1ODUA

Crystal structure of thermotoga maritima alpha-fucosidase in complex with fucose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
441
structure length
422
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEDLPGYKWEFTRGIGLSFGYNRNEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
total genus 148
structure length 422
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1oduA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1oduA01
4W93A 1HKKA 2O92A 1I1WA 2BY3A 2D3LA 2BVYA 2VZUA 2J7HA 1UUQA 3QHNA 5CQ1A 3VNZA 3TTYA 3O2LA 2DT0A 2X0YA 3U57A 2VNCA 4HZ7A 1GQLA 1E73M 4W5UA 1MW2A 1W1PA 5EFFA 4HZ6A 3APGA 1HP5A 1R7AA 1CLXA 3T0AA 4AXNA 1OSEA 3MANA 3AIWA 2UY5A 4PMDA 4CCEA 4JL2A 4AZ6A 2JF6A 5A8MA 3H55A 4AZ7A 1ISXA 3ZT6A 1H09A 5BXRA 2QV4A 3OA5A 4QDMA 2VZTA 3WDPP 1V3LA 2BHZA 3MUAA 3ALGA 2X2HA 4W88A 3SUVA 1WZLA 1TQVA 1UWIA 3EJQA 3ZM8A 1J11A 1E3ZA 5JBFA 3W25A 5A6LA 2W66A 4WKAA 3FN9A 2OWWA 2BXZA 1E71M 4NF7A 4M56A 1NP0A 4B15A 4W8BA 5D9OA 1JFXA 4PTVA 3RM4A 3WH9A 3PTKA 3EJSA 4PSPA 1US2A 3WDJA 4AMCA 2UY2A 1ZJBA 1IV8A 2XHYA 3U7BA 3W24A 2F1BA 4AD0A 4UFJA 3WD4A 1ISZA 2WPGA 4P7OA 4PTWA 3WMSA 5FD0A 4HA1A 1DEDA 3WDIA 5CLWA 2UY4A 1J0ZA 1J0YA 5AYIA 3EMCA 3DHUA 1YQ2A 3KLKA 4MTVA 2BY1A 2C0HA 2WVSA 4MADA 1DP0A 3QOMA 4JFTA 4E8DA 2WNWA 1G1YA 1WO2A 3TTSA 2WCSA 2OW6A 1BTCA 2OWXA 1JYXA 3BAXA 3O6AA 4V2XA 7CGTA 3UCQA 4H2CA 4AZCA 4HU0A 3W37A 3W6MA 3EDKA 3WQ8A 1NOFA 3OLEA 1FFQA 4NRSA 1PX8A 1HX0A 4UFMA 1B30A 4N0RA 1GHRA 1XGZA 3NJ3A 3CO4A 3A23A 3NSXA 1NWTA 3WH8A 1UKQA 4AZIA 4BF7A 4KRUA 1RP8A 1PIGA 3MO4A 1ISWA 2OYKA 2WSPA 3FAWA 3K8KA 4U3AA 2QHAA 4PMRA 4LGXA 4AEEA 3CZKA 3VDBA 1V6VA 1CLVA 2OSWA 3PZOA 2VT0A 1E0WA 1W1YA 4Z2GA 4PMYA 4W5ZA 3WF2A 4DUVA 4Q22A 4EE9A 5FOOA 2A3AA 1KBBA 3BGAA 4DWSC 4FNTA 2ZUNA 3BLPX 1DWFM 1C91A 2PB1A 1UHVA 3SIMA 4AZCB 1UQZA 3WELA 2W91A 1S46A 2J62A 2WKLA 4FLOA 1PEZA 4X0NA 2D24A 3AI0A 2EBNA 1JZ8A 5LYRA 3WQVA 1G94A 4DUXA 3TTOA 4KGLA 3A24A 3A21A 4D6FA 4X9YA 4ZE4A 1E4NA 4HOXA 3RJYA 3OGVA 4GI6A 2UWFA 1JXJA 1KGWA 1TFVA 1UR1A 4AC1X 1KXQA 3VSVA 1UKOA 3D51A 2J79A 4PUEA 3SCPA 2CBIA 4CU8A 4ML4A 4UQDA 5CJ5A 1HIZA 5I78A 3VGDA 1WNOA 3W29A 3HG4A 4WKFA 2XFYA 3VIJA 2QF8A 3NSMA 1JNDA 4NX0A 1BSIA 2O9OA 2GFTA 5BROA 3VD4A 1D3CA 1V08A 3VGBA 1CGXA 3WD1A 3NCOA 4XUYA 4QAWA 1HKJA 1Y7VA 1UWTA 1HL9A 4JFSA 2WANA 2VCBA 4B16A 3A6OA 2DSUA 2VZVA 4H41A 5E9AA 4J28A 1HJXA 1V6UA 3WBAA 3W81A 2DH2A 1EDQA 3WN6A 4JHOA 4NZCA 1DWHM 5M03A 4PSRA 2D20A 3GXTA 4PMZA 3L2MA 2OSYA 1K9TA 3WNOA 4KMQA 1E43A 1C8YA 4UFLA 2DEPA 3AXHA 4C7GA 5A69A 4AY1A 3LMYA 4M29A 4XZWA 4KWUA 2V38A 3CUGA 3BLBA 3WIJA 1LF1A 3BMVA 3WNLA 2ZUUA 3CZSA 3IGUA 4GO8A 4Z2LA 3OG2A 1NM9A 3F5KA 3AQUA 1UD4A 5E0CA 1GQIA 3K1DA 3D3AA 2Y24A 1UR0A 4JAWA 1V3JA 3GXNA 1VJZA 2F7QA 1HJUA 2CEQA 3UG3A 1KFWA 1PZ2A 1B3YA 2W4XA 4HOWA 1E3XA 1XRVA 3M46A 4F79A 1H4PA 4GIAA 1JD7A 4W87A 2O9RA 5FL0A 4NI3A 1W9XA 3FNDA 1NH6A 1X6LA 2J7FA 5AY7A 1DHKA 2Z1SA 4AMWA 1HP4A 1R8LA 2CBUA 4LYPA 3UR7A 4ZFMA 1PBGA 3HU7A 2V3DA 4UQEA 1JFHA 3W26A 4B3KA 3CHEA 5A6JA 2VX4A 1OT1A 1K6AA 4GZJA 1W3KA 4ACZA 8CGTA 2V3GA 3DHPA 2CXGA 1GZJA 2E9BA 3AHXA 3SCOA 3D50A 4EKJA 1QW8A 2GDUA 2ZX7A 1JI2A 3CUJA 5ABGA 3WSUA 1QOXA 4F66A 3T2QA 4WK9A 3WF4A 4DWSB 1V0LA 5JBDA 3VSUA 1CBGA 2FHBA 1QWNA 3BSHA 5FCZA 2VOTA 4YHGA 2D22A 2F61A 2YBTA 1UKTA 4H8UA 3WY4A 2X2YA 1HJSA 1VFMA 3LRLA 3PZMA 4GKLA 5A95A 3UEQA 2DDXA 1W9DM 4XX6A 1TR1A 1FA2A 2WHJA 2EPKX 2BV9A 4ZE5A 3GXFA 1EGZA 4HMCA 4AWEA 1UH3A 1L8NA 4FF5A 1HWWA 2EQDA 2WW5A 1R86A 3VKKA 1GVIA 3W6LA 1JZ5A 4JIEA 2HISA 1J9YA 4UCFA 2EPOA 3QOKA 4CD4A 3WENA 4FNQA 1J0HA 2GJPA 4JCLA 1KWKA 2YDQA 1ITXA 3WY2A 1JYWA 2WZHA 1K9FA 3DYOA 2WBKA 3ARTA 1BYCA 1UR8A 3I3EA 3AIQA 1XSJA 5DEZA 2FE0A 4JZ5A 2BY2A 1C7SA 4OBRA 3WH7A 2IUZA 3OGRA 4ATLA 5A6BA 4YPJA 3AHYA 5JBEA 3VDAA 3VIIA 3DX2A 5A6BD 2YFNA 4JCMA 3WEOA 1LWHA 1Q4NX 1UYQA 2F7OA 1MW0A 3KL5A 3VOCA 3QR3A 3ARQA 4ZXLA 1QNSA 4QLLA 1W3JA 2G41A 1HVXA 3WEMA 1G0CA 2VTFA 1R7OA 3HZ3A 5A8PA 1CYGA 1PIFA 3SUWA 5JIWA 3D52A 4CD8A 3WUFA 5DT7A 3ZJ7A 5I23A 1YHTA 4M80A 3AMKA 2W62A 2JEQA 3ZIZA 2O9PA 1WDRA 5M3WA 1CWYA 5BRPA 2E8YA 3ARXA 1J0IA 1ZU8A 1ZBCA 3CV5A 1BYDA 1DWJM 4W7UA 1B90A 1HKMA 1FH7A 3SCTA 2XUCA 1BVZA 