1ODUA

Crystal structure of thermotoga maritima alpha-fucosidase in complex with fucose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
441
structure length
422
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEDLPGYKWEFTRGIGLSFGYNRNEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 148
structure length 422
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1oduA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1oduA01
1OBAA 1CZ1A 1XYFA 5LA2A 3ECQA 3L4VA 2J74A 2XSAA 4XX6A 3IGUA 3DHPA 3OLGA 1UKQA 3IAPA 3OBAA 1V6VA 3NDYA 3SUVA 4BCEA 2GVYA 2PI6A 3WDIA 3WIJA 3N1AA 3TV8A 2GFTA 3WF0A 3CMGA 1UD8A 1BGGA 1K9TA 3UR7A 1V02E 3WN6A 2AMGA 1BAGA 3NJ3A 1L0PA 2E3ZA 1BTCA 3WQVA 1RP8A 3MMDA 1TCMA 3LPOA 3HG3A 3VPLA 5IFPA 1YHTA 4P7LA 2W5FA 3ARPA 2VURA 1UWSA 2ESCA 2J7GA 1V0MA 3T2QA 2W91A 1V08A 2VNCA 1ZBCA 2Y24A 2DIJA 2YKKA 2CERA 4EANA 1NOFA 3OLDA 3VGEA 2J47A 3VX1A 4B9YA 4PCTA 2OYKA 1G01A 4PMZA 3GZAA 1FFRA 5AC5A 4GQRA 3ALGA 4FNTA 1X6LA 3AXXA 1TE1A 5JBEA 3THCA 2XM2A 5JIPA 1E4MM 4W86A 4D6CA 1E56A 1UA7A 2AAAA 3AHYA 1G1YA 5AY7A 3WH7A 2WSPA 4U5KA 3ZT7A 4JL1A 1JAEA 4TVDA 2IXUA 2VRKA 2D2OA 1DWHM 1CXIA 5CSYA 1H49A 3CUFA 1EGZA 3PZOA 2FGLA 4WSKA 4PN2A 2WVVB 4FNPA 4E8DA 4EK7A 3CZ8A 4GI6A 3OZPA 4CD7A 1XCWA 4N0RA 1BPLB 1MW0A 3SUUA 3BLKA 1V3IA 1V0NA 5A3HA 4CN6A 1XCXA 1PBGA 3LXBA 2YL8A 3A4AA 2XVGA 1VF8A 1HVXA 3QHMA 4TX6A 1W1YA 2DEPA 5D9PA 3QGVA 1B0IA 1K6AA 1KXVA 2YOCA 1NH6A 2ZUUA 2PWDA 4HPGA 5CGTA 1OWQA 5E6YA 5BXPA 3WUGA 1QBBA 2FH6A 4N42A 1JIBA 1CBGA 1NARA 1WDRA 4CN4A 1ZJBA 3AICA 5CQ1A 4J3WA 2BFGA 2W63A 4OBSA 1DWIM 3VIPA 1IZKA 2VL4A 2J8FA 5A6SA 3RCNA 1E0XA 4ATDA 1W1VA 4UFJA 2XN1A 3SCVA 1VB9A 2WSKA 3AHTA 4MPKA 3RO8A 4M80A 4E8CA 2E40A 2GJPA 3F5LA 3BAKA 4HOZA 1UQZA 4ATLA 3AMDA 3WEOA 2VQTA 1HN1A 1W1TA 1BLIA 4HZ7A 1OT2A 4M8UA 3SCNA 2CIPA 3M07A 1MW1A 4QLKA 1K9EA 1JDCA 1QW8A 3ZO9A 1J9YA 1EH9A 1HP4A 3PZQA 1VFUA 3NSNA 3WEZA 4OJYA 4HPHA 4GO9A 3AIUA 3VKKA 4UFIA 4H41A 1G0CA 4UQCA 3EDJA 4DWSD 4GQQA 4DWSA 1E1FA 3VIKA 3NSXA 5A6JA 2IUZA 1WZAA 2J7HA 4CGTA 2XM1A 2CESA 4HZ6A 5EFFA 3D4YA 4GIAA 2J7DA 3POCA 1GOWA 4AYSA 1VENA 2BNJA 2Y2WA 4WLCA 3VMNA 2YDSA 2VQUA 2F7RA 5DT5A 4CU7A 4AD2A 5FCZA 1X6NA 3MUZ1 2BHUA 5BWFA 4AZBA 3T2OA 2JF6A 9CGTA 1SMDA 4FNUA 2XFYA 4JAWA 4AW7A 2WMIB 2EEXA 1W2PA 4HMDA 3NSMA 2IXVA 1H41A 3WD4A 4DUXA 1SYTA 1D2KA 1QNOA 3AQUA 1UUQA 1AMYA 2D1ZA 2D20A 1W3HA 4NZCA 1FH8A 2ZXQA 2C8NA 1GNXA 2W62A 1FHDA 2CHNA 2J78A 1HX0A 2VZUA 1TA3A 1FA2A 4PUEA 4BQ2A 4CD4A 4E4PA 5I3DA 4D6DA 3WDPP 4NRSA 1BVNP 3APGA 2ZUNA 2F18A 3M6DA 2E8ZA 4JKLA 1NOUA 2GJXA 3L4ZA 5E1QA 1Q6EA 5FOOA 3TONA 5M3WA 4PBGA 4D1IA 4D72A 2ZWZA 5EFDA 4LXFA 1R34A 1WP6A 5BXSA 4ML4A 2V38A 1GCYA 1ISXA 2CYGA 4F9DA 5CSUA 3AIVA 4AIEA 1GW1A 5A2BA 4RL3A 3SCWA 1E3XA 5HNNA 3ZT6A 3BAYA 5LYRA 2ZE0A 1X1NA 4M24A 4JCLA 2BHZA 4HMCA 1OGGA 2YBUA 1K9FA 1BYAA 2HISA 2EAEA 4B15A 5BRPA 3VD3A 3RM8A 1QHPA 1KQZA 1HJUA 4GI8A 1Q6CA 1I75A 3W27A 5I77A 1BG9A 4R27A 5HPOA 4M82A 1EOKA 4KGJA 5FIPA 1BYCA 2D23A 3N15A 5E9AA 3CUJA 3ZR5A 3D3AA 2WHLA 2JF7A 4MNKA 2J79A 1U33A 1QWUA 2WNWA 4JKMA 1L8NA 3VOCA 4PCSA 3L4UA 1E0VA 1OIMA 2VX6A 2D3NA 2GK1B 2VCAA 4AD3A 4NF7A 3BUIA 2VVNA 2PWFA 1JFHA 3T0BA 2YA2A 4U33A 4QCFA 1KCKA 1W9PA 1ITCA 1LF1A 1WB0A 1UWTA 2JE8A 1M01A 1GZJA 1CYGA 3MUIA 4AMWA 1LG1A 3SCOA 1JF5A 3TTOA 3WFZA 3CIVA 5KEZA 3GNOA 1R7OA 4AIUA 1RPKA 3ZQ9A 4TTGA 3WY4A 4PTMA 3TOPA 1J0ZA 4CUCA 1OGSA 3HJEA 4AMXA 5A2AA 3HG5A 1EA9C 3L4YA 4P8WA 2PBGA 4OOZA 2O9RA 3OLIA 1H3GA 2YBTA 3ZJ7A 1NP2A 1JZ4A 4PMUA 2F7QA 3G6LA 3K4DA 4XZBA 1B3WA 1PX4A 4OZOA 1TMQA 1SFSA 3SUSA 1XYZA 5DF0A 1W3KA 3J7HA 4J3TA 3UEQA 3UETA 3O6AA 1UD6A 2YIHA 3GXDA 3WNOA 3KL5A 2HVMA 4UZSA 5A94A 3II1A 3D51A 1CGYA 1JFXA 4GZEA 4AEFA 1CWYA 1XSKA 3I3DA 1UZ4A 3OGRA 3LPGA 1KQYA 3I3EA 2ZUWA 2DH2A 3VM7A 4KRTA 4JL2A 4JIEA 3CZLA 2YL6A 1QX1A 3OLEA 1OCQA 2OSXA 4U31A 3PBGA 1UWUA 3W25A 2WMFA 5BROA 4TVUA 2WVTA 1PJ9A 1UD2A 3DDGA 3WY1A 2WKGA 3PHAA 5I2UA 2BXYA 5CLWA 4UOJA 3T0AA 2G4FA 2XN0A 1B30A 3KL0A 4X9YA 3MV11 1ZBKA 4AZHA 3PZIA 5JIWA 1KXTA 1C93A 1DWJM 3AMKA 5A2CA 3KWXA 4IUGA 3MSDA 2GUYA 1KBKA 4BQ4A 4C7GA 3RIKA 3AZSA 3WD1A 4AEEA 3OGVA 4DM1A 4AZCA 3B8SA 2DGAA 1KTBA 2VX5A 3WQ4A 3IK2A 1E4IA 4R5EA 4DO4A 3ZMRA 4L4OA 4ACZB 2J7CA 1XGZA 2CBUA 1UR1A 2VO5A 1UASA 5GNYA 1MVYA 4PSRA 2TAAA 4HA3A 1PAMA 1TVPA 3WKZA 3IJ8A 2EXOA 4ZE4A 1WAWA 3AXIA 3DDFA 2YJQA 1QI0A 2WBKA 1C92A 2QHAA 2V5CA 3RJYA 1VEPA 3CH9A 4TTUA 4DWSC 2D22A 3QOKA 4CCCA 3MS8A 3VILA 4CVUA 3QHOA 6CGTA 2ZUSA 2DT0A 1ODZA 2A3EA 2D0HA 5GNXA 4U3AA 5A6LA 3F5KA 1WPCA 3AMGA 1CNVA 2QMKA 1DWAM 4UQAA 1ISZA 1GOMA 1J18A 2BY2A 4OOUA 4JFWA 3WY3A 4GZJA 4UOQA 2B31A 2ZXDA 2YDQA 4HZ8A 1WNOA 2DT3A 4WKHA 1CXKA 5DEZA 1KXHA 2DH3A 1TQUA 4J3VA 2OYLA 1IV8A 2VRQA 1B9ZA 2G3MA 1KFWA 1JZ6A 3VD5A 4FNSA 1NOWA 3WNKA 3UG5A 4GKLA 1M53A 4W5UA 1H09A 4BZYA 3GBDA 2C0HA 3U57A 4Q7NA 3T09A 2DT2A 3MMUA 3N11A 1OSEA 4B3KA 5F7UA 2EACA 1LLOA 3K46A 3A23A 4CD5A 2EPLX 5CLTA 2VVSA 4CU6A 3WH6A 3WNPA 1KWKA 4UZUA 1KBBA 5A6KA 1XHGA 1O7DC 4OIFA 3VM5A 2YFNA 3ARZA 3AIEA 1KGUA 1JZ7A 4OGZA 4JHOA 2V3EA 2ZX6A 