1ODJA

Purine nucleoside phosphorylase from thermus thermophilus
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
234
structure length
234
Chain Sequence
SPIHVRAHPGDVAERVLLPGDPGRAEWIAKTFLQNPRRYNDHRGLWGYTGLYKGVPVSVQTTGMGTPSAAIVVEELVRLGARVLVRVGTAGAASSDLAPGELIVAQGAVPLDGTTRQYLEGRPYAPVPDPEVFRALWRRAEALGYPHRVGLVASEDAFYATTPEEARAWARYGVLAFEMEASALFLLGRMRGVRTGAILAVSNRIGDPELAPPEVLQEGVRRMVEVALEAVLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Crystal Structure of Purine Nucleoside Phosphorylase from Thermus Thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 80
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2003-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1odjA00
4YO8A 1ODJA 1YQQA 1PBNA 3P0FA 4TTJA 3UAZA 3C74A 4MARA 1PK7A 1RYZA 1A9PA 1A9RA 2OXFA 3UAWA 3LBAA 1Z34A 1LX7A 1B8NA 3DP9A 3PNPA 1T8RA 5K1ZA 3KVVA 4R2WA 4YMLA 2RJ3A 1PR4A 1V45E 3TL6A 4X24A 3KU4A 1RR6A 1RXYA 4OY3A 3FNQA 4GLJA 1T8SA 3OCCA 3BL6A 1V48A 4NY1A 4GKAA 3FOWA 2HRDA 5F7JA 4TYMA 3OF3A 5F76A 1VHWA 4M3NA 4WKPA 2QSUA 1K27A 4MCIA 1RSZA 3OZDA 1XE3A 4TXMA 3IOMA 4LKRA 4WKBA 1JDVA 1YRYE 4TXLA 4LDNA 1U1CA 1WTAA 2OC9A 1YQUA 2A0WA 1A9SA 4OJTA 1TGYA 1I80A 2IQ5A 4GLFA 1V41E 1JYSA 4D8YA 1RCTE 1B8OA 2B94A 4DARA 3E9ZA 1Z39A 3KHSA 3FB1A 4DABA 1SQ6A 1NW4A 3BGSA 4TS3A 1YBFA 3DJFA 1Z5NA 2PGAA 4OGKA 1Y1SA 4QAQA 4NS1A 1JPVA 3OPVA 4LNAA 2Q7OE 4F3KA 4K6OA 5IU6A 2I8AA 4TTIA 4G89A 5B7NA 3UAXA 3EUEA 1T8WA 1LVUA 5ETJA 3U40A 4D9HA 1SJ9A 1Y6RA 1JDTA 2I4TA 5I3CA 1PKEA 5F7ZA 3O4VA 1PWYE 1G2OA 1Z5OA 1TCUA 4DAEA 3EEIA 4DA0A 1PW7A 4DAOA 3BSFA 4RJ2A 1V4NA 3P0EA 1JE1A 1ULBA 1N3IA 2XRFA 4DANA 3LGSA 1Y1QA 4WKCA 3DPSA 3GB9A 1OTYA 1A9OA 5F78A 4LNHA 5KB3A 1RT9A 4YNBA 1Y1TA 4M1EA 3PHCA 1T0UA 4JWTA 2QDKA 5EPUA 4GMHA 1CG6A 3OOHA 4QEZA 2GUWA 5JPCA 4L5YA 1Y1RA 3PNSA 1Z35A 1LV8A 4D8XA 1RXUA 3PHBE 1JE0A 4PNPA 3D1VA 4L0MA 4QATA 1OUMA 1A9QA 1M73E 4TXHA 1ODIA 3KUKA 3UT6A 5C80A 3NBQA 1ZL2A 4ECEA 1Z33A 4OEHA 4LZWA 1PR1A 1Z38A 1PR2A 5DK6A 5B7QA 4L5AA 1Z37A 2P4SA 1JP7A 1JDUA 1U1GA 3K8QA 4OF4A 4U2KA 3NM5A 4E1VA 2OECA 3NM4A 1NC1A 2A8YA 3UAYA 1RXSA 1SD2A 3DF9A 4TXJA 1TD1A 4QARA 1TGVA 4MCHA 4BN0A 3KVYA 4BMXA 3NM6B 1U1FA 5EFOA 1OU4A 1ULAA 4L5CA 5FAKA 4EB8A 4G41A 5F7XA 4EARA 3E0QA 2QTTA 3FUCA 4P54A 1RFGE 3K8OE 3LA8A 4JOSA 3F8WA 1Y6QA 1PR0A 1Q1GA 5CXQA 3OZCA 1VFNA 1ODLA 2QPLA 4DA8A 1K9SA 4F1WA 4M7WA 4OGLA 3MB8A 1PR5A 3QPBA 3OOEA 1CB0A 4F3CA 4IP0A 1Z36A 3FWPA 4DA7A 4QFBA 3SCZA 4BMZA 1VMKA 1QE5A 5F73A 1PF7E 1U1DA 5B7PA 5CCEA 1OVGA 1V2HE 1PK9A 5F77A 1VHJA 1OTXA 4F2WA 4YJKA 4BMYA 4R2XA 2H8GA 4WKOA 1JDZA 2ON6A 1PR6A 2A0XA 1K3FA 4R31A 1ODKA 1T8YA 4WKNA 4JP5A 3INYA 3DDOA 4TXNA 3T94A 5B7GA 5CYGA 2AI3A 3EMVA 3EUFA 4I2VA 4QASA 5CXSA 5CYFA 1U1EA 2QTGA 3OZEA 1TCVA 4TS9A 5F7OA 3MMSA 1C3XA 3GGSA 1JDSA 2OC4A 4NSNA 4F2PA 2AC7A 4UC0A 1ZOSA 1OV6A 2HSWA 5IFKA 1YR3A 1SD1A 4G8JA 3IEXA 4D98A 1ECPA 4KN5A 3ODGA 3UAVA 3OZBA 4PR3A 2HN9A 1RXCA 2BSXA 3KVRA 4H1TA 2AI1A 4L6IA 1NC3A 3ONVA 4DA6A 5EUBA 3ENZA 3O6VA 1A69A 4FFSA 1Z5PA 1V3QE 4D8VA 2AI2A 3BJEA 4TTAA 5CCDA 1A9TA 2ISCA 2A0YA 1FXUA 2HWUA 3E9RA 3FAZA
chains in the Genus database with same CATH superfamily
4XB1A 2PT7A 2P4UA 1JKFA 3TD6A 4LC0A 4KRGA 3M6LA 2X8JB 1PBNA 3O1IC 3LP5A 1TYZA 4KK4A 3HVJA 3P0FA 4OP3A 2F4VB 4CN8A 3B6MA 1XZ8A 4DSOA 5JSUA 2OENG 5SY6A 1H5NA 3GDWA 3ZV7A 4H2DA 2BBTA 3QA3E 5A04A 1XEWX 3TBHA 2AW5A 2UKDA 4CM8B 4CCWA 1B14A 3GGCA 4YRNA 1ZOPA 1DBPA 4LQLA 2OA0A 5ALZA 1M83A 1OAOC 1LBSA 1UXOA 1CZNA 3E8SA 2QMQA 3M2TA 3IV9A 3UHFA 1VPLA 4D0RA 3OO0A 1Y33E 3SR0A 5BN1A 1WCWA 1KDTA 4WNCA 4I4LA 5IMBA 3KKOA 5K0BA 1CE8B 1NSFA 1E5LA 1ELOA 3GROA 3TFWA 1PR4A 4A8JB 2CNNA 4MGEA 4W8GA 4MV8A 1M1NA 5IYZB 3KU4A 3RUEA 1OILA 1CZUA 1R4MB 1ADGA 1R0BA 1SIWA 2JGNA 5JISA 3NLLA 4DE5A 1I1HA 3C14C 1Z0ZA 4CETA 1BDHA 2XWQA 3RC2A 2QQFA 4JXXA 5IS2A 4GKAA 4FBMA 1QHSA 1H8EA 3ZQKA 3L8ZA 5A9RA 5JAZA 5C1BA 3PXCX 4OVKA 2F9MA 3R8CA 1LTKA 3HJCA 3R40A 3THXB 3V7YA 4WOKA 4UQLA 2CWDA 4PXYA 4ZYLA 1IULA 5EMHA 4RKYA 3S2YA 2GF9A 1BVYF 1D2EA 2Q3LA 3PFKA 4F4JA 1GM5A 4P32A 4EI8A 4IHQA 4LJYA 5JEEA 4FM9A 2QE7D 5BN3B 3L6DA 3TNJA 4XQEA 4A5OA 5DHTA 4RY2A 2P3LA 1N0HA 3CB2A 4UPVA 3WRYA 2XMQA 3GFFA 2EJTA 3UCEA 5HE8A 5BSRA 5AI5A 3B20A 4M6WB 3KZVA 1S9HA 1KNQA 3QH4A 2O14A 1U94A 1U1CA 4MTLA 3WLLA 4QC2A 1WTAA 2R25B 4HGNA 4FZ5A 4A2WA 5TDHA 4DL9A 2OBFA 5I9MA 3C5EA 4LRSB 1KAEA 4DFDA 2W98A 3VDNB 2J3JA 3CR7A 4HNQA 3QF4B 1RP7A 4B5KA 3Q2IA 3RYHA 4I1IA 1IPFA 2ID4A 3VMFA 4EHNA 3WO0A 4DARA 1NXTA 1R0KA 3VUEA 2PL3A 2PZMA 3CT6A 3UM9A 3N0WA 1GU0A 3NTUA 4PNHA 4TMKA 5DYWA 3C45A 3KZXA 2C77A 2Q1WA 2GYYA 4UTNA 2CSXA 2EF0A 2C95A 3FM9A 3QWBA 4YJHA 4D9GA 5P8WA 1SULA 3MRVA 3WKCA 4KPUB 4NBSA 1NXOA 1AT1A 4GZ3A 4NCHA 1SKMA 2XE4A 4UE6A 4RJTA 1I10A 4JR0A 4CT4B 3S3TA 3PVCA 3BREA 3MXTA 3PHIA 4UHDA 4EYSA 2J4FA 3ZHYA 2IP2A 1KAOA 4I2NA 1UMCA 4K6OA 4JB0A 1VG8A 4KSYA 1CU1A 5CDGA 3SBXA 5AW0A 3EHDA 4MRNA 5L8VA 3LD9A 2WDZA 5C8YA 3WDKA 4AY2A 1IVNA 4CF5A 4AYXA 3ITEA 1RU3A 1J2RA 4CL8A 1NBIA 1QAQA 3BSWA 3C41J 3EMKA 3ZE6A 5BN5B 2QRJA 3UCFA 5FFMA 3RS7A 1GTZA 1L7NA 2BEVA 2NYVA 4N4AA 3BL5A 1EP9A 1FFAA 3V4ZA 