3CZJA 3AXIA 4WLCA 3WY3A 4U2ZA 2WM0A 1JZ6A 1JD9A 4A3HA 2W67A 4X0VA 4UFHA 4UNIA 3ZR5A 2IGTA 4D6EA 5D9PA 3K46A 3ZOAA 1TQTA 3VMOA 3F4VA 2WC7A 2WVVA 3L2LA 1C90A 1W9UA 3SUUA 3HG2A 3OLGA 4J3TA 4HTYA 4UOZA 3FY1A 4CUCA 3K4DA 2Y8KA 3UERA 3HMCA 3N13A 2JF7A 2NT0A 3EJTA 4UR9A 2CHNA 5DFAA 3E1F1 1KQZA 2ZXAA 2QPUA 2FGLA 1U33A 4OGZA 3GYCA 5BXTA 3DX1A 3AZRA 1E72M 1I75A 5IHRA 2Y2WA 1JYVA 2ZX9A 2YIHA 4MAVA 1LLOA 3AYRA 4MAZA 5BWFA 1EH9A 3MKKA 2OW7A 4UZSA 3BXWA 2CHOA 4D1JA 4JL1A 5E09A 1CPUA 4PTXA 2OYLA 4MDPA 3T0BA 4TX8A 3EDFA 5HOSA 2WVVB 1PX4A 4ZEPA 4E8CA 1B1YA 5E6YA 5A2BA 2XWEA 2J7CA 3WUBA 3CMJA 2V5CA 5CSUA 3TONA 5GNYA 3RPMA 2CKRA 2WVUA 1V3MA 1JF6A 3BVVA 3GZAA 3ZQ9A 4FNUA 3ZMRA 1IT0A 3I3DA 3O9NA 5I5RA 1XSIA 3VIPA 2VL4A 1NQ6A 2D0GA 3VX1A 4TTGA 1EQCA 1LL4A 1V03A 2VO5A 1L0PA 3THCA 2XN1A 2OYMA 1VB9A 1JIBA 2TAAA 4CN6A 4MJ2A 5HPOA 3SCUA 4J7RA 1UD2A 2XPKA 4UTFA 1VEPA 1XYZA 4LXFA 3A4WA 1R33A 4CD5A 1OGSA 1V02E 3OB8A 4OOUA 1VF8A 4BQ3A 1I1XA 1PPIA 1Q6EA 2J74A 2XFRA 3EBVA 1C93A 3VM7A 3AZSA 4XB3A 2BY0A 3ZO9A 1ZBKA 3WBEA 1E6ZA 1GOOA 4C7DA 1M03A 1US3A 1E0XA 1CXIA 1CGWA 1MW1A 5I79A 5LA1A 3EJPA 1OD8A 2VI0A 3WD2A 4U5KA 5DO8A 2WXDM 4D71A 1EDGA 1E5JA 1UWUA 4L4PA 1C8QA 3W27A 3AIBA 2CCRA 5ABEA 5HBFA 2WMIA 3UG4A 1MXDA 1H11A 1OGGA 4AD5A 1VEOA 5LA2A 1QNOA 3BVWA 1VIWA 4NZJA 1CGUA 4CGTA 3IJ7A 4J3XA 1O6IA 4M1RA 1M04A 3T09A 3N04A 2D1ZA 4J3VA 4MNMA 5ECUA 1F4HA 4GZIA 2XG9A 2Z1KA 3GXIA 1E1FA 3D5HA 1SZNA 2VURA 1AQHA 4OBSA 2YL8A 4YHEA 1CTNA 3EJRA 4OUEA 1XD0A 4DO6A 3OBAA 5A6AA 1R75A 2VZSA 5M5DA 4MNJA 5I24A 1WZKA 3WQ5A 2VRKA 1OIFA 1E9LA 5AYBA 1MWOA 5CXPA 1G5AA 3ARZA 5C71A 2XVPA 2Q8XA 1TG7A 2PF0A 4EANA 1AQMA 2B31A 3N9KA 5M17A 1PZ3A 5F7UA 3BUIA 3FHQA 4IM4A 5EFDA 1WCGA 3SCNA 4GO9A 3L4XA 1CXFA 3CMGA 4TX6A 2ZE0A 4OJYA 3CC1A 3PZUA 4CU6A 3VIMA 4MNLA 4W84A 4CN1A 1BLIA 1UWQA 3WD3A 2D2OA 1MQPA 2XN2A 3VINA 1EOMA 2YFOA 3DC0A 4UFIA 2A3HA 2WHLA 4MB1A 2JIWA 3EDJA 4AZ5A 1BYBA 1KTBA 1T0OA 2NSXA 2DIJA 4W7WA 1JDDA 1QHPA 4PCSA 2VZOA 5A2AA 4HMEA 4KRTA 2PC8A 5I6SA 3GXMA 1UKSA 2XJ7A 1GHSA 4PMNA 1J01A 2ZWZA 2EADA 5CPQA 4Y7EA 2OWCA 1QBAA 2ZICA 3GM8A 2YDSA 4GINA 1ESWA 2WYSA 5CGMA 3WL0A 4GZEA 1E15A 3KL0A 5I0DA 3CZLA 2YBUA 4W89A 5A1AA 4PCTA 1FP8A 2CITA 1CXEA 1BQCA 3BH4A 1W91A 4OIFA 1ZBWA 4JKKA 4U3CA 1V0NA 3JUGA 2GJXA 3W38A 4BQ5A 2DGAA 1VRXA 2J8FA 4AZGA 5GQBA 4AEFA 5CGTA 4ZENA 3TOPA 1AVAA 3J7HA 4ACYA 4Z2IA 3MSGA 2D3NA 4ATWA 3NIYA 1EXPA 5DT5A 4U31A 1HF6A 3AIEA 4M81A 3L4TA 1D7FA 2D73A 2VR4A 2EO7A 3WNMA 1EHAA 4IISA 3SCQA 2ZOXA 3BMWA 3AYSA 1W3LA 2WVTA 1H5VA 4TTUA 2CERA 4RE4A 1LG2A 2E9MA 2X0HA 1CZ1A 4P8VA 1Z32X 1BHGA 3N12A 3AMLA 1BGGA 3GXPA 1TZ7A 1JL8A 2WMGA 1OBAA 3VGEA 3T0DA 1BG9A 2VCCA 3SUTA 1NOUA 1FH9A 4CN4A 1UR4A 4JKLA 4MNKA 2D0HA 3TP4A 3NDZA 2GJXB 3BAIA 3ARRA 5IXEA 2XSAA 3GDBA 3EJUA 5E0FA 1VENA 1ZL1A 4D6HA 1ZJAA 3NSNA 1QI3A 5BRQA 1VJSA 1TQWA 1EOKA 5LA0A 3L4YA 3AMCA 3WF1A 7A3HA 2CPUA 3HN3A 3CUIA 3AXXA 4H8VA 3PTQA 2ZIDA 1B2YA 1V3IA 3AROA 4MPKA 1BAGA 3CZ8A 4AD2A 3L4WA 1OB0A 3A4XA 1DWIM 2JALA 1M7XA 3VGFA 1XSKA 5GNXA 3LRMA 4GI9A 2E40A 1W2PA 3SCWA 4DM2A 4FLSA 3T2OA 1R87A 1C92A 2FYVA 4AMXA 3BVTA 2G3IA 2CYGA 5ABHA 2X05A 4OKDA 4V27A 3L4VA 2VR5A 3S2CA 2J7GA 2VQTA 3AJ7A 1R47A 3WF0A 1LJYA 1GPFA 2Y4SA 3VIOA 1IZJA 1WP6A 3RIKA 1E55A 2ALWA 5KZ6A 1MXGA 5IHSA 4FNRA 2PBOA 1ZB5A 4BQ4A 2AMGA 3GH4A 5BCAA 2CNCA 1XV8A 5HNNA 2DPEA 3BAWA 4Z2KA 3IJ8A 3H54A 3LPFA 1PJ9A 3PZQA 1JZ3A 3LX9A 3LPOA 2NT1A 4M8UA 1CXLA 4PN2A 2XYLA 5A2CA 5D8WA 3CZGA 4HPGA 1KWGA 3A5VA 4PMOA 4CU7A 2A3BA 2EPMX 2YLLA 9CGTA 5D9MA 2EPNA 1A3HA 3K8LA 3VILA 1QNRA 3OZPA 3KE0A 2E9LA 1UD6A 3VSTA 1FH8A 4H7VA 1W1VA 4QP0A 4ACZB 2ZUVA 3THDA 3F5LA 3CBWA 2XGIA 1J18A 2EABA 1BVNP 2A3EA 3CIVA 1KXVA 3N18A 3WMCA 2X1IA 1R34A 1VFOA 4WF7A 1JDCA 1H1NA 2QMJA 5E1QA 2W63A 2WZIA 3VD5A 1K9DA 4KGJA 1CXKA 3DDGA 3HG5A 5D8ZA 3UETA 2BXYA 2J25A 3AIVA 2GDVA 4CCDA 2A3CA 2E0PA 3MSDA 3AMGA 1LQ0A 3AS2A 2YL6A 4TVDA 4NXKA 3W0KA 4R27A 3WQ4A 5BYWA 2AOSA 1RD6A 2PBGA 5DF0A 1NWUA 3BUDA 3DYMA 1E5NA 5IDIA 4PBGA 1OCQA 1HNYA 4DO5A 2F8QA 4HPHA 4DM1A 3ZT7A 6CGTA 2ZUWA 3IJ9A 3RO8A 4R5EA 4B9ZA 1J10A 1V3KA 5A8NA 4ZXOA 1E6PA 2XIBA 1E1EA 3ARUA 3AOFA 4TVUA 1GUVA 1K9EA 5GNZA 4UQCA 5AC4A 4AISA 2PWFA 1KR0A 