2VCCA 2BVDA 3WNNA 4MJ2A 2WC7A 2D0FA 1VEMA 1E6SM 2Z1SA 3AMLA 1I1WA 1PIGA 3VGDA 1EDGA 2JEPA 2XFFA 3WF2A 4AD5A 5BYWA 2WHMA 7A3HA 3VDHA 3WD3A 3IJ9A 5I5RA 1HKKA 4Y7EA 1UWIA 5I24A 3WL1A 3K4AA 3KZSA 3VDCA 1WDSA 2OWWA 4D6IA 5A6BA 2WMKA 3RILA 2DSZA 2XIBA 5FKYA 3S6TA 3GDBA 2A3AA 2OYMA 5AC4A 1VJZA 1GQKA 1NP0A 2Z1KA 4NXKA 3AI0A 1E55A 5ABGA 2ZOXA 3VSTA 1V6YA 4W8AA 1MWOA 1UD3A 3PZMA 1V3HA 1GVYA 3VINA 1EO5A 1HKJA 1QPKA 3OIHA 3LMYA 1GORA 4FK9A 4PTXA 4GXPA 4M1RA 5EB8A 2WWCA 1AQHA 2UY2A 2J8GA 1UH2A 5E6ZA 2DSVA 1QNRA 1H0GA 4W7WA 2BVYA 2Y4SA 2Y5EA 3PZ9A 3EJRA 8CGTA 4S3JA 5A8QA 1B3VA 2BV9A 3AIBA 2V5DA 3NIYA 1LG2A 4AD1A 2VR5A 3D52A 4X0NA 1J11A 1LL4A 4YHGA 2DSKA 3KLLA 1FOBA 2XGBA 4TVCA 2PBOA 1HTYA 3ARTA 4LYPA 1R46A 2E4TA 1E0WA 4IPLA 5GNZA 3FAXA 1QW9A 5A8PA 2BHYA 1VBRA 1MW3A 2O9OA 1HXJA 3AMCA 4W8BA 2QMJA 3WD2A 5C71A 4IM4A 3DECA 3GXTA 4ACYA 2E9MA 4A3YA 1RH9A 1GHSA 1B3XA 3EJTA 5BXRA 1EQPA 2VJXA 4QLLA 1J0KA 3W37A 1DWGM 4JFVA 5C8BB 1J0JA 1HNYA 2VOTA 2AOSA 2F7OA 3A5VA 1Z32X 2WYSA 1QI5A 3CZNA 3CZSA 1V6UA 1Q6DA 1E73M 2DQXA 3GH5A 1E6ZA 1FH9A 5ABFA 1NQ6A 1CXEA 3KE0A 1R86A 2WK2A 3HU7A 4HOWA 2W66A 3N13A 5A6AA 4LX4A 1V3JA 3SCSA 3IAQA 2FHCA 1A3HA 3VIFA 2WLZA 1W9VA 1C7SA 2QLYA 1UKPA 2PC8A 2ZUVA 2WANA 1W32A 5A8NA 4S3KA 1NWTA 1H4PA 5ABEA 4C7DA 1BYDA 2ZXBA 3HG2A 2F7PA 5A8MA 4FLRA 1DP0A 2VC9A 2ZIDA 3SURA 3U5UA 1ZBWA 1MQPA 3GH4A 3CZGA 2Y8VA 1XH2A 2YDRA 2WAGA 3AJ7A 3EDKA 5CPTA 3LPFA 2NT1A 3TTYA 1WZMA 3TP4A 3AS0A 4HMEA 3VU2A 3WUEA 3PZTA 2WVUA 4GZIA 3GNPA 1PX8A 2CXGA 2XWEA 2UY5A 1QHOA 4XUYA 1YQ2A 1UKOA 1Y7VA 1R47A 4LQ1A 4FNQA 2VT0A 1JDDA 5LA1A 4KH2A 3BMWA 1DEDA 4MNJA 5DO8A 2XG9A 1WZKA 1HJXA 2YLAA 3UCQA 3WBEA 3ZT5A 1TQSA 1QNPA 2UWFA 3MUAA 1QVBA 3RM4A 2VRJA 2WKLA 3DHUA 2O92A 1W1PA 4ATWA 1C8QA 2D0GA 2VI0A 2GDUA 4M56A 5D9OA 3WUBA 1CGVA 1OT1A 1GOOA 4D6EA 1W9DM 3CC1A 2A3CA 2CKSA 2PWEA 4AC1X 3H54A 1AQ0A 2WZEA 1JF6A 3WNMA 3AROA 1CEOA 7CGTA 4P8XA 3ARUA 2WVVA 3GXMA 3OA5A 3VD9A 3MO4A 3OGSA 4U3CA 6A3HA 3BCFA 1ZL1A 2GSJA 4XZWA 1JI2A 3GXNA 2YL9A 5BXTA 3VD4A 3OG2A 2ZUMA 3AIWA 4J28A 3VMPA 5D9MA 1J01A 1H1NA 2EADA 1UG6A 1JGIA 2WHKA 1OIFA 3NUKA 3AS1A 3MKKA 4P7OA 1CLXA 4FLQA 1EIBA 4ZEPA 2VZSA 1XSIA 3A4WA 1OGBA 3F5JA 4IPNB 4DO5A 3LXAA 3QHNA 1C7TA 4CN1A 1K9DA 3WDRA 1O7AA 5E0FA 4FLSA 3AHXA 1FH7A 2D73A 3AS3A 4Z2JA 1BYBA 3BVXA 4PTWA 4TOQA 2MANA 1QBAA 5D4YA 4P8UA 4W89A 1UHVA 2G3JA 1UKSA 4OBRA 1LWHA 3ZR6A 1B31A 2EPMX 1JZ5A 2XGIA 2WMJA 1OM0A 1GONA 1R7AA 2VTFA 4V2XA 3VTRA 3WQ5A 1O6IA 3H55A 1JAKA 3A21A 3AXHA 4QLJA 3ZJKA 4Z2HA 1WCGA 1LQ0A 4YN5A 1HF6A 3MV01 2G3NA 2CBIA 1JD9A 1PS3A 2YA0A 2EJ1A 4W7VA 4W93A 3MMWA 2CITA 4GPNA 2EPNA 3M46A 2XVNA 3PZVA 2X0HA 1UH4A 4FNRA 5E70A 4C7FA 4UFKA 3VDBA 2A3BA 1EHAA 5D8ZA 2EO7A 3UG4A 1HP5A 2O9TA 3IJ7A 2DPEA 2YFOA 5A8OA 8A3HA 4NZJA 1OD0A 3LRMA 4F8XA 1KB3A 5I79A 3B9EA 5CPQA 3EJUA 2EPOA 2W67A 3DX2A 2WWDA 4PYSA 1GQLA 2BS9A 1ECEA 1G94A 1OD8A 1E4LA 2VMFA 1V3MA 3VIGA 3S5ZA 4NZFA 1ISWA 5FL1A 3VIOA 2PWGA 2ZXAA 4UFHA 1MQQA 3VIMA 3H53A 1CGWA 3DX3A 2E9LA 3L2LA 2UY3A 3BH4A 1PZ2A 3DC0A 4PMQA 1UR8A 3WH5A 1RD6A 2F1AA 2GDVA 1LL6A 4UNIA 2F8QA 2WW5A 2E0PA 2VZTA 4RE3A 5TD4A 2J7EA 2VZOA 4WK9A 2BY1A 2WMIA 3W81A 3ARRA 4E2OA 3VNZA 3AYSA 2WCAA 3FHAA 1KR0A 1JXJA 4CVWA 2CHOA 2WMGA 3ZOAA 3CHEA 5JUVA 1WO2A 4W84A 1R33A 1MXDA 1V03A 1SMAA 5CJ5A 1NWSA 5A69A 3WH8A 1GJWA 2CPUA 1JXKA 5HBFA 3DYMA 3A22A 2PF0A 4UOZA 1JL8A 3FAWA 3N12A 3MSGA 3D50A 3A4XA 4NXSA 3TTSA 1Q6GA 2PWHA 1EOMA 3BVTA 1W9UA 3UG3A 4J3XA 2RGLA 1TUXA 3N18A 3G6MA 2F61A 3T08A 1J12A 3GM8A 1WE5A 2WCSA 2JFEX 1TQTA 2VCBA 4JFSA 3BVVA 4AISA 1XH0A 4H8HA 1FHLA 1UWQA 3TTQA 3BSHA 3PN8A 1E6XM 1Q6FA 4MTVA 3LX9A 2CEQA 1G5AA 3WF1A 4HA1A 4PMYA 3ZIZA 4PUDA 3BCDA 1TQWA 3SUWA 1E71M 3ZSTA 4P8VA 1JI1A 3VD7A 5A95A 4MDOA 3FW6A 1NWUA 4V28A 1KWGA 1HJVA 3CHFA 1KTCA 1QI4A 3D5HA 1TVNA 3ARVA 4U2ZA 1JD7A 4PMNA 4F9JA 4UCFA 1E43A 2XFRA 3VGBA 1IT0A 1VFOA 2NT0A 3CTTA 5JBFA 3W53A 4J27A 3W29A 1E6QM 1E3ZA 4WF7A 3W24A 3WSUA 3UERA 1UR9A 3AHZA 4LGXA 2Q8XA 5D9NA 3FXYA 1KGWA 2W4XA 3PTMA 2FHBA 3BAJA 5CZKA 2J7FA 2OSWA 1VFFA 3A3HA 4WIWA 2X2HA 1CLVA 3UR8A 3L2MA 4NRRA 4Z2LA 1VAHA 3VGFA 2FH8A 5M5DA 2FYVA 3F4VA 4TUFA 2GK1A 3FHQA 1R87A 3BLPX 4DUWA 4H04A 1WZLA 4CCEA 1E40A 1QNSA 4H7VA 1UOKA 1VBUA 1VJSA 4UQBA 4RE2A 1GOQA 2VX4A 2ZICA 1E72M 2JALA 4W88A 1HT6A 3KL3A 2FHFA 3PTQA 3ZJ6A 4ZXOA 4PMXA 1S46A 4NSBA 4P7QA 2EQDA 4PMVA 4PRWA 5A1AA 3ZM8A 1UR4A 2J4GA 3CUHA 4JCMA 4AD0A 1HVQA 2J62A 5EMYA 2E9BA 3K1DA 3NCOA 3CO4A 3VDAA 5CG0A 1C91A 5EBAA 4ZXLA 3WNLA 3MI6A 3BAIA 1H11A 4GINA 2XWDA 1NWRA 4XB3A 1E4NA 3ARSA 1EXPA 5I0DA 1VRXA 1ISVA 1BFNA 1JG9A 4PSPA 5AYIA 1OINA 3W28A 1PEZA 1QI3A 3VSUA 1J0YA 3GYCA 5FD0A 2ZX7A 2J77A 4P7RA 2WC3A 4DWSB 1OB0A 1UD4A 3QR3A 4P7NA 1XD0A 5A6BD 3VIJA 4Q22A 3A6OA 3W6MA 1BG4A 4TX8A 4UTFA 2X1IA 3WDJA 4UR9A 3WMCA 3GTNA 4DO6A 1CXLA 4FLOA 1R85A 5HOSA 1US3A 1HWWA 1Q4NX 4D6FA 5ABHA 1M7XA 3THDA 3GXPA 5IDIA 2J7BA 3WMSA 4LYRA 5BCAA 3SEPA 4YHEA 3T0DA 3LPPA 1JYXA 3CHDA 2XVPA 2DDXA 4ZFMA 2WB5A 3SCPA 3CHCA 3U5YA 5E09A 4BQ3A 3N17A 4WKAA 1GQIA 2C7FA 3SCQA 1V0LA 4H8UA 1EHNA 4PMRA 2CETA 