 2FEMA 4YDHB 3SQWA 4WXPA 1OFTA 3SYLA 2UVQA 1HURA 3VR3A 2ZRLA 2ZS8A 1VCNA 2BM0A 1CF4A 2VBCA 2WVJA 1VYTA 4C0KA 2XJ9A 3MD0A 1G41A 4P32A 2JLXA 4KCGA 1NN0A 1W0JA 4O0MA 4DCSA 4IDPA 2HF9A 5KSPA 5KSOA 5JHGB 1E0JA 4A6PA 2B21A 1OHHA 3GJ3A 1M8PA 2MMCA 5BWMA 3FKSA 2D74A 2QROA 2P2LA 1JEDA 4ZI2A 2REOA 2BJWA 5BQ5A 3R9WA 3M4YA 3L0OA 3OIWA 1TPZA 4I1SA 2VSXA 4B43A 5H1YA 2ZU0C 1S0UA 1S2MA 1MOZA 4Z54A 2R6AA 3SI7A 1CBUA 5E7IA 1OXSC 4AK9A 2RGBA 4LPKA 1E4YA 2GJ8A 2N46A 5HCIA 4CEJB 2J0SA 5LDDC 4P4SB 1AZTA 4BLRA 3SYKA 4CEIB 2WBLC 1R10A 3Q85A 1G8HA 3CRQA 4XOIA 2ZRHA 1D5CA 1TQ2A 3CNNA 3QKSB 5C2JB 1DO0A 1E9DA 2AFHE 3OAAA 4ARZA 2IXFA 3ND8A 3CRMA 1YR9A 1P62B 4LOAA 4RD6A 3THYA 2ATXA 2AWNA 2ZJBA 4OK3A 3CX6A 2OEPA 3QENA 3AB3A 2PX3A 2QTFA 3FDIA 4GI7A 4R71A 3X1XA 1KOFA 2IA5A 4GZMA 1KI6B 2EFCB 3OEHD 4B47A 1CTQA 3UG7A 4KU4A 3SDZA 5EE3A 2O8EB 1JEEA 1OE0A 2F9MA 3ZDQA 3A36A 4NL4H 5CITA 1TNDA 3AVWA 4URZR 1DELA 2HT6A 3QXJA 3TUIC 3ZZUA 3B1WA 4HLCA 1RIFA 3OIVA 3MSXA 3DHWC 4JLBA 4DLSA 4GSYA 3DMNA 4PSKA 1NG1A 3RABA 4NKRA 3FE2A 3W8NA 3LD9A 2AR7A 4NYMR 1WBDA 2PH1A 4I99A 2GVDC 1AQYA 4Q9IA 1Q20A 3AV0B 2P6NA 3NEYA 4EJSB 1I2DA 1MO5A 1P9RA 1VHLA 2ZJZA 2JLQA 3PQCA 3B8HA 4LBWA 2WWYA 4ABYA 1W48A 3KKMA 1YRBA 2C78A 4Q03A 2FFHA 4AWXA 1E9FA 4M2LA 2GA8A 4BUJA 4A8JA 4TYNA 1ESMA 2QENA 2B8TA 1IY1A 2ZSBA 4B3CA 2ZE6A 2ZUCA 4J0QA 3O8BA 1P75A 3W3ZB 2BKUA 5CDFA 2QMOA 3HU1A 3PEVA 1U99A 1XMSA 5JI3E 4WIAA 3TRFA 3L8ZA 2ZIAA 4JL8A 1E2NA 3QIAA 3KQUA 4XSGA 2A5FA 4M21A 521PA 2ZYTX 3CUEF 4PQRA 3NDBB 1R5NA 3U44B 1GKIA 3ZH9B 2RHDA 3I92A 4N0DA 4B74A 2IS4A 4XJXA 4MGZR 5EE5B 1G3QA 4QNMA 1HEIA 3LLUA 3W6PA 1RRFA 2AXPA 4KITB 1N6PA 1XEFA 1Z8FA 3TJZA 4DB4A 4OI0A 2KB0A 1OB2A 4PHFA 2OE2A 4PFSA 2WPDD 4ZCMA 2IYLD 2AKAB 5CYPA 1IJEA 1IOZA 2HXSA 4QGAA 1L4UA 2ZI9A 2ZRAA 3BD9A 3UPUA 1KK3A 2OHFA 4NYJQ 1TTTA 3RYTC 3LVQE 2HLDD 2G0TA 2RCNA 1JECA 1QHNA 2NO7A 2ZJYA 2CVHA 4K46A 1E79D 1ZP6A 1SZPA 4JT4A 3WBJA 3TUZC 2O8CB 1AGRA 4PC6A 3K0EA 4ZDWA 5HCNA 1X86B 3O47A 2GF9A 4JJZA 4Q18A 5DN6D 2O8FA 3O8CA 1TUEA 3WMEA 1L2TA 3U3MA 2FX3A 4A1FA 4BEBA 4LYJA 4RKFA 3F0TA 4QGHA 1DPFA 5BYJA 1ZNWA 3AGQA 1AKYA 4DC9A 1KNQA 2DWOA 3LDAA 5EP1A 4LJ4A 1XFAA 2O0KA 4EJSA 3UMSA 3GJ8A 1DG1G 5JS8A 5DH9A 2WAXA 2BBSA 3L0IB 1VG9B 3RAPR 4DVGA 1A5TA 1RJ9A 1XDBA 1XMJA 2YV5A 4A2PA 2PZFA 2J7KA 2NTYC 2PCLA 3VR5A 2ZR0A 3VKWA 2CJWB 1E2HA 1DAIA 1JQLB 1HT2E 1E32A 1G6OA 1NBMD 2UZIR 4Q48A 2MSCB 4N3NA 4ZKEA 3QEJA 1D9XA 1KI9A 2IYRA 4KBFA 2BV3A 4OHXA 1HTWA 4C0LA 4EFMA 1UPTA 3IKJA 5L3VA 3QKTA 4P4UA 3S1AB 4BZQA 2VIIA 3OF5A 1JAHA 1W36C 2W6JA 3W34A 4CF7A 3ADBA 1SQ5A 4RVCA 3FFBA 4W5JA 1JJ7A 1UKYA 1OH7A 3CLVA 2W6JD 4WVFA 2DHRA 2QM8A 2O52A 3U7HB 1RC8A 4KLNA 3IEVA 3ECCA 1DBSA 1KHTA 4WBSA 1HE1C 1KDOA 1U0LA 2YHSA 4TMWA 3RS5A 4V0OA 1SVSA 2ZE7A 3LXRA 3AF1A 3ZVMA 3IBYA 2OLKA 1VECA 4LYAA 1W2GA 2NOAA 3C7KA 1Z6GA 4R98A 2EFEB 2BBWA 4P31A 2FDCA 1G3RA 5JRZA 2BBOA 5LB4A 2EW1A 4HAUA 1BO6A 1RRCA 1N25A 5D3QA 1CJKC 1FX0B 3OZXA 3RANA 3K0AA 4L16A 4NPHA 4TLAA 1P2TA 3B82A 3U60B 4G0NA 1N0WA 4A82A 2RGDA 4EFNA 2ZUBA 5LB2A 4ASUD 4IJMA 2D4HA 5FOTA 5KSYA 4ASUA 3EA0A 4MKHA 1KO7A 1WA5A 1EWRA 1F60A 3EZ7A 4OQXA 3DZDA 