1KQFA 4V0OA 1EVLA 3IIIA 5AKYA 1LF5A 4LYAA 3ZCRA 2CXUA 5F7ZA 1NUSA 5ANRB 4Z53A 2W6QA 3PPIA 1XUOA 2A33A 2IS1A 3Q0IA 1J1IA 1J0EA 3SWWA 4Y3UA 2Y8EA 1YDFA 3OT5A 5IASA 1GYPA 2ZPUA 3HI6A 4UD2A 3CCCA 1ZD3A 3H84A 5ALXA 1SVKA 2IUFA 4MGZR 5KTYA 3DZ8A 4MV4A 3A6LA 4Y9TA 1FUIA 1TT5A 3TI9A 5EL0A 3KQKA 4DYDA 8ADHA 5CIYA 1BXRB 4QYWA 3TIVA 3HA7A 2PT9A 1V4NA 1QM5A 3ICWA 3DLCA 3RV3A 5LMUB 3EQ2A 5EJIA 5M7EA 1E0KA 3HJHA 2PD4A 4KVFA 3RREA 4DSUA 1N3IA 1KDYA 1USVA 2AUNA 3ISTA 1BIFA 4G0XA 2B0JA 5FTNA 1Q84A 4BVFA 4JGBA 2IZOA 5CT8A 1EA7A 1I4TD 4QUGA 1OQAA 3I6BA 3CEAA 5FHRA 3JQ6A 4W63A 4EJSA 4UTVA 4HATA 4KC0A 2XMZA 1ZN9A 1XZQA 3K70D 2QTMA 1YZTA 2H65A 2QN1A 5DBGA 2UZ3A 3CZRA 3FYTA 1GPDG 1CX9B 1K68A 2YTZA 5H59A 2CYBA 2GZ1A 5DM4A 2FF5A 3UGKA 5KYWB 1KBQA 3SNKA 1CF2O 3CLSC 4KQWA 2DRIA 4RIFA 3V2GA 2Z43A 4L0QA 4PX2A 4AJ1A 3VKVA 4ND2A 2V6JA 5CK4A 2Z0MA 1OB2A 5JANA 5IT9A 1D7AA 2I6QA 4ZYTA 2YYAA 4FWBA 2PMDA 5EPUA 1WZEA 3FNEA 4Q0MA 2X1VA 3QOYA 5CLQA 4IV0A 3NRBA 4UNSA 4R8KA 3G8DA 5U9CA 1U7XA 2PX0A 2C5LA 2H1VA 3CH6A 3BF7A 1Z6YA 1T3GA 3MJRA 3PTZA 5BT9A 3K9GA 5IJWA 2Z6UA 1LV8A 4DV7B 1DU4A 1C0KA 3IQFA 3UO8B 4QDOA 3QPUA 4XH9B 3LX4A 4AIRA 4ATNA 1UDAA 2AE1A 4GZLA 3JWJA 3PFIA 5FUQA 1FVHA 4PNEA 4P7JA 2CWWA 2GGSA 3R3UA 2FAXA 2C97A 1A9QA 3EVNA 5LNK1 1F14A 1QIGA 1FU8A 1FYEA 4GLLA 3A14A 3O75A 4AJIA 1OYVA 2GK6A 4CUZA 3MT0A 2YMMA 4BNUA 1QIFA 1UBRS 5EJ7A 1RKQA 4C29A 1VRWA 2QQGA 4QSMA 4R1QA 3G9TA 1QZXA 2PVPA 3DM9B 3G5TA 2BFFA 4PW0A 4TT3D 3C8MA 3HL4A 3RKSA 1LRLA 2CW5A 2YVLA 2I7XA 3B5EA 3KX2A 1CEXA 2BFNA 4UU7A 5JYDA 1G21A 1L1FA 1SQFA 2IYQA 4MRMA 2OVFA 4MYCA 4MIYA 4C0SA 2APJA 3SYKA 9LDBA 5MN4A 3ND8A 2HMUA 3NHPA 2PJUA 3LUHA 4F2DA 1M1NB 1U3VA 4QO8A 5U4XA 3BEOA 2JHGA 5T41A 5KINB 4JB8A 5LL6P 5F35A 1O97D 1CJTC 4TRNA 1AKNA 2G0TA 1DKRA 1BGWA 4E22A 3DE1X 2LVBA 1IZ9A 1T2CA 4UTPA 3AIOA 3ENKA 1QF7A 4GUDA 1Z4LA 4KQHA 4LVOA 4Z9XA 1ATIA 4C4TA 2WD8A 1NUTA 1B26A 4HWTA 2W6MA 4ZVLA 5LQMA 3T1QA 4C2TA 2OECA 1XC7A 2IOQA 1I4OA 1T9AA 3QG1A 2YJ4A 3STUA 4BMSA 1IG0A 4ZAXA 3FTQA 3UK6A 2RK4A 1J00A 1YJAA 1ZI6A 5D5PA 4G1MB 3OFJA 5KVQA 1MJ5A 4YN3A 2R4TA 4WCFB 1Q1BA 2WFMA 5FTWA 4REOA 5FAXA 2WICA 1PZNA 3EXG1 4O2BA 4GI3A 1E2QA 3DEAA 2AGVA 3I30X 3QUTA 5KDOA 3U56A 1S2NA 3F8SA 3PHLA 4XGNA 1BS9A 1TYAE 1WZ2A 2ISSD 3R77A 3PVSA 3ZW8A 2AN1A 2BKAA 5DCLA 4Q1CA 4ALMA 2G9NA 3GEBA 1OU4A 1LK5A 1YUBA 1C9YA 3KTFA 2WPDD 1O0CA 4YBZA 4Z7QB 1T0BA 5HMLA 1ZGCA 3HCDA 1NDQA 5FAKA 2NSLA 4ZRNA 4AWAA 2CHEA 1HMYA 3I9NA 4MEBA 4BKOA 5F7XA 1EUQA 2VHQA 1JHXA 1C50A 3CJRA 4X1YA 3RYHB 4O4JB 2QLLA 4J0EA 1TJYA 1R0SA 2V9ZA 3T52A 3QSYA 1N8NA 1J0CA 1M0WA 1TTPB 2X7HA 2YFYA 1R5BA 2H1IA 2LUOA 3PQCA 1VJ1A 2GK4A 1HNXB 2PYZA 1CT9A 4RK1A 2HHHB 2DKNA 3SYTA 3ZDFA 1KP9A 2IEDA 3TQRA 3W90A 3QVJA 3E53A 1UKCA 1X8LA 2SECE 3HWRA 4EGFA 5JNSA 4YJHB 5DASA 5DNUA 5KOJA 4BIMA 4RQBA 1T29A 1TIBA 2VNJA 4LGYA 1HWYA 1JR3A 2SBTA 4GP7A 4LRYA 4DMCA 5A4DA 4E5UA 2HQ1A 5DTQA 4MQUA 5ELXA 1Y8ZA 4IHJF 3ZWQA 2JFZA 5GPBA 1ZD2P 1GL9B 1CUDA 1PQUA 5FL7D 4KW7A 1A5ZA 2VBIA 2G5PA 2MSCB 3CKYA 5EE3A 1QE3A 3ABSB 3V42A 4BJ6A 2GA9A 1VG0B 2H9IA 5C8YB 4OCZA 1KDPA 2ZVDA 2OORC 3QV2A 4X7BA 3PC2A 1JLHA 4X91A 1DEKA 1TVKA 1V9CA 1NQXA 2BEVB 2BRUA 3PKJA 4H0NA 2WM9B 3OE7D 3K9NA 5G41A 3S2ZA 3OAAA 3VR0A 1PJBA 4DA7A 4JU8A 4UCFA 2B2NA 5ADUS 3DDZX 1IWPB 1FRNA 2C1EA 1BS2A 4UAVA 5IVKA 1PYOA 1W59A 2HRBA 3CPJB 2TRSB 5JTTA 2OYSA 3GA7A 2VJNA 4QQKA 5KYYA 4DCJA 4H16A 2XAAA 3L8EA 3SJAA 5THKA 1UAAA 4DCVA 4CKEA 5LMCA 2D06A 3ZU5A 3FTPA 3R2JA 2LKCA 2BH9A 1AV7A 3JQBC 4QU5A 5JXIA 3DAPA 5C51B 1TT5B 3KOYA 4CEJA 2F9LA 1R6XA 1Y4ZA 4C87A 3DOEA 3OLVA 4LYYA 5GY7A 3QJ5A 1BFKA 1SM4A 2P4HX 3KAPA 5LZ4A 4KSBA 3RS9A 2VQEB 1G6OA 2IUEA 4Q9AA 4Y6QA 3FBWA 1P3JA 3N6RA 3K35A 2F7SA 2RAVA 3ZR4B 3SYMA 4D8WA 3K7EA 3AIIA 1U9IC 1DAKA 3NBXX 4OL0A 3DC2A 1N1GA 4E5YA 2JBWA 4Q9KA 4EEZA 4EJSB 3ZD6A 5HUHA 5KTRA 1YKSA 1PZFA 3P27A 4GICA 5D6NA 4CLHA 3ZIAA 2H4WA 3LUCA 4XOUA 3TLMA 3UJ6A 4NCXA 3DYBA 3R75A 3QTTA 3QK7A 3HZRA 2Q9AA 1K3FA 2H2AA 4TTRA 2BFOA 4ARSA 1YC2A 3E3OA 1BVRA 1KY3A 4XE5A 5EIWA 4V03A 2Y92A 4K88A 1ZR4A 3C6YA 4WCFC 3TNLA 3W7AA 3CLHA 3IEMA 1AKUA 2BGKA 1U8CB 1P4SA 3E5NA 2HNBA 3KR9A 3W6PA 3EISA 1CR0A 5CTAA 4W1SA 2W4MA 2XGGA 4HAWA 4JOQA 4HBZA 2C8JA 1Z6XA 1CRPA 2I1QA 4WINA 2D4HA 4J0DA 4MVXA 1G8FA 3CGGA 4DB4A 2X6RA 1FNCA 4CHTA 2W2LD 1O95C 3B1WA 2JJ1D 3I05A 4IICA 2NZ2A 2Z9DA 1Z6GA 3RUIA 3CEJA 1YVRA 2H1SA 1PX2A 3PC4A 3A58B 1MHPA 1VKHA 3NHYA 5CHYA 2UUPA 1EVEA 1J8VA 1IXYA 3JYPA 4ALNA 3FF4A 4IOLA 3T12A 4IV8A 2XPCA 3IQXA 4Y2JA 3SE0A 1GT91 2LIPA 3MJTA 5EVCA 1NI3A 3U4AA 3ZVNA 3PQ6A 2W2NA 2W6IA 4WADA 1NYTA 1VJ0A 2Q5FA 4KQ9A 5FI1B 5LP6C 1YS6A 4NJEA 4EF4A 4NFHA 2XKAA 3AM3A 4J43A 2BFFB 4JKIA 3LZ6A 1L1QA 5BRNA 1IHYA 3BX1A 4II3A 4MWGA 4RHTA 4DLLA 1S8OA 3KEGA 1G21B 1UPBA 4Q4JA 4WDRA 4MRMB 1X2BA 3GU3A 4YH1A 3RR2A 4K9NA 3D0QA 3HV0A 4BO6A 2HSWA 1OXVA 2FPMA 3LT2A 4DV4B 1MT3A 1E5VA 3AJEA 4ZVRA 3EZ7A 5AP9A 5IAJA 3EA0A 2ZUDA 3MTAA 3KXKA 3LP8A 3R23A 4LCJA 4B6RA 2IYYA 4XUDA 4O5OA 4OHKA 1EXDA 1T2EA 5EWJA 2ZRDA 1GAEO 2KE5A 2VRCD 2XHEA 3RC8A 3OLYA 2AG0A 4GYKA 2ZQYA 2P2DA 3F74A 1RWPA 4EO7A 2R6DA 2B8TA 2EKQA 