2VCAA 4JHZA 1G9HA 4LYQA 5I77A 2WSKA 3IAPA 4UQBA 5A8QA 1LG1A 3TA9A 4UQAA 4V28A 3VM5A 3MS8A 2F18A 3DX3A 5EBAA 2XIIA 1E6QM 1GONA 1X6NA 1MFUA 1BG4A 3POHA 4URIA 3WDRA 2QLYA 1R85A 3U5UA 1ZBVA 1QNPA 1JAEA 2JE8A 3CUFA 4AIOA 3KZSA 3CZEA 2X2IA 2O9TA 2WMHA 3ALFA 3WMBA 5C70A 4PEEA 3PZNA 1TE1A 2J8GA 1GOMA 4HZ8A 2VVNA 3BAJA 2WWDA 4XZBA 2WK2A 1W9VA 3SUSA 4B9YA 1WZAA 3IK2A 2J77A 1F4AA 1VAHA 4FK9A 3D4ZA 4MB5A 1UD5A 1BGAA 4DUWA 1OGBA 2IXVA 1E6NA 4PMVA 3A4AA 3M7SA 3RCNA 2GVYA 3EMZA 2XTKA 3MUY1 2ZUMA 1CDGA 1ITCA 1GOQA 1SMAA 2ZUTA 2WMJA 1NWSA 5A8OA 3CGTA 4HMDA 1U30A 1E4IA 2ZWYA 3VIHA 4CCCA 1W2VA 3K8MA 2EJ1A 1H3GA 2BS9A 3GNPA 3VGGA 3BCFA 1JDAA 5FKYA 4H8HA 2GK1A 1QI0A 3L4ZA 1GORA 1KB3A 4WSKA 5HDRA 1TA3A 3S5YA 1XH2A 4UOJA 4J3SA 1P6WA 1HT6A 2D23A 1RP9A 3DX4A 1SYTA 1EHNA 3DYPA 2Y5EA 3VO0A 3PBGA 2BFGA 3ZSTA 4GXPA 3ZR6A 3EYPA 1C7TA 5A6SA 6TAAA 2PWGA 4CD7A 1H41A 3CPUA 3VUPA 3PZ9A 2GJRA 2WB5A 1E6RA 2J7BA 1TVPA 2VX7A 4PTMA 4AD1A 3OIHA 4FMVA 3PN8A 1R46A 2JIEA 3VMNA 5A3HA 2E4TA 3PZTA 1JG9A 3DECA 3PHAA 2W61A 2V3FA 1A47A 1VBRA 3OZOA 2DT1A 1LL6A 4XV0A 1RPKA 2GK1B 1D2KA 2XFFA 1NARA 1KXHA 3NYDA 1E6SM 2WC4A 1QBBA 1TA3B 1UG6A 1V02A 3BVUA 3RM8A 4AZBA 3BC9A 1W9BM 1MVYA 3GNRA 3ZJ8A 3VNYA 3VPLA 1XD1A 4PRWA 1UWSA 2VJXA 1SFSA 3BCDA 1JXKA 1PX3A 1TVNA 2RGLA 3GNOA 3HJEA 1WB0A 1FHLA 1UQYA 5CLTA 4FNPA 3T2PA 1WAWA 1Q6CA 5A94A 1JYNA 1GW1A 2EPLX 4NSBA 4U2YA 4TUFA 2W5FA 4D6JA 3BUQA 3M6DA 3TTQA 1ECEA 2ZXQA 1KQYA 1UH4A 4MDOA 3GTNA 4HA4A 3SCVA 3UESA 4B3LA 2DSVA 2DT2A 8A3HA 1BPLB 2ZXBA 3ZJ6A 4N42A 1V6WA 1CIUA 1XYFA 1J0JA 2DQXA 2GSJA 3G6MA 3VD9A 5ABFA 1KXTA 2DSZA 4FNSA 1AMYA 1GQJA 4RE3A 4JFUA 4YN5A 4E4PA 5E70A 1IZKA 4PMQA 3A3HA 3VDHA 1UD8A 4JFWA 3VD7A 3PTMA 1WKYA 4UQ9A 1H0IA 3VIKA 5I2UA 3ECQA 5EB8A 2WMFA 2DH3A 3VGHA 3B8SA 2Y8VA 4CVWA 4IUGA 1SMDA 3II1A 3BSGA 1XHGA 2WAGA 3WH6A 1HJVA 2WMIB 5BXPA 1QHZA 1EA9C 4D6DA 2BNJA 4GQRA 4D6CA 1E4MM 2VQUA 4AD4A 5FL1A 1M01A 4AD3A 1E6XM 3B9AA 1V6XA 3MUIA 5ABFB 1CGVA 2V3EA 3OLDA 2X2JA 3WQ6A 1B3WA 7TAAA 2PWHA 3K4AA 3CTTA 4U33A 2DSKA 1UH2A 2VRQA 4Z2JA 3VIGA 2WHMA 1H2JA 1KGXA 2CETA 2FGZA 4AYGA 1CEOA 4QCFA 3TV8A 1ISYA 1CENA 4AYSA 4L4OA 3AS0A 4GQQA 3EMQA 1CGYA 1UOKA 2VMFA 4P8XA 4W7VA 4RE2A 1EIBA 3GH5A 3PZIA 5GPRA 1WE5A 5CSYA 4LPCA 2QPSA 2XWDA 1HKIA 3VIFA 1E4LA 1VFUA 2WZEA 2WCAA 2MANA 3RJXA 4D6GA 1SR0A 3S5ZA 3CZNA 4HU8A 3CH9A 3FXYA 3IAQA 5HXMA 4HP5A 3QHMA 5C8BB 1XCWA 1X1NA 3WF3A 5E6ZA 1JGIA 1DWGM 3LPGA 3W4RA 3ARWA 1MQQA 3WY1A 3I3BA 1CECA 3A22A 5EMYA 3M07A 1HN1A 2WHKA 1JZ2A 4W8AA 1KTCA 1HJWA 4ATDA 3AHTA 3SURA 2IXUA 2WC3A 1XH0A 2EXOA 3RM9A 1EQPA 5BXSA 2ZX6A 5A6MA 4JKMA 1ISVA 4OOZA 2VUYA 3GBEA 1EO7A 4M82A 4Z2HA 2WLYA 4QFUA 3CHDA 4U5IA 5JUVA 4P7QA 1VBUA 3SCSA 4W86A 1HXKA 3BUBA 4BQ2A 1QI4A 4S3JA 1GOWA 3GBDA 2YL9A 1U2YA 4TVCA 3N1AA 4AW7A 1UR2A 4PUDA 1V3HA 4MJ4A 4D1IA 1DWAM 3AISA 3PZVA 1FP9A 1UASA 3CLWA 1QW9A 1Q6GA 2F7PA 1V0KA 5KEZA 4E2OA 3W28A 3OGSA 2RGMA 4WJXA 3D4YA 2WCGA 3WQWA 2DSWA 4PMUA 4IPNB 5JIPA 4BA0A 3VU2A 3N17A 3AS3A 3WH5A 2J7EA 3AICA 3U7VA 4GI8A 1VEMA 1E56A 1OD0A 2YLAA 1OWQA 1GNXA 1WZMA 2GUYA 2JEPA 1CXHA 3WNKA 3QHOA 4CKQA 1B3ZA 1NP2A 4NZFA 1RH9A 1JF5A 3FHAA 1OINA 4IPLA 1GJWA 3AIUA 4P8UA 4F9DA 1WDQA 2C8NA 1JI1A 3LRKA 2ZX8A 3S6TA 2WMKA 1NWRA 4CD6A 3EDEA 1TCMA 1HVQA 1TUXA 1B31A 4WKHA 3MMWA 2G8ZA 3AMDA 1BYAA 1C8XA 1BF2A 5IFPA 4DWSA 1HJQA 4P8WA 5TD4A 1AQ0A 3A47A 1QNQA 1CNVA 2WLZA 4DWSD 2G3NA 3BAKA 1V0MA 1GQKA 2E3ZA 2C7FA 3KLLA 1J0KA 1KBKA 2J47A 3DDFA 1XC6A 2PI6A 3LXBA 3KWXA 1GJUA 2ZXDA 1KCKA 4HOZA 4FLRA 1UA7A 4BCEA 2YJQA 1V6YA 3G6LA 4GPNA 3BAYA 5I3DA 4AIUA 5HPCA 1QWUA 4P7RA 3RDKA 3U5YA 3KL3A 5FIPA 2E8ZA 2CIPA 4QCEA 4QLKA 2YA0A 1UZ1A 1LWJA 1UKPA 3N15A 4BZYA 3HG3A 3BVXA 2G4FA 3MU7A 2YKKA 2XM2A 2DT3A 4D72A 1J12A 3VD3A 3WDQA 3ARYA 1KR1A 2OSXA 4J3UA 3N11A 1QPKA 1B0IA 1VFFA 2J7DA 2BHUA 2F2HA 3AS1A 4F8XA 1E70M 2F1AA 2JFEX 3ARVA 2ESCA 1JAKA 1W9PA 3OLIA 4FLQA 1B3VA 3WEZA 3ZSSA 1TMQA 2AAAA 3MI6A 3AZTA 1WPCA 4LX4A 1B3XA 3KEHA 1OIMA 4UFKA 3WKZA 2G3MA 2J75A 2YL5A 3WFLA 1HXJA 4LQ1A 2XVNA 1CGTA 2VRJA 2ZUSA 2NW0A 3SEPA 1E40A 4UZUA 4WIWA 4EK7A 5A6KA 3GXDA 4P7NA 5DMYA 3RMEA 2J78A 1ODZA 2WBGA 3ARPA 3FAXA 2EACA 1FOBA 2PWEA 4C7FA 4TOQA 1UA3A 3F5JA 4S3KA 4P7LA 