4HDCA 1UAAA 3SHWA 4AKEA 3MLEA 3LA6A 4IOJA 3K8YA 4O25A 2FZLA 5FPYA 2OCPA 5DYGA 3A6PC 4DIDA 4XTRA 2EWWA 1Z2CA 2G3YA 3FGNA 1FP6A 4A0GA 1FW6A 4DLYA 2Q6TA 5KDDA 1XD2B 4LK2A 1NF3A 1OKKA 1PVOA 3BGWA 2CLCX 3REGA 4LHXA 2ERXA 1QRAA 3NEJA 5K8TA 4IDHA 2GEVA 4UNPA 5CK5A 3WMGA 2BC9A 2Q0HA 4TL6A 5A0FA 1P3JA 2CLDX 2OV2A 5FBVB 4DLRA 2RGNC 4IVRA 4Q1BA 3IILA 3T35A 1XPOA 1NN1A 5GVRA 3THWB 2JLWA 2WHXA 3AUYA 3DL0A 3SN6A 2JJ2A 3PUYA 3NHBA 1NNEA 4I81A 3H2YA 2ZSDA 2JEOA 3B9PA 4LWZA 4LY6A 4UXIA 1HV8A 2OILA 1NRJB 3R7WB 2XNSA 3RS7A 2IXGA 4X8OA 1Z0IA 4FN5A 1EX7A 3D3QA 2FA9A 2FPKA 3FYHA 2D7DA 1C4OA 5DHFA 2WV9A 3CZPA 4G5QA 2ZJ2A 3TGPA 3RS0A 3PV0A 1S3SA 2QAGC 3CF2A 1G4AE 2QUZA 3S1AA 1IONA 1II9A 4LBZA 4GOJA 5JHHB 2XGJA 1JPJA 5EE1A 4QC2A 3AF3A 1JXOA 2ZRKA 3CR7A 1H8ED 4Y0AA 1OB5A 1UM8A 1CIPA 3TAUA 1TF7A 5EXPA 1A4RA 3T5DA 1H8HD 3AVOA 1OIXA 3I1FA 3IBGA 4QJ3A 1OLOA 3K0AB 4B44A 3K70C 1CRPA 1XF9A 3CX7A 1KSGA 2W83A 1MABA 4DEYA 1BYUA 2YOFA 4Q4JA 4Q1EA 1SHZA 1G7TA 2XITA 4Q47A 4YDSA 2Q9CA 2IHYA 3IO5A 4LJYA 4R2IA 1J8MF 1EFCA 1FX0A 1QF9A 1W5SA 3EARA 4A8JC 4P3YA 4FMCB 1G5RA 2SHKA 1G8FA 1M34E 1UADA 2F1RA 2J45A 1KI3A 4UJ3A 1NVWQ 1ZCBA 4C7OB 2FSIA 1IQPA 3RC3A 3IGFA 1E0AA 5C46F 2A9KA 1X8LA 4HAXA 2J46A 4DCNA 1GIAA 2F7SA 1XX6A 3KB1A 1Z0JA 4PO1A 2ZQ5A 2R65A 2GK7A 3MWYW 4FCTA 4HSEA 4TYPA 1KKLA 3Q7QA 4NCIA 1QVRA 5H8WA 2RB4A 2R6FA 4LJ6A 1TQ4A 2HJGA 3C41J 4P4SA 3SHFA 2CCGA 4NMMA 4NHOA 4BE7B 1Z07A 1CEEA 2VL7A 3NC0C 4WA7A 3ZLJA 2IK8A 3CIOA 3T5GA 4A2WA 3V00A 2A7QA 4V0KA 2WJVA 1E9SA 1GTVA 4B33A 4ACBA 1EFUA 1SXJE 3KUDA 1X8JA 2GK6A 4DXAA 4P4TA 3R7WA 3QF7A 3AM1A 1DAGA 5CDFE 3O8RA 4O2LA 2PX0A 3BAFA 3K70B 1GKYA 5EZ5A 1MKYA 3EC2A 2DBYA 3EIHA 3I8XA 4C9BA 5JSZA 1NLFA 3CW2A 1T3HA 2BM1A 3GLHA 5CIQA 4CW7A 1ANKA 2QSZA 2QEQA 1BKDR 2W0SA 1NVUQ 3Q5EA 2FFAA 4EQ6B 1LTQA 4M1TA 4OK6A 5CIWA 4ZO4A 3CM0A 4KSBA 1Z0KA 1QVAA 2GJSA 4GP7A 2WMNB 4HZUB 4II7A 5JJKA 3QKRA 4CRWB 1Z08A 1ZNXA 4ILEA 4B3DA 1DADA 3DDCA 3QXCA 1VG0B 2GCOB 2ONKA 1AM4D 4QFMA 5EUMA 2GF0A 1XCPA 5KPJA 3QF4B 3VAAA 3TE6A 5FFMA 1ZUIA 2GJ9A 4M9QA 4ZIRB 3T06B 2W6ID 4FXPA 4TTRA 3K70D 5IF9A 2VF8A 5C4GB 4FMDF 2RAPA 3U4QA 3GLGA 1RZ3A 2CCJA 3P27A 4BLSA 4Q4HA 3KB2A 5FTMA 1B23P 3U5ZB 1YE8A 2QL6A 4TQ9A 1HQYE 4I1VA 3RS3A 2VP0A 3VU9A 2EQBA 4OK5A 3I73A 4ON9A 3V4FA 2G77B 2VTKA 2FFBA 4M1WA 3L8YA 4Q7MB 1RRGA 2QNRA 3SFZA 4GOKA 1D8TA 4GPTA 1Z0DA 3KXLA 4B3FX 3DVLA 1IXZA 5EP3A 3EWSA 4XWAA 1CJUC 3JZAA 1T3SA 5TB5A 3EZ6A 4EAQA 3DZ8A 4DHEA 3HU2A 4MRSA 3TW8B 1R8QA 1I4DD 4V03A 3TW4A 3AQ4A 4JS0A 4PTLA 4BFZA 1G1MA 1QZXA 1T0JB 3AP3A 5IDVA 3ZGXA 3TK1A 3PEWA 1G3IA 2G9NA 1LY1A 3E2IA 1VIAA 2V3CC 3CONA 1E1RD 2E9SA 4D2IA 4EUNA 4NBSA 2XTZA 4HUQA 2GXAA 2BBTA 1ZM7A 3D7MA 3ZD6A 3FWYA 4IFBA 2V1UA 4OJQA 4DZZA 1GSIA 1U8AA 2OM2A 2PBRA 3B9QA 1ESNA 3BXZA 4LBVA 3NG1A 4W5WA 3NH9A 3V4RA 2FSFA 4AURA 1II8A 1KO1A 1NLYA 1OFIA 5JEEA 1UKZA 3ONWA 4C7OA 2V1XA 2ZTSA 4L8GA 4QHTA 4LV6A 1QDEA 2MMGA 2PLRA 2J3EA 1XNJA 1CS4C 2R6CA 3SEAA 4AYXA 1BMFA 3K09C 3ICEA 3SC3A 2XB4A 2WKQA 1W1WA 2C9OA 2FGKA 5A5GA 3CF0A 3W8RA 4G1UC 4A36A 2IYTA 3U6KA 2WWHA 1E0KA 2ODBA 2GEDA 4QJ4A 2MSDB 2W2TA 1SVKA 3UXMA 2R8RA 4FCWA 2FPLA 2FF7A 