2DHDA 1NM5C 4QD3A 1WUTA 3UPTA 3ZDAA 3EWIA 3I2JA 3O2SB 2FWJA 1T4CA 1ZCFA 4BNMA 5A4JA 5KHLB 1ZGAA 2HLNA 1YB2A 4JJAA 4NABA 4LXIA 5FNZA 1XHLA 3HNOA 4RACA 2FWMX 6GPBA 3F2IA 2BFDA 2CVHA 2OWDA 1V7CA 3HUEA 4G85A 4I4TA 3RANA 2WSSD 3U3MA 4D8VA 4IUBS 2P78A 4O2BB 2PNJA 2BGRA 1V1JA 3W1VA 2ZYDA 1KK3A 4XUGB 3DXYA 4RHYA 2P77A 3S29A 1M0EA 3ZY3A 5DBFA 1KJZA 4D9IA 5B1IA 2WV9A 4AMVA 3LM8A 4CMAA 4I8DA 3BRWA 2VH5R 4AWXA 3E3NA 4L0CA 2RJOA 5CFZA 2AG5A 2HO5A 3E4DA 1XO1A 5BV1A 1KOGA 4Q03A 1PNTA 4G1FA 2ONJA 2FX5A 4CKCA 3EOAI 4EVIA 4PYKA 1NNSA 1YQQA 2NNWB 2VP3A 5SYAA 1HT0A 2IKSA 2X0IA 2JFWA 2ZI4A 4X1YB 4BASA 5B30A 3UAZA 4PQYA 3WYFA 1Z25A 1A27A 2P90A 3GPBA 2YZ2A 1Z2DA 5EXPA 3VYVA 4F9EA 4GBGA 4Y2GA 3TI7A 3GJXC 4AI6A 4UFNA 4A8TA 1W1UA 4I9NA 3LY7A 3MAAC 4JA0A 1G59A 3NU1A 4J29A 5AVQA 3U3KA 5KOJB 4HQRA 1Y5MA 1HTTA 2GEFA 1U8AA 4L4UA 5KYGA 3ZD9A 4YMLA 2GHRA 2XCQA 4OQQA 4AF8A 2SCUB 4GLOA 1R27A 1CPYA 3ZWKA 1V45E 4NNJA 3ROPA 5I45A 1HDXA 5I9NA 4W5RA 3OPQA 2IYTA 1OLXA 2IE8A 3PITA 2EW8A 3F71A 3EGOA 5FBRB 4A5SA 4F86A 4ZAZA 4EBFA 4HKTA 5ALNA 4GLJA 3I1JA 5KWIA 2YFHA 1XROA 4EG7A 1M5TA 4XJXA 3OECA 1GNSA 4NEGA 3T3HA 1LFAA 2P0EA 1UBLS 1TVKB 5JI2E 1QV6A 3QXHA 3ZVLA 2XWPA 5H3LA 1GQQA 5HCUA 3SIWA 2O5RA 1C2TA 1NVAA 4L8GA 4AMZA 5A02A 1SUBA 4D2IA 1VPEA 2HYDA 5KJEA 2PJRA 4FEGA 2AC2A 4IDOA 2ZTLA 3MRSA 2GNOA 4RNDB 3SEZA 4DLNA 3CPHA 2YMPA 1RYHA 1XE3A 2R6JA 4AJJA 2P9TA 2AEJA 5KYYB 5LDHA 3ND5A 4KIJA 2IYZA 1US8A 1ECGA 2B0CA 4Y1GA 5E7QA 3WQQA 3CO0S 3H0CA 2QRLA 4CKEB 3Q88A 4GIBA 1APBA 3LXRA 2B7CA 3A8TA 1FEZA 4NDZA 4KIUA 1A1SA 1U9CA 5C1DA 2AB0A 1NPTO 1Q1AA 1QANA 1T0JB 2XQGA 2A57A 3D9QX 4QXRA 3P96A 3N0XA 4CEIA 3HUUA 1B0PA 3HR7A 3IA2A 5IARA 4N1AA 3H05A 3ZWCA 1XCLA 4MP3A 2H18A 3F7NA 2XD4A 4PYMA 2BKEA 1YUNA 4RGQA 4AS1A 2JI7A 3WJAA 4MWDA 2JAQA 2P8JA 1Q19A 4QBFA 4JJIA 5JPIA 3UMFA 3CUVA 4BFUA 5CDTA 1HT2E 2CY0A 1LBEA 3I39X 3INGA 4CU2A 5FD8A 3G0DA 1N7HA 3LXUX 2L17A 2VDPB 3NASA 1YBFA 4XKJA 3PNMA 2A4MA 1LGYA 1NFQA 1T34A 3G85A 4V0QA 4Y6RA 4PRLA 3WGIA 1DDOA 4KGVA 1JKIA 4F5WA 2HSEA 4IHJA 1YIDA 4YRKA 1HQYE 5TPWA 4QAQA 1QO7A 3QE9Y 1ILEA 2ADFA 2X9VA 3L8CA 3E9MA 2QGFA 4LNAA 1CY2A 4DS3A 4P2BA 1CZLA 2Q7OE 1H66A 4F3KA 1MX1A 1M2HA 3H0EA 1QQBA 4OX9Y 3T0GA 3COWA 3T9BA 1L4KA 5AVOA 4PZDA 4EUSA 2O1WA 1V8OA 2QT9A 5CEJA 1OFIA 3HMQA 4IIYA 3SU8A 1CR2A 2AZ4A 3AFIA 2ZUCA 2Q4TA 4M9QA 3ZEAA 1J5PA 4ABYA 4BE9A 3QVSA 1CYDA 1XDUA 4L3OA 1EZ4A 3DVRX 4BIIA 2HU2A 1CP2A 1NXQA 1VPDA 4U8HA 2XYQA 2CJPA 1Q11A 2VDMB 3OEED 1BHQ1 2D0PB 5CIQA 2IHUA 3JAWB 2JW5A 4EZBA 4UHBA 1BA3A 2IK8A 1X13A 1V3UA 2CHQA 3C1AA 3MGGA 4HAYA 4B43A 1TK3A 3WQHA 3OOWA 3NANA 1G3MA 1B6RA 1SVMA 2G9QA 5JNWA 4YUYA 4FVTA 5F1OA 1KC3A 2GPJA 2NGRA 4NJEB 1JH8A 3LFHA 4KPYA 3KPWA 2NXEA 5C37A 1R8JA 4KTTE 4GX0A 3C6QA 1Q1QA 2XQIA 2ZT7A 3QF7A 2FN7A 3AWIA 4Q4JB 3LQ2A 5BORA 3EHEA 1BJKA 3GG2A 3GN1A 3R7AA 3M1YA 3ZZNA 2P7IA 4Q18A 4L02A 1QAMA 4L2IA 1TU3A 1J2JA 3R0ZA 4I6EA 5J23A 3A1EA 1M74A 4TZTA 1SN7A 1EIWA 5E6RB 4BATA 4QBGB 1AO0A 1RFLA 3PQ8A 4KKVA 4D7AA 1CFZA 1YDEA 3SD7A 2JLUA 5EWJB 1S8AA 2QZJA 2XV1A 3IVCA 3TDKA 4TZKA 3AQ4A 4UE2A 1D2CA 3L06A 3W2TA 1WQ1R 5HUQA 2FPRA 3RFXA 3MFYA 3MMXA 3O1LA 2I7CA 3CC8A 1DAMA 1QDLB 2H59A 2LZ0A 3GBPA 4JU9A 5A1TA 1T4CB 1QZZA 1U0GA 1EAYA 4DY6A 2DMRA 4LZAA 4QPZA 4LRXA 1V7PC 3KQUA 2BFDB 3GFVA 3R44A 4I4TB 4RGBA 3RJ5A 3PHCA 1A77A 2WVGA 3N8GA 2EAUA 2BUAA 3NOOA 1ENOA 3BWVA 4LHZA 4J2HA 1DX6A 3A1SA 2ZBEA 3CRVA 1PUJA 3OOHA 3SIRA 1LBQA 2W2PA 4GBED 2JFYA 2C9ZA 3HQ4O 4JLWA 5AKZA 1O97C 3I01A 2JGDA 2IIPA 1Z35A 4ENQA 4YPFA 2JJMA 3ONFA 1GTL1 4Q01A 5LBTA 4RLFA 3SF0A 5TARA 3HABA 4WXPA 1JE0A 3M7IA 3UFXA 1Y9JA 5F3DA 3AVTA 721PA 1OKKD 4KKXB 4CM9A 1KDOA 3OY2A 3ZS9A 2Z56A 1GG5A 3GLIE 2O8FA 3FCCA 3ILYA 1F5SA 3RADC 1THGA 2BWJA 2P2SA 3H99A 4UPEA 1LV7A 1TW2A 1T5TA 5HIAA 3G0GA 3H9CA 3ZTTA 3OZWA 2D5CA 4CE6A 1AY0A 2ZRFA 3EYWA 3HXOA 1DTSA 3BKXA 2FOXA 1T0IA 4IQGA 3OEWA 4HDNA 4ZMSA 3DA8A 2OGSA 3LCVB 4J75A 4JP8A 2CEKA 3KQTA 3TQHA 1EX9A 4F4IA 1OLXB 1OX6A 2IYSA 2QAIA 4PYRA 4XQ0A 2ZUEA 4U2GA 4WVLA 2X5XA 3FETA 3UCXA 1MB9A 5BWCA 1EDDA 1C29B 4PC2A 2PGIA 2I6GA 3PP8A 4S1VA 1YV9A 1JPJA 1FXWA 2FSSA 2HMWA 2L0XA 1ICEA 2NUAA 3OCYA 4MV5A 4QPDA 1EQUA 1VL1A 5L3VA 3IP6A 3SBDA 3I04M 1QPZA 3FCSB 4BZZA 4YMVA 3SLKA 3U7HB 3L93A 3FSJX 1ADJA 1COWD 1VLVA 2BHNA 1KO4A 2IXEA 3UAYA 2AN3A 4HQLA 3K96A 4YRQA 4RPGA 2JEOA 5J4LA 5B3JC 3EAQA 5E1DA 2GYVA 1CXZA 1US8B 3ULKA 2AOUA 4NEQA 2Q45A 4PAGA 1BGXT 2OR3A 3L84A 3KZMA 4LF4B 5FUWA 4HYEA 4WY2A 5DYYA 3TE7A 4GGOA 5LQJA 5ES3A 3GJZA 1R9MA 4U0KA 4K6CA 5FTLA 4HB4A 4LV6A 4LYGA 5AVTA 2EX0A 3GIWA 3STWA 4WCVA 2PRYA 1WUHS 1E1NA 1RI1A 5EP2A 1OFTA 4BLWA 5AFSA 1BA2A 2GZMA 2HK6A 4L16A 3RFTA 4OAQA 1NR1A 3DBVO 4DDTA 4CEIB 2BJVA 3NS7A 1HYBA 3PR3A 4FNAA 3GELA 4R8VA 2WWYA 1H85A 4IILA 2JLBA 3LLVA 3L40A 4Z5XA 2JI8A 4WCDA 3A25A 3KPYA 4E5SA 4EA8A 1S8NA 1Z4MA 5FWYA 1ISHA 2CNDA 4KWTA 2AR9A 4MQBA 5KHOC 3CTMA 4XWGA 1JQLB 4E2WA 1YAHA 4BQRA 2OCPA 2IE0A 3B3JA 3EPJA 4P4NA 5ALVA 3HY6A 5JAPA 4HWOA 4DDUA 1I7DA 2H29A 3LA8A 4MJ3A 1DCMA 3VC2A 4XVQA 1Q50A 2H7YA 4U02A 1WZNA 3DLAA 1UEIA 1DTWA 4IHJB 1NF8A 2UZ0A 5TPWB 1HSOA 4GZ6A 3ZYCA 1K8QA 