5GQBA 5ECUA 4AYGA 3GXFA 2CKRA 3A24A 3ARQA 3IANA 3VX0A 3ARWA 1HJWA 2WZHA 1BSIA 1E5JA 1C8XA 4ACZA 1UA3A 2YL5A 4QDMA 2EABA 2IGTA 1TA3B 2DIEA 4OKDA 2WC4A 2WPGA 1GVIA 2O9PA 1V6WA 1U30A 1M04A 3O2LA 5DMYA 1JZ2A 3WMBA 2BVTA 3VVGA 1ZS2A 4V27A 5I78A 3FNDA 2X2IA 4PMOA 1R8LA 1C90A 1HL9A 2GJXB 1JYWA 2G8ZA 1E70M 4JKKA 4NI3A 2VR4A 3DX1A 3WENA 4B16A 3WQWA 4W7UA 1QOXA 3BUBA 4EKJA 2EPKX 4JHZA 3RMEA 1B2YA 1GPFA 3GNRA 1J0IA 4PEEA 1CIUA 1ZU8A 2OW7A 3KLKA 3L4XA 2XVLA 1NM9A 3L4TA 1F4HA 4W87A 1HJQA 3CZEA 4OUEA 1IZJA 2V3DA 1TFVA 1FP8A 4MJ4A 3VGHA 2WVSA 5HDRA 4D71A 4PMDA 4Z2KA 1B1YA 4U2YA 1JZ8A 2FDMA 2CCRA 1E9LA 4F79A 3BMVA 2ZUTA 3W0KA 1GJUA 4QAWA 2CNCA 1QHZA 1GHRA 4KMQA 4CD6A 4M81A 2DT1A 3N9KA 3A47A 1ODUA 1XD1A 5HXMA 3S2CA 3VNYA 3QOMA 2OWCA 4A4AA 4QCEA 3JUGA 3LRKA 1KGXA 2FE0A 2NW0A 4JFUA 1LL7A 4RE4A 1VIWA 3EJQA 2GJRA 3NDZA 4MAVA 4MB5A 1JYVA 3LRLA 4WSJA 4MNLA 2W61A 2CBVA 3OB8A 1XV8A 4KRUA 1PX3A 4IISA 4MB4A 4MB3A 3W82A 3ZJ8A 1GUVA 3EBVA 1QWNA 4A3HA 4J3SA 1B3ZA 1HXKA 3SCTA 3BVWA 2UY4A 1D3CA 1D7FA 1BHGA 4ZE5A 3AISA 3AYRA 3WQ6A 3N04A 5M03A 1UH3A 2OLHA 5I6SA 1UYQA 4AD4A 1AVAA 3BAWA 3U7VA 2E8YA 3WQ8A 4HTYA 3MU7A 7TAAA 2DSWA 3GXIA 4AZ6A 4F66A 5DFAA 1V3LA 1E6PA 2A3HA 1SZNA 2WZIA 1UD5A 3WD0A 3BUDA 1HKMA 1CGUA 2QPSA 4DM2A 3MUY1 3CBWA 4B9ZA 1QI2A 3S5YA 4JFTA 5I23A 4FF5A 4UFMA 2JEQA 3LXCA 2XYLA 4MNMA 4UQDA 4CCDA 3WL0A 3AHVA 3EMZA 4J3UA 1MW2A 5AYBA 2BXZA 1V0KA 3EDFA 4CU8A 2X2JA 3O9NA 3HZ3A 1BQCA 1JYNA 2RGMA 1VFMA 1V3KA 1JZ3A 1CGXA 1CPUA 1VEOA 2YLLA 4W8LA 3WY2A 4W85A 1M03A 3W26A 1EO7A 1EDTA 5M17A 1KCLA 4ZENA 1F4AA 1CXFA 2X2YA 3HMCA 1ZB5A 3RJXA 1BGAA 3WDQA 1W3JA 4D1JA 1WKYA 1JNEA 3CLWA 2ZX8A 4BQ5A 3RM9A 3W4RA 2OSYA 1GOIA 1FP9A 2VZVA 3K8LA 2WMHA 4AZCB 3WUFA 2XSBA 1UR2A 1UR0A 2WM0A 2XVKA 2G3IA 1KXQA 3FY1A 4J7RA 4CD8A 2G41A 3WELA 3D4ZA 3BXWA 1E5NA 1V02A 3BGAA 3CZKA 3AIQA 3VGGA 4AXNA 2QV4A 3CPUA 1XRVA 2WXDM 4D6GA 3VIHA 1RP9A 2WCGA 1I1XA 2Y8KA 4HU0A 3EYPA 4KGLA 3L4WA 4AZ5A 1BVZA 1MFUA 4NX0A 4AZGA 4QP0A 1E6NA 4AZ7A 2F2HA 4HP5A 1QNQA 1T0OA 4WKFA 4K68A 3BAXA 3WDHA 3EJSA 3EMQA 3DX4A 4U5IA 4BS0A 5LA0A 3T2PA 3DX0A 1GQJA 1HJSA 1U2YA 4LYQA 3BSGA 4AZIA 5IHSA 4AY1A 1HL8A 4HOXA 1MFVA 1ZBVA 3CUIA 3WF3A 3WBAA 5JBDA 2J75A 3ZSSA 2XIIA 4AMCA 3SUTA 1H5VA 1ITXA 1UWRA 3B9DA 1FFQA 4H8VA 5GPRA 4D6HA 3AS2A 3NYDA 3VUPA 3B9AA 1ZJAA 3AIRA 1CECA 3ARXA 2ZX5A 3WEMA 2JIEA 3GBEA 3CMJA 3K8MA 5CPSA 3WFLA 1E6RA 4DUVA 3AZTA 1CTNA 3PZGA 1E15A 3VIIA 5BRQA 3AOFA 3U7BA 4CKQA 3ALFA 3VO0A 3SCUA 1LJYA 2D3LA 1HIZA 2CBJA 4HU8A 5HPCA 3WH9A 2OW6A 3BC9A 1J10A 4MDPA 1XSJA 1DHKA 3UESA 1W3LA 1B3YA 4H2CA 1ISYA 4Z2GA 1XH1A 1DWFM 2VUYA 3EDDA 1JDAA 4URIA 3CGTA 3E1F1 5IHRA 1HKIA 3SCRA 3VMOA 4KWUA 3WF4A 3VSVA 3W38A 1MYRA 4FMVA 2XHYA 1CGTA 2FGZA 1A47A 4YPJA 3PTKA 4AWEA 4UFLA 4PTVA 2NSXA 4GO8A 3DYOA 2V3FA 3CV5A 2VX7A 3GH7A 1GOKA 3BUQA 3I3BA 2X09A 1CENA 3MANA 3BVUA 3ARYA 1ESWA 4EAMA 1EQCA 3FN9A 1C3FA 3EMCA 1W9BM 5IFTA 3EJPA 3HN3A 4L4PA 5FL0A 2XUCA 4BA0A 3AFBA 3BUPA 4XV0A 2ALWA 1PIFA 3RPMA 2ZWYA 2WHJA 1N82A 1TZ7A 3AZRA 1TQVA 3CZJA 5C70A 2WLYA 2BY3A 1BF2A 1US2A 3K8KA 4JZ5A 2QPUA 3CUGA 1DTUA 3POHA 2XJ7A 1AQMA 2DSUA 1P6WA 4QFUA 2X8RA 1H0IA 3BLBA 1LWJA 1MXGA 2X0YA 4LPCA 5DT7A 1EDQA 4UQEA 3DYPA 2PB1A 2F1BA 1R75A 1W9XA 1MQRA 4AIOA 1SR0A 1WDQA 1WDPA 3RDKA 2V3GA 4MAZA 5E0CA 5CGMA 4MADA 1V6XA 4UQ9A 5D8WA 1UQYA 5IXEA 1KR1A 4D6JA 2X05A 1TG7A 2D24A 1PPIA 1J0HA 3EDEA 2ZX9A 2BY0A 3M7SA 3KEHA 4HA4A 3PZNA 4MB1A 4GI9A 2YA1A 2QF8A 2OWXA 4B3LA 1JNDA 1XC6A 6TAAA 1W2VA 5CXPA 1G9HA 3PZUA 2XTKA 4W5ZA 2EBNA 1C8YA 1CXHA 4BF7A 2JIWA 4TXEA 3HG4A 3OZOA 3SIMA 1W91A 5ABFB 3W6LA 4M29A 2XN2A 1UZ1A 1PZ3A 3TA9A 2W92A 4EE9A 1H2JA 5A6MA 1UKTA 2WBGA 1TR1A 4WJXA 4X0VA 2XPKA 5KZ6A 2J25A 4Z2IA 1B90A 1CDGA 1E1EA
chains in the Genus database with same CATH superfamily
3CL8A 2XTJD 1Q9WB 3NL2A 3S5NA 3LZQA 1JZIA 7FABL 3DI1A 4KTDL 4M7LL 2PI6A 1XWVA 3A6CH 4EXKA 4D9LH 4UV4H 5SWZD 3PQYB 3EYUH 3WN6A 4MA1B 1FH5L 5ABDE 2W9EL 4GYJA 1UWSA 5AALA 3ULUL 1FL3B 5D6DA 1V0MA 3MXWH 5ANMA 5G5IA 3MT1A 3THML 5F72S 3VX1A 3EO0B 2QGBA 2W9DL 3AXXA 4H8WC 2NX3A 1BVOA 3V55A 1FE8L 4GAGL 4WSHA 5AOMA 4MAUH 4IGBA 3MCLL 4UB9A 1UA7A 1G1YA 1DFBL 7PCYA 3GJFA 1YX1A 1WT5A 4FQJH 1DWHM 2YAFA 2VZ3A 5CSYA 3EWUA 4W4OA 2QR6A 2Z7GA 3E6HB 1XBZA 1IBGH 4WSKA 3OPZL 3VVVA 3UW6A 1OAQH 3BLKA 1T2QL 1JCVA 1JCXA 1F90L 5DXWA 5E8OB 1IEAA 3MV7E 4GG6E 3FT4A 3WO8A 3R94A 2OSLB 3BEVB 3MRNA 3ARDA 4IK7A 5F9OL 2HPOA 1S5TA 3W7RA 3CXFA 2HLAA 4H13C 1KDIA 1ORQB 4J3WA 4P2QB 3TS8A 3FUMA 4C58B 5H4ZA 3OHXC 4PAZA 4NQXB 2XWJA 3CVDA 4QRRD 2Z2AA 1BFOA 4A8IA 1MJUH 4WY0A 2MTPA 4P59H 3I7SA 1N6QL 4NAEA 1T1XA 4HSNA 4PJHA 5IB2A 5IQMA 3FJNA 4XPHH 2D31A 3QC3A 1JDCA 3SD2A 1J9YA 1EH9A 5GHWL 3NPVA 4ELMA 1EEYB 5E8EB 1DQMH 2NNRA 4N9OB 4LLQA 3L2IA 3HE7B 5I17B 4HZ6A 3A9BA 4GIAA 1XGUA 1VENA 2BNJA 2YDSA 3UZXA 1YA5A 5IMOB 3FNKA 4DPRA 4XN4A 3N42F 3WGVB 4W9TA 5IVOA 4FX7A 1JULA 1HAUA 4WFED 2QSTA 4L1TA 3UPWA 2VP8A 2YAEA 2E7DA 4DUXA 4YR6B 3VNMA 1HXMB 1DFXA 2D1ZA 1IHIA 4KXDA 4OFYD 1RURH 2G9HB 3EYVB 4JO3L 4HWZB 4ZUTA 2CJUL 2F54A 4MASA 3U4FA 2HFFB 4PJCE 3B43A 