4D6IA 2G3JA 3H53A 5IFTA 3PZGA 1NOWA 1HTYA 1KGUA 3WFZA 2X09A 3AFBA 3WUGA 4J27A 4PYSA 1JZ4A 1JZ7A 2VVSA 2YDRA 1XH1A 2F7RA 4PMXA 1ODUA 4A4AA 2ZX5A 3MV11 4J3WA 3AHVA 1GVYA 2XSBA 3MMDA 3IANA 4K68A 4W85A 2D0FA 1TQUA 2EEXA 1O7DC 4JFVA 3NUKA 3POCA 3ZT5A 1N82A 1QHOA 4LYRA 2FH6A 1GOKA 1E0VA 3WNPA 1GCYA 4TXEA 1UD3A 3W82A 2CBJA 1FHDA 3LPPA 2XVLA 3VVGA 4EAMA 4MB3A 1MQRA 3CHFA 1MFVA 3DX0A 2CKSA 3VDCA 1C3FA 4F9JA 2W92A 2YA2A 2YOCA 3RILA 5CPTA 3ARSA 1PS3A 2WKGA 1OM0A 1QI2A 3QGVA 2X8RA 3UR8A 1UR9A 1TQSA 4M24A 5D4YA 1H0GA 3CUHA 2VX5A 4OZOA 4NRRA 4DO4A 2J4GA 2FH8A 2XVKA 1DTUA 3BUPA 5D9NA 3SCRA 4H04A 2XN0A 4MB4A 2BVDA 3WL1A 1QI5A 2FHCA 1FFRA 1W1TA 1WDSA 2CBVA 1LL7A 3L4UA 2DIEA 2OLHA 5CZKA 1Q6DA 4AZHA 3B9DA 2HVMA 2VC9A 3VMPA 5CG0A 1BFNA 3NDYA 6A3HA 3AIRA 3MUZ1 2EAEA 2FDMA 1EO5A 3FW6A 3GH7A 4AIEA 1WDPA 1W32A 3B9EA 1W3HA 4NXSA 4WSJA 2XGBA 3W53A 1ZS2A 4Q7NA 2YA1A 3LXAA 3UG5A 1MW3A 3VX0A 2WWCA 1QX1A 1H49A 2PWDA 3T08A 1XCXA 3AHZA 1MYRA 4QLJA 1PAMA 4HA3A 5AC5A 3WNNA 1QVBA 2BVTA 3BLKA 3MV01 3WD0A 2BHYA 2XM1A 4UOQA 1UZ4A 1B9ZA 1G01A 4RL3A 3WUEA 2UY3A 4BS0A 4A3YA 3MMUA 2V5DA 4KH2A 3VTRA 2VX6A 5CPSA 3LXCA 1O7AA 1HL8A 2QMKA 2XVGA 1JNEA 4W8LA 3ZJKA 3CHCA 1KCLA 2FHFA 1Q6FA 1UWRA 1EDTA 4CVUA 3WDHA 1M53A 1OT2A 2CESA 1GOIA 3EDDA
chains in the Genus database with same CATH superfamily
2JB5H 4JO5A 4CQ9A 5I0YA 2CRIA 1A6AA 5F3BB 1YQVH 1L3WA 3RIFK 2C9UA 5KSUA 4H6EA 3QZLA 4KI5C 3VNZA 3TUUA 3TTYA 2Y7QA 3EO9L 2VNCA 1QTSA 3VXNA 5CHNB 3WL9A 1DQVA 1K4HA 1YRRA 1YE4A 3RTQC 3LCGA 3WX7A 4N9EA 1S2AA 1X5ZA 2VABB 3UJSA 4BCZA 2HLAB 4ZTXA 1IAKB 5FWQA 4BQ9A 2D7MA 1KNWA 3SUVA 3LNDA 3STLA 2ESVE 2EVJA 4PJDA 5JBFA 2QAFA 2BXZA 4NIKB 5FIEA 4FTVE 4E0RA 1P5VB 2VWSA 3IU3B 2G4JA 4MRBA 1AS8A 4N2MA 3K4ZA 1IV8A 2F1BA 5LHDA 3O9WA 4F15C 1S78D 4EPSA 2DU2A 1HHKB 3O81A 1J0YA 3M17A 1QTYT 2RQ8A 5CINL 2HZHA 2NLJA 3MMEB 4XBGA 4AV4A 2EE2A 3G0UA 3TTSA 2NWSA 4WWID 3TYDA 1MEHA 1XF0A 3O6AA 4WHCA 7CGTA 2WNXA 4NNPL 5HWMA 4CQCA 3MLVL 4HU0A 4NZTL 1NOFA 5D1XC 1B30A 1LQ2A 4FHBD 1I1RA 5AC6A 3MRGB 4R3SB 4BF7A 1T2QL 5I1LA 1DVXA 1J9TA 5F8RC 1KM6A 4KY1H 4RH4A 4NQEE 3QYSA 1AQKL 3MRBA 1H3UA 5LGJB 4RIRB 3RITA 1VADB 4ODTL 3DA0A 4RZCB 3PPFA 4R34A 3P0YL 4EE9A 5FOOA 2YXWA 4NIYE 1EDYA 2OCJA 3LVEA 4L6HA 4C55A 1S46A 3LZQA 3EH3B 3IKKA 1SXBA 3HVDA 3TTOA 4IRSB 3ELQA 4D6FA 3VXPA 1FVEA 4Q89A 4I88A 5FA3A 4FQXD 4D8PA 4PUEA 3GKWL 1KRCC 1Z9SA 4CU8A 2Y6SC 2OMAA 2GLKA 3KYAA 1S9KC 2WTOA 2PDKA 4L1WA 1E9PA 5HD8C 2RMNA 5D93C 3CUPA 2X6CA 4J2QA 3VXUD 3T8LA 2Z00A 5EUOA 1JPSL 5BROA 1DL3A 3WLPA 1FZKA 1Y6KR 1EVTC 2WANA 3KDMB 3GSUB 2AGKA 2BRQA 5IKCB 1HJXA 4WU5B 1S5NA 3SE4C 4PODA 5GS2D 2V5MA 4QQ3A 1IB5A 4ETQA 2X1UA 4RZKA 4YHYB 3EYQD 1CQKA 3GMNA 2BSSA 3NFPA 4QOKD 4L5FE 4DW2H 3UA4A 1RFDH 3UPMA 3LTVA 5JQIB 1UWEL 3F6IA 1CR9H 3AQUA 4P48A 1VJZA 3TC7A 1PZ2A 3K74B 3ZDYB 4G3YL 4F79A 3TN0B 2V81A 2AJXH 3CVHH 2J7FA 3HI5H 4WI2A 4K07A 3A12A 1OWRM 2YCLB 3L7EA 1P7KA 4LBUA 3OZYA 2BZCA 3WLOA 4ACZA 3KHOA 3LKPA 3FQTB 5ABGA 4IHCA 2WNKA 2WLNA 3KLHC 1KW1A 1UJ3B 4OLVH 2IALB 2KPNA 2C79A 3DTXB 3IV3A 3MA7A 3SE6A 3IM1A 4PULA 2X2YA 4PM1A 1HWGB 4GKLA 2EH7L 3GO2A 4QRSA 1MIMH 1A5KC 4JRYE 4ZE5A 2VL5B 3S2JA 2NY2C 5IJCC 4BH8B 3ECBA 5EMMA 1JZ5A 3PTDA 2HISA 5LJYH 1NCDH 3ASOB 2VXQA 2R91A 3U4EB 3PBVA 3FU6A 4KHTL 3WENA 1J0HA 1KWKA 5LKNA 2L04A 2YQ3A 3DK0A 4XD4A 3QC6X 1C7SA 3D2UB 5I6PA 1JRBA 4ATLA 4YPJA 2IH9A 5CJQL 3VIIA 3V3WA 2JF1A 3GK8L 1DANT 1FUNA 3MR9A 4HQVA 1VFBB 4Z0JA 3CYVA 1DVSA 3ANYA 3C86A 1WH0A 3PJWA 4DK6A 1W5OA 3EUUA 3D52A 5F7DB 3JZ7A 3O3DB 5EEWA 1GKOA 3LV3A 5ADOL 1PV8A 4FADA 4Q2ZB 1BFTA 3C8FA 4XAWL 5C5YA 4GWEA 3CFBB 2YSSB 3NYKA 4OLXL 5LGHH 4A3HA 1TSHA 4MCZB 3CQIA 2RB8A 1NBVH 4FI6A 1IARB 3DVIA 1D5MB 3Q9QA 3K46A 5TDOB 2VLRB 3QI9B 3E0VA 5DUJA 3CBKB 3NCJH 4O53A 3D85B 4UOZA 1BQLL 3D9AH 3TURA 5HI4D 2Z26A 5I07A 4GW1B 2OOGA 1NPJA 5IB4B 3TH6A 4O54A 3O3AA 4MMXB 4IH3A 4XAYA 3PS7A 4UZSA 3TYBA 4JL1A 3G08B 3DN5A 1DLFL 1CN4A 4JS7A 1MCWW 1UACL 2K1MA 3SCMB 1DJSA 2HT2D 5CR1A 1JOIA 1HYSC 4GEIA 5FKAA 3CN0A 3ZQ9A 4P2RD 4WI0B 3ZTDC 3LCFA 1THAA 4JO1L 3LD5A 1A14L 2KLRA 1TJHL 1LL4A 2PP9A 5F7KC 3NBNA 1XIWC 2X4OA 4TRPL 1TV2A 3NZQA 5D2LE 1KSRA 3P8JA 1UD2A 4HCDA 4LPUA 3BP7A 2N59A 4HG4K 2Z1VA 