1XRSB 4MXDA 5H4HA 1OD6A 4XOIA 4CIAA 1R4NA 2VSQA 3B48A 4ENRA 4IDNA 4RMIA 3I9MA 3WXMA 4NU0A 3HK2A 2HF9A 2LPMA 2HL6A 2R6R1 2YBDA 4YQYA 1YJCA 4ZYUA 4K9RA 4Y6GB 5DN9A 5LQSA 4M36A 5TVGA 3LTNC 1HYQA 1NMEA 3FSEA 1X9GA 1O6ZA 3UG7A 5AD1A 4HY3A 4IXDA 3TJZA 3QI7A 4ZCMA 1M1ZA 2FE4A 4PPGA 2NTJA 3TPZA 4P80A 4PHCA 4OPMA 3O5AA 5I51A 1Z22A 4Y1FA 1Q7GA 1CQPA 4R5MA 1YU6A 3TZCA 1YR8A 1Q0UA 4IIVA 4NU8X 4X45A 1IJFA 2VBGA 4NJOA 1U31A 1OIXA 2RGXA 1HBJA 2YL2A 5FFNA 1OLSA 2I76A 5I7AA 1HDEA 1BHJA 4Y2UA 4X6YA 4AYTA 4CPDA 2WUFA 1U2PA 1V26A 2IVZA 3AYZB 1ZMRA 4B79A 2A86A 3K20A 4HD8A 5K8LA 4WLNA 2NTEA 1GQFA 1X87A 3KYDA 4UNRA 4YASA 2PDAA 5A3VA 1VJGA 1G1AA 4L2IB 3OCXA 2BDEA 1ZDMA 1HE4A 3DE4X 3IPLA 3M70A 3VPFA 1Q22A 1TUBA 3HXPA 2H48A 3ZHOA 5BV0A 2BJHA 4R2XA 4A3SA 2ZR0A 1DJQA 1GPNA 1FTQA 2NYRA 3PEVA 3IPCA 3N5CA 3PFWO 4MWZA 4XARA 5IM5A 5CD1A 5LQNA 5EHIA 2AOTB 1HDOA 1TJ4A 2G17A 3N05A 1IFXA 4IMRA 2A0XA 4EG3A 3GDGA 1YRLA 4LJLA 1F8GA 3AEZA 2OHFA 4FI3F 1MBZA 1ETHA 1ZPDA 4HP8A 4JN6B 4BO5A 5JZSA 3ZHSA 3UK2A 4AF6A 2R5FA 1E6EA 3RF6A 5C32A 3BFXA 1DO8A 3K1JA 4FOTA 1PEDA 2VG8A 1PJTA 2PWPA 3MMZA 3WLPA 1S6YA 3D1JA 4W9NA 4QUBA 5HF5A 4FZ3A 4WKNA 1E7RA 3B1FA 4WHMA 3CX3A 3IUPA 4M46A 4OH1A 5FXMA 4D4GA 1U0OC 1BH6A 2D5BA 5FOUA 3D5TA 4XJSA 3LZDA 1SGWA 1JJVA 2X22A 2HHLA 4FFNA 4V2UA 2JG3A 5AHRA 1GSAA 3FR8A 1EDOA 4JDUA 2P5SA 5LZ8A 1O6BA 2AR0A 2JGDB 2W8BB 5JNRA 1IM5A 5D3ZA 1VP9A 1EHYA 4JHLA 3HY3A 5B53A 1I6KA 4I6JA 3UFXB 2FQWA 2V59A 3UMYA 3HB7A 1K63A 1MB0A 5FPKA 2RHDA 1IUKA 4IJKA 3R74A 3Q8MA 3NVKI 1H2EA 5DHPA 1NF3A 3LAWA 2BE7A 3TPFA 2O8FB 1V39A 2J7PA 2AR7A 3D4OA 1HM5A 1OI2A 1LLFA 1CRWG 4N5MA 3H3XA 2RCNA 1K8YB 4KODA 4NSNA 5D00A 4ZD6A 5H82A 4A92A 3W2EA 2HREA 4OQFA 3PUVA 4F2PA 3QXJA 4JOCA 1X1SA 3ASVA 3IVGA 4UEWA 4B47A 1Z9BA 1NR5A 3QLTA 2FMIA 3DE6X 5LQAA 2VT7A 2CXNA 4YYEA 2BGTA 1HSZA 3GUZA 2FW1A 3LU1A 4B4KA 3K15A 4HDNB 1QPGA 1G7SA 1OE0A 1YR3A 2ENUA 4HPWA 1E6LA 1RHUA 2J32A 3AFHA 2H4FA 2ZW9A 3L4SO 3PWZA 4K05A 2OLKA 2O20A 4OBBA 3KHTA 1D03A 3BFKA 1MA0A 2HY7A 1DO0A 2K6GA 3HN6A 3PK0A 5GZ3A 2HN9A 4CM7A 3OY7A 2DBYA 4OHXA 5H16A 1NJ5A 2SICE 2NUAB 4JR1A 1PQWA 2AI1A 3LHSA 1VI6A 4REQA 4ZVSA 1QO0A 3CR8A 3GCGA 2ZRCA 4V38A 4BP3A 3X3HA 2XCSB 2P9CA 2IZ5A 3MUNA 3OLZA 3KUXA 3AF1A 2WZBA 4MR7A 4KR6A 4ZV7A 3EZ6A 3MELA 1KOLA 1NBMA 3SSMA 3ZBQA 1HLDA 1PV2A 1YRQA 1E5XA 1SFRA 3BMCA 3GVXA 4IFTA 2BTQA 1KRHA 2C9BA 3AF5A 1Q12A 4TQGA 4U39A 2O8CA 4V3CA 2ASEA 1TE2A 4MRRA 4QNNA 3UANA 2AOUB 3K0HA 2ZUSA 1Z83A 4JJ7A 4OQYA 4ZT7A 5IUKC 4B4UA 1BXKA 2VR1A 3DEYX 1I6MA 1JQAA 4AY4A 3UGQA 4F71A 3AKZA 1JZTA 1M6WA 4FYIA 4CLRA 2C7GA 1Y6ZA 2QX7A 1X19A 3TCXB 4A6PA 4TSRA 3MCZA 3T1VA 3WICA 1QXSA 4RZQA 3QBTA 1DEXA 1EX1A 1M8GA 1Q6YA 3P19A 2J5RA 3I5UA 2PCJA 1JQBA 2QN9A 3T9CA 3EXAA 4MJ7A 4ALJA 3GMIA 4HNTA 1WHTA 2QMOA 2AK3A 4QECA 1QLWA 4O2RA 1WM1A 5FWYB 4MARA 3TLCA 3C3YA 3WLHA 1V7ZA 4R98A 4DJJA 1RYZA 2Z8ZA 3LT4A 4QDZA 3RFCA 1Z6AA 1TZMA 3T5MA 2BCEA 4P5PA 2P5YA 3N3AC 4P84A 1KSFX 4RK4A 2BFWA 2WYOA 1CY0A 2F17A 3VHQA 4S04A 5FA5A 5EJAA 4BWYA 4V0ME 3BHNA 1CUAA 1RJDA 1IHDA 3KOXA 3SZ3A 2XTJA 5AKEA 3TSZA 3CNBA 4MUFA 3H19A 3OBBA 5I9LA 3R9XA 4CGYA 4UVEA 3NEPX 1DG9A 3WISA 4CKBA 4EEXA 1DTWB 2YNMA 3HCBA 4JZKA 4HDRA 2CLMB 2OV6A 2PH3A 3HU5A 4FUQA 4IOJA 4UCQA 1SNYA 1YUMA 3GR6A 3KJHA 3P2IA 3ZZTA 4C7XA 4OQ4A 3RJ9A 1R4NB 2JFGA 4DKXA 5K4HA 3GLHE 4ETNA 4C2BA 4F6RA 1RRMA 1QYVA 2DTDA 2Q0QA 3CUWA 3PTLA 5CNIA 1F6DA 3LDFA 1S96A 3LW7A 3OCCA 4KAJA 2PX4A 5ARDA 2C88A 5FI3A 3UUWA 2CFOA 2CLCX 1X3SA 4NICA 3D7RA 2R6FA 1V48A 4NY1A 1T3SA 3LS2A 2QTVB 4KPFC 1KJ9A 2C2MA 2FSVA 1N2BA 2SKDA 1JX6A 3FOWA 4IKEA 4KV7A 1S2GA 1DJOA 1YGPA 3JWGA 1DIAA 3CNQS 3R5XA 2JZNA 1JAHA 1RAGA 3QITA 4DBZA 4X6LA 5KC8A 3VI4B 1L5ZA 4QRHA 3CR3C 3Q1LA 3GWZA 3DB2A 3ML1A 5AK0A 5I4CA 1M33A 3AL3A 3D6JA 4RVOA 1SUWA 1OLSB 3ER9A 1N25A 1PGPA 1R3DA 1UIRA 1HLGA 3O2JA 4RELA 5KNDD 2DFPA 1XVIA 3VAAA 1WHSA 3MT7A 2EBUA 2ZYAA 4TXMA 4ESVA 1HORA 1U98A 3C16C 4MJXA 2OCXA 1E1QA 2WAXA 2JLXA 2RH9B 5K0TA 2D3TA 5DGDA 5GTDA 2I34A 5HFNA 1KWKA 1LI4A 3KYDB 4QUKA 5EUQB 1XTBA 5SYMA 3IOEA 4LFCB 3EIFA 2V6MA 4JBNA 2QRQA 3IOCA 1NI4A 4F9FA 1W4ZA 1GPMA 1T9GS 3NC1C 5CFOA 2IQ5A 1G6KA 4M60A 1ZSYA 4AZ3A 5AM3A 1J70A 2Z2JA 5K6AC 3V1LA 4BMCA 1V4BA 1JYSA 2XT0A 3I34X 1O03A 4KGDA 1RCTE 3EZFA 3I23A 3U3ZA 5A7FA 1IQRA 3F67A 2WT4A 5ES4B 3MTIA 1HFJA 4Q9JA 4LF5B 1U63A 3OJXA 1T9CA 2V65A 3L46A 1H4SA 4MUBA 1ZJZA 4M7OA 4BRUA 1SKQA 1IMOA 1U81A 3FVWA 3JVUA 1TLTA 2IOFA 3R3ZA 3TIGA 4ZXPA 1UAGA 1L2TA 2AMJA 2QK4A 5I7RA 2XSZA 3EEOA 1XX6A 4XCXA 4DEXA 3QKUA 4U7TB 2I4OA 4DA4A 2HRCA 2GRAA 2WWTA 2XOEA 3JZAA 3LWDA 5AJTA 1SCBA 2B4TO 2P2ZA 1L8OA 1KJIA 2NM0A 4MDEA 1Q0QA 2Z5FA 2ZUUA 5BOSB 4B73A 4NAVA 4GKVA 2F8SA 2G72A 1EHCA 2DWPA 2ZYHA 1ZZGA 1EQ2A 2TSYB 1G8JA 3AFOA 3IDZA 2LCQA 3SCZA 3ZLBA 4F7WA 4RSRA 3HCOA 5CW1A 3JPWA 2YY7A 3FYDA 5BSVA 1QKIA 4EB6A 3ONEA 2H00A 1XD2A 2PA0A 3GFPA 4N76A 2XUHA 3I4CA 4TRMA 1IUPA 4DQLA 5K8TA 4ARIA 4RTPA 3IHWA 1RHJA 4IRXA 4WOCA 2CSUA 4LX0A 1TM5E 2PS3A 4E07A 4EATA 3DOIA 4IGFA 2O50A 2ZWVA 2PZAA 1DLJA 1KTVA 2LW7A 3P9ZA 4HJXA 2HK8A 5TF0A 1ZN8A 3UB2A 1KMIY 3W8FA 3WY9A 4F60A 2OAQ1 3MQFA 5IVDA 