5D2LE 2B2XH 3O8XA 2WWMD 2FJFA 4LAQL 1XGPB 3E6EA 1FWBC 2A85A 3O4OC 4HQQL 2BOBB 3V6OA 2W65B 1WAEA 2ZP0T 4LU0A 3V5HB 3TH3T 2ZTKA 2RCSL 2V5KA 3NZUA 4P2VA 1BYAA 4AG4H 4KDTA 4XOBA 5LIXX 2O6DA 5CSRA 2YBGA 4TSCH 2DMKA 1IGIH 1PLAA 3W27A 2FVNA 1WUNT 2X6BA 5C0JA 4PRHE 4NHUA 2K3HA 3HI1B 3PF3A 1ACYH 1RCQA 3DG3A 2N4IA 1W72A 35C8H 4PCSA 1OIMA 5E08L 2W0LA 4OTXH 2GOKA 3T0BA 3V4LA 2VN3A 1XLCA 4F3FA 3ZZQA 5D2VA 2UUDH 4F9PA 1WB0A 3MYOA 3BPWA 2QVTA 3C8FA 3SCOA 1NDZA 1NGYA 2X1RA 3ARGC 1ZAHA 1RCOB 3R4DA 2ICWI 1TFPA 2YD2A 4MNQD 1R2RA 2A5UA 5J8LA 1CU4H 1NDGA 5HDQH 1DQLH 1WCBA 4HSOA 2VEMA 5L2JB 1WKEA 4XZBA 3GLDA 4U1NA 3ZTNH 4AWUA 2CLZA 3P0VH 3ZDYE 4PJIB 4J3TA 4RGMB 1PQZA 3FXGA 4QUOA 5G1MA 5CCZA 2BCMA 4TUJB 3TN5A 3SQBA 3AY4A 3OKKB 5IFJA 2KUTA 2RQ8A 4TVUA 4QHLA 1WBZB 1UD2A 1KFAH 3FGCA 3QUXC 1ADQL 2EICA 3E2RA 4ACZB 2W65A 2CLRB 1P43A 5C0BD 4TNFA 1OARH 2GPTA 1A5KC 4R3SB 1IFHL 3DDFA 1TO5A 2QHAA 2X7LB 2V5CA 5FEBA 4UTBA 1JPFB 4E9VA 5C2XA 4U3AA 2QMKA 4R34A 1ZWIB 1BM3H 3HAEG 1BGXL 4QRQB 3JTBA 5GGTL 3RGHA 3WHE0 6TIMA 1NC2D 3GRGA 3DVFA 3K4ZA 4PI0A 5BRZA 1OCOB 2H9AA 1KFWA 1JZ6A 4OGQC 5DRZB 3VD5A 3L7FA 2NSQA 1UA6H 3LENA 2YXGA 1MLBB 1RU9L 1RZPA 3EPMA 3BZGA 3B7YA 1RXOB 2NQCA 3VI4A 2N0KA 5FAAA 3QWRD 3N11A 3BQUB 4K3GA 5CPLA 4BCYA 4H4NA 3RHWK 1ZLDA 4I4WB 5LNGA 2Y6TE 3ARBD 4X22A 5DQDH 5I3HA 3BI9X 3LY0A 3W22A 2XX0A 2RJHA 3SDXE 3MRGA 4I6KA 3CU1A 3FB6B 2Q2LA 5KINA 4EX4A 3TW6A 3VB9A 3MTRA 4LCYB 5LKNA 5BS0D 4LKXB 4NQCB 1KC5H 1IXOA 1Q66A 1YN6A 1RCYA 1D5BA 4W9KC 1HH9A 1PY0A 3OKKA 2OQLA 4KQ4L 3QDMB 5C7VA 3OSKA 5KSAC 2AL2A 2C79A 4XOCA 1QR1B 3QJFA 4YPGA 3BW3A 3SDCA 4K7PL 5LQBH 4OUUB 4AD1A 4BQCA 5D8JH 2PBOA 3HKFA 5ENWA 4QSHA 2E4TA 5J8OA 4HUXB 4IPLA 5TK4A 2DYSB 1T1WB 5FM8A 2BNQD 4KBXA 4FOUA 4P5MB 4XGZB 3UYOD 4Y4HA 5C07A 5CZVL 4EIUA 3CX5J 2NX5E 1OGAB 4W9LC 5FCUL 2DW7A 4PLJC 5D1ZB 1NBZB 4GGHA 5AZ0A 5FYJD 1IGWA 2DQXA 3MHGA 1FH9A 6PAZA 4LRNH 4M1GH 3UTQA 5IP4A 3EX4A 2WLZA 1EP2A 1YPIA 3R12A 2B1OA 4R9OA 2ZUVA 2NQ9A 4DZBA 2VZ1A 1FKXA 1BVWA 2Z93B 2E68A 6PCYA 4LL9A 4J4PD 3W1ZA 1I9CB 2YD5A 1THCA 3REQA 4NBZB 3GH4A 5SWQA 5EU6B 5H2BA 3LPFA 1ZT1B 3JWNC 4PJXB 1A1NA 4ENLA 2BOFX 5GGVY 1U9KA 3W71A 1CL7L 1YQ2A 2IPKB 4LQ1A 3I75A 4LCYA 3S9ZA 1WZKA 2KZWA 2Z35A 1TQSA 3NTCH 4P9MH 2AGKA 1KBGL 5JW3H 1Y0LB 1U93A 1F56A 2OP4H 5F2LA 3MV9D 4DEFA 1SZEA 3DROB 3QI9B 4DLMA 4QITA 3AFLA 2CHDA 4UT9L 3X13B 3TA3B 3TCSA 1QR1A 3UWVA 3TWBA 4LSVH 3TBCA 2A2IA 2KQNA 1ZL1A 3LB6D 2FZNA 3TQPA 4NJAH 4J28A 4K38A 2HZHA 2DYRB 3CVCA 1OIFA 1DN2A 4GJJA 4WO0A 1AG0A 4WHBA 2KDGA 3MA9L 4CGUB 2ZF8A 1KA9F 3MRHA 4QEGA 1NANH 4JLRA 3HQNA 3SIZA 4PJGB 3BAEL 1QK0A 2AXHA 2VXTH 1FH7A 2W1NA 4K8RH 4XTIA 4O02A 2FSDA 1GZHA 3LSOA 1PSKL 3D2UD 3IMBA 3C08L 3NCFB 5M95B 3BZDA 4DVOA 2B3IA 4KTYA 1PYWA 1OFOA 1FO0A 5AWNL 1UZDA 1XBXA 3EGXA 4OJEH 3BRFA 2VL5A 2CLVB 1R7AA 2A5HA 5GIRA 3ATZA 3SJVB 2ADGB 4BK5A 4FTVB 4JFQA 5JHDD 4ZMAT 1IXQA 3GC3A 4PUBH 2NDFA 1Z5LB 2PDWA 3K81A 3CJJA 3AW5A 4GG9A 2CDFA 5K9DA 5D8ZA 5EO1B 5LVEA 2J7LA 2VITA 1HP5A 4M5ZL 3DU0A 1ZQ5A 4NZJA 3RX5A 1GC1C 1G69A 3EZJB 4QXGH 2QIIA 3T4AA 2OJPA 1RK5A 4BSWB 3E3QC 3EJUA 2BX5A 4DUOA 1BZ7A 4KQ3L 3U1SH 3M7FB 3KS0J 2ORBH 2NW3B 1AFVH 1ZEAL 2F1EA 4RBPH 1UXWB 4ZTXA 3VIMA 3DX3A 4JG5A 5A16B 3BH4A 1I0DA 4AOFA 4ZFFB 2V2DA 1QBLL 1F97A 1O9VA 4UU9A 3II3A 4U6VL 2VZTA 4C6QA 4GIEA 3QQ4B 1BEXA 3HBZA 1U8MA 5EUOA 2VDHA 3GLCA 1MNSA 4Y4FB 3DARA 5K2ZA 4H20H 6FABH 4WKXA 5LBGA 1GG0A 2QLVB 4KI5E 3TWYA 4W84A 1NWSA 2QJMA 3DFNA 4PW4A 4YYFA 2F15A 1KBLA 4YTQA 4XO6A 1U8KB 5I76B 3CVIH 3IKKA 5IJVA 3D50A 1RZJC 2OBGA 5HPMB 1ZA6A 1N0LB 3BVTA 3QDHA 4PJ9C 3V6BR 4HKXB 1KCRL 2DQGL 2FZ9A 2HXUA 4AQ1B 5IBUG 1TJIH 1TQTA 3N29A 3ARED 3TFKD 3GS4A 1PCKA 2Y62A 2QCDB 3LX9A 4PFHA 4HA1A 3UPBA 1LUCA 1DJSA 1KENH 2DQCH 2EEBA 3CHFA 1ZLVH 5C9UA 4EZJA 3PQYE 4KUZL 4I7UA 4KK5D 4YK4C 3SBPA 2XFRA 4J4PC 4XVTH 3T6CA 1E3ZA 3HFMH 5FA4B 2PMZA 1IEXA 2BVPB 3EOTH 4MQTB 4ZJ9A 2Z7UA 1UUOA 3W23A 1ZGLA 4U1JA 1IEHA 2J7FA 3SDAD 1U8HA 4HLJA 2P46B 3HTLX 3WLHA 3KCPB 4Z2LA 1BX2A 1Q9OB 3VGFA 2WP3T 1KTDA 5LG6A 1RBLA 2WNKA 5FJTA 3I7RA 2CQVA 1X97A 4R7DB 1H9DA 1QPQA 4YEEA 2VD8A 1B3IA 5ECJE 2CAKA 3ZJ6A 1YECH 3VFPB 1G43A 3ZL4H 3QB7C 1KM6A 2E4FA 3AACA 4WW1B 3QZEA 5EMYA 2CBTA 1X4XA 2X4OA 4C4BA 4AF0A 4BE5A 2EXTA 1GGYA 3LB6C 2FL5B 3MRQA 1CL7I 3WE1A 4EXQA 2XFXB 5I6XB 4P2QE 2E27H 2X42A 4UYQA 4EF3A 4HJGA 1Z44A 2K7PA 1BVLA 5DWUH 2ZRYA 2FWOA 3CVHH 4QHNA 3UTPE 4UTFA 1PFOA 4GVIA 3CX2A 2J7BA 3KXFA 1BLNA 3DERA 5BCAA 2CBQA 3UADA 2NUTA 1JYXA 4PJAA 3RBGA 4FYRA 2CKBH 4XXCA 3MUGA 3BSZL 5XIMA 2YPLA 3ARQA 4ZW3A 5E95B 4MF4A 1E8WA 2A4CA 4UINL 5BV7L 5D03A 3D7PA 4HS6B 4MHHG 3C0JA 4O4YH 2X88A 5I1IH 3WFBL 5ICZB 1IQ8A 3DPBA 1EWEA 1FFOB 3M6YA 4WVRA 3T8VA 4G8GB 4YHZL 1MRDL 4PEEA 1N8OE 3NCMA 5DA4A 3F7RA 1F6LL 4LU5L 3B8IA 1WAAA 3L4TA 3S37X 1G4MA 1D7BA 1TYJA 1HJQA 1BVKB 3MRIA 4Y16D 4OUEA 4ELDA 1FP8A 3KW3A 4XP6L 1ADDA 2YRPA 5M7QA 5DD6B 4A3QA 5DRWB 3U36B 4Z2KA 3PNWB 2Y7NA 1V6TA 2MEJB 3QFGA 1XLIA 1AZ1A 3PPFA 2EDNA 1BAFL 1YDYA 1TPC1 1YDNA 3BMVA 5T26A 1I7ZA 4A63A 3DJZA 4HALA 1ETJA 3O6FA 3SRHA 4YFLI 4DK6A 5IFAL 5ITBL 