5EZJA 4ELMF 5DD6B 1AMXA 2V2XB 3QQ9C 4F9LC 2CKNA 3ZO9A 3QYCA 3JV4B 3EFDH 3NJNA 1YYAA 2CCRA 3WAKA 4PQXA 1D2OA 4GFTB 3NZ1A 1OAKH 1VBHA 3WO4C 3UWEA 4S2SA 5EOCL 1M04A 4G8TA 4B5ZA 1DSYA 4MNMA 4PWHA 1P0DA 3RUGA 2YL8A 1XD0A 3OBAA 4KRNA 4LLDB 1K4DA 3Q2DA 3IGAA 3CZFA 2XQBH 4IGMA 1CXFA 1JPDX 1PYWA 4KVCL 4LRNL 1YJDL 4OKVB 4HBCL 3FC8A 1WQVT 2HG5B 3PULA 5ISZA 3H26A 1NWOA 2HXUA 3FYPA 1WD8A 4UOW1 3NQ7A 3L12A 1JDDA 5JO5B 2R2CA 1QHPA 4RZ5A 2K3HA 3DERA 4BDVB 1UKSA 2ZWZA 1NGWA 3NCEB 4DBDA 2OGYA 4R53A 3O6LH 3CXDH 4GZEA 2QCCA 5E1IA 3CZLA 2KKQA 1Q6RA 3B3IB 1M7PA 2IG2H 4HCRL 4Y7OC 4NM4H 3BH4A 3LKOB 2AGJH 3TYFB 3MRIB 5EN3A 3WCZA 3O3EB 4BCXA 2DBLH 5HAOA 4FYRA 5KZDA 1DFBH 3GLAA 5SWQA 1K1DA 2XZ7A 3NIYA 1Q90A 1WAUA 3WG6A 1OEZW 5T1DH 1QLEB 1U8KA 4M81A 3Q2LA 4NRYA 3E6FA 1RJZA 1D6VH 3OMZA 1XRFA 5F1IB 1NBYB 5C0JA 5ENWA 3NDZA 2OLAA 3ARRA 3NPWA 2G5RA 4FG2A 2J1ZA 3QC3A 3DPBA 3DGGA 4XMTA 1IEAA 2K0RA 1XAKA 4HPYH 3VXUB 1NMAL 1SXAA 3PDOA 4H25B 4R4BB 1T7ZA 2J57A 4UUJA 3EOYG 3CUIA 2ZZ2A 3BJLA 1V77A 1A4KB 4X9HA 1MQKH 2YKLL 1OB0A 1L2QA 1BEXA 5CM1A 5D4QA 1XXDC 5D7HA 4ZW3A 4JPIB 2FSEB 2E40A 4NUJB 3NTCH 3SCWA 1R3IL 4KNSA 3W6YA 3W83A 2KH2B 2E6QA 1N7ML 3DURA 4AJWA 3Q5YA 4QOKB 4PGDB 4RV8A 3T4AA 5C7ZA 1AYOA 2J7GA 3VXSD 4AYID 4PJ8A 3DX7B 3RIKA 4ZXBA 2FIKA 1CT8B 3H8NA 4RUBA 4PS4L 4HIXL 4NNAA 2XN9A 1S7SA 1AJ7L 4Z2KA 1UURA 1E1CB 4IBQA 1SRDA 3T4CA 3EH2A 4JN6A 2HMCA 2WV3A 5TH2B 3ZQWA 1CXLA 1ZDQA 2E5BA 1NAL1 3KDPB 1A3HA 3VILA 1QNRA 4H7VA 4PVLA 1W1VA 3E02A 3VW3H 1JP5A 1PTZA 2A3EA 1N4XH 4WHYH 4LUJA 1LRQA 3CHQA 2R6OA 3HB9A 4ZOAA 2A3CA 1MQ8A 5DRWA 5TE4L 3BW4A 1KN2H 1MCPH 3URNA 1PQZA 4PBGA 3EGXB 5DS8B 4QAIA 6CGTA 3ILPA 3CB8A 4IDJH 1PG7H 3TFCA 4MQSB 2O30A 4ZXOA 4MVBD 1AHMA 4MCMA 2DQFA 1OVZA 4NFBA 2QCEA 3B8VA 4XHJD 2PWFA 3B8IA 3S96B 4FE9A 4LRSA 1NAKH 4FN0A 1QSED 2KLTA 5M1TA 2BC4A 1T20B 3PF3A 1N2RB 3UTZB 5CH9A 2XIIA 1TMCB 3N25A 2Z4GA 1HAUA 3ME3A 2OODA 1EEYB 2GY5A 3JVGA 3EB2A 4TMBA 4P2QA 4PGZA 4HF5H 3TR9A 5T5FL 4NRXA 1W9VA 2C9AA 4B9YA 4ZQTA 3CHOA 1RULL 5HANA 1J5HA 3BUYA 4YOKA 8PAZA 2E86A 1CDGA 2E5CA 1GOQA 5DY2A 4WV1B 1XR2A 2XTSA 5TFSL 1UCBL 5FKYA 4F91B 1Q9LB 1GORA 5HDRA 2AABH 3E6HA 3C8NA 1SYTA 2OXGA 3BH9B 3DG7A 4GSQA 4QCIB 1S5MA 2R2EA 3HPFA 3IKCA 1EZ2A 1E4XI 3W22A 1RZ7L 1TEFA 4LC6A 2A6DB 1BLNA 3KWWB 2BNRD 4DJEC 4I3RL 2X7WA 2IPTL 3RVTD 2VSKB 4AQZA 3FB5B 2HX8A 3E3QE 4UB0H 3I9PA 1KFLA 3NTYA 4DO7A 1IEBB 1WCQA 4F9PC 4LQFH 5I73C 1KFEA 1CBJA 4KF1A 3EX6A 4H4IA 3GHTA 2NV2A 2WZTA 4Z1PA 3BPWA 3ZJ8A 3VNYA 3BWUC 4YTQA 1KC5L 3RU8X 1DYSA 1FFOB 4P2RB 2XACC 3TWBA 2X4SB 4GQZA 1KG0A 4R9HA 4DN4H 3OVRA 4QEEA 1HH6A 2CGYA 3FOLA 3RVVD 4CBZA 4HS3A 4HJ1A 3QPKA 1XO8A 3PNWA 3UWQA 1JN6A 2SEBA 3BWZA 1U8HA 2DSVA 5I02A 4JY5H 4HN8A 2J3SA 3N6YA 4N42A 1V6WA 2GSJA 4QRRA 1MUJB 5DVPA 4M93C 4JFUA 4BEQA 5E70A 2NY0D 6PTDA 2MNJB 3BDBA 1O5RA 5ACZA 4JFWA 1ETA1 1X98A 1UJPA 2G2NA 4N87A 2B7PA 5DJAA 5EO1A 1XGPB 3BSGA 2XLLA 3L1GA 2WAGA 3H21A 2OK0H 4IW4C 3GJFK 4L05A 5L4JA 1A4MA 3VH8A 4JLRA 5IFJA 1KELL 2A1WL 1WDWA 4YHZH 1CICA 4F8QA 2GQAA 3QH3B 2EVFA 1U0QA 4NPYB 7TAAA 4WO0A 5KYUA 2EDJA 2O61B 2YUVA 1H6UA 4W9LC 3S34L 3T6ZA 4PV9B 2FGZA 1CEOA 3V5KA 4KI5E 3D25B 3TC9A 1FNEB 2J9ZA 4RGMC 1OANA 5CBAA 5LG1A 3G5VA 1NFDA 2E68A 3FCTB 3HFYA 1TQCC 3QIUC 1SW7A 1XCWA 3LQZB 1W0YT 4GSRA 1E5AA 4NHCL 2LLGA 2W38A 2P3YA 5CAYB 2WQDA 4IMFA 2QFPA 3VD0A 1QMLA 4G7FA 1C8VA 2D9QB 3RM9A 2QUUA 3V1PA 1WBZB 2QUMA 2FWLB 3U46A 2Z7ZA 3MRPA 5F7FA 4UIKH 1ZGDA 1QI4A 4JO4H 1GOWA 1R3TA 4AW7A 4PUDA 3BLOA 3LHAA 1FP9A 4C83A 2P88A 4PBDA 3QORA 3CLWA 3N9GL 1SVCP 2E7CA 3MOAH 2Y85A 1S2VA 1E4JA 1RJLA 4HC1H 3MO1A 1HZLA 4IPNB 3TJ4A 2DMCA 5JDSB 4M6UA 2WOYA 3FX4A 4C6OA 2J44A 1OP3H 2DQDL 2ZRUA 5HR7A 1LTDA 4MOZA 3QEGH 4DN1A 4HXBL 4X42A 1LO4L 4EWND 3AU1A 4OD1H 3IJIA 3QV8A 1BMGA 1OINA 2BVPA 2UYLB 1U1JA 3GSWB 1GYLA 1G84A 3NIFE 3MHFA 5FDYA 1BF5A 4URKA 2G9KA 3SKNB 2DWTA 3TFKC 1NL0H 3ULVD 1BYAA 4D0DB 1SNRA 4JQXA 1ICTA 2PDJA 3OZ9L 1CNVA 4HJJH 4EXPX 3MCLL 3KLLA 4Q8OA 5AVQB 2VKWA 1GJUA 2W9EL 1C08A 1CE1H 3MRJA 4KVNL 4OCYL 4POZC 3KOWA 1V6YA 4GPNA 1BP3B 3DVGA 3RI5K 2UUDK 1OY3B 2QPFA 2ZOLA 5HI5D 4MUPA 4BZYA 2G4FA 1ADOA 4QJ3B 1EJRC 4PUMA 1ZHBA 3WXWL 2MQ3A 5DC9B 1O5XA 5FCUL 3V6OA 2J88A 5K93A 