1W4RA 2WKRA 4TL8A 3MFYA 3MGCA 4PQFA 3DM9B 4Q7LA 4FW9A 3TIFA 3WNBA 1Q1QA 3MWLA 4EPRA 5HPYB 3A1VA 3LX5A 4QBGB 5EJEA 3RWMB 3VNUA 3VKHA 2GJKA 5CLQA 3U2QA 2FG5A 2IT1A 4XD7A 4NONA 4NCJA 2QGNA 2GWHA 3BE4A 5JCPA 2BJVA 3ZD7A 4UNQA 3VR6A 4PO8A 1M7GA 4MUBA 1KAOA 1NVVQ 2I1QA 1TX4B 4TL7A 1G7RA 1LS6A 1NMYA 4JVNA 4NYJR 1ZC3A 1FTNA 3B1YA 5CJ2A 5FH9A 1SXJC 3BFKA 2QU8A 2ZU6A 2VP4A 1T8TA 3U7GA 4OQFA 3ZIAD 3A58B 3IIJA 1E9CA 2CK3A 3ZIAA 2ZVQX 5L3RA 2CK3D 5K8LA 3TQCA 1L7VC 4US2R 5CB8A 4AIIA 3QBTA 1VKJA 1F2TA 2D2FA 3BC1A 5AJWA 2CHGA 5TY0A 4Z8YA 4B3BA 4EPXA 4F4CA 2DPXA 4AD8A 5E3HA 2IS1A 3B6EA 2JASA 2XOKD 4LHZA 1KDTA 4BPBA 1NY5A 2ZSEA 4ITRC 1CRQA 5GJBA 1PLKA 3HYTA 4NCHA 3IIMA 3B13B 1FQKA 2FWRA 2YWEA 4RCZA 3FTQA 2BCJQ 5BYKA 2PMDA 1UBEA 1VMAA 3W6NA 1OFUX 2G1JA 1ZBDA 4B73A 1N5IA 2BHRA 2V6JA 4TMZA 1X1SA 1KK1A 2F3TA 4LYFA 2CE7A 1FUKA 1E4VA 1IAQA 3LQRA 4V0MA 4OHVA 1R5BA 3SYNA 4B6FA 2N42A 5FTLA 4XH9B 3TMKA 2GHIA 3CH5A 2PCJA 4M9SA 2PLFA 5KUTA 3QY0A 1G21E 5E95A 4JVMA 4QG7A
chains in the Genus database with same CATH superfamily
4JCCA 1RLOA 4CL8A 4O4HB 3LU1A 4RE6A 4NOLA 2W6MA 1AKVA 4JJ8A 3WZLA 5I6DA 3ZCTA 4ZT6A 1E4EA 5TQ2A 3ORRA 1CQJB 1Y3HA 3VSEA 2Q5CA 2SICE 2DSNA 1SULA 3BRWD 2VF4X 4MYDA 2TECE 4MQEB 4QO8A 1Z82A 4CQLB 5GONA 1TEVA 1V5WA 3ENQA 1OYVA 4CDGA 3NHSA 5TMEA 1D1QA 4DOMA 4D4MA 4P4GA 3A3YA 1ESDA 3I04A 3FR7A 3LUPA 3MVEA 5U4XA 4HUJA 5HK8A 1YJCA 1MCZA 2V4ZA 4RV5A 2D2IA 1P8AA 1KS9A 5CM9C 5FUBA 3D1JA 4IDNA 3U48A 1XVUA 3RRXA 4CM7A 2REQB 1YRYE 3KTAA 1PUIA 4AUEA 3GLGB 1OQAA 1CP2A 1L4LA 3RLFA 5JV5A 3GLIA 2DWQA 1JW9B 4IMPA 4EBBA 3C74A 2PL3A 4R5MA 4TTAA 4MWSA 2BGKA 4UTPA 5JYBA 1DRJA 1Z4KA 1N2JA 1E94E 4C0HA 4CT4B 3IDAA 1ZL0A 1KMHB 4CMEA 1YDHA 2H1RA 4P7JA 1PS0A 2IIQA 4G3XA 1GKLA 3C97A 2YMQA 4OXYA 5I5GA 3DHEA 5TQJA 1U7UA 4NLLA 1EK5A 2ZRMA 2WIDA 4B6PA 5C1OA 2ZI4A 2ZE5A 1GRQA 1TYCA 2FTKE 3OPMA 3QJYA 5ETJA 2PV7A 1PYGA 2ZUUA 4IDCA 1ZM3A 3ERCA 3SY8A 2Z8YM 1XZPA 2IEYA 1EGVB 1AY0A 1UPAA 3K0CA 2FW0A 2FVXA 1HE4A 4FJ2A 1EA5A 4ZCSA 5BUCA 1IOLA 5AVTA 5CP8A 3Q3CA 1NASA 4KXVA 3TINA 4G5SA 2BHLA 1W2WB 1EGAA 1NZFA 4YJ3B 2LD4A 4GU5A 3FPCA 5AQ1A 3GV0A 3GAZA 2ST1A 2ZUSA 4IH1A 4KAXA 1J23A 4L9WA 4PLWA 1PD0A 1RMYA 4G26A 5DGXA 3ICCA 3ZPXA 1CFZA 1D7AA 2BEVA 2PKRA 3BJRA 2QIPA 3LXUX 4TMKA 4V0RA 4LMPA 1MZPA 2WTUA 1RWVA 4MRNA 5EMKA 1NP7A 5A2QA 5EHQA 4JI6B 2IW3A 3FMVA 4L7QA 1N6IA 4B79A 2JAQA 3SM9A 4HP8A 4XB1A 3T12A 3I61A 4CKWB 2DJ5A 4YCCA 1IG0A 3JQ6A 3JVUA 4BNNA 3K94A 2BI8A 3KEGA 3DMGA 1JWAB 1U3UA 1VC2A 1N0UA 3RRYA 5LJIA 1SUPA 1YU9A 2ZT6A 2W8ZA 4I55A 3PDIB 2O5CA 2JJMA 1KZHA 4BO3A 1NVDA 2WU4A 2NW6A 4M0UA 3ZW9A 3QFFA 1MHTA 2CF5A 1U4NA 3E18A 3FYDA 5F3WB 4UJ5A 2ZB2A 1G3MA 1P9NA 2DP4E 3DLPX 3N0WA 3PWZA 4M8SA 1GNPA 1C7QA 3DFFA 3WWZA 3U3XA 2Y3IA 1UBFA 2C2XA 1KERA 1JDJA 2EQAA 1AC5A 1MFZA 3RJZA 2CJFA 3X1JA 5EJAA 3CTPA 4QYSA 5E6SB 5KQSA 3SSOA 3BEOA 1HI9A 3A05A 2NPOA 4NCNA 5EJMA 2DFKB 1T43A 1PCXA 3U5TA 3HYLA 2Q3MA 4H31A 2PT5A 2W2VA 1TD9A 1Z4OA 2J3HA 2OAP1 3AUSA 3C5EA 2VDKB 4HYYA 3K6SA 4B6EA 1ISHA 2E4XA 2JCXA 4GKBA 4UAVA 4UZFA 3ETNA 4NOKA 2ZIEA 1NI4B 3E7FA 1BDJA 1KI8A 1MF7A 1NQWA 3GFGA 4PPFA 5EQTA 1RKXA 4U7JA 1AB6A 