3IJLA 4JHBA 3CQKA 3ECVA 2LV4A 3DBXA 4YWGL 1UBPC 2PDXA 4A8RA 5HGBB 1JYVA 2HLFD 2W60B 1XIIA 4G42B 4H3DA 4ZW8A 2MTAA 1A6WH 4B4FA 3BVWA 3AREC 3B9KC 3JZUA 4X4ME 4XN2A 1FAIL 3EA2A 3N43B 4NUGH 4HGMA 2Y7EA 1U4FA 7TAAA 5D6CB 1V3LA 3WD0A 1TQJA 3HBGA 2EUXA 3MUY1 3MBDA 1LL1A 2WYZA 4TVPD 2ZUQB 1WHPA 4ZQCA 2O4QA 5FYLE 2FTWA 4UIKH 1E9PB 3T81A 2RB8A 1ML0A 2BS8A 3P77A 1HSAB 2PDLA 1UT9A 2B3RA 2FEDC 2C19A 2Q7YB 2X2JA 4S3AA 2G3FA 3RB7A 1DJXA 3H42L 4QSFA 3ZVHB 3KEDA 4JN1H 2P53A 4W85A 1AIFB 1EDTA 5M17A 3RWDB 4NO5A 1XI3A 1CXFA 3K0WA 3NM3A 2BNRB 2VERN 3GQYA 3VNKA 5BZDA 3M8OH 1JNEA 3P3UA 3IWPA 5RUBA 4Z0BL 4F57L 3Q8AA 4QRUB 4PJIE 1UR0A 4LAMA 2XVKA 3MLYH 3QORA 2JLPA 3IEBA 3N85L 4NQEA 4AL8L 4K2UH 2DL9A 2QUUA 4PBXA 5DRWA 2ED9A 3L4WA 3S3DB 2F53B 1P1VA 5FJRA 5ITFB 3QY6A 4HPYH 1F3DH 4XRCA 3BAXA 3L5WA 1WV2A 5SX5H 2CU9A 1U2YA 3UYPA 5DUML 4YH6A 3RYMA 5T5FA 1RLDA 4H1ZA 2F74B 2OKTA 4BGLA 2K0RA 1UWRA 5INCB 5A2IH 4NT6A 3SE3A 4AHPA 3Q2VA 2ADIB 4S11A 3C5SB 3QCVH 4MXWH 2VDGA 2DQDH 4NZRL 2I25N 5D6CA 4K9JA 3TCTA 1YNKL 4JBSA 5D37A 2QADC 2VN7A 3W2MA 5I3JA 5FC9A 4GKZA 3WH9A 2OW6A 4MDPA 4TSBL 1JZDC 3NEXA 5DJDA 4HEMA 4QXVA 2J24A 3OO2A 1HKIA 5HI4D 3PUUA 4DXKA 1FDJA 3W7KA 4PRPB 4HS3A 3NIDF 3T4WA 3OXRA 4Y16C 3BQVA 3EEGA 1H19A 4IG2A 3UZJA 1PZUB 1FNAA 3I9GH 1C3FA 3PY9A 2IMMA 5FL0A 1KTKE 1ONRA 3BUPA 3X2QB 2FAUA 4KF1A 5G4WA 4BI5A 2ZSVB 3HFFA 3N2MA 1D3GA 5L7XL 5LNWA 4GYKA 4Z7QF 4PMJA 2W0FA 1L0YA 4NQCE 4FXFA 2NW2A 3RZCA 5C9WA 4LPCA 1FHVA 3MR9B 5K9CA 4L61A 1FUYA 1KG0B 3VFUA 4I88A 4IRJB 3J07A 3USZA 3I2CL 3QDME 2RD0A 5HGHA 1TPEA 1NEZB 1PDKA 1OP3K 3ZKMD 2B4CC 4NUJA 3B2PA 1MVFA 1EBAA 1J6PA 1CXHA 1W91A 3OG6B 1E5ZA 1A8JH 2OAAA 4F0HA 4HCDA 3DO7A 3SO7A 4OZFA 1F42A 5KZ6A 4PY8I 4LLVB 4IH3A 2P1YA 5AVWB 4X99B 3C5SA 1CZ1A 1SJCA 2FVLA 1HZLA 1OGAE 5DUBB 2KPWA 3OTRA 3UIZA 1D9KC 1PZSA 4ZQKA 3QHZL 1BGGA 4FFYA 1J7VR 2PA6A 1YMHB 4PJ8D 2NUWA 3BE7A 1RMFL 1OAXL 5AZUA 2GB2A 2Y24A 4JFZL 3EOYG 1QNIA 4KKCD 3GMLA 4YJ5A 4ANUA 2YD3A 5JQ6H 4GRMA 5AG8A 2J47A 4WV1C 2D7TL 5AC5A 2XXMB 5LXGL 4K6AA 1YYMH 3L23A 1JGUL 4PGCB 3ROOB 5CWSA 3QF0A 3QV6A 1IWAA 1XIWB 3JW7A 3G08B 4JL1A 4TVDA 5SV4A 5EU6E 3ITXA 1H49A 5F1NA 4PJXE 4FG2A 4TQIA 4J6RL 1BPLB 3KWTA 5JQIB 1UP2A 1XXFC 4DZHA 4JHMA 3V35A 2TPSA 5HHNB 1VF8A 1XLDA 3JBG7 1YXYA 2WUCH 3QGVA 4RZ4A 4JTCA 2J57A 3MR9A 4HULB 1A3QA 2JSFA 4LLWB 5DMKA 1XX9C 4I18B 1URIA 3F12B 4OCRH 3A4DA 1QEWB 4YVXA 2W63A 4OBSA 4KPHH 5GRVL 1CDYA 3VFSA 1QLRA 5B22A 2FLIA 4WGWB 4KVNH 4S1SH 3M5XA 5DHVA 5B8CA 4ZOAA 2QFPA 3Q6FB 1UQZA 4ATLA 4AYFA 1L7TL 1W1TA 5CU9A 3AU1B 4XP9H 2Z8SA 3O2DA 4KX8A 5FJPA 4G1MB 1YEDB 2Y9RT 1IC5L 4PJGE 4O9HL 3SGDH 4N8VB 4RDQF 4WTZG 2GOUA 2E6DA 1GZQB 3PBYA 3N55A 5IVNA 2HXTA 4UTBH 4XT1C 3MRCB 4BV1A 3FTXA 2X4SB 3GSNA 4F5CA 1CFMA 3SJVE 4O51A 3TN0A 4HB7A 2HPMA 1B5TA 4FTVE 5L4FA 4M9OA 2X4UB 2ABBA 2H9GB 2A21A 5DFVC 1NC4A 1SYVB 2V67A 4ILDA 4JDZA 3CPLA 4XMKH 5FYLH 1A5SA 4HMDA 4XI5D 3IGLA 4W6WB 4CNSA 5TJWK 4FNLL 2XWCA 4Z77B 3IFOB 1AE6H 3AC0A 4P3DA 5EEZA 3QQDB 2OJEB 2MQ0A 3WTVA 4LPUA 2FJHB 1NBCA 4CD4A 1JQVA 2QJGA 3ZKMC 4X4XA 4LIQE 3WHXB 2P3ZA 3WDPP 3OMZA 1L3NA 1N2RB 3BX7C 4JVWA 5IF0B 1XYCA 4FQIL 1KJVB 4HKZB 3GSXA 1ULVA 3LEVH 1NGXA 5LSMA 1A5CA 1VYPX 2SEBA 1XVSA 2BHZA 3GWJA 1S5HB 5BRPA 2FTPA 2Y22A 4HIJA 5DSCB 1AL7A 4KGJA 1KLFA 1BYCA 5G55A 3BW4A 4PJ8C 4PJ7B 3FCGA 1SXBA 4G8TA 4A05A 2L7QA 4X7CC 1QO5A 2I9EA 1E0VA 2VX6A 2VCAA 2Y3NA 3BUIA 3SQOH 3BYYA 3GC2A 4KKCC 3NACL 1SOQA 4LGPB 1IGTA 5E94A 3H6AA 3GU2A 3S5SA 4BH7A 1SVBA 1EPFA 4CDGC 2O30A 3Q9PA 5DS8A 3Q67A 3HI5L 4RIRB 3M17A 5A2AA 3Q13A 2R1WB 1NP2A 1JTPA 1G7VA 2OLSA 2E6YA 4C90A 2EDLA 3D0LA 2X9ZA 3KPRB 1SFSA 1SYVA 3PHSA 3UEQA 3GHTA 1T5WB 3NCCB 4ZFGH 1FC1A 2Y7DA 2NXZD 4JJHA 5KS9F 4AEFA 4X60A 3BT2L 2F5BH 3LPGA 2XLLA 2OB3A 5DUPL 3TE9A 2ZUWA 5I3FA 5CC6A 4JHVA 5H94A 3MUXA 3OLEA 1OCQA 2OSXA 4HNOA 4OIIL 4XVJL 4ANXA 2BXYA 4F15B 4WW2C 3H12A 4P2AA 2NY3B 1ZBKA 2A83B 3KWXA 1NM4A 3AZSA 3EFDH 3MCOA 1KTBA 5T8IA 1EEPA 5MF5A 2J7CA 2VO5A 2VYOA 2X9YA 3GZKA 3IJ8A 5I1AB 4U1KB 3RAJL 3DI0A 2I5YL 2JKTM 1GKEA 2J44A 5JW5B 2PP0A 5AAWC 4GRWB 1P7KA 5CJXA 3JT2A 2GVLA 3F2LA 1NFDB 4LSUL 4GP5B 4Y4KC 5DK0B 1EAOA 2XZAL 2CGRH 5JOFB 4RNRB 1BZ9B 2CLPA 1QLEH 1BF5A 1M9HA 1WGOA 3WLOA 3QIBD 2YMXH 5DEZA 1KXHA 3MRDA 2VRQA 2G3MA 5B38A 4C1LA 4DF2A 5E2WH 2PP3A 1OK4A 5CHNB 3GK0A 1FZKA 4KFZC 4FZEL 3TC9A 4XI5C 3DVGB 1Q0YH 4B3KA 2INFA 2ZQ0A 5AVYB 4RJEA 1RUQL 1QPXA 3VFMA 3EZ8A 1YPZB 4G8GE 1G0DA 4K8RD 4HBKA 2V3EA 4WHYG 3NP3A 2JJUA 2Z31D 1A7NL 4MHBA 3KRSA 3R1GL 3KR3H 3KP1A 3WIIL 3AG2B 2BINA 4FPSA 3WD3A 5AEAA 2E56A 2EIKB 2PLJA 3BJFA 2ILLA 3DRQB 1OLZA 3NJJA 4PRHD 2FZBA 3GLAA 4YSEA 4MLIA 2OYMA 1H61A 2VXQA 3O4LD 5F9WC 2ZOXA 3F7JA 2UWEF 3CCHB 3ILPB 2X4NA 4GAJH 2NQZA 4GUHA 5FO8B 4ZQRA 3PG2A 4H8WL 2GITB 4YHGA 2V5SA 5F6IB 2WB7A 2VR6A 4K5OA 4A2EA 3CXOA 3EGSB 1VBRA 4FALA 3UTTA 1EXUB 2QMJA 2YXXA 3GXTA 3NCXA 1PTDA 2CLKA 2VJXA 4OCWH 2XJLA 4NP4L 4HEPA 4K7PY 1L9WA 5DBTA 3WLWD 4JJ5B 3VC6A 3OG4B 2CJTA 4QXUL 4LSRH 3MODH 4A3RA 2P44B 1KYUA 4L6HA 4IWWA 1YZZA 5T1LD 5GZOC 3KOZA 4PRIA 3RUGB 4A6YB 4MJHA 1J5TA 2BNRE 2PC8A 