3B2NA 1WMAA 4MCJA 2AMFA 3OSUA 3AGQA 4BBJA 5EIAA 4BUCA 1E1DA 5IKEA 3WQBA 2PZKA 4W1QA 2YHUA 2JARA 3ONWA 3TINA 4AAYA 4HAVA 4LGMA 1PW5A 4MW9A 3IBCA 2QX6A 2X1HA 4MDHA 1R9JA 4PANA 3IDOA 3WIEA 2Y4NA 4UEQA 1E2KA 2E9SA 2CNWA 4HH1A 2YX1A 3HYCA 1QR2A 1JXAA 1C0EA 2XKJE 1VJRA 4LDQA 4KREA 2R47A 2ZYGA 3GZNA 4RKFA 2ZB8A 3DPSA 1REQA 4GMFA 4REQB 5TC4A 4EMBA 4ENVA 2J3HA 1RVDA 2X3FA 4C89A 2XA2A 1YK1A 1AHIA 1SBQA 1XMXA 1QHYA 2H2HA 4JFAA 3IPAA 1KY4A 1D2MA 2Z30A 3ZH2A 3HGQA 1G55A 3ZPXA 4C0HA 1UZLA 2WM8A 3MJ4A 4F3YA 3BMCB 4JIGA 3CWCA 1D04A 2BTQB 2O8CB 1VG1A 1XQ6A 3KKEA 4JSYA 1RXVA 2HQBA 3DL7A 4Z3DA 5JS6A 1I4WA 4XCVA 2Z04A 4IQ8A 4U2CA 3D8TA 3PCXA 2JGIA 2VK8A 1KQNA 2B4AA 2X2EA 1AIPA 3H65A 4UEJA 3DR3A 2DE0X 3P26A 5EQDA 4FCTA 4CLRB 4D6PA 4C4AA 1N2CA 1RWBA 3V46A 2Z9CA 1M6YA 2GZDA 1KYVA 4W9RA 3C8ZA 4I1OA 3E35A 3VI3B 3OWHA 3L5KA 4O4HA 5IP5A 3L4EA 3I32A 4C4RA 3DAHA 3FZEA 4ARUA 4DMFA 1NW5A 2C5GA 3EZGA 4P22A 1UC9A 2GETA 3DZBA 1QHXA 1WHTB 4C2AA 2FPIA 1C1XB 1D4OA 4IIJA 4PSKA 4DGQA 3X0DA 5C35A 3MW8A 3O95A 5CH8A 1RC8A 3C7CB 10MHA 2H17A 2HMTA 4M83A 2FP3A 2FR0A 1KYTA 3TOSA 1NQWA 4BMDA 5KSOA 1AQLA 3QUSA 3YASA 1BOFA 1SZDA 1JHDA 1Z2OX 3OPXA 4X60A 3TZHA 5IJAA 1N4DA 4QPNA 1M72A 1JQ3A 4BZPA 1DQZA 4YREA 3LC7O 3O3CA 4CKBB 2Q3FA 1DAFA 2WTXA 2Z2IA 3VR4A 4OHUA 4V0RA 1YNOA 2NO7A 4Z7OB 1IEWA 1JBQA 4E12A 1CFJA 2VWQA 5FI0B 2C58A 4I8XA 1VYVA 3OIVA 4WGGA 1ZMOA 2ZULA 4EJFA 4Y2QA 1KYQA 3E18A 4MUEA 2GUGA 3U7IA 5J2TF 5JZOA 1DC6A 3CNEA 4CG0A 4W8HA 4RMHA 3UBMA 3PHGA 1O89A 2JB9A 3NBKA 4HQNA 1JIUA 4TKMA 2PV0A 3IUMA 5FFFA 1NLMA 4KLRA 1ANKA 1JFLA 3IUYA 3KRTA 3LP6A 3KLBA 4F84A 3BIFA 1WD7A 5LQCA 3MOIA 4DQKA 2X5JO 1RPZA 3JALA 3BWEA 4QNMA 4S0XA 4G67A 1N6RA 1QNLA 5J1TB 3WWCA 4CG2A 5CA1F 3BS4A 3MWLA 1WHSB 4PX5A 4YP9A 1T2UA 2VS1A 2ZR8A 3HB4X 4GI2A 3L1IA 4HYYA 6PFKA 3L6UA 4FR5A 1HNZB 3MUOA 3WK4A 3I9LA 3CRMA 1P5HA 1XKTA 1VYHA 1E2PA 2R7MA 3I52A 4HB2A 4NYIR 4A91A 1TA9A 3HJBA 2YHAA 1Y3DE 1E2EA 3OZUA 5CGZA 1LFDB 3FG9A 4DLUA 2CVQA 2OQIA 3OKPA 4BWVA 1NI4B 1K88A 2E1PA 4QXOA 4ZVQA 4EA6A 2OBMA 4QVIA 1JU3A 1SXJD 5D87A 1FFGA 3ZU3A 5IG2A 2G5GX 1ULSA 5EXTA 2PGLA 4BV9A 3EW9A 4G41A 3B5JA 5F2EA 1T35A 2C4NA 1Y5LA 1I9GA 2JRLA 1K7SN 4AZ3B 4MLDA 1TRHA 1YS2X 2AYYA 1PJCA 4GXTA 4ZVOA 3BH6A 1FFHA 5A62A 2VYNA 3BFVA 5CVDA 4AG3A 3R3JA 4OJYA 3NVDA 3PGMA 4R9NA 4XD7A 5EUMA 3ZDEA 2FWBA 2VNHA 5CK5A 1RBMA 1F8YA 1FC0A 2O0LA 3L1VA 3WGKA 5EJ5A 4D43A 2R7KA 3WYCA 4FXOA 3X1DA 4I5EA 3K05A 1GQYA 2I1LA 1GLNA 1BWRA 1WTCA 1ZK3A 4CF3A 4P83A 1Q77A 4H4CA 4K46A 4HX2A 5EINA 4HNUA 1MAVA 1MX5A 2IDZA 3JYLA 3E61A 1J07A 2JAOA 3O9VA 5KQSA 5K8JB 5DPMA 4YDRA 3ZVKA 1FP4B 1OI7A 3GXOA 3RTDA 5GINE 3K1TA 3WFJA 4A9AA 1J2UA 1OPXA 3OT1A 5AW2A 4AIIA 3ZKWA 5NULA 4F6LA 3UOGA 2H51A 2IU4A 4N03A 4NOJA 1U11A 2QYSA 2JZOA 1DAOA 1B4DA 2ACKA 1TD9A 2VAXA 1XA4A 4NQZA 1HH4A 3D3QA 4EB6B 1KU0A 2IYOA 1XD2B 2CK3A 3CNNA 2R9VA 2FFAA 1FFDA 4NJMA 5K45A 4QIHA 2OMEA 1YTUA 4NK4A 3IHLA 3ZNQA 1ZLXA 5HW0A 1TEHA 2UZIR 1F4PA 1S1CA 3HCFA 3CISA 1ZIOA 1MTZA 3PE6A 5IF3A 1GRQA 1G5IA 2P9EA 1MGOA 3BWCA 1Z12A 4G0MA 4CM5A 4PLCA 1YZUA 5AJUA 1R8QA 3SOPA 2BMVA 2Z4SA 3PUXA 2GJ9A 2RH4A 5LYYA 2JCYA 4NV1A 5LZ2A 3DTVD 4G1VA 3BDAA 2ZR7A 3L7AA 3C3EA 4RTSA 4TS1A 5BWLA 4BNJA 3ZJYA 3CEMA 5EJMA 3WR5A 1ETUA 3KVOA 3UC5A 3SYRA 1QR6A 2RHBA 3U17A 5BSMA 1NP7A 3UJPA 1UAYA 4BMYA 2E7ZA 3LSTA 2HCBA 4JH0A 4UHHA 2J46A 2A2ZA 4HAOA 4R9UC 4HVLA 2GEJA 2YWDA 2J30A 1IJEA 1GAJA 2PRSA 5D51S 2JEZA 5JR3A 2XBMA 4JYPA 3GJ7A 5DGXA 1PYGA 1FDTA 5FF9A 4REMA 3CIFA 3UXYA 5T3UA 2ZYVX 3GRYA 3GZNB 2TMYA 4CMKA 3JCZA 1REQB 5JAOA 4JUAA 3SVZA 8GPBA 1GZ6A 2FVXA 1PR6A 1YB1A 4B81A 2O23A 2X6QA 4FE4A 3OZRA 3SDZA 3T5GA 4ZYZA 1P7VA 4DCUA 1G6Q1 4X7MA 2ZAMA 4IHKA 5MGNA 3NUGA 3PDWA 3M5CA 1BEZA 1XZEA 4CIVA 1F3OA 1A5BB 3NHBA 4Q9DA 2IV2X 3V4VB 2JKVA 3BRSA 1C3EA 2BMWA 5FLYA 3IKMB 1JLLA 3BHMA 4XUCA 2V8BA 1M76A 2Z8YA 2TMDA 3VHXB 3L4KA 2PVSA 2WKPA 3E0XA 5DHUA 2AWNA 1IZ7A 3RU7A 3TEJA 3VZBA 2I3ZA 4N12A 3G0IA 5DB4A 3VOTA 1N2CB 4QDKA 3I61A 5ELMA 5FPSA 2D5AA 1LC0A 1F1JA 1NVGA 3DE2X 1RQNA 3WJ1A 4B6SA 4O4HB 1X8JA 4URUR 4W9MC 1IY9A 1E2HA 2ADMA 1J0AA 2ZTHA 2ZPAA 3FPFA 3G5UA 3L0SA 5CXSA 4OJNA 3OD5A 4PVDA 1PYDA 2GCNA 4AKTA 2FPIB 4IIJB 3I01M 4JP2A 1IMJA 3FNIA 3IAFA 1NFRA 1C3XA 1Y5IA 3W0LB 3SSNA 4LN1A 3Q85A 3PQ5A 1J56A 5C81A 2WMOB 2XMCA 4BQIA 4PO9A 2LBPA 4INJA 4IR7A 5DHSA 4EVSA 1H0RA 4KJXA 3OA0A 1CV2A 3LOPA 1JQJC 4Y6OA 3BKWA 3WB1A 1C7IA 3H5WA 3UHJA 3QHPA 3D3WA 4NMHA 3THYA 1QHGA 1TZKA 1XFDA 1L5QA 3OX3A 4FX5A 2A58A 2DC1A 2OPBA 5FBKA 1IZYA 3Q6MA 3VVMA 3IAS1 5CT6A 1Z5ZA 3NJ4A 5FJIA 4FYXA 5IANA 4FSXA 4MB0A 2ORVA 2XEDA 3A6FA 3DE3X 4G8JA 4TL6A 3TSCA 5ADVA 2XX3A 4DLAA 4GMKA 1F2VA 3DF7A 4KQEA 5I8WA 1R50A 2IPMA 3TG2A 5KTNA 3VR2A 1T1GA 3LC1O 3W77A 2BM9A 2QTWB 3I2GA 5TB5A 1ULTA 1PZMA 1T5LA 5FBWB 4LCEA 2P4QA 3NEAA 4KVZA 2QX4A 1GGJA 4X85A 3J80A 2PWZA 2WK1A 2O8DA 3FPAA 3WRXC 2Q21A 3V2UA 1GQOA 1H1LA 3CVYA 3RE1A 1QIHA 3BF8A 3QEKA 3TKLA 4JC4A 2ZJ6A 1PR9A 3ZWWA 4D26A 2W6JD 2B25A 3C7KA 1SQ0A 4G5OA 1KEUA 2SKCA 1XNGA 2WYVA 4F1JA 2GBCA 1FP7A 1M8KA 5IZCA 4G0VA 1KYIA 1Y37A 1ZO8A 3Q3JB 3AF3A 2J0EA 3FNBA 3JQ8A 1OLUB 3N8KA 3IEVA 