4YPOA 2Z4SA 2A5LA 1UWCA 1GCOA 4J0GA 1OLSA 3DAOA 3Q11A 1W581 4E5PA 3EDYA 1QBGA 2H9YA 4NE9A 3JAWA 2PQ0A 2W42A 4CZ2A 4HBZA 4HB0A 1VHTA 4FS3A 1URPA 5FBRB 1DV1A 5EMNA 1B1CA 2VUIB 3EEFA 3OSZA 4C5AA 1HF3A 2QUJA 4N7BA 4QJ5A 3LUBA 5EWMA 2EBUA 3F73A 4J7AA 2XZLA 2B2CA 2C4HA 3KYDA 3MOSA 3HCDA 4G24A 4J0CA 4WL0A 2ZBQA 4ZVOA 3P9QA 5EHZA 1I6MA 5DFAA 3PFHA 4BIMA 1QDUA 1RE0A 2P2CA 2XDQA 1PQPA 3A1TA 3C5HA 2EGGA 2GK4A 4HQOA 1E8DA 1XE3A 2VAVA 1OYOA 3GDHA 3F1LA 3I4LA 1Z75A 1KWGA 4NBRA 2W70A 4BNJA 3PIDA 3AK4A 4X41A 2HF2A 3N0VA 4KMMA 3VPFA 3CLHA 5CA0A 1LDMA 2A1TS 2ATCA 5DYIA 4B1FA 4E7PA 3UV3A 4FGWA 2P3SA 1E2PA 2QRJA 5C52B 4UHDA 5ELXA 4DA8A 1FJHA 1X1CA 1BGWA 2JBAB 2JGDB 6REQB 3NBZC 4GMGA 1WPQA 2YV1A 2AHRA 1ZM9A 1OX4B 4FYYA 2WMOB 2COKA 3KJIA 2XSZD 4AQ7A 1IK6A 1J9ZA 3RS2A 5F9FA 3IAHA 3DNFA 5ADWA 5DHQA 3L6CA 4EZEA 4H2DA 5JARA 1T8PA 3ZBUA 1E2BA 4BASA 2AFRA 2BEVB 1DIHA 3W8FA 1W2HA 2A9RA 1FS6A 1UJ6A 3CH6A 3I2KA 3VR6H 1I6LA 2FKNA 4Q4AA 5IJ0A 2UZAA 4QT4A 3TM4A 1R9MA 1THZA 4GF5A 2FSVC 1YC2A 4FZ5A 2DYKA 4YONB 1VYVA 4EHIA 2Y0DA 2FLVA 3LOUA 1WXFA 4HKTA 3PC6A 3ULKA 3OD5A 4DDWA 4QFDA 5BSWA 2OBNA 5B7PA 4GECA 3WDMA 2Q4DA 2QT1A 2OAEA 1P33A 3V8PA 2CFOA 1KMIY 1MN6A 1MIHA 1OW3B 4ZYXA 5C8XA 4W5TA 4MUXA 1JEOA 1TE2A 1GQQA 2PAFA 1UXIA 2C3PA 4YRSA 3DLHA 4A6XA 2QW8A 2AN5A 4ZQIA 1ESZA 2FFRA 3EFHA 4N3CA 5T67A 2HRQA 3QW4B 3V2IA 1PVVA 3ELBA 5JCZA 1ZGCA 4RKQA 2H4JA 2ZYVX 1C3VA 4QD3A 4ZXPA 3ZEIA 2X22A 2JLUA 1H1DA 5ECYA 4B34A 3P0IA 4FQ8A 5HIIA 1KIMA 4LZJA 1S1MA 3A4MA 3DYBA 1R9GA 3D6HA 1YOVA 4KQMA 4EYSA 2DWPA 3CCCA 2N1BA 5C81A 3WRVA 2B82A 2OENG 3KBBA 1K98A 4KSCA 4JP5A 4QOHA 4E30A 4JMPA 1Y6GA 4JI7B 3BMNA 4DA7A 3S81A 3KTAB 2XBMA 4IZHA 1N57A 1SUWA 4KVZA 1XMVA 2H52A 4I9UA 1ZM4A 4QXOA 4BAUA 5KNCD 1XBTA 5FX2A 1X2EA 4CDRA 8GPBA 5EIHA 1Z5ZA 4ZVTA 2IBMA 5EJ9A 4PSAA 3UBTA 1HA3A 1TVEA 2OYSA 3SQOA 1JR6A 4RFLA 4IJ6A 4X64B 3R0VA 2NIPA 3ZDYB 3LPAA 2NUAB 2HSJA 3L2OB 1BJKA 2H4HA 4X6UA 3HBNA 2EBHX 4IVNA 4XIGS 2ORVA 2WZCA 2VZ9A 1JDTA 1WUIS 1F20A 2NO1A 2EP5A 2CDNA 4IJVA 4ZZ3A 4HLDA 4OJMX 2BZSA 1IDN1 1MEEA 2NYRA 1RWKA 2PGLA 3C8UA 4MWCA 3ROGA 4C4PA 5AYVA 2ZT8A 4D4LA 4L7VA 3VSAA 5JLAA 2JKYA 1NLZA 3AXSA 2VI5A 3VKGA 1N2CE 5K20A 4PIMA 5HFAA 3O21A 2F4NA 3I23A 3HR7A 1UDAA 3OX3A 4DR6B 3SVZA 2E4UA 3CX4A 2BZ1A 3G9UA 3DLBA 2HSZA 3ZU3A 4QUBA 1JEQB 2JJ1A 4L08A 2CD9A 3RRFA 4QKQA 4V2IA 2WIJA 3WTBA 2M6RA 2JI7A 4AJEA 4AJIA 1I2CA 5EMMA 5IVDA 1O6BA 1G9TA 1P0CA 1XJ0A 2AA3A 2VWPA 2XGMA 3NIFB 4BLTA 2A3NA 3AX6A 1GTJ1 1X9GA 4W9NA 2EWVA 1SIWA 5KOHB 2QYTA 4HWOA 3KSBC 4GPEA 1LBEA 1P1BA 1NUTA 4RMNA 3QVGB 3IESA 4DS3A 3P20A 3BB3A 4P3OA 1IHXA 1PG2A 2BGTA 4RTLA 3LYAA 3KQKA 1O8CA 4NK5A 1EE2A 2WILA 4D4IA 2QP3A 3HI4A 4B3GA 2D8AA 1OVGA 4KVFA 3BF8A 1BWQA 4YRJA 2ORYA 4PWZA 1JBKA 1KO4A 2HUPA 4XYMA 5DM4A 1O9GA 4KKXB 1HMPA 3ZNNA 4F6LA 3W7AA 2VDLB 4RF2A 4LPSA 3LCRA 2GBPA 5L3ZA 4BAZA 5KVVA 1QPZA 4HTAA 2ODNA 2PUAA 1L4MA 1ZI6A 2AFIA 3HH8A 2XCRB 2RHMA 3G8CA 2FETA 1VZ2A 3IKVA 1P19A 4UKDA 4YMWA 4CM4A 3PQFA 2QM0A 5JJLA 3ZW7A 4YAJA 2ZIFA 3AIKA 3E6AA 5FL7A 2I87A 5KYUA 1FFAA 1NVAA 1R4AA 2AS0A 2G06A 2ZYUX 3MMZA 4ATNA 4DIMA 4A0SA 3TOZA 1OGJA 4DQKA 3M5DA 3R7SA 