5LNRA 3ZYOA 2NXZC 4ODXA 4R97C 4KESA 3HC3H 3QQWA 1IR1A 3WBXA 4PRAB 3MCKB 2PC4A 3ZW3A 2DQFB 2PDQA 3ZVVA 4RMVA 4ZNEE 5JU6A 4XUYA 1R47A 4XAWL 5FGBC 3C87A 1JJKA 3O9WB 4UILL 3KBHE 5AW7B 1G7MA 1BECA 1FVDB 1UM5L 2F53E 2V5MA 5EF0A 2NY0D 1H7WA 3EYSL 4M7JH 4DBWA 3VU1A 1YKWA 1T1YB 4M56A 2OZ4L 4OCMC 2ZWLT 1B0WA 5EN2B 5B7YA 2WXNA 2WZEA 1QATA 5BU9A 3CD4A 4QS6A 2ENQA 3VD9A 3OGSA 1WWCA 2JJSC 3WFCL 4AITA 3NPSB 4QNWA 1GYWA 3VKBA 4LIQH 3RX7A 2AVGA 2A6JB 5FYKL 1FLRL 1Z69A 2OK0H 3ZZLA 2N0MA 3U4EA 3AQDA 4FLQA 1G7HA 4F7MA 3S4SG 3WLTA 2DZUA 5BZAA 4IPNB 2XU2A 2PDJA 3U6RA 3T0EB 5DZJA 3K6NA 4JAMB 2ZKHH 1BYBA 4YDVB 3VWJB 3BVXA 3M5VA 4XZ9A 4QEHA 1WK0A 4A04A 2WXMA 3N3EA 2IO5A 4PJEB 5IM51 2Z0IA 4Q9RH 2I7GA 2EPMX 2EE3A 4FHAA 4WUKL 3V9EA 3VTRA 4PRPE 3WQ5A 3H2WA 3MMEB 3AXHA 3KHQA 4YHML 3TROA 1UEMA 2R2HB 3S47A 5JZ7D 2H32A 1R3JB 3M64A 4GPNA 4U6TA 3BUTA 1KFLA 5FHBH 4A2RA 1C9DA 1EHAA 4DP9X 2YFOA 4O4WA 4NGHL 4NS0A 3PTDA 4F8XA 2HX7A 1FWDC 2DQFA 4XPFL 3CL6A 4LF3A 4XNYH 1KM5A 5FL1A 3K2IA 1OE2A 3H53A 3E0VA 1WITA 2P7TA 1U3ZA 2Q8AL 3S1XA 3QPYA 5FUZL 5D1XD 5FOJA 1F02I 3G1SA 3CIAA 1T0NA 1TZ8A 2NX5D 1TPB1 4NL1A 4U7KA 2HT3D 4ELKA 2VW4A 2WCAA 2YD6A 4PB9H 1IC1A 1XLJA 3H1ZA 3KG5A 4OT1H 3QJHA 4HKPA 5H1WA 1UB5A 4AJVA 3DYMA 2CKNA 4AI7A 3KGUA 3GZQA 5ANMB 2VFGA 2H7WA 5DD3H 3GMNA 3WLWC 1W16A 1AR2A 4XMTA 4ZQPA 3NIGB 2O5NA 3KXQA 4X63A 1TTQA 4IU3A 1JEZA 3LEYH 4BUQA 4IGBB 4U1SA 3GJFB 4F8OA 4GRLA 1JVLA 1OP4A 2ROXA 2VFHA 1FGNH 3T0EA 3KVDD 4JAMA 1NPUA 3TPUA 1TVNA 5ICXA 3S7GA 5BVPL 4E6MA 4UMCA 1KBJA 2H3KA 1R24A 4LPYA 1Q3NA 4ML9A 4M9PA 4PP1C 1IEAB 3FT4B 4O2EA 3MRNB 3LOWA 2QSVA 4RWHA 4NRRA 2HLAB 1KY6A 4UANA 3E9AA 1K5NA 2PP9A 4MSWA 4UF7C 2XWJB 3LZOA 1UOKA 3QYQA 4YOKA 1DBBH 1BFOB 2EDDA 4JQIL 3EKZA 3QDAA 3KL3A 4WY0B 4NAEB 1JPST 2Y7MA 1T1XB 4PMXA 4PJHB 5IB2B 1H3UA 3HB3C 3G7TA 1MZYA 4YSPA 1IBDA 2BZNA 1CO1A 2D31B 3UYIA 5HYJE 4ELMB 4WI2A 5FSEC 3C09B 4K5PA 4MZ1A 3H7UA 3PFMA 3GIYA 1MNZA 3VG9C 3VI3A 1J0YA 4W9HC 1HKLH 1W31A 5FUCE 4N9CA 4LLQB 3QR3A 3W7MA 2DICA 4GS7C 1PLCA 3UTZB 4MCZA 4M1DL 3MNWA 2ISWA 1SRDA 1XGUB 1A5LC 3L9YA 1GS8A 4F7TA 2NXYD 2KC0A 1RI8A 2DJLA 1EYWA 1XCQB 1AP2A 4Z3GA 2NZ9D 1V0LA 3IGAA 2IF7A 5GQBA 3RIFK 2IDQA 5AYTA 2DM7A 3WS6C 2D2JA 1HJWA 3DFSA 2P50A 5DZ9A 3LIZA 1G4SA 1TTCA 3CK0L 1UA3A 2VC5A 1DE4A 3EYOA 5E24E 2VN5A 4HHGA 5KVMC 4HJ1A 3E7JA 2YO3A 4ZUTB 5KBDA 2BSSA 3DGGA 1KCVL 4Q8NA 2DP3A 1CMOA 1N70A 1K4CA 2F54B 3P9WB 3O6ML 3O8XB 2JKWA 2FJFB 5IRPA 3ES7A 4OTKA 4F1ZA 4LRIA 4FAMA 1F6FB 4BWLA 3DX7A 3VD0A 3QY8A 4KI5D 1KSRA 3IMTA 2ZYHA 2OX5A 1IZJA 5D1XC 1O5RA 4G6AC 4ODUA 3MYZA 2WYTA 2JKRM 3K2UL 4POZC 4DKTA 3RVTC 4HG4J 2HT3C 3QEZA 2BP1A 2DWEA 1EPVA 3IN0A 2CLLA 5C0JB 3V79C 1OLLA 3K0YA 1F5ZA 1GHRA 4NHUB 3BLIA 4M81A 3MXVL 1ODUA 2ZRVA 4OLYH 1W72B 3GNXA 2GIXA 4JO4L 2NW0A 3Q1SL 4MAVA 3CFTA 1P0EA 4F3FB 3CIQA 2PLTA 1G7LA 4LYKA 5J7CC 2EDRA 1D3CA 3GSRA 1NGYB 3AYRA 3FZUD 4HXBH 3UTZA 5I6SA 4AD4A 3MBXH 2AVFA 2E8YA 4X42A 3A67H 1K4GA 1E51A 4F66A 3UT0A 4PJ7E 4FCAA 3EADA 2VDQL 1E6PA 3PG8A 3E2HC 1NDGB 1WCBB 4XAKE 1F58H 3ONBA 5BOPA 1QI2A 4U1NB 1XCQA 3LV6A 4I9TA 4LRTA 2CLZB 2EDMA 3WL0A 3AHVA 5CEZE 2WGXA 3D4GA 4MKSA 1PQZB 2EUZA 1TPWA 4FG4A 3ENEA 1C9WA 2JKIS 3QEQD 3SQBB 5IFJB 5FKPA 4YDIH 1L9SA 1M03A 1EO7A 4GSDL 1TJ0A 4QHLB 2UXTA 2PRMA 3K2GA 3LBMA 3FGCB 3CIWA 4P2QD 2DQTL 3MLRL 3KPRE 1E6JL 4CBZA 5I1KL 2AAMA 3GYRA 5D96B 4KCVA 1ZT7A 2P42B 1O5DT 5LAXB 4GD0A 3UTPD 2YB4A 2VH5H 1E5NA 2BS71 1XX1A 3UP1A 1VYSX 3EA1A 4TPRL 2XTJC 4D6GA 2PLKA 1A7OL 4XWGH 1BVZA 2WZTA 2RDWA 3QSKB 1TTFA 1CFNA 2B7OA 4U5IA 4PH6A 4BS0A 1I8JA 2Y70A 4F24A 2NXYC 5BRZB 4DLFA 3OMAB 2H9AB 1XHHA 1T20A 4ORGA 3WBAA 5JBDA 3HE7D 3W6YA 3OTTA 4ETQA 3L7FB 2IGLA 1J9CT 4JIHA 1E5YA 5EORL 3EO9L 1WCQA 3RG6A 4IIZA 3VI4B 2JKAA 2COVD 3IJQA 3ESNA 1CECA 3ARXA 1E0UA 3X14A 4GRWE 1DBML 1G0XA 3F4DA 1NFDE 4ANKA 4ZMPA 2G60L 4PYHA 5BRQA 3AOFA 5KVEL 1K7XA 3HAEA 3GBML 1M6OA 2QJDA 2NR6A 4NWUL 2P24A 3S3BB 3UAJD 3MRGB 3BKJH 4PJDA 3B34A 2VOMA 5BOFA 1Y18B 3SD5A 1M3JA 1YN6B 1U8JA 2AQTA 2FGZA 1LROA 3N2JA 3K71A 4FL4C 5E6RB 3W3BA 1D5BB 1NDYA 1HH9B 3JV0A 3ZKSD 3ZHFA 1JNNL 2UV8G 4EWND 1YPZE 1W9BM 3EJPA 3A5FA 2AL2B 4S3DA 1OADA 4BA0A 4CQDA 1TVDA 1J93A 3GTIA 3QJFB 4YPGB 3AZRA 4H01A 3C2EA 1MZZA 3WAJA 5TF1L 3SDCB 4ETYA 1R6VA 4ODHH 4XNQA 1QKZH 3SQLA 5LAXA 5ENWB 1H0IA 2X0YA 4J40A 4MA1C 1H5YA 2R14A 1QAWA 3OKDA 3RDKA 1MCFA 1V6XA 2R1LA 4G7SB 5FYLD 3LKRA 4Y4HB 5FF3A 5C07B 4ICCX 3GKFA 3W7EA 3UJEA 2WZ6A 1URZA 2YA1A 4M62H 4BZ2A 4S1QH 1W2VA 2WWNA 3MRBA 4WZHA 5EEVA 5I06A 2XPYA 3ARFA 4N2MA 1UMLA 3WQOA 3THQA 1TZIA 3C2AL 3PANA 2OL3A 1YXCA 4QO1A 2JNZA 3UTQB 5CC3A 2VLLA 4DZBB 4E42A 3DDMA 4EPKA 3R7MA 3QVAA 3REQB 3OLGA 5SWQB 5H2BB 3SPJA 5B7ZA 3X11A 4K5LA 3TT1H 5AOIA 3WDIA 5GJMA 5FA3A 1JE6A 5AOKA 1IX2A 4GMTH 1A1NB 1K9TA 2QQNL 3UCRA 3OAYH 2WWMC 3LPOA 12E8H 2WSRA 1M6JA 2HG0A 5DMNA 3I75B 4BQ6A 5KUKA 4XNBA 1L6PA 1Y18A 5GRJH 2Z35B 4ROPA 3RUGE 2CRZA 1LBFA 4HJUA 4DGWC 3SGJA 1DEEA 1U93B 3CFBA 2Q71A 6ALDA 1WRFA 1EGJL 1V55B 1N55A 4ROQA 5JPMA 4X7FC 4U5KA 4J2PA 3TFXA 1QLEB 2P8LA 4I7ZC 2FGLA 2ZT9C 2CK2A 4IX2A 4BFFA 3OZPA 