3V4BA 1KR1A 1QPKA 4L9LA 5D7KE 2VELA 3VXSB 2QJHA 4F8XA 4RISH 2H41A 1TPC1 1EJVC 5HHNA 4M19A 4UM9A 6PCYA 4GHRA 4LVFA 4A37A 1TMQA 5K1JA 4JG5A 3GO1L 4GLRI 3WO8A 2J75A 1V10A 3T4YB 3MLTB 2FLMA 3BJFA 3S98A 2VRJA 2SODB 5B7YA 3BT2L 1M6JA 3PWAA 2VDLL 4M6OL 3RWIB 3A3YB 4IXHA 1AS7A 1ZEAL 4BJLA 3EO9H 1FXQA 1S3HA 1FL3A 3STGA 1JZ4A 3Q2VA 4JY6B 2ZRZA 5BO0D 4NEHB 4KNTA 2VVSA 2P5WE 4DAGH 2C9VA 1U93A 1HKLL 5LNSA 4LLWB 1P6BA 4QUOA 2J2ZB 3EGDB 5I17A 1R5VA 1VCVA 2R1YB 3T3MB 3EKZA 4UMAA 1QO2A 3NRPA 4NJHA 1MQRA 2YYUA 1MFVA 1L9SA 4MY1A 2YA2A 4X6DB 3QY8A 4LEBA 3DXAD 1AIFA 5DMLA 2ZSWA 4NRRA 3C6EA 5CINH 5F70A 1QSEB 4MB4A 4H6QA 5EO0B 2PCPA 4EN3D 5J11C 3L66A 3T40A 5AB3A 3GJFA 5CBIA 5EU4A 4NNPH 4U1SA 4ZS6D 4NZTH 3PG2A 4UANA 3FW6A 5I09A 3MGOA 2OMXB 3VH8G 4AIEA 1O68A 1K5NB 5HJ3B 3DSNA 3GAKA 4BFKA 1QR7A 3CLFL 2AK4A 5BRBA 1AQKH 3W7EA 1JXDA 1XGUB 4JRXD 4ODTH 3W11C 2NXYC 3DLQR 1ID2A 3HC0A 2H32H 3P0YH 3PIQA 2APXA 2F9RA 3NYZA 3I6EA 3CX5K 3BLKA 1ZFJA 4MKSA 4ZQKA 5C0GB 4UOQA 1B9ZA 1KOAA 1BQUA 3KWSA 2MKLC 3WJXA 1UWRA 3PPCA 1EDTA 2AF2A 4HUVB 3KR3L 4E42B 3O7UA 3O3BA 3DMMA 4RZBA 4YFDB 4LLMB 3GKWH 2UZYB 4OJEH 1L0XA 4K2SA 5F97E 3U57A 4H26A 4EDXB 2R4SH 3HC2A 4WDWA 4K55A 1GKEA 2BNRB 4A6YA 1F97A 5IMOA 4U3HA 2ACQA 2DRUA 4QDMA 1XIHA 4M6ML 2X2HA 1IC4L 3CDZA 4N8VB 1MDRA 1WZLA 4H8WH 4L6OA 5I1KH 4C6MA 2I60L 3AADB 2QQ6A 1OFRA 4AQAB 4I9TA 2FBJH 4F7EB 4XMLL 4D8ZA 2Z2UA 1KLZA 3NEHA 3W7QA 1AZ1A 4XCNA 3WH9A 2X1PA 2V68A 2UY2A 3MLSL 4PREB 5AZ0A 3WD4A 1ISZA 4YN3A 1BYPA 1TWWA 1SPDA 1UWEH 2NX5D 3MRRA 2DMHA 3QFJA 1DEDA 3C8KB 5U4NA 3VVVA 2GABA 4GQPH 1PSCA 4K9JA 3KLKA 3TH4T 3O8XA 2CU9A 4NSKB 1TNMA 4KXZH 1SJVA 3LZFL 1OF2B 4NT6B 1IM9D 2OW6A 4OGYH 3IDJA 4UR8A 1WYIA 4O14A 3WQ8A 3LOTA 3RDJA 4M4RB 3ZDXB 4EXAA 3CO4A 3WK3A 3TA3A 3VNLA 3C5SB 5IWLC 3IVKA 4UT6A 3VABA 5ICUA 5SX4H 4DBWA 1CDUA 4E36A 2QVNA 4QHMB 1BBJA 3QUYA 1IKOP 2AXFB 2EH7H 5CSZA 4NRZA 1DWFM 5MEQB 5FM8A 1C91A 3TIDB 3PHSA 3W3OA 2N56A 4S23A 4NZ4A 1P1VA 2OT0A 4ZFZA 2ADIA 3RGVA 1BEYH 4GI6A 4F24A 3QARA 3SKOB 3ELFA 4CNPA 4KHTH 3IGKA 1A1NA 2AJZB 3UWVA 3D3VD 3S0CA 3ULUF 3L54A 4IRJA 1WNOA 4JZNB 3TNMA 4L37B 3QQ4B 1ZCOA 4XSMA 4RAUA 5DRNA 3VD4A 1TZ8A 1CGXA 4O16A 1LBFA 4AJYV 4K5NA 2V8MA 4KKRA 1JUFB 2Y61A 2E27L 3LMJH 4XODA 3UWYA 1RIVL 5DHDA 1SZRA 5BVPL 1W3NA 3VGAC 1O94A 3GBMH 1GS6X 2EDHA 2Z25A 5ADOH 5DUMH 4XAWH 2A99A 4JFXA 3I6LE 4XI5C 4RDQG 3VFSA 2WZAA 4I1PA 2J6XA 3KAOA 4X63A 3OL2A 3HRPA 2P5EE 3IRPX 3F12A 1NCBL 3KS5A 3LYRA 4DKAA 3REVB 4MJ6B 2JQMA 1W3IA 1MWAB 1XVSA 1HDMB 4XVEA 1A53A 3NCYS 3WK0A 3MLPA 3Q58A 4ZFMA 1PBGA 3DHJA 1R3VA 2NX1A 3BESR 5TK2A 4HKZB 3QNFA 1S3RA 4EKJA 3D50A 1Q0YL 2QGHA 2TRYA 3PSWA 1V0LA 5D7LE 3BPCA 5FYKD 1E50A 1OT4A 4DVBA 3ABRA 2PRLA 1KFGA 1VFMA 2AGTA 5MHSD 1UIPA 3UEQA 2GK0B 5I18L 3ZBMA 5IK3A 3RDTA 1ZTXH 5LNRA 3APNA 4ORZC 2BASA 1QOPA 3EGJA 3RWFA 2YARA 1XIGA 3RWHA 2XZQL 2JB6B 1J9YA 3UYCA 2BCKA 2WXHA 4FYQA 3KPPA 3T71A 5F6HJ 1TJHH 2NR6C 5D55A 5B3NA 1F76A 2WZHA 4KTEL 3A9BA 4G8GE 1BYCA 4F33B 1UR8A 4G59C 3MNVA 1F3JA 1W6WA 3ABOA 3NSJA 5JBEA 1XFCA 4PJXE 2PGRA 4GGHA 1UYQA 3MFGB 4RDZA 2P50A 5SV4A 4H3DA 3LCLA 3HZ3A 4WOQA 4A29A 5E4EB 1LO5B 3CPRA 3M7FB 3EUDA 5D7IB 4ZMTA 4JTQA 2X1XR 4IGNA 2P80A 3IJLA 1JXFA 2J6EA 3IIZA 3CZJA 4M8QA 1JZ6A 2PMQA 4X0VA 3O6FA 1SJEB 4LLUA 1I3RA 3OHXA 4HYTB 1LDCA 1I8JA 5E1HB 1JPIA 3OKOA 3SUUA 3FB7A 4HTYA 2IPUK 3H2QA 3PWIA 1LILA 1BQ5A 3SDXB 1JPHA 1OD9A 4E41D 3CIQA 2ZADA 1F45A 1CFSA 4ZMQA 3HE6D 1KKOA 4PRRA 4PV8A 3UYPB 1YJDH 3R6IA 4L8SB 3DXAB 4HBCH 4XNDA 2XPGB 5K59F 1R0MA 2P48B 1UT9A 4P3CL 3WJMB 3QYNA 5J13C 3HUJB 4EN3B 3BQUA 3HBZA 3IDNA 3MLWL 1H7OA 2QJNA 1E5YA 2H26B 5LWYL 3QY6A 3GZOA 3MGTA 4FXLA 4A35A 1TTCA 4LDOB 4F2UA 4F7TB 1S9YB 1JF6A 2X28A 4ZFOL 1WQ5A 2IH3B 4R8WH 5FOJA 1AJ2A 3MRLB 2W94A 4HCRH 4Z1AA 4L29A 3FSZA 1JIBA 4JRXB 3VE0A 3GMRB 5FA4A 3U79A 2ICCA 4JM2C 3TCLA 1VEPA 3RPKA 4HPOL 4AVNA 4K71B 2XZCL 3LERA 1TTPA 1Q8MA 2NUTA 1RSCA 2GJZB 1E0XA 1I1AD 4X2RA 4HLEA 4ZPVA 4NAEB 1OCRB 4LFHG 4YMPA 3AIBA 5JHDA 4PV1C 4I5XA 4G82A 5K4ZA 4W6WB 1VIWA 3AB0B 3KD4A 3HHSB 3BN9D 4X2UA 1B0GB 4NKQB 4R97C 1SYVB 5CU9A 1NMAH 4OLYH 5GS0C 3LTYA 2VURA 3A13A 1E5BA 4C4UA 2YR3A 4HCIA 3GSXA 3FB8A 3RR1A 4XN4A 2BSTB 4NYLA 2W59A 2YKLH 2V2CA 