5H3LA 1WZNA 5JSFA 3ROMA 5AKGA 3BK2A 3EWNA 5KDOA 2G9VA 3HL0A 1JHXA 1ZH6A 2HSWA 3IPAA 4PBSA 3UK2A 1GGNA 4EA6A 1DFIA 1N5RA 5FTJA 1GITA 1U90A 4BNIA 3N39C 2PZLA 3KXPA 1GDHA 3CSDA 3O9VA 2RK4A 1Z0AA 1WB9A 4WESB 2H2IA 4L57A 1DX6A 4LHVA 3I8SA 1YVUA 3T9FA 4EHKA 1YUMA 3QEOA 1LA2A 1PYDA 1CQJA 2GEBA 1T5SA 2A8YA 2YBDA 1WDTA 3A2NA 3U1VA 2JKVA 3HKEB 2NP6A 3GLFB 5EIFA 2JDID 4EHFA 4MULA 2JIRA 2FEOA 3SBOA 3MCWA 5AHXA 4LRWA 4ROSA 1ETUA 4CHGA 3R0IA 1DIBA 1Y4DE 5B3JC 1JI3A 4B7UA 3BKWA 4NFSA 2C84A 2VH2A 4MV0A 3SJZA 4FLMA 4IPTA 2HB6A 4IX9A 5FBLB 1QOZA 1FUIA 3BJIC 3U4CA 3V3TA 4C3VA 4LUCA 3D6UA 1LFAA 3V32A 1SD1A 2QZPA 3MT0A 1RQLA 4QHSA 2B5VA 4UREA 2HKIA 3KFLA 4OAQA 4BQOA 5IPFA 5D6NA 4N01A 1T34A 2FU5C 4A0FA 3HKDA 4FZ3A 3MWJA 4W5OA 3GA0A 4IGKA 4PXSA 1H2RS 4KBGA 1DT5A 4JASB 2BR5A 1S8FA 4LIPD 3DTVB 3IQWA 1KVSA 2NNWB 4Q19A 4C6SA 3CF4G 4K40A 2W6CX 4S35A 3B9BA 2Y05A 2H7XA 2P9FA 1GUZA 1TO2E 4CKXA 1KO5A 4QTUB 2UYQA 1QK5A 2CZCA 2NSJA 3FIJA 4KLRA 2J3IA 4MV6A 1RFGE 3VBCA 3VNBA 4ZN6A 1ZN2A 2P65A 1KMQA 2F3SA 2VWQA 4EABA 5KTTA 4M4SA 3UMGA 5JBNA 5KC9A 1DVRA 1A69A 5JZVA 1BS2A 1NIPA 5AKZA 1CDOA 3EN0A 4RCVA 2QSYA 1Y8QB 2XA1A 1XAIA 1XQYA 1SCIA 3AUFA 3BFJA 4OI2A 1XTJA 4Y9SA 1M34B 1YDMA 3VUEA 3R8FA 3R0QA 2EF1A 2NYAA 3OKCA 4W63A 3WXBA 5JXHA 2VAWA 3EIQA 4O8ZA 4CUZA 4MKGA 1R0ZA 1KZ6A 1WQ1R 1FFBA 2WHEA 3WP1B 2QJRA 2HJ9A 2YY7A 3F7TA 4MI3A 4D0LB 2WJ6A 4DREA 1C4WA 2X0DA 3K9FC 3PRKE 4R8SA 1MOPA 4UU1A 3OH8A 4H3HB 4DJEC 5BNIA 3QG5A 2LDBA 1XN4A 4I46A 1SU6A 4NYMQ 5ULLA 1E1QA 4Z1MA 4POAA 1AMNA 1GPH1 5SZKB 2BR4A 5HZMA 4EAAA 4J9UE 4CM1A 1I5RA 1JSZA 4RWZA 3IP8A 1G38A 5KWEA 1RYBA 2HJVA 2JLRA 4ED9A 2I8LA 3IJEB 5DTRA 1W73A 2FPXA 3QTTA 2G70A 5FPKA 1M0TA 1FNDA 1MX9A 2YWXA 4GLOA 5CM8B 1YZKA 3EZ2A 5KYWA 4LXQA 2Z09A 4KXQA 3AF4A 2JCBA 2GRUA 2R00A 2VDRB 3OCXA 4GYWA 3IUSA 1JA1A 1XO1A 1ZLXA 5T6MA 3EWAA 2MCFA 3VPXA 2F90A 5A06A 3DBHB 1KGDA 3DGFC 3CZ9A 5FLXA 2A30A 2QTRA 4M8IA 1GL9B 1QH1B 5ALPA 3TLGB 3TR5A 3O2JA 2D0DA 4XQEA 1NTRA 1NW7A 1XZLA 2QR5A 1G64A 3LF2A 2R8OA 3GD5A 4U2DA 1FJXA 2B8WA 3NQ41 4MRPA 3PDJA 3PFIA 4HN9A 1RXIA 1CEXA 4GH5A 4ZYWA 3OTOB 1AO3A 3JR3A 3L8EA 3O2NA 1J2RA 1LRJA 5K0TA 4HWRA 3GUYA 2PLNA 3I2GA 2QX4A 4IWXA 3DB1A 1US8A 4KRXA 3TQTA 3SDSA 4KHZA 4M0EA 4BNGA 3ZS8A 1ORTA 2UV8A 2ZK7A 3MJ4A 3PI7A 3QFSA 3U7EB 2CHVA 5E4YA 2GEKA 1UK8A 2Q3LA 3RFVA 2WT9A 1OLSB 4QQKA 4TT3D 4WKOA 4C2UA 2B98A 4ZYUA 4ZQHA 3RSHA 3SR4A 4FT4A 1DLIA 4KJZA 2F6RA 2RG7A 3UKJA 4YCDA 5KQPA 1YI8A 3KQOA 3H4MA 3N6VA 4LWPA 1A5ZA 5AK0A 5A5EA 1FJGB 1NJ5A 3BXEA 3KT6A 3DWFA 4CLRA 3TCNA 1JSCA 1TFRA 1QVVA 4B7ZA 4ZV9A 2AVDA 1DG9A 2OO5A 4FR0A 2BFDA 4E5NA 2VAXA 1JIIA 1N6HA 3QEMB 4TUYF 4GLFA 4FEGA 1TK3A 3S55A 4B2PA 5KTYA 4DWWA 1E2GA 5JECA 2ZATA 4MW4A 5BPFA 1TUGA 2XE8A 3QUAA 4W99A 2JFGA 3M6AA 5CUQA 2HL6A 3ELUA 1E18A 5C7LO 3EEOA 2CEAA 2RI1A 2ADMA 4YRNA 3WK4A 1AG9A 4JLPA 4DUGA 3HO8A 3I1YA 4GAEA 4KDCA 1FA9A 2VJYA 1V11B 5H83A 1F4VA 2WUWE 4JL5A 4MWBA 2DY1A 5I9NA 4ZXFA 4F7DA 2IGBA 5LQCA 2VRNA 4PPNA 1R5JA 2HN9A 2O5RA 2V3WA 2VHQA 3MBKA 3C70A 3HYRA 5ARDA 5BSFA 4Z4IA 2M98A 1M0WA 1NF2A 3O1IC 5TQVA 3TTUA 5DLQC 2W2XA 4IIFA 2R79A 1KXZA 2D1QA 2H1WA 3BWCA 2NYVA 