3E49A 5JUEL 3KHJA 3SGEI 1MJJA 4C6DA 3A4AA 2X87A 1QTYT 5D04C 5LGJA 1B0IA 2H2SD 1K6AA 2YOCA 4UDTA 1ZLUK 5CGTA 3MRHB 4JLRB 4PYGA 1H8SA 4CN4A 4O02B 3ZWTA 2YB1A 1DWIM 3LSOB 3NJLA 2P28B 4HIEA 4UFJA 3FU6A 1PYWB 1J8KA 1FO0B 2WSKA 3F7VA 3EGXB 2VL5B 2LHAA 3BQUD 5GIRB 5I66A 3NCJH 4CC4A 4HYWA 2PODA 4PBDA 3RPDA 2BBFA 4H9XA 3UAJC 3NYZA 4JFQB 4M8UA 4EPBC 4GT7A 4J8QA 4TULL 3CB8A 5JMUA 1QW8A 2WP3O 3R79A 3T0EE 2CDFB 2Z7ZA 4RAUA 2VITB 2DYPA 1UOVA 5IHUH 3O3EA 4XP1H 3T4AB 1BZ7B 4PJEE 4NQCD 2Y06L 2CESA 2X7WA 3K6FA 3FO0H 4XZNX 3DC8A 1S78D 4IDLA 1SM9A 2VQUA 4LSSL 5DT5A 3EUDA 3QDMD 4UU9B 3GIVA 1U8MB 5EUOB 4JN2A 3MGTA 1POJA 5IBTL 4U6HA 3C8DA 4JAWA 3TKFA 4AW7A 2EEXA 1ZDQA 2BM3A 1THFD 4QROA 2HDJA 4X2PA 2IXVA 3TQKA 8FABA 1Q8AA 2QVMA 5CEZH 1D2KA 4XBPA 1J79A 3MJ9A 4Q7IA 1KCUL 1ZHBA 1FHDA 4PIRF 3T1GA 1KEMH 2V7HA 1OIOA 5IJVB 4E4PA 1UXSA 3M47A 1ZA6B 3W1PA 4Z95L 3PUGA 1YTEA 4F58L 3Q01A 5T3XE 1YXDA 2TSBA 3D85D 3LH9A 4D72A 3L3OC 1J2BA 3UR5A 4DEPB 1OGAD 1IGSA 5HDOA 2CYGA 1LUCB 3MZTA 4BFOA 1FCUA 2A1YA 5D1ZD 4U4IA 5LYRA 3UGRA 1A3RH 4RXFA 4RPQA 2HG5A 3MRKA 3D6GA 1XFBA 2XZ7A 1HJUA 5ANME 4WK0B 2VEKA 1OK6A 3ARBC 2YKLH 3OVUB 1EO8L 3ULVE 2DEXX 2OFQA 3GFZA 1ZGLB 4L4VD 2ZXEB 3NIGE 4I7WA 5DMIL 4U1JB 3VKCA 4M6ML 1U8HB 4IRZL 3WJJC 1BX2B 3VOCA 5EO0A 1KTDB 5EU6D 2D3NA 4GH3A 1NMCC 4P23D 5D2YA 2WOBA 3VE0A 4K94C 1LF1A 3IMRA 3RX8A 2GSIA 4O2FA 2EYTA 2I27N 3WFZA 4BHUI 2ZPKL 3GNOA 3HRZC 3WY4A 2VLRA 1P2CA 2XKUA 2QUNA 2X4OB 4GRWH 1WBXA 2Z00A 3NK3A 3PB2A 4AF0B 3NTYA 4LJ3A 3OLIA 3ZJ7A 4YZFF 1PLBA 3QI9D 3MRQB 3F2BA 3G6DL 4LCWA 2KHAA 4MFDA 3TA3D 1OL0A 3GAYA 3SUSA 1KXVC 1OGPA 4HJGB 4JPSA 1OJXA 1BVLB 2VAAB 5EF3A 3O7UA 4QJ4B 2FWOB 5T9CE 1W6WA 4QHNB 4GZEA 1A3XA 3P6LA 3BKCH 4BFRA 1CBVL 4FE9A 4PJHE 2DH2A 1HGYA 3KXFB 1BLNB 5J6HA 2NUTB 1OWWA 3W25A 4PJAB 4JQVC 2WXPA 4YDLC 2Y7FA 1IGFH 3MUGB 4ELME 4AZHA 2PRLA 1FJ1B 3B5TA 4GH1A 5IJCC 2YPLB 2VHLA 4BQ4A 4LLYB 2I9LB 3OVGA 3RHWF 3IVUA 3EBIA 1HJBC 1RJRA 4QI3A 1XGZA 1UZ8A 2HH0H 4HA3A 3WKZA 3I6SA 1A5AA 4PCFA 3AXIA 1XO8A 1F3WA 3TO4A 4AQ8C 4EXAA 9XIAA 1X5YA 4QEEA 1GVFA 2DQUH 3DPBB 2XINA 1KTJA 1CB4A 1MEIA 4NZUH 2EO1A 1LLZA 1CDIA 1Y1DA 4TTDD 3AMGA 2CSPA 4TKWA 2VEPA 4EN2A 1ISZA 1J18A 2BY2A 4QISA 1FCVA 3GIZL 1OANA 3N9SA 3MRIB 4X6DF 4XNDA 4B5UA 4G3YL 2G3ZA 3ANUA 4NASA 3SY0A 1D5IL 2P8BA 4GKLA 4LCSA 2C0HA 3PF2A 3MMUA 2F54E 2Z1BA 1I7ZB 1W8NA 2EPLX 5CZTA 2D2GA 3O6FB 3FV9A 4MMYA 4N4YB 4QTHA 2NY5C 3DBXB 3CTLA 3Q43A 1QAPA 4A22A 3V6OE 3UJTL 3SN1A 4MJ2A 2P5EA 1E6SM 1RV8A 1EDGA 2JEPA 3WF2A 7A3HA 4J9JA 5HHOA 1S7VA 4GQPH 2VAAA 4DJDA 3VXSA 3ZGIA 3MCNA 1SM3H 2NXGA 3VVWA 2FMNA 5D1ZC 4A6YH 3WJSA 2VCOA 2H0EA 3VSTA 4TL4A 3ZE2B 5CZRA 2DY3A 5K9QG 4HC1L 3MLWH 1ITUA 4TR9A 1OEPA 3GRIA 1TPXC 2BK8A 1FJ1A 3P77B 4EPSA 4B96A 5BUPA 4LLYA 2I9LA 1Q1JH 4A7SA 1IC4L 2O6FA 1R3IL 2X1UA 2DZEA 4UWQB 3L3DA 1ONXA 2VFFA 4ZTPH 3LJ3A 4P23C 3L5MA 1R19A 3WKQA 4NO5B 3GFUA 2H26A 3UO1L 1G9MC 3UYRH 2WZPA 3M7WA 3M0LA 4NRXA 4JPWL 4WENB 4IM4A 2X4QA 5BZDB 3Q6GL 2J21A 4RDVA 3EOEA 3AUOA 4E8GA 1FFPA 3QYSA 4OUIA 1ZP4A 4H9UA 3I50L 1QI5A 3CZNA 3QORB 2J6WA 4NQEB 3LKSA 3TA3C 1CXEA 3KE0A 2AGJL 3S2JA 4Z3HA 3GPSA 4CAGA 1GW6A 1AD0A 4G83A 4HZ1A 4XRCB 3L5WB 1ZTXL 4Y2DA 3TF7C 5EIQA 1AZCA 1FVCA 3AT0A 1RHHA 3NJMA 3UYPB 1TJMA 1CJYA 4POUB 1ZBWA 4ZB5A 4L7ZA 2WAGA 4DYJA 3M0HA 3GDLA 3ISYA 2CWXA 2LW3A 3GVQA 1KLGA 3AUJA 2E67A 4XBEL 3TFKC 4NT6B 1ETZA 4G7YL 2P48B 1L3WA 1V77A 1FN4A 1XTMA 5DO8A 1AXTL 2AJ3A 4S0HA 3RM4A 4DPAX 2DQJL 1A0DA 3V0UA 2ENJA 4JDTL 2B77A 4BFEA 2R1KA 3W85A 4PLNC 4KK5C 2TMDA 4JN8A 2GI7A 1W9DM 4EOWL 2PWEA 4AC1X 4GKZB 5BRZE 5H35A 5DJDB 1OCNA 1A4CA 1TZHA 3AROA 1PAZA 3OX8A 4HF5L 1FORH 2WAQA 1OKEA 1RHCA 3OKMA 3RNKA 3SDAC 5ALCH 3VI4E 5I1EL 3VD4A 1TCDA 1O6TA 4HS3B 3AIWA 2OO6A 3MJMA 3OXRB 2ZF9A 1II4E 4QMEA 4LSTL 4IG2B 1K7EA 3BUYA 4G8GD 3MKKA 2PTDA 1UYWL 5T3XH 3G0XA 1FGVL 4BE6A 4GAYA 3F7LA 4XSMA 1INDL 3IDJA 5F21B 3AWNA 1MG3C 4XMPL 2ICSA 1FXQA 2W0FB 1OM0A 2NW2B 3RZCB 2AL1A 4GIPD 1PL9A 4QLJA 3L12A 4ZD3H 2CO7A 3ULVH 3M7OA 1HOCA 3CHQA 3VFUB 2CBIA 5F7EH 2JI3A 3MMWA 1Z66A 5HGHB 1MCQA 1UH4A 1PDKB 3GJFH 4UFKA 4NUJB 5EH1A 4NCC1 2ZCZA 1LRTA 3VZXA 5JIMA 5BOJA 5HDBF 5B7MA 2NXHA 3FUIA 1QW7A 4DRSA 2Q2EB 1ZNNA 2VMFA 4JZJC 3MC0A 2O56A 2ZXAA 5HMEA 3DO7B 3SYOA 1CGWA 4OZFB 1YEHH 1LL6A 3B6SA 2WW5A 1I4NA 2NQ3A 2BY1A 3DIFA 4KO9A 2Q9OA 5C07E 2YWZA 1UZ6F 5HYSA 2NWRA 1RJQA 4ZQKB 1V03A 1SMAA 3DUHA 4JO2H 2CPUA 2VFDA 2VR7A 3KPTA 4AIXA 5CAYB 4N9GA 4NXSA 5C2BL 2QCNA 2BNRD 3GMLB 3M16A 4UTTC 4GRMB 2IKGA 4YDKH 1X9QA 4BWTA 5AW4B 1WE5A 2M8XA 3BLOA 5CWSB 1L6ZA 1AJ0A 1YEEH 2NQLA 3H2FA 3WFDL 4KHTH 4AVHA 1E71M 4GJIA 3QR2A 1JI1A 5A95A 5F1NB 4L9LA 5KYWA 1HJVA 1I3VA 2GJ6D 4S2BA 1LO5A 2J88A 1I8LA 5JYLA 1WBJA 4XZLX 4OF3A 3ZYZA 2HLFC 5DMKB 4LB8A 4GUCA 1LE5A 3MI3A 4NAMA 1AQ8A 5M5DA 5FF4A 3MNVA 5T1DH 3AM8C 3VFSB 1QLRB 3QFJA 4LRSA 5DHVB 5B8CB 2FATL 5EYWA 4Q6KA 4F80A 3LHZA 3NZSA 4H4IA 1R3SA 4EDXA 4AYFB 4PVNA 3VW3H 3ZBMA 3TX4A 1CE6A 5I74B 4X6FA 3PAOA 3WLIA 1TR7A 4A21A 4EMZA 3K91A 2A99A 1I2NA 3D06A 2YOAA 3IE4A 2WZMA 4A66A 2Z1VA 1ML1A 3VSUA 1QP1A 4HZLA 4S2SA 4YXGA 4HJJL 