3VKFA 1XDBA 3Q9UA 4O59O 4KYTA 5CCDA 5HFJA 5BWNA 2IH5A 2R8BA 5AJWA 2ISCA 3ICPA 4MR8A 2A0YA 4X90A 1NU6A 3RLIA 1Q7TA 1NRXA 3J7AC 1DCFA 2DR0A 2J41A 3T7IA 1AUOA 4H3KB 2WR8A 4QBIA 1IG3A 1KMHA 2X9LA 4M22A 3RDPA 3AINA 4Z6KA 3CF4G 1XMIA 4N0DA 2N42A 4HAUA 4OQXA 4RQAA 5EERA 3VH3A 5JALA 2UYCA 1IBKB 5IUJC 1DPFA 5MFZA 1RLUA 1ST3A 3E05A 2Y4OA 3GVPA 3ER8A 2Y77A 4B4WA 2CXSA 2N1BA 3B6IA 1JR3D 1ZM9A 4KCGA 4JOBA 1JRLA 4WUVA 4TV9F 1W44A 3T7CA 1LX6A 1WUYA 4C7MA 5IAOA 3T1NA 2PMWB 1UKBA 3FI9A 3D7NA 1MCZA 1ZY2A 2DHEA 3FVVA 2O2HA 3OQVA 1VSUA 2GNPA 1EB8A 2BFBA 2HDNB 1HV8A 2QL5A 1I9CA 3RG8A 3RVOA 1AXEA 2RBEA 3AM1A 3KVVA 3RAFC 3F7MA 3EIWA 3RJMA 5DW3A 1DMRA 1EI9A 4QTUB 1O57A 3VDRA 4XUEA 4H6PA 2ZUFA 4K0RA 4D1YA 1YJ8A 2ZIAA 5L6LB 5AK3A 2A5FA 4ZO8A 3KP1A 2MSLA 3CTPA 4MYHA 1GUFA 5DTRA 5K0NA 4LF7B 1B0AA 4OY3A 1ZNQO 1UBEA 1FJHA 1QX4A 3HSYA 4F5DA 3OT1B 1UADA 3ECCA 3OAAD 3ZKWB 1RRCA 3LL4A 4JBIA 4BNHA 3LUJA 4AKHA 5A05A 1QQAA 4FBGA 3EVTA 2DQKA 5DK4A 1AGPA 2V54A 3WNVA 2J3EA 1JZQA 4KE9A 3E7WA 3PJFA 4FGUA 4NJMB 1UFOA 2B1GA 2CDAA 1E60A 1TJNA 3DQZA 4OJQA 1MV5A 1UJ6A 4QTZA 4XSVA 2WIKA 1P1KA 2E5WA 3HU2A 2C8KA 1Z0KA 3EDCA 4WFQA 3I6YA 3SYLA 2ZBFA 2NOAA 1G2PA 2J5QA 2VF7A 2WWGA 4MCIA 4R7TA 3WVNA 3ZHUA 3VKUA 5B37A 3UV3A 3WKAA 1G63A 1RIFA 4XX0B 4R2JA 4ZREA 4M86A 1KARA 4KXVA 5JVDF 1NG1A 1GNRA 2PBRA 3MUEA 4GMXA 4R6WA 4QXQA 1ZD9A 3KTAA 2H4HA 4TXLA 4Z0HO 3ZZUA 1P2GA 2HA6A 2VSOA 2XUOA 2HJ9A 3ZIAD 4ZV9A 1YQUA 4CGZA 2XNSA 1JI3A 2HJVA 4PC6A 1IIRA 4OJTA 2Q5EA 3R3WA 2ZI3A 3I4LA 1P2SA 4I50A 3I8OA 1I1QB 5KSWB 2PNFA 2A84A 3BCSA 3D0RA 4FJ2A 1NAHA 1V41E 2UDPA 4O3MA 4LC1A 4CMHA 1XZJA 3O31A 2B94A 3VYUB 2RHGB 5ESDA 4G0ZA 3E5RA 2JPDA 4YCLA 3FROA 2FMXA 3C98A 2W2VA 2V7XA 3AF2A 3TDMA 2J59A 3L18A 2P41A 2R6AA 2ZJ3A 5K4AA 5B4VA 3NTOA 1SKYE 2J5XA 3K6JA 4U63A 4DRZA 3IE1A 2XE6A 5LR6A 1IK6A 1IQPA 1CUHA 1P4AA 2JAHA 4P4SA 4DCPA 1Z0FA 5HWSA 3MWJA 4MUKA 2PEYA 1MJGA 2PGAA 3A2MA 4AS2A 1N0VC 1JLLB 1U8UA 1U0EA 2VK4A 1WQ4A 3F3KA 2YXBA 3FJOA 3OPVA 2HA4A 4JLMA 1U2DA 2I6FA 3BVPA 3JQFA 2Q6OA 4X1IA 5AI8A 5L4NA 4QOJA 4CT0A 3NIBA 5IVPA 1S8FA 2GEKA 2D7CA 2EZ8A 2ORIA 4POOA 1KRWA 5JY1A 1TMGE 4WXEA 4G89A 3TRFA 1CF9A 4A26A 5B7NA 2G9VA 3H9JA 5DHQA 4MW0A 1NXXA 3ESDA 2W6ID 2I2WA 3A4LA 4NCJA 4EOGA 4P8RA 3SIXA 2FW0A 4EHBA 2XNKA 5D7NA 3FCAA 3QVWA 2X76A 3LQFA 3KCQA 5DYGA 2B5WA 3LUKA 3DV0A 1X38A 1RE0A 1Y8QA 3X1XA 3OOJA 3AUKA 1Q2XA 2VHWA 3L7MA 5AM2A 1Q0HA 3GT0A 5C7OO 1U7DA 2GD0A 4B40A 5BYBA 2ZBRA 2ZXEA 4IWYA 3FCYA 4MP8A 2VJQA 2WAOA 5IBPA 1WEKA 2WWFA 1H2YA 2A14A 3D3WB 2VTEA 3THYB 2P9BA 3S2IA 5ALPA 3AYXB 5C0OE 2E82A 4ENWA 2ZB2A 4IIUA 4B9AA 3GLFA 3M9LA 2C82A 4BBPA 2WP8J 2Z2KA 4Q3BA 4QQ8A 4Q7EA 3TLAA 3TZEA 1F48A 3KZKA 4RJKA 2BY4A 1JA1A 1PDWA 2I6TA 5DBEX 5A7HA 5KVSA 4XWTA 2IWRA 5L95A 1ZHOA 1SRRA 2I2DA 3FFTA 5DN6A 3F90A 3D8BA 1A4UA 1VDMA 1XZFA 4QWMA 4GPD1 3C43A 3KJXA 3VSBA 4A6XA 3DXZA 2YFQA 3P5BA 3R5TA 4L72A 3IVAA 4DANA 1Z7GA 5HKAA 3DQQA 3HYRA 2JGJA 3IHTA 2IOYA 4S3MA 2O8DB 4DJ5X 3BXXA 1BMTA 1H1LB 3ICEA 5AVJA 1ZOLA 2WJHA 1S2DA 2HHJA 3AI3A 3WSWA 1Z73A 5B2FA 5E6UA 1WXXA 1BXGA 4W7IA 3WBFA 1UF9A 3NR2A 5CM8B 1FFCA 1EE2A 2HWXA 1ZWLA 3HVIA 3TDNA 5IXYA 4Z4FA 1M0TA 3BRWD 4MUHA 3J81k 4KB5A 2BGNA 1GVHA 3JQ8B 4PG5A 1AB6A 3GRPA 1SQGA 1KZGB 1YE5A 4N47A 3UHOA 2R86A 4B6OA 4RVGA 2ID8A 2NZ8A 2O7QA 4KXWA 3SJCA 1J25A 1DAGA 3PUWA 4MR8B 2BEUA 4R3WA 3GNQA 4YAOA 3RIYA 4AL4A 4CTNA 5H9WA 3M6WA 1EXVA 4MV0A 1NXSA 2FP4A 1UP4A 2J4DA 1OH7A 1KMHB 1YE3A 3BICA 2B98A 1N8SA 3IAM6 4CYMA 4JBHA 1JXOA 1F6WA 2JL1A 4P4TA 4ND6A 4ESHA 1S4MA 2CV0A 1LNQA 5IDXA 5ER9A 2C3OA 3DOCA 2O52A 4ZODA 2V4UA 3LC0A 2HJHA 3QEAZ 3EWNA 1FK8A 5C5DA 2C83A 3JQEA 5A9TA 2R2GA 1SEPA 3L7DA 4Z4IA 1GU7A 3DMGA 4U9UA 4N48A 4G09A 1T3HA 1A2KC 2OZLA 4JYCA 1HOXA 1OLOA 1SXHA 1UWKA 2BFBB 3DMNA 3E9QA 4U1RA 1TF5A 4RD0A 1S2LA 5CU7A 3MB5A 3AO0B 1UJNA 4IIFA 1YULA 4Z1MD 4CV1A 2CFRA 1QUFA 3OIWA 1X7GA 1WB6A 4RPCA 3G2OA 5IAEA 3RU3A 3QBVA 4FQ7A 5KNCH 1M54A 1RJFA 1PWHA 2K87A 2IW3A 2IYAA 1MJFA 1P2DA 2FZWA 4BPRA 5J2UF 3B1KA 1SXJC 4TLBA 5BR7A 4BB6A 1TEVA 1XN1A 3O4FA 4M0MA 1YE8A 3WZLA 4ZDWA 4IOMA 4BVHA 1IXKA 2O0KA 1U2SA 2WTEA 1L4FA 1C3JA 1XBTA 2QT1A 3EGVA 1HFWA 1U8YA 4OHYA 4U2KA 3OMLA 1P1CA 3Q10A 4FDMA 1K0FA 3NIWA 2BEWA 4B7ZA 1L8QA 3DAYA 2H06A 4MUIA 3N86A 3F8TA 2WILA 2KWIA 1DINA 4O4LF 3GFTA 2PYDA 4PIPA 1JA0A 1IN5A 3PC6A 1N3LA 3WL7A 3DF9A 2O8BA 4J0JA 3HCAA 4K3UA 3TM4A 4TKZA 1HE8B 3S2SA 4KE7A 2IH2A 2OFXA 4LI0A 1XVAA 1QVAA 3IE2A 5ALJA 3QEMA 2QWXA 2YWFA 3E27A 3HBNA 1EP2B 4IFBA 3KTAB 3UMMA 2HYIC 4OFZA 4B2YA 1V43A 1O77A 4TL9A 1U7ZA 3NTRA 5JNLA 4U6NA 1BCRA 1JLSA 3K32A 5HOQA 5KQPA 3IAEA 4RF2A 1KYYA 2EYQA 3FLMA 3ZDRA 1MOPA 2PKWA 2PY6A 4V2IA 1Q2UA 1E2MA 3PPWA 4KBYA 2TMGA 4PPYA 3NJ8A 4RABA 2H85A 5AHWA 4I50B 5DI3A 2WHRA 2FEMA 3Q8WA 4TV9A 4R7GA 3QNMA 3NEYA 1GTG1 3WG9A 1C30A 4R1SA 5B6JA 3W6OA 3GL9A 3RSSA 3OZTA 3W06A 3MC1A 4K0KB 5A2QA 1CULC 1M2WA 4W5JA 3Q3IA 1CY1A 1TMKA 5DM0A 3SMQA 3ZWMA 1M1UA 1VE3A 3EIHA 4WGFA 5EHXA 3BBPA 4IQ0A 4LPKA 3TPCA 2Q4BA 3T34A 3U44B 2HKIA 2NTVA 3F8WA 3ICOA 1D07A 4P4SB 2IUSA 4G36A 3WLQA 1NT2A 2QV0A 3D81A 5CXQA 2R7AA 3RYIB 4HEHA 3ER6A 4X1IB 