1LJUA 3WNCA 2H06A 1F9AA 2C20A 5AIAA 1AV7A 1S9DA 4C4ZA 3U16A 1RWQA 3SXPA 3PDHA 5D86A 1TEXA 3RLIA 2O7RA 4MPTA 3DEYX 3GGSA 2ID7A 1E5LA 4Q7JB 4ZO9A 4EX6A 1R4ZA 4NZ9A 4EUFA 4PGHA 4CFZA 1UMKA 1USIA 1X14A 4Z0PA 3ZCPA 3D3JA 4XOUA 1DSSG 3TGLA 4JCOA 5KNCA 1V4NA 2J7PD 3BMCA 1C3OA 1GA4A 1JMVA 3ONFA 3I45A 3TEMA 1XZFA 1L5QA 2QE7A 1RYMA 4YAUA 2JGAA 1QMGA 3WAKA 4K9PA 1B14A 1Y3CE 5J47A 4ZEVA 2H2AA 4Z7OB 3I6QA 5JJCA 1C7FA 4DLWA 4ZJUA 2JA1A 1V26A 3HFJA 3MHPA 3O31A 4N8SA 5JO0A 1SB9A 1KJYA 4IINA 3G9QA 1KAGA 2P9BA 1VJCA 1OXXK 3R23A 4QFBA 4EGAA 3WP0A 1APBA 4XGKA 2WF8A 2ZS9A 1VRWA 3L4JA 2X4LA 3IP1A 3KUUA 2IYPA 2WNSA 4Q3KA 4IS3A 3S6JA 2YNMC 4I1UA 2XQKA 2KJQA 1MPTA 2BKEA 4WZBB 3IMCA 1QIFA 4G5FA 1I4EB 3ZJTA 3CY6A 2COEA 4LCBA 3CLTC 5JS6A 4JGIA 2FLKA 4HJXA 1GADO 5DGTA 5ANRB 3EZYA 3RHFA 4KDRA 2GHRA 3I9KA 3NUGA 1A3CA 4MJLA 1NDQA 3KQSA 3G13A 4L85A 4Q4LA 5AI5A 2R00C 1QFMA 4AO6A 8AT1A 4YP0A 3QSGA 1XF1A 3Q3JB 3U0BA 3ZHTA 5C53B 1BX1A 2C8KA 2I99A 4F06A 4HYQA 2VUUA 3DDWA 4GX1A 4I4TF 4UEJA 5E7JA 5AW3A 1MZVA 1ZD4A 4HQFA 1FDSA 3O3OB 1EK2A 2JZNA 2H3HA 4A36A 1OBHA 1CUUA 3A9VA 2RHHA 3UAOA 3IEKA 3UHAA 2W93A 4UNSA 3GZTB 3UJCA 4C3UA 4ZQCB 2IOQA 1Y89A 3A3PA 3NBFA 3E5RA 3PJFA 5LR6A 3MIZA 4LRTB 1GZ5A 1JEYB 1SVLA 4KYUA 3B1ZA 4Z0NA 4PQGA 1G18A 2Q1TA 2YINC 3PFNA 4HMQA 4NTZA 2FOLA 1HO3A 2WG1A 4RXUA 1XDSA 3U4HA 3Q7TA 1BFKA 4IKPA 1E3WA 1I4OA 4LISA 1DQPA 3SR0A 4NEQA 4RSGA 1ESCA 4US1R 3ICQB 4KQEA 4WOCA 2D0OB 3IQIX 2WIAA 1OXKB 2BFFB 1WCIA 4I5IA 1VPTA 5ENDA 4KYIB 1T9AA 2GCNA 4DCPA 5DEOA 2VQ3A 4RU1A 1CZRA 5DOVA 4ENTA 1VL6A 3QX7A 3C3WA 4MNTA 4BNLA 1XC7A 1P31A 1V8PA 3NT2A 1U94A 4QULA 3UMJA 2C9CA 1M2WA 3JWEA 5EWJB 5IBCA 2CNDA 4ZGWA 1I13A 2RGEA 3ITEA 3N7TA 4O4IF 4R7ZA 4HBGA 3LECA 3VX4A 1UXKA 2AQIA 2FHSA 4DF3A 5JSYA 3RVSA 1UJBA 3K1AA 5KB3A 3LCVB 1DBWA 4Y2HA 2G1KA 4FDUA 4BZZA 2VP2A 3PGJA 4R68A 4F60A 1KZGB 1I4WA 5BMVF 4LF5B 2N47A 5KWJA 4B35A 3THWA 2OM6A 2EKLA 4OQNA 2HCBA 4Q34A 4QECA 5EUQB 3NV9A 4JX8A 5DB4A 2EX1A 2PVCA 2R4QA 4Q4JB 5BW5A 1KEEA 5ALVA 1Z4NA 3RD5A 3QVKA 1RR6A 1L4HA 5BVGA 1M8FA 1TO1E 4ENQA 4FD2A 2GUGA 2O1WA 3QVVA 1MA0A 4HX2A 5CFNA 1UBRS 2VEOA 4ZKDA 5KJCA 1DQYA 1OBVA 5FUQA 1KAMA 1G9XA 4NBWA 1QE3A 4MGIR 4P0QB 1QNFA 1GZ4A 221PA 1KK0A 3FZYA 2NYUA 4C88A 2QGZA 1ADGA 3HSKA 1Y8CA 2FEXA 2VQFB 3N07A 2FWNA 2ZQYA 4LDAA 1AJEA 3WNVA 2PGOA 5JZSA 4QOEA 1QWSA 2P79A 4PO9A 5I3CA 3T1HB 3A0UA 2O8EA 4KR9A 1QIDA 2V7VA 1H69A 4BFUA 3JQ9A 4L9SA 5CEFA 1G8MA 4MITA 2IYSA 3ZGYA 1JFSA 4QUKA 4ZARA 3TXYA 3ZCVA 1CXZA 4YUWA 4R9RA 1M10A 3FG9A 3EPLA 3VR0A 1JG7A 1KI7A 3D81A 4G9GA 1K6MA 3RIEA 1E3TA 2LE0A 3GJ6A 4WKPA 4J8PA 2NP7A 1N7JA 3UWKA 1U31A 1NHGA 2QAGB 9ATCA 1ISJA 1ZH8A 2K2WA 3O8OA 1GKKA 1W4BA 1YS6A 3HDGA 3IUYA 4TQUS 5C9ZA 5K6TA 2LCFA 2B4KA 4GZ3A 3H19A 3RUFA 721PA 2IEZA 3Q7IA 3LI2A 2YXBA 1RC1A 2JAOA 3MHTA 3EVFA 1MNQA 4FMCF 4KX3A 4QU8A 4GDMA 4FHGA 3R0ZA 1KTVA 1C7RA 2FQWA 3VSCA 4RHCA 1HYEA 3T4EA 5KTRA 3K0HA 1NKSA 4TS3A 4ZT5A 5ESRA 1COWD 1VGQA 5C34B 5LQKA 2P5SA 4OHYA 3IMFA 4MRRA 1KMHA 1BG6A 1RXUA 1BJRE 4KAAA 5IVIA 3PGA1 4C1NA 1R0YA 1YMQA 2IX9A 4REMA 2QTWB 1XJQA 3MG9A 4J4HA 3SD7A 3GEDA 2AR9A 1I4TD 3AVTA 4JSRA 3OQOA 1H2XA 