1G5AA 3WO3B 2BP0B 2Q8XA 1X4YA 2X7VA 2B31A 1R9YA 4LPTA 1R3IH 1WCGA 2A9BA 4GO9A 1AI1H 4GKOA 3FQWB 5J1SC 3W1PA 5FF7A 3VIMA 3RG1C 1AY1L 1R9ZA 1QABA 4GSXA 3RNKB 1GZPB 2YFOA 4UFIA 1EAJA 4RFNB 4YS4A 2R69A 1BYBA 2OMZA 3QRLA 4GKNB 3OJ2C 2FEEI 1IM9B 3MACH 1O6SA 5G4NA 4G1KA 3VFRB 1J01A 1FDJA 5CPQA 2YXOA 1EPXA 4AX3A 1KM0A 3BG3A 8FABA 4GUGA 3LIZA 3N1PC 3QAZB 4NBYB 3PF2A 3KOXA 4FCAA 4IK7A 4P9HH 4A6GA 3UP6A 1H0DB 3UZVB 1A5BA 3HTLX 2DUXA 1LO2L 5DVKA 1PKLA 2CK0L 4P4KC 5CC6A 3O11B 3VI4A 4MQXC 3QXWA 3ISYA 5TE4H 4RJEA 1NMBL 2EO7A 5IBUB 3EFOB 3GC2A 4P5TD 5GRVL 2X0HA 4KK5C 4R88A 2YR1A 5FFLA 3KGSA 2YN5A 4JKLA 2F5AH 3BAIA 1OK4A 3WJLA 4ICNA 3F7VA 1V5JA 4PS7A 4MYAA 3D3VB 3GSQB 3MV8B 5EY5A 2AI0H 2FQEA 3ZDZE 3VFNB 4R84A 3G1VA 3QJAA 2UY6B 3UZYA 5DZVA 4KS0A 1G7HA 1QNZH 1B2YA 3E0GA 4QROA 3AROA 2V5TA 4MPKA 2G3XA 1QR4A 1IT9H 1T83A 3HQNA 3OB0H 1TPVA 3U0TB 3KPMB 4LUYA 4HGWB 4WK4B 3MUJA 4KXDA 1RULH 3IV8A 1SJHA 2Z1BA 3YPIA 4JIIX 1LP9F 1OARL 4GE8A 1U95A 3IT8D 3HS0C 3GR7A 1B6UA 3WF0A 1GPFA 3GZQA 4FQQB 3S1UA 5LCVA 5IEKB 1FG2A 1E55A 4WW2C 5KZ6A 3WV0A 3UY8A 2YBGA 1WZ1L 4HAGA 3ONCA 2Z2AA 3C2RA 5TFSH 3ZRCC 4JM0A 1W6LA 2W79A 3H54A 3WS6A 4UTAL 3UMTA 2XINA 4H4NA 2Z9TA 2CDEB 4B3ZA 2DWEB 4F7KA 4N0FB 1D5IH 5E4OA 3CVBA 4DY1A 2EDEA 1WCBB 1KJ3L 2K4AA 5CWSA 2ZUVA 3A5FA 3CBWA 2XGIA 2R82A 4NO3B 3M43A 5AHEA 3K5RA 4M6PA 4WF7A 3UAEA 4I3RH 2ILLA 3BZEA 2IPTH 4J3OG 2L8AA 2BVOA 5MEND 4RSVA 1G4TA 2GDVA 3D18A 4PW3A 1RZMA 1U8QA 4R27A 2EXYC 4ODVH 4ZZFA 4I9WD 1KC5H 5IJKC 2HVBA 3AQDA 2WJ7A 4N7QA 4QD2E 3NT0A 1V3KA 3FDGA 5E2VL 1EGJL 2OMTB 4Z7VA 4ZMAT 5ESQB 5ALBL 3L5IA 4F8PA 5GNZA 1A25A 1VFAB 1NGQL 5KSBE 4JJ5A 4AVOA 3Q2NA 2PUZA 3NZRA 1E5CA 3NCBB 4Z7OE 3RKDC 1QO3B 2YEZA 3SGZA 2VMEA 4X9IA 5G5DA 1A64A 4NO0A 5DUBA 2B1HL 3CUFA 1IC7L 4LS0A 5KVGL 2WMHA 3QT2A 3KYOA 5AW1B 1Y6MR 2R29L 1T21A 4IIDA 4YTRA 3CCHA 4L3FA 1FDLL 1XCQA 4XPBL 4MB5A 2V4LA 3NQMA 3KVKA 3MKGA 2QSTA 1JZFA 2VDIA 4WWKA 3UXDA 3FL7A 2A1WH 3QQ0A 5CBBA 2ZUTA 5DJCA 3S34H 5IT2L 4H8HA 1LCOA 2POTA 4WSKA 4K7VA 5E6RB 4J3SA 4MNGA 4YSUA 1V79A 2ACSA 3CZUB 3BZ5A 3UDWC 1KULA 4Y2WA 4G1MA 3U30B 3ZSTA 1HHIB 4XKMA 3HE6B 4DHLA 2QHLA 2E6AA 4CD7A 2NUPB 1GGBL 4JYDA 2WB5A 5IVZB 3QJFB 3WFEL 2VX7A 4HT3A 4QS5A 4MXVF 3S6OA 4YCPA 2CH8A 2O6CA 2WXKA 2V3FA 3FCBA 4MJMA 1K03A 1Y8BA 3QZWA 2YXVA 3H4WA 2K8MA 4PHZA 4KRZA 3V4LA 4XVUC 4S0HA 3BOVA 1XZWA 4LKXA 4C1KA 5I3FA 2WXOA 1IAIH 3BCDA 1Z41A 3TWAA 1JXKA 4YDKL 3ZZSA 2UWEF 1WDDA 3CXHJ 4KJQC 3N9GH 1JYNA 4NAMA 4PH8A 5H1WA 1U1HA 2HAZA 1HNFA 5JIMA 4UNUA 4DEUA 3WLWC 3GTNA 3RZCC 4HA4A 4YSCA 5T3ZD 3IRSA 3FU9A 5INCB 4V2CB 1G1KA 4ELKA 4RE3A 5KVEE 1AP2B 3KP0A 3M5YA 4UV7L 1LO4H 3Q13A 3KVJA 1H0IA 3VIKA 1RD5A 1I1AB 4Y5YC 4X9BA 4LCCC 5IBXA 1NFGA 4HYVA 2W95A 2UY7A 4PE8A 4QE4A 3S3BB 2G0LA 4XWUA 1Q8JA 2VDQB 2BNJA 5IIEA 2VQUA 5M94B 5FEBA 4AD4A 2C26A 3P3BA 3CDCA 3MCLH 4XXDB 1OK8A 1B5TA 3TYUA 1X5GA 2W9EH 4KVNH 4B7IA 5GSRB 4PJBE 1GGUA 1SDDA 1A3RL 3DBSA 4LCYB 2A1YA 1R5WB 3RGTA 4NKDA 4XP6H 1R3LB 4XTRD 2Z93B 2CIKB 4D6GA 3WXWH 4KESA 5D4IA 5C8JA 3OZLA 2IPUG 3W1RA 2EEAA 3EAUA 1JGIA 3MRKA 3LPGA 4X6FB 5D7SL 4BK4A 1CECA 1P6CA 3AG4B 2A4CA 1L7TL 4LKCB 3VQMA 3GO1H 1F86A 1LT7A 4YVPA 2VGGA 5CCZA 5KS9A 3ID7A 4JKMA 3WTWA 2GSIA 1EO7A 3BT2H 1QSFA 1WK0A 3FK3A 1DVJA 4M6OH 1JK9A 1ZLEA 4TVCA 4TNFA 2GAZB 1DWAM 1ZEAH 3R8GA 1OAUL 5FYJD 5CJNA 1BVWA 5JW3H 4HNCA 5F9AC 2QJJA 3QG6B 3K0YA 3L3DB 3NEVA 4K94L 1FGNL 4PC8A 1HKLH 2EE3A 2FWOB 2LU7A 3AM8A 3VI3A 1J8KA 1K6WA 4XXWA 1YN7A 4AOFA 1EEUA 4P5TB 4N1EA 1JF5A 2Y0SA 1GJPA 4YHML 3OAUH 3KG5A 2OJ1A 4ZMGA 3MRQA 1KY6A 1HVQA 1AH3A 4FA8A 4ZO8A 1H7RA 3LRSA 3MMWA 2H0JA 1BOYA 1Q13A 5EFIB 1GQKA 3ROOB 2ZXDA 1WA2X 1FL6B 3NO1A 5FESA 4UTKA 3B9KC 1NBZA 2PP1A 3RB7A 3L9RB 3KL3A 3PGFL 1AGEB 3M64A 2ZCKL 4QLKA 1LWJA 1HKWA 3P3YA 3LN5A 1LMKA 1NTDA 1IJ9A 1OTSD 1U4EA 5DSCB 1VRSA 4YDZA 2YKKA 3G24A 1P7BA 3CLFH 4TNWF 3TQPA 4C5ZA 1XLAA 1MF2L 2EP6A 3DFYA 2X38A 3AS1A 1MHPL 4JMXA 4KKQA 4OTXL 2VO8A 3R7MA 1LO0L 1B4LA 4K7YA 1QSVA 2R9HD 2QPDB 1D3HA 1EXUB 1IKFH 4GRWF 4O0ZA 2BVQA 2B39A 1MFMA 2C91A 3G5EA 2AJUL 2JH2A 4JGDA 4WIWA 3ERPA 3KR3H 1Z42A 2X4RA 1OZUA 2DQGH 1P5UA 1HQTA 2EACA 3WFHB 3HI6L 4C7FA 2VGFA 3QUMB 1KTDB 2X1TA 1Z9LA 2FNWA 1BQGA 3WUGA 