4YVFA 1GRCA 3UAGA 2IGBA 2OO5A 3B6ZA 1JHMA 2F1OA 3EA5A 3UHAA 2MYUA 3RBVA 2FZ5A 1MPXA 2PQ2A 4C0LA 4EO9A 2B82A 1H23A 4CT5A 3T3NA 1T9GR 1Z2CA 1IRXA 4GRIA 2FR1A 5AW3A 1SUIA 1L5SA 3PYMA 3QELA 3NX4A 3TH5A 3TSWA 1E5TA 2G5CA 5I9SA 3QOXA 5BYJA 3W9SA 1KPHA 3W3AH 1ID1A 4FLMA 5E9JA 2OGUA 5JY6A 2IWHA 4JC0A 2JA2A 5BV2P 3ETDA 1BE8A 2F43A 5LZ5A 4OM7A 1QBGA 1RPAA 5DXJA 3UMJA 5EEHA 4IP0A 2FX3A 1IOLA 2V9CA 3D64A 1G41A 3GFRA 3DV0B 1Y8QB 4HB3A 1HT3A 4Q66C 4ETWA 3PX7A 3ADCA 2RHTA 1E98A 3OCVA 1QP7A 4FR0A 3A6DA 3U3DA 4BJ1A 4GOXA 1WMDA 4MV1A 4QGHA 4QHTA 5JCOC 1TU0A 2DERA 2REQA 1EFLA 2ZBUA 3FPHA 1FMCA 2C3PA 4RJIA 4UNPA 1QE5A 2WHXA 3BILA 3OX2A 4OSPA 5I6DA 3B2EA 2V7PA 5CVUA 1C9DB 3Q3VA 1WG8A 2IYLD 4PO3X 1B6TA 5DULA 5ICMA 5JXHA 2OT3B 4M0UA 4F1KA 2W4IA 3SHQA 5C1IA 5DZSA 5I48A 4II7A 4GSKA 4GX1A 2GPSA 1W4AA 1YASA 3EZYA 4JUCA 3S1LA 1P7YA 4O25A 3VR6A 2AH5A 4KN9S 4QU9A 1LJUA 3F7TA 4HSEA 4NCNA 4MWCA 4LJSA 4NWIA 4J6EA 5DLYA 3RT1A 3WRWA 1PFYA 3V8RA 1PJLA 1UT8A 4WNIA 4RK7A 1VB3A 3FOCA 1XTPA 3ON5A 2SHKA 4MS4A 3UKOA 3ZE9A 1PV1A 4N5IX 2R6HA 4B44A 2V1XA 5KC9A 1QNFA 2XMDA 1IXZA 3FDJA 3KD2A 2B35A 2ODQA 1HDGO 2GH1A 2Q5JA 2Z5VA 3IP7A 2GSDA 3G5LA 3NFYA 3PDCA 4JWKA 3CLRD 2VRNA 3D4LA 4K9OA 1BXGB 2OM2A 2AF4C 4PFQA 1LC3A 2XDQA 5E6UB 4HUQA 1WAMA 2X2FA 1UM8A 4NR0A 1R15A 5HP4A 4JFRA 5F98A 1XMQB 1MH1A 1ZFNA 3I53A 5EYPA 2C7BA 3VPHA 4E6EA 5H68A 2IU6A 2AKAB 4Q3LA 3PXGA 1SOUA 1JBKA 2AFIE 4HADA 4XPIA 1J42A 1KK1A 3QM1A 2GCEA 2Q9BA 3F6EX 3Q4GA 4JP1A 1G8YA 1XZCA 3WHKA 4ZV4A 2BEUB 2VEOA 4CM9D 1IBLB 3UMVA 2ZWAA 2C98A 1Q7CA 2FP4B 2IDKA 3U3RA 2J5BA 4DV1B 5K3FA 1NMZA 1U3FA 4MPTA 3AVOA 3EQ9A 2ZIXA 1JDJA 1O8CA 1RS0A 4L3VA 5CT5A 3WSVA 2HD4A 5FHQA 2R6ZA 2MSEB 3DVQX 4FGKA 5ERYA 1EK5A 1Y7HA 5LDDC 5F9FA 2VYVD 4NBKA 4FMCF 4DQXA 3ZN2A 4BKUA 3GT3A 4FEYA 1SXPA 2QSYA 1X70A 2HTFA 4KZKA 1M34E 2DPMA 3BMOA 3L7NA 2CCKA 2EC5A 2XQVA 2OZLB 3OTWA 3AZOA 2DB3A 5K8IA 4AROA 4QGGA 3OG9A 3L43A 4Y2HA 3I9FA 4G4SP 1SKAA 4PSUA 4Q1AA 3G6WA 3NUQA 1OV6A 1TQHA 3EF3A 1FFSA 4KIFA 2Q6KA 2NU9A 4LDAA 1P91A 5B4TA 1GAQA 1RZRD 3D6FA 4YRPA 1Y3IA 3HDQA 3TQFA 2XNDD 3S70A 3FRHA 4M8KA 1Z5UA 2EBHX 4EMSA 3OZBA 4M9XA 4KR9A 4XX1A 4PR3A 3FB4A 1EM6A 1A71A 1RXCA 3AI1A 3PR1A 3X1WA 3A4IA 2O7RA 3H2HA 3CW2A 1KDVA 3R5KA 3X43A 5AUQA 1FDWA 2K7ZA 1YTLA 2G0NA 2EZ9A 3VR3A 1W5SA 2BEWB 2V58A 3FDIA 2P40A 1ZMTA 3MPOA 3FYUC 5T4EA 3P2OA 4TMFA 1FYXA 2NZXA 4R41A 5AOAA 4DA6A 4TYNA 3T4XA 5ARCA 4ON9A 4R3NA 3DZDA 5AKLA 2C9CA 3HB5X 4G26A 4C7VA 1QB8A 3N2KB 2IEZA 5HK9A 2PMFA 3DD1A 4RU1A 2O8BB 3H11A 1GYQA 1Z8FA 1GCUA 3DZHA 5DI9A 3SBEA 3LQRA 4DEVA 1IDN1 3DV9A 4QJIA 1X8XA 4XGRA 1TLLA 3K9BA 5DKFA 2PUEA 1SCDA 3QEMB 4IH9A 4G2NA 2R8EA 4X97A 3SXUA 1BCRB 1X6VA 2ZJBA 3NFRA 4P7BA 3RTBA 4WH0A 1G66A 2VDKB 4HXEB 2H6EA 1J09A 1SU7A 4FFDA 1K5DA 1ODJA 3BGIA 2DJ5A 3IP9A 4NP6A 5DI3B 1R5OA 4MKRA 4I14A 4YBRA 3TNFA 4TV9B 4MA4A 4DF3A 3GJYA 5AW6A 4A0SA 1C30B 1JW9B 1Z16A 2RGAA 1JALA 3PBKA 3WDLA 1KFBB 2FGKA 3MUFA 4MGKR 5AIAA 2FSHA 1A9RA 4J1SA 1C7EA 2GZSA 1AJEA 2Y1EA 5KHAA 2IEGA 5THXA 1NV8A 4UAUA 1E62A 1RXEA 3AUXA 3EXHC 4UVDA 3VZCA 4HT3B 3RUFA 2ATEA 1V95A 5J40A 2D5IA 4D3YA 4BO9A 5BRJA 1S1MA 1O94C 3HRKA 3MK31 1K98A 3JD4A 4KWHA 3HFSA 3GD7A 4QXMA 4A8PA 1PQ4A 4O1IA 2P1ZA 1QVVA 2NW6A 4NAUA 4DCTA 1JEAA 3ADDA 5JEDA 2PAAA 4RL6A 1NBAA 4UU1A 2QX8A 2CB0A 1ND6A 4IKPA 3RS8A 2PWYA 2EU8A 2HX1A 4ILEA 3SFVA 3ZGZA 1U2QA 2FLKA 3QELB 4UUBA 5DIFA 1X7YA 2VJAA 3OH8A 1GQ2A 1VLJA 3MJFA 4UM8B 1P0QA 2F43B 1W34A 4XDGA 2XA1A 1ILWA 4BO1A 3KB1A 3E23A 4US1R 2QD5A 3X1YA 2C9MA 1FMLA 1G3QA 2P6UA 1Z4JA 3RWBA 1CY7A 3LYAA 1XU9A 1GNPA 2BFCA 1CQIA 3GW8A 4E0BA 1IWBB 3K94A 1EFCA 2REQB 5IHPA 2W90A 1T26A 3HH8A 3W2HA 2HR1A 4YONB 3VGPA 1XTRA 3C6ZA 4ZOQI 2Y0EA 3CU5A 1P1FA 4LKRA 4YXWD 3DFIA 3PRHA 3LHDA 1UPAA 1LEHA 1NVUQ 3EBOA 1EH5A 1DIHA 1N3YA 4QYMA 2EF1A 1YRYE 3DQPA 3HPQA 4QG7A 3W05A 4F72A 4IDQA 2DR3A 5F23A 1PJQA 2Q5HA 1HO3A 4EH1A 2GA8A 3DDSA 2ZM6B 4JLBA 1BU8A 4LZOA 1TPZA 2Q5QA 1D6NA 1X0VA 2BR4A 4DB2A 4R1MA 1IBRA 1XNJA 4ICIA 1TC1A 4KWCA 4UBKA 1N6KA 4OYYA 3G0OA 1IQUA 2P9ZA 2CJFA 2IHBA 4XJTA 4JEUA 4DY4A 2QR5A 2BI8A 3HR4A 3AY6A 4DA9A 3VVLA 3PUKA 3D8HA 1T4GA 4FYJA 2FI1A 3KHSA 4CKCB 1PJ8A 3GRAA 1P0IA 1EINA 4R9VA 3HEMA 1CERA 3LVFO 3P7MA 4KVAA 4O0MA 1T6YA 3IJEB 3MMPA 2ZYRA 1OA1A 1DJLA 4HUQB 4R2IA 1E9CA 3B13B 4IEIA 4OG2A 5H9VA 2ZWOA 4KWEA 2DH5A 4OHWA 3D7SA 5EYPB 1QSGA 1VL6A 1VJTA 2XXBA 3E8MA 4FNOA 4NMLA 4K6GA 5HKKA 3RBZA 1YZLA 4OGKA 1OVMA 4XPIB 3AJRA 2ZBPA 5HOEA 2BHRA 1UWLA 1C9NA 1KEEA 3UXEA 1P81A 4PZ0A 1CSEE 1I3KA 3RROA 4PM4A 1E4EA 4DC0A 5JJLA 3WLFA 4IDAA 3HKDA 1VJDA 4X92A 2P91A 4JEMA 1H3FA 4UMVA 4BHTA 4JI8B 1EFPA 5A0TA 2QAGA 2XDAA 1ZICA 5EVJA 5K3FB 1EFHA 5BNIA 1ISSA 2EFCB 2ZIXB 1LVUA 1GGKA 3BE4A 1QG4A 1LY1A 3OURA 4MYUA 4OATA 3X2FA 4ZMBA 5IJ9A 3O90A 3UF0A 1U0TA 3KJEA 1XTSA 1UT5A 2FMKA 3JYOA 4X8HA 3EIUA 4H18A 3UKDA 4NBNA 2AEMA 1QX3A 1E99A 2Q6TA 1DKOA 2FU5C 3MLBA 3BMOB 3O8NA 1PWYE 3LQ1A 4I5FA 5AKKA 1RI5A 2DKOA 4GS5A 3ZDZB 4OP1A 3BXHA 3OIYA 1XMJA 1Y3AA 1DEHA 3F6BX 3LKVA 2XWSA 3ZJ4A 4ALLA 4B3CA 4QOGA 2BGWA 4YCSA 3WBJA 3ABRB 5CTJA 5IBCA 1QMPA 2BMFA 2C7VA 3O3NB 2NU9B 1Y1LA 3GGDA 