4PLPA 3KB6A 3GLGE 3HK2A 2PT9A 1WXWA 2VVTA 3QKRB 4OYLA 4RUKA 3V55A 1FFHA 1YKGA 3ND9A 5FULA 3W2EA 4LOIA 2ZOSA 2XE4A 3F5QA 4K9NA 2Y1GA 4GPZA 3AVXA 2VJKA 1SQFA 3JATB 3S99A 2KE5A 5DOZA 3Q3EA 2ASEA 1IL0A 3JQAD 4FCCA 3UFXA 1UF9A 4TLCA 3ASYA 4URWR 2PYIA 4I66A 1P4RA 4YJ2B 2HBZA 2LVBA 3BSWA 3EOZA 1W34A 2V7XA 2X8JB 3UA4A 5F52A 5BW8A 2EEZA 3SKVA 2PKYX 2PYDA 3R7NA 5CM2Z 1QGUA 3KPYA 2FB9A 3N75A 4YUYA 3VR2A 5EZQA 4JLVA 1QGAA 4ZRDA 4FFVA 4X1YA 3RC7A 4I9NA 3FMPB 3VR2D 2PS3A 1Y1QA 1PSZA 1D4AA 1G21A 1A7JA 4CIAA 5ALRA 2D54A 3RWOA 1YBVA 1V9SA 2YYYA 6YASA 5JTUA 5JPDA 1F5SA 2PL1A 5K8IA 1VDMA 4Y9RA 3GJ7A 2Z56A 4YQYA 3CX8A 4EY8A 2X5XA 2IU3A 3D31A 1FP7A 4IP0A 1BW9B 1WULS 3PLNA 4O4HA 1EI9A 3KG2A 4LE0A 1W35A 2C8VA 1Z4JA 4EI9A 2W6IA 4C29A 1ULHA 3KKNA 1MW9X 3T7SA 3U39A 1MDFA 4QGBA 1Y6QA 4IXNA 4BTEA 4LC9A 3EA4A 2Z5LA 4Z4CA 2IHKA 2GCIA 5K3SA 3SMVA 4CKWA 5KQRA 4HAWA 4B75A 5U9CA 1HOTA 5F4BA 3TH5A 1JZSA 1U9IC 1FMLA 3L7KA 2X0EA 4PLHA 4KWHA 5ELLA 5C7IO 3TSYA 3AT1A 1YR6A 5AW6A 2HA4A 2MSLA 4BNXA 3CZ4A 3HR4A 1JYFA 1RI3A 2IEBA 2VA8A 3VKVA 2VJMB 5HNKA 2AOVA 3WADA 4DRYA 4L28A 2XHEA 3LTNC 5KSZA 3NWPA 5F7ZA 3ABSB 3OCJA 3ZBQA 4A4DA 4F6RA 4H3SA 1ZMBA 3KLBA 3R7LA 1W5TA 1XTVA 3V1KA 5KDLA 1OXVA 1XZQA 3VV3A 4UM8B 4K2HA 3SHOA 3A1WA 3R09A 1PTJC 4F8YA 3JYNA 3QFCA 3EC7A 5KYKA 1HE8B 4L0QA 1TVCA 3GJZA 2HMYB 1H4SA 3FPJA 2DULA 4L5CA 3DZIA 5DNEA 1NUAA 4G8BA 2Q7DA 4FQ5A 4BGIA 1RZRA 1D1SA 4GBED 5AHRA 4EA9A 3RGWS 4DLPA 2GN1A 1NRXA 4PLTA 4G0VA 1IOVA 1U0SY 2J0VA 3QEKA 4ZVLA 5L3QA 2QL9A 5CH3A 4YCJA 5DDIP 4HVLA 5F7XA 1TT5A 1QQBA 3NTOA 1X39A 3WL4A 3FGPA 1QYVA 3IQGX 5DKFA 3R76A 1ZRSA 3SNHA 3PIIA 4HATA 5LNK6 1QO9A 1XKLA 2V0GA 5ESWA 1JIQA 2O5VA 4OHOA 1DC5A 5I9LA 5DCLA 4KK3A 1XPRA 3AR2A 4MVJF 1F0PA 4XM1A 3ORQA 1N9GB 5KOYA 1ZZEA 4M1YA 2ON6A 4TRMA 1HL7A 1QTRA 2NZJA 2XQVA 3Q72A 5AKKA 3FBTA 4OGLA 4D5EA 2HPZA 5B7NA 1KKUA 1GA1A 2QQ0A 2PX2A 2HD4A 2H5JA 2GYWA 3A27A 4B80A 5FQOA 1DP4A 1OGIA 3G0DA 4IZ6A 1HYGA 3L84A 4PZPA 3I05A 2ZYWX 3UOAB 4XPIB 1I7PA 2ZYIA 5DXAA 2VK8A 5AM5A 3L7MA 1P29A 1AQNA 3BERA 5DPMA 4DKXA 4PS0A 5DCYA 3PC8A 5FWAA 2QRMA 4D8UA 4F4FA 4G0XA 1TZMA 1WY7A 2GZDA 1X3LA 2J4DA 2RH4A 1ZKDA 2FQYA 3GJTA 3JARA 4W9NC 4D9JA 4DSUA 5HUJA 5HSGA 1EWQA 4ER5A 1T2EA 1BRTA 2OVFA 4NPAA 4F9GA 2IS6A 5B57C 4G8DA 3U56A 4RIIA 4X44A 4KXMA 3OT5A 4PZCA 4LYGA 4PZYA 1C7ZA 4NECA 1ZSYA 3L4EA 4XZ3A 1H0SA 1CS0A 4DGQA 2BIFA 1EGQA 2WZQA 3DWEX 3PS9A 1KI4A 2VEDA 3CF4A 4CMKA 5TIIA 3AKCA 3ZXXA 4QG3A 1LNZA 1WU7A 4LY3A 5KQLA 5DE3A 1T0IA 3UHOA 3W3AH 4J07A 4E08A 1RBMA 1F14A 2F8MA 4WKNA 1OI4A 2IELA 4ZI3A 4C4RA 2R1VA 3SEFA 1ZUD1 1I7QB 3BA1A 1XMOB 3A37A 1Y1LA 2JFQA 4RGVA 5HKKA 1K8YB 3IV6A 5L4SA 1K2VN 2JGLA 3KHKA 3IUEA 3PHHA 4HDAA 4L0MA 5AM4A 4BNKA 5H4GA 4KV9A 2FK8A 1PJ2A 1RQRA 1M54A 4HQ0A 2DX7A 3JQBA 4JXXA 1AUVA 3DZKA 3NT4A 2WOOA 3AEKA 2CXSA 2QZ4A 1YR1A 1W4CA 2ADFA 3QVMA 4GMDA 3SC2A 5HM8A 3KEOA 4R1LA 1EU1A 3NBUA 1DCFA 2R44A 1MX5A 1O0BA 3GRYA 2WHQA 2C92A 1K5DA 4P0PB 3DJYA 4MP6A 3RTEA 2IHBA 3OOWA 5G1PA 3GUZA 1ONBA 3T7AA 4M1MA 4V0SA 3T4UA 1NI3A 3NUQA 5EE9A 2WUVA 5FEUA 4B81A 1E5XA 4TXJA 3W78A 3IVRA 3ELYA 3BXPA 3IDOA 2EFGA 3KLMX 5D87A 3O3NB 3RF7A 