2VN4A 1B4RA 4PRPD 1H6FA 1O9ZA 1F1DA 5EIVA 4DO6A 3GSNB 5CN1A 1Y5VA 4GY0A 4O51B 3GXPA 5IDIA 3TN0B 1YEGH 4ZMGA 4IQDA 4AM0A 4R85A 2WB5A 4BI7A 1NC4B 4N3UA 3N17A 4F0SA 1W72H 2OMXA 1EJRC 4JDZB 3CPLB 2GYSA 4M00A 4XP5L 3DOSA 4P3DB 2RR3A 3NEEA 5MEND 3CQQA 4V15A 3PP3K 1KCSL 3VXPA 2WPGA 3IPFA 4X4XB 3BOXA 3H2PA 1Y6KR 4ZMXA 4CNNA 4TRPL 4WFFE 4IRJD 3BOVA 4IRSD 3O0LA 5J1AA 1KGIA 1WV7T 4NI3A 5EUOE 4PIBA 3GSXB 3GUFA 1NGXB 5AL8A 1KJ2A 2OEKA 3L3GA 4OLWL 4OHQA 4NKDA 2SEBB 3RHGA 2R2BA 4HPJA 2NMSA 2AQPA 4MJ4A 3CLEL 2CA3A 4HIJB 3FF7A 3IM1A 4HPOH 3QR1A 1KLFB 1IC7L 1MHEA 3ABSA 1DLFH 4GSXA 4I3SH 2E6AA 4QHKJ 4QAWA 5FB8A 2AV7A 2AQVA 1C1EH 1P4IH 3BJLA 3FUJA 1TIWA 2E9IA 2X89D 2BSED 4DVRH 3GG0A 2MOVA 2BGNE 2AZUA 3TR2A 1UROA 5HI4C 2J8UA 3LRKA 4JFUA 4WWPA 1VIWA 3IJHA 4MB5A 3P30H 3C56A 5GRYA 4PHZA 1IGTB 5E94B 5JW4Q 1GUVA 1JXGA 1QWNA 3SCTA 2BW5A 2OI9C 5B1JA 4BH7B 1OK8A 3WQ6A 1OFRA 2B14A 4UMSA 1XZ0A 3MPGA 5DS8B 2OLHA 3SO5A 3VC5A 1S1RA 3U7VA 2XC8A 4PRDA 1E9ZB 3M17B 3DNKA 5DFAA 4O53A 4EAYA 3DGRA 1XIWD 2DMBA 1ZVNA 1CGUA 2VISA 3G24A 4JY6A 3BWAA 1HILA 3D0LB 1YAIA 1D8CA 3EMZA 5I71C 1QNZL 3KPOA 3S36X 5AYBA 1SDDA 4CU8A 5FUOL 3O9NA 1MDAA 4AQOA 4GG8A 4DPCX 4ODWA 1GEHA 5TAOA 5H94B 5HYJD 4ZENA 3UACA 1HCYA 4RKAA 1WFMA 3MVSA 5ABTA 2WIIA 2ACQA 4RGOH 2X0WA 2RKXA 3ETBJ 5IQLA 4Z7WF 2XSBA 5KITA 4I9WE 3FQ2A 4XP4H 4IOIA 2EXWD 3VIHA 5D4HA 2K1MA 1AI1L 3EYPA 1FNSL 4KGLA 3KXFE 4AZ5A 4JHAH 1P7KB 3STZA 5K9JL 5F97E 2PMQA 3WAKA 4PJAE 4I5XA 4NLHA 1H7XA 4A8NA 5FAGA 1FWHC 2ZYSA 5GZNA 1U21A 1FPTL 4N85A 1OFBA 2LOEA 2NUXA 1GQJA 2Z0BA 3ZYIA 2YPLE 2OJ1A 4AZIA 5IHSA 2YQBA 2VR9A 3MRDB 4GVGA 5B38B 4AEOA 2YHGA 3HBPA 3BVNA 3LCXA 4Z78A 3FXIC 1FZKB 1J1PH 1F6KA 2FJUB 1K70A 4H6KA 3DVIA 3RQ3A 1LYQA 4GY7A 3OKOA 1AZUA 3MV7D 2B0MA 3K8MA 3MJGX 3VFMB 5CPSA 3ITLA 4GHRA 3B2MA 4JM0A 5E9DA 2RBLA 3FS2A 1B9BA 4CKQA 1WAAE 4JPIB 2Z7KA 4IRJC 1P4CA 1DCLA 4GKSA 4IRSC 3SY8A 4DGIH 4NZ1A 3HA1A 3WFHB 3CGTA 1Z3GH 4DJMA 3DK0A 4R33A 3WF4A 2QZQA 1HXYA 4OLXL 4FMFA 1MFCL 4GMSH 3L9RA 4MNHA 2PW2A 1UEYA 1LO3H 4OIAA 4FS0A 3WL9A 3CV5A 3FQNA 3FC8A 3ARYA 3L13A 4DKFL 1MHPH 2X4NB 4L4PA 3NOIA 2IGFL 5TQLA 2E7FA 1IEIA 1G6RL 3S0CA 1DANU 1VJIA 3H2MA 1C5DA 3W1TA 3VFWA 2J6VA 1A50A 5KSBA 3HZMA 5D9SA 1KTRL 3ASNB 1H50A 3M0JA 4NHVA 2PB1A 5KW9L 2D3VA 3UTTB 4XAKD 1WDPA 1OCBA 1LNUA 1JZHA 4OFPA 1RVGA 3ZE2E 1GIGL 1AGEA 5GXBB 5CEZD 4H00A 3MJ9H 2BERA 4AJYV 4Q8VA 1W1ZA 2ANUA 4AGMA 2QJNA 1DANT 4MD0A 1BIIA 5CXPA 1G4RA 5FFOA 4ONGH 4BF7A 2R59A 2YK1L 1IT7A 2QQKH 1PZ3A 2AP2A 2NVDA 5FR3A 2ZUYA 2F8OA 2YD8A 1IKOP 1PCWA 4PRIB 5E5MA 4EDWH 2F58L 3KFTA 3D0AA 3MREA 5TQ0L 5CD5D 3SOBL 4ODXB 1HI6A 5FK9A 1A9VA 4OVUA 3B8WA 2G75A 5SX4I 1I1FA 4O02H 1F1GA 3CXDH 5IGXH 4AM0Q 2Q6WA 4R4ND 4JPIA 4TLSA 1FO0H 2AMGA 4NQEE 1YHTA 2IKIA 2W5FA 1HO1A 5I15L 2M26A 3WFHA 4ORZC 3U82B 4CDHA 1V08A 1G7MB 2OJZH 2PDIA 1EFXD 4HETA 1G87A 4B9YA 4WXYA 5FESA 4DK5A 4ZXBD 2TRYA 4TUKL 2A0NA 5JBEA 5EULV 3CLFH 3QPZA 1OPGH 1CT5A 1E4WL 1CXIA 3OBEA 5SWUA 3GHPA 4FNPA 4B7IA 5C92A 3APDA 4WDIA 4LUIA 5C6TL 4HAFA 1LQAA 3U4EB 2DQEL 5KBPA 4N2LA 1G7HB 4F7MB 1F8MA 3OMNB 1ZCRA 4C6JA 5EU3A 1OHQA 3U6RB 4FR6A 3NAAL 4XG1A 1R5WA 3DFPA 3E0LA 4JFFA 4OKVA 1D5ZA 5FCSH 2HN7A 4G8IA 5AQ0A 5G4NA 4HEME 4Z1DA 3MA8A 3JV6A 1RUSA 1UCBH 2EINB 2QPFA 1HKWA 4PI2A 1OT2A 2H32B 4TQEH 1XH3A 2CIPA 4X2UA 1HCZA 4IDJL 1MW1A 3S4SA 4U4MA 3U2ZA 4HK6A 5C0DA 1JUKA 4AUJA 3FYYA 4GO9A 2FLBT 1PZ5A 1G0CA 1LOSA 3N4FA 3LHYA 3FTZA 4OGYH 1L6SA 1FNEA 2QCCA 4LF3B 4US5A 1H8NA 5MHBA 3D4YA 3E9TA 2P7TB 3OR6A 3LHPL 4LBSA 3FL7A 1KBIA 1T0NB 4YO0A 1SMDA 3IS4A 1LZOA 1HEHC 2OMUA 1U8NA 4ELKB 3GG8A 3NQ2A 2IG2H 4IGSA 3QJHB 3VNLA 1CI1A 1UB5B 2ATMA 2FQEA 4O2CA 1VFBA 2KZHA 2A74A 3OMIB 3GMNB 4KRNA 2HRPH 2DQWA 2ETWA 2ZOTA 2F18A 1OAKH 2DZBA 3QIBC 4IU3B 5E1QA 1QTSA 1TQCB 3SKJL 4RMRA 2AEOA 2BSBA 3T8LA 4LXFA 2IDTA 4LO9A 1FFTB 4U1SB 1GCYA 4GRLB 4C47A 5IHWA 2OQHA 3KLAA 5J12C 4A35A 1FWSA 1L7IH 3TPUB 2Q76A 5ICXB 2J9ZA 5DRIA 1R24B 2HISA 5AAMC 1P7QD 5TPWH 4K8RC 1XIMA 1BG9A 3SZKC 5BRBA 1LMIA 1QFEA 4Q7BA 1DBJH 1N4XH 2ATSA 2Z31C 4O2EB 4R4NC 2O5XL 3DHJA 5I75B 1D5RA 3GTVA 4XPGH 3H2EA 4GSRA 4MG4A 2K8QA 4UYPA 5K4ZA 1MCBA 1K5NB 4MSWB 4LAOA 1JFHA 3DTXA 5BOOA 1D5XA 1SF3A 3E1ZA 4ZXBC 3SE4C 2X1WL 5ADPL 5IMMA 4L1WA 1F1AA 3O9WD 1TWSA 5KEZA 4AH2A 5E4EB 4XNAA 5IW1A 5BMFH 1NQKA 1A5NC 3RR1A 1SFJA 1EA9C 1KKOA 2ICEC 4POYA 2A6IA 4I9AA 3ELQA 3VI3B 1VZIA 1GAFH 3UO8B 4JRYA 2GQ3A 1H3PL 5C97A 2YIHA 3GXDA 3WNOA 5AVVB 5DWPA 2HVMA 4MCZB 4GI4A 5CGQA 3MNWB 4K9EH 3U0WL 1ZLEA 2XQBH 4PJFF 4F7TB 1YVLA 2X0UA 4RDQG 3NJKA 1I3GL 5F3FA 4QE4A 2R91A 1AP2B 2WKGA 3PHAA 3IGAB 4R84A 2CXEA 3VWJD 1DWJM 1YUHA 1VP5A 2DQHH 2X3CA 4KKAD 3OU8A 3EF7A 3LDBB 2CBUA 1DE4B 3EYOB 1ASPA 4JY8A 1PAMA 4JM2F 2BSSB 3DGGB 3BT0A 4F5CE 1ET7A 2VXNA 3TCEA 1K4CB 1JCTA 3BZEA 4ICMA 3P80A 4BGDA 2HS8A 4UMBA 1ODZA 4HFUH 5PTDA 2D0HA 3GHBL 3ANYA 1WPCA 5IWLA 2D69A 3DX7B 3EH5B 4GAAA 5B7FA 4HZ8A 2YDQA 1AGCA 3KBJA 1S1PA 1WNOA 2XXGA 2OX5B 4ODUB 3ME3A 1TQUA 3KPLA 2CHXA 2MCG1 5AKQA 4R4BA 2NY0C 2GYIA 2JGYA 1NOWA 3WNKA 1GYLA 3ONCA 1Q94A 4ERGA 2DWEB 4TV5A 1OGTA 4BZYA 4LMQI