1SA0A 1QO0D 4JGIA 4NC9A 4J16A 4B4VA 5C5EA 3BA6A 3GQBA 4XYEA 2VF2A 3P9CA 4QFCA 3RT7A 1RAEA 1ULBA 4FZVA 3PNKA 4IPTA 4KXYA 1U6KA 5CBKA 5CBPA 3K9CA 1HPLA 1NBMD 1L4YA 3DKKA 3WGTA 1JB1A 3ILXA 5K3DA 3FHCB 2Y99A 4FP9A 4MAFA 2WF9A 3D6VA 1FS5A 4C30A 1LBTA 1VSTA 4TSFD 2CJYA 5CVCA 1AHPA 1A8SA 1KEVA 2EFDB 1H0SA 4RFVA 1FLAA 3TK1A 4AICA 2Z3ZA 3NHJA 2YUTA 2VN8A 1ESEA 5HRCA 4FGWA 3E15A 2W58A 2WWRA 3NHRA 1GZ5A 2D1FA 3NOXA 4CMEC 4BGEA 1LVGA 1U6IA 2PSSA 4LYDA 2XXAA 1K6XA 2B5OA 4BO7A 2R97A 3H11B 2NLOA 1KY5A 1PJSA 1M5UA 2R4QA 3R6WA 3TRDA 3V4OA 2IS6A 3EDQA 2WHPB 2DT8A 3WLRA 3TL2A 1PSDA 3DZKA 4BO0A 3RVPA 3P9QA 5FQNA 3T5DA 2FSFA 2I1WA 2XYGA 3TOVA 4L5YA 1NNI1 3U60B 4K9MA 5AK5A 2PLRA 2FZ4A 4Z9YA 3OQNA 5LLSA 1GP2A 1JSZA 1DXHA 3ETCA 3MTDA 3TZLA 2GHIA 3K0SA 1A4XA 1JJIA 4NV3A 2HPZA 4C7JA 3G2JA 2HIGA 1HEUA 1SRQA 3WYEA 4HQ6A 4NNOA 1TW3A 3A2KA 4L0MA 3T1YB 2C2WA 3ECAA 1L3IA 5JTUA 3HHEA 3RRJA 3A7EA 2HSGA 5DMHA 3W5HA 2YUIA 4LMBA 1I2CA 2BW0A 2PTHA 3P0IA 4US0R 3TWOA 3TX2A 4CMGA 5LD2B 4R3UC 3ZCQA 3VOBA 4B6FA 3NPMA 6ADHA 3C85A 4LTDA 2O3TA 4RXMA 4HEQA 1C3OA 2FF7A 3MWGA 3UJ8A 1VMIA 2AN4A 1UT6A 1EM8A 2Z9BA 1C0LA 2Q1UA 2HUNA 4X61A 4YGYA 5IXJA 2BEKA 3UH1A 1AQUA 1D6SA 4UMEA 4EJ2A 1Y3BE 3H0KA 5KX5F 3KYBA 1OBOA 3ZWBA 2Q1YA 3R7FA 4DMRA 2CJXA 4P86A 4GX5A 2X4DA 3D7MA 1E77A 4IDCA 4J4BA 1OFUX 3ZH9B 5FYQA 1ESNA 2A5DA 3OX4A 3P2MA 4GI1A 5DNAA 5TEWA 5A6VA 3PNQA 3OJWA 4DLTA 4OKIA 2ZAIA 1DIOB 1HYHA 1IOZA 2DHQA 4TQAA 2IH4A 3IP3A 2PLWA 2JI6A 1G8AA 4FT4A 4QPJC 3PLAE 1X7YB 3CGWA 1CJBA 3ESZA 3GI1A 3LK7A 3QHAA 4CMJA 1D2RA 5AM4A 3FCEA 1K6IA 4ZK6A 5AVWA 2OUKA 4HGZA 2DBQA 3T5CA 1E8NA 3E7FA 4DR2B 1Q44A 2YJ5A 3MS7A 2UU9B 4H17A 1QJ4A 3TLXA 1X1AA 2A8YA 2XCUA 1QYXA 2BMAA 3HO8A 2OHHA 3M4YA 4IO0A 4IXTA 1KE1A 4FKZA 3T7EA 4CBVA 1HTWA 1CQIB 2BFCB 4PCAA 1DT5A 3FI0A 3LVBA 5BMVA 4PAWA 1YBHA 2DCMA 3M1LA 1FDUA 1TD1A 1RQLA 1FW8A 2JFUA 2WF7A 1SUSA 3N2GA 4YJ2F 1OBCA 4QDJA 3RHSA 1T10A 1ML3A 3L0DA 2EGGA 2J3IA 2XOXA 3N2LA 4MCHA 1DAEA 3T5PA 4WOJA 4LZLA 4YCDA 1OHHA 4XRGA 5CA0F 1G7RA 1CQJA 2VI5A 3F5SA 1U2GC 1SELA 4LEIA 2D5LA 1YHNA 4XDYA 1MKYA 1WPRA 5PGMA 3F5FA 5TJ9A 2YY6A 2E49A 4L76A 3I5YA 1CUSA 1PD0A 1RVV1 2VHVA 3A6GA 4MGYR 2CUKA 4WZ6A 2VWGA 3HVRA 4BFTA 2WG0A 3D02A 3LSYA 3ZNOA 4ZI7B 3EYAA 3TCNA 5BPHA 1KYXA 4RTNA 4NECA 2D4AA 2HJRA 5KTPA 2AXPA 2EDAA 2B8WA 4J7XA 4GXNA 3SM9A 1FNSA 2VDOB 3L07A 5FLEX 3GJ8A 3G2IA 1FPMA 3IKJA 1D9XA 1A3CA 3H9QA 3F97A 4G56A 4NCIA 3SS9X 1XHFA 1LDBA 3GUHA 1G64A 2LTAA 2X4IA 1RYDA 2HBYA 3O21A 3PJEA 1K2VN 2EXXA 3U37A 4AXBA 3KYIB 2XNHA 4L08A 1WDMA 4TVKA 1SXJE 3N70A 1PX0A 3Q5DA 3IAM1 1ZD5A 1NVXQ 2QR2A 3RVLA 4QUAA 1BVHA 1MO5A 2I65A 3WIOA 1IPEA 1PFQA 3RLFA 2KM1A 1IWOA 1E4EB 2YYSA 3GGPA 4C0KA 1K9SA 3HKDB 4JUIA 3V7UA 3OQPA 4JYBA 4NZMA 4GOOD 5A5EA 2AX4A 1KP3A 2QAGB 1XPOA 1WOYA 3T3IA 3WHIA 2J6BA 1NLYA 4K9KA 4DTCA 3ZE7A 4IFIA 2IS4A 2NSHA 5IJ9B 1W2WB 1EDZA 3KQLA 2X7XA 2IGTA 3Q7RA 1AM4D 4OGFA 4IWXA 3U0BA 1JKMA 3LX6A 2NVWA 2UXCB 4WZAE 3I62A 3JQDA 4U7HA 4MQEA 3Q0TA 1TUGA 4FFWA 5JCJD 3FTDA 3LPLA 4MKXA 4Q12A 4WBSA 3MQ2A 3PKIA 3G0HA 1I3LA 2O7VA 3ZOZA 5EXEA 3CIOA 4B6GA 1WP4A 3BAFA 4BCCA 3AOEC 5T6BA 4V1CI 1PLLA 1M1YB 1FX0A 3G88A 2Q6IA 2R1VA 2X8LA 3QX9A 3H5IA 3LUGA 1U02A 1Q3TA 2WJ6A 3GPIA 2CNWD 1CUFA 3G7UA 2WU3A 4OMUA 4UTXA 2VDUE 1QK5A 2QGZA 4KQJA 3VPCA 1JEOA 4D4LA 1BNCA 1Y6JA 2UZ1A 4W99A 3K9LA 5JMPA 4FW9A 4RWEA 4E70A 5ALRA 1SA0B 1ZUIA 2H1LA 4F2WA 3AF4A 4HXFB 3GQBB 3A9TA 4P5EA 3ROMA 2BKUA 3DPIA 4O2AF 4BNFA 2HRRA 1AS0A 1P9RA 3SJUA 4XW2A 3T7RA 5CBPB 1JS1X 1FPQA 1N2IA 1R7RA 4FHZA 4NBWA 1E9EA 4MB2A 1LPMA 3MVEA 1SPXA 2NIPA 2QZPA 4MVJE 3A32A 3IUQA 1V5FA 3PIIA 5C1OA 1ZCBA 4FN4A 3WIDA 1MVOA 2OESA 3QYFA 5AKGA 2C5HA 5C34B 3KKLA 2P9GA 3EIXA 2X0KA 3MIZA 3L0ZA 4GKBA 2XUIA 3L6OO 1M2JA 2F90A 4C7KA 4O33A 2J3MA 4YRZA 3HADA 4XLTA 5JDIC 5JUWA 5KQMA 2XXAB 2DF8A 3IO3A 1KTIA 1DI0A 2C0CA 3VHRA 4CKWA 4Y1RA 3RVQA 4UE3S 4L7QA 1U0SY 1A5SB 4AKEA 4NIMA 2M32A 3RKRA 1ZINA 1IYZA 2XDYA 3WGJA 1VGVA 1WX1A 3GLRA 4WASA 3RS5A 1ZOOA 2FTKE 1H65A 1JHUA 2PD6A 4L5BA 4MEAA 3TD9A 4BFYA 4YAIA 3K6SA 4RUKA 5C8DA 1NSYA 1K0UA 4FQ5A 4U00A 221PA 1UPXA 2EL7A 5F33A 4GYJA 3TYXA 2QN8A 1PS8A 1ZNWA 3EGEA 1ODFA 3DNPA 2XH8A 1KO5A 2LE0A 1GQRA 4UNQA 3KB2A 4KNYA 3BL8A 2QZ4A 3I42A 2O2IA 2ZS8A 1WSBA 4IZIA 1LQ2A 3WL4A 2D7DA 1CY8A 1YL5A 3M89A 2QE6A 2WJYA 2MOKA 3GJRA 3PU6A 4JB2A 1W581 4UEKA 1ZJ5A 3VAYA 5IJ0A 2JDIA 3O3MB 4OA8A 2FR8C 4RULA 3VR4D 4NVRA 4W4TA 1AKYA 4KYVA 2WOJA 1C3OB 2GN0A 4KDCA 3BCRA 1M66A 4UC0A 4OQEA 4NU5A 3VNUA 1M2OA 3ANXA 8OHMA 3HY4A 4YAFA 3FWYA 2ZRHA 1YCFA 3KXDA 4CV2A 1DQPA 1YS1X 4XVUA 4CZ2A 3C4QA 3SI7A 1Q6ZA 5E3HA 4EEKA 1I0IA 2BF7A 4F8JA 4ER3A 3QVGA 2BDTA 4XLZA 2WB2A 1VJCA 3C5WP 1P5FA 1UBSB 1Y7LA 3HL0A 3QOWA 4UUPA 2NADA 4O63O 3CVXA 3LHIA 3CJQA 3PRJA 4MOWA 4V0SA 3GJ6A 3HU1A 2NUTA 3VPDA 3GMDA 4AVYA 2H4XA 4ZZ3A 1EUYA 3IURA 3BGWA 1BDJA 4EHIA 4RHUA 1MA3A 1NC3A 3KHKA 5JXJA 8LDHA 2D7JA 5ULLA 1HLFA 3PI7A 2CLSA 1RHKA 1GTRA 2XTNA 1ZVMA 3EDOA 2IXGA 3QWIA 4DIMA 1DC8A 1DJPA 1U8EA 1LW6E 3TLGB 3PD1A 3ZCUA 3B5IA 3OJEA 4BTLA 3MYYA 5HHTA 1U7PA 2D2XA 3MNFA 1LLQA 3WGVA 4BGVA 1OW3B 2GDZA 3WK7A 1KY2A 2I8CA