1Z5NA 3W5BA 1OD6A 3S2EA 3WGHA 4Z86A 4ERNA 5JAPA 2ZWMA 5KHLB 2UDPA 1G7SA 4WFKA 3TS1A 1OH5A 2GEUA 4HH0A 4NC9A 1E2KA 3UATA 3I1IA 4ALMA 2W6QA 3O03A 5EXTA 2JIOA 1C0KA 1ULSA 1JUDA 5J43A 3KETA 2IS2A 1IZYA 1XK6A 1DWUA 3F67A 1GUFA 3G8DA 4HHEA 2I3GA 3L7OA 3NFYA 4OHBA 2FPOA 1KJWA 9LDTA 5LQMA 4BO2A 3IUBA 3H4TA 5LBIA 5ESXA 5JZOA 2FSVA 2AZXA 3IMEA 3LBHA 1CSEE 1JI0A 2OO7A 3IRUA 3SR3A 2JAHA 1CY4A 3ZU2A 5CDUA 3MTDA 2X5NA 2YWHA 2B99A 3KSZO 3RUCA 5TF0A 5LP6F 3DCIA 5A04A 4DILA 2AXNA 2OBFA 4DNPA 4BE9A 2BLLA 1Q0HA 3DVSX 3H87A 1VBNA 4B32A 4DXHA 4BXOA 1Z5PA 2CNNA 2O6LA 1AHNA 2OV3A 2GN8A 4MEBA 2OQRA 4LV5B 3SBEA 2HEIA 1TKRA 1DJPA 3NJRA 1V5IA 2ZWIA 2PRJA 5CK4A 5F73A 4HZGA 4XJVA 4PC7A 4BL5A 1QOPB 2PXHA 3UK6A 1B8NA 2OV1A 2QE7D 3K2IA 1AKTA 1ZXLA 4FYXA 4JBYA 3T4PA 1A8QA 4P35A 3H2KA 4DIUA 4NARA 4IYRA 1P0MA 2C7GA 4JWKA 4A5OA 1QH8A 1FP1D 1KI6A 1O2DA 4EG1A 8ABPA 4NR0A 4AKGA 1WE2A 1JEJA 5FI0B 4WFJA 1PT7A 4AN4A 1BH6A 2AV6A 4M9ZA 1YONA 4S1PA 4XFKA 4BGVA 1I3KA 5ED0A 2CD7A 1N6LA 2H7VA 2YUIA 4I5GA 4TT3A 1U0JA 1XNHA 1SFRA 3A6HA 3EY9A 4MGHA 5IJXA 4XSHA 3RSZA 3T5CA 5LM3A 2B6HA 1DKOA 1DKNA 4TVSA 3QV1A 2QLJA 2NO5A 1SUCA 2C2KA 2WFAA 4ZVNA 1C4XA 1Z3IX 2DBQA 3HJTA 4NAUA 4RHTA 4TZ0A 5J4YA 2PU7A 4CF5A 3LVBA 1QIEA 3WR5A 3QM1A 4F93B 5IEBA 2QRHA 4UCQA 1CS0B 1XXHE 2X9GA 3RR2A 3T38A 3X44A 4C14A 3U61B 3L7BA 5DTJA 1E3MA 1U8ZA 3INYA 3IEMA 4QHYA 1EBUA 1XTKA 4BU0A 1VKHA 1C9YA 1QG4A 1XCBA 1Y1PA 4ZVSA 4CIDA 2PT7A 1E7YA 1NI5A 3ECAA 3FSGD 4J1QA 4JVSB 2VJNA 4OOFA 4F8JA 4D8WA 3K1JA 2AZTA 3I37X 4PG7A 2Y4NA 1CUSA 2JFHA 4C6TB 2ODWA 3DCJA 3GJ0A 3ISJA 3GF4A 4FSXA 1IN4A 2OFWA 3LJKA 4LXUA 4R6WA 1R3DA 2ZWPA 4HTFA 1QHYA 4PZDA 3ZQ6A 2JGIA 3KWLA 1VCMA 4EVQA 3HO1A 4HGZA 3SS9X 1F06A 2OAGA 2P68A 5DM2A 1SWWA 5TMPA 1E1MA 3OEED 4P36A 7ADHA 4I1RA 4L5BA 3B3FA 1P2SA 3AEZA 4LX8A 1JJVA 3DL4A 1EK1A 3FI0A 2JGEA 5FPPA 4C5BA 4BP9A 1AX9A 1Z2AA 1Y34E 2QN6A 3OQ6A 3EDQA 3EEBA 3OT4A 3HRIA 2V97A 2O2SA 3QHPA 4A1OA 1O6FA 2QY6A 2VRCD 1S2GA 1QONA 1GNLA 2QVYX 1KETA 4K86A 4URUR 2PS1A 2D5BA 3JWPA 3PE6A 1FMTA 5HJEA 3H1AA 1QS0B 3E03A 1YE3A 4AQDA 5IAAA 1UANA 4UUBA 4WOJA 1BU5A 1G8GA 4FPXA 2PS9A 2NZWA 5A7GA 5IUJC 2XUHA 3ENNA 3PB3A 1PD1A 3H99A 4ZQFA 3L06A 3T0GA 3VNQA 4AVYA 1GAWA 1NUUA 3RK1A 4MS4A 3MILA 1Z26A 3QLUA 4JYPA 1AK1A 3A0RB 1KSHA 4GXRA 4GNKA 1H3FA 3SF0A 1Q3HA 5PNTA 2FUEA 4KI7A 3KQPA 1M5UA 4DWOA 1P2VA 3OOSA 5GV8A 3B12A 1ZMXA 5L4LA 3JATA 3QLJA 4R16A 1EVQA 2UAGA 4F4DA 1GFWA 1WDWB 5FOXA 5EJ4A 1BEZA 1B8UA 3M3PA 1D2MA 4IW3B 4DMLA 1YGYA 3U4DA 2ZUEA 2CUKA 1DARA 4TUYB 5AKYA 2PPLA 5CJPA 2W2LA 3BXFA 4MYRA 5CU7A 3VPHA 1ZPDA 3IQEA 2RHGB 2GTPA 3FVWA 3FNEA 1TGYA 5CXUA 1A7UA 1A04A 5JUWA 3BT7A 1YD7A 2YY6A 3FOCA 2O3TA 3DSRA 1NC3A 3LL7A 2HLNA 5LSAA 4RY0A 4BMVA 1ZWLA 2RHJA 3DE0X 1CEYA 3A9CA 2ZXEA 4NICA 3REOA 5IAOA 2BGUA 1P6UA 3VR4A 3EAGA 3PUIA 1FXUA 1TQHA 2IUFA 5G0UA 4M0KA 1CUCA 5IT5A 3RAEC 1Q74A 2RGYA 2KI5A 2XUJA 3EGEA 4MR9A 1EUYA 3N0TA 1WXHA 2EFHB 3WO1A 3ET5A 1BIFA 3DT6A 2I9PA 2VA9A 4MB6A 4JI0B 2WTNA 4CM9A 3TL6A 1FCJA 1PFKA 5A4IS 5IYZA 3PDCA 3HLTA 3VC1A 4R3WA 5HUQA 4XPZA 3VTFA 3GJRA 3E5NA 4FTWA 1OUMA 1GUAA 2BH2A 1HKUA 3E9RA 2XEXA 3FRJA 1GILA 2VBIA