4DXKA 3QZMA 2BWDA 3QZWG 2OEJA 3OXSB 4FZ8L 1BQRA 1GYUA 5JIKA 5HGDB 2HB0A 1R3WA 4M6MH 2XSBA 1IC4H 3MMDA 3W84A 2I60H 4NJJA 5JDJA 2IAMD 5ABZA 1N3NA 2FL5A 4N8CH 5K9CA 43C9A 3VTTA 4XZIA 3WNPA 4TXEA 1ZPLA 4Y19D 2CBJA 4HPJA 4XMLH 3COOA 2DD8H 1J96A 1JCLA 4YIQA 3G6AA 3OP2A 3ROLB 4NL1A 4H1LA 4H8PA 4J1UB 1WFTA 1GGIH 4N4PA 4Z3IA 1WC7A 1F6PA 2VX5A 1FYTA 2J4GA 1CD9B 2XVKA 1X3DA 3IETB 2IQ0A 1RZPA 1H15A 3LZFH 1ZT1A 1LL7A 2EINB 3KOFA 4FA7B 3D30A 5DI8A 1RK7A 2WKOA 5CAHA 4XCYB 1MEXL 1EO5A 3TVMD 1NICA 1NMCC 4RMSA 4FGMA 3WJSA 1SJMA 4DP7X 2WQSA 4Q7NA 3WIHA 2GK2A 3NL3A 3KPRE 1TF4A 3W9EB 5IG7B 4L8CB 3R4DA 4KK8C 4NO5B 3DGBA 4MZYA 2F54A 1P4IL 3TNOA 3ABKB 2XWJA 4NYUA 1KBGH 43CAA 3CUZA 3R4IA 1O7AA 1H62A 3ZE1E 1JGDA 3ESUF 1M2VB 3TBVB 2WWMC 1M53A 1USZA 3SDCA 5KAQG 2W6RA 3JVFC 5CZSA 4P2OA 5G55A 4RA3A 1LEIB 4MAYA 4O5LL 2QIIA 4NUQA 2RIKA 4UU9B 2TSBA 4K39A 4G80A 5DJDB 4JL2A 4LSSL 1BMZA 3MYZA 2D03L 2HNEA 3F05A 3WDPP 2BHZA 4M1GL 3P4OB 1AL7A 4W88A 4M43L 2CO7A 3VYPA 4PCFA 1XH3A 4TQHA 1RIVH 2P1FA 4NF7A 1B88A 1TSIA 4YWIA 1T89A 5BVPH 3EX3A 5IQNA 4B15A 1XR8B 1QLEL 4FIQA 4WNQA 3ME0B 5JYLA 2J8UE 3GC5A 2QGBA 2PNDA 3WUWA 4PTWA 1XF3B 2WB1A 4IRZL 1HCVA 2HE5A 4Q8MA 3SGDH 2BY1A 1RL1A 3CN2A 3U4BH 3ABSA 1SJDA 3VWJD 3WSQL 1SO6A 4JFTA 1KBJA 1U58A 1BTCA 2OWXA 4U28A 3K6NA 4OI7A 4ATTA 2L5HA 2DORA 1GHRA 1XGZA 4XAKD 1UKQA 3BIAX 4G1EB 2BWIA 4A22A 2WSPA 1Q0YH 4LP8A 2FB4L 2PKDA 2QHAA 4DQAA 1RZGB 1E0WA 3QXAB 3D1MC 4W5ZA 4HSQA 3LU2A 4S0SD 4Z77B 2ZA3A 4FNTA 1RZ8A 4YDLB 3WKPA 3R8RA 2FJHB 4UQ3B 5I18H 2XC8A 3D0AA 5FO2A 1G94A 3FFOA 3PL6A 1QFWM 4RXGA 4ILSA 5CD5D 5E2WL 2UWFA 4BI6A 2ZG3A 3OJGA 1A7NH 4ML4A 4KTEH 1MZRA 2X87A 1SJAA 3X3GH 4KK6D 2QKIB 2AQSA 4QRFA 2EVGA 1DE4B 4C6PA 2XKNB 3FOMA 4JHWL 5IVXF 2DSUA 5E9AA 2NYYD 4FQXB 5C86A 2R0WL 4H9TA 4GCAA 4LUTB 2WZPD 5HATA 1L9PA 3WLBB 1M1SA 4JQIA 3QXDA 4QGTA 4Z78A 4H9MA 4MBRA 1MHHA 3P7YA 3H0TA 2WY3B 3IS4A 1YPFA 3K1DA 2IWEA 1RJYA 1I4FA 3RWEB 5FW8A 4D8OA 4QTHA 1YY9C 4D9PA 4HOWA 5DLMH 1L8PA 5FFOA 3GIZL 1FNSL 4H1LG 2HEJA 2ZC8A 4AMWA 2CALA 3W87A 1ME9A 3S42A 1B3JA 1OM9A 4IDLA 4CSSA 2IDFA 2CLRA 5AAMA 4M8VA 3DKHA 1KM1A 3PP4L 1MUWA 3WSUA 5LBSH 2ZA1A 4Q6IB 1TLKA 5KTEH 1IC1A 3H3PL 2CZNA 2HE8A 2F6UA 5JXED 4P3CH 4X80H 2YBTA 4H8UA 2VFGA 3PQYE 4NQDE 5HYSA 1HJSA 3BPNB 3U82B 3TSDA 1W9DM 3TA4D 1CB4A 2A9ML 1XF5B 1ORSB 4AWEA 2EQDA 2WW5A 2WBJA 4Z0BH 4RR4A 5F2MA 2FCBA 2EDQA 4NN6C 3QOKA 3FUIA 5EUKB 4P46D 2YDQA 3ZJAA 5C0RH 5JOPD 5DEZA 4P57B 2OMWA 2PWVA 2XZCH 1OP5K 4EIZC 3WEOA 4TMPA 2F7OA 1AL8A 5GGQH 3LM3A 3RNQB 1SQ7A 4IIQB 5DD0L 2X7LA 4TNWK 3QA3A 4EI6A 1AZ2A 3W1LA 3QRFM 1DIOA 5DCCA 1XM3A 2XWCA 2M83A 2EHHA 3HHRB 5JHLH 4F4RA 1B90A 1UOWA 5EV7A 1ZPTA 3WY3A 1JCMP 1NCUA 5J6HA 5H8MA 4FXKA 1G7MB 3CFTA 2Q8ZA 4OZFH 2IAMB 1SVDA 4OQ1A 4Y19B 4NKIH 2Y8KA 3UERA 3WUWG 2W3ZA 3J8F7 3OXRB 2YX0A 1ZVSA 1E72M 4DRSA 3HS9A 4MGGA 2LAGB 1JVKA 2K7QA 4D1JA 2VITB 2PR4H 1J6OA 4B27A 2PRMA 4Q4PA 4FKEA 5L9DL 3HG1D 4W6YB 4PJIF 2WVVB 4CQDA 4TX9A 1R3SA 2E28A 3TVMB 4M48L 4I1RA 3O9NA 1DVFC 1P7TA 1I3VA 1LE9B 3VCLB 4W4QA 3REWA 2JBMA 1KTLA 5JW4M 5HDBB 4LOVA 5KSVA 4BD4A 4FAAB 1O95A 2WJ5A 1LO2H 1DQXA 4YNYA 4JX0A 2CK0H 2XXCB 5ETUB 5DWPA 3PBWA 4HHWA 3CH1B 1NMBH 1WXZA 3RUBL 1OTTD 3N34A 2IDUA 1EP1A 5DEFA 1GC1C 3H2OA 4I18A 2ESVD 2FVKA 2OVLA 4IIEA 2A6JA 4OV5A 3PPEA 1T03L 4FC3E 3BVWA 4O19A 5EBWB 3T09A 1A5FL 4UINL 2LU3A 1J4EA 1F4HA 4TLSA 3TNBA 3WMLA 4XD5A 3E96A 4PMJA 1WIUA 3ITGA 3UD6A 3EA3A 2C13A 5I3HA 2I9TA 4M7JH 1ZSDA 2CQVA 1Z6KA 1TPEA 2P44B 1PZ3A 4X7EC 1SDYA 4NS0A 3FHQA 1VSCA 3CMGA 3HURA 4TL4A 2VISA 2TODA 5MEPB 5AW2B 3QUZA 3X14B 1WUEA 4W84A 1OARH 2D2OA 1QFOA 3LS9A 2VEPA 3WQDA 1PFCA 2WHLA 4H5SB 5E6ID 5DZ9A 1UXLA 3VWJB 1WZ1H 3S3JA 1X5XA 4HMEA 1KYOJ 4PMNA 1TRIA 4DYKA 2ZONA 3P6LA 5DJ8A 4UTAH 1DN2A 4AUBA 1NDMB 4GBXD 3C3UA 1LBLA 4FYSA 1F18A 5KBMA 5DQJA 2FLBT 2CDFA 1KJ3H 2DUAA 2DYPD 2JKLA 3C56A 2C9RA 4GRLD 1WWWX 3HMWL 5HYSG 2GJXA 1IX2A 4BQ5A 1QUPA 4CNSA 5J89A 1HO4A 1GVEA 1WA0X 3DO7B 3L5MA 1U3JA 1FZOB 5DHXB 4Q4IA 3L4TA 5KZMA 3WQCA 4J2PA 3FUHA 2XY1A 4C6NA 3EO0A 4O2EA 4G11A 2OTPA 3SUTA 4IKLA 4MFDA 3T0TA 5ALBH 5H4YA 1AHWC 1RUML 4N0CD 5E0FA 1NGQH 1XCTA 1L6WA 5D1XE 5BRQA 1TQWA 4HJ0D 3QJSB 2F0CA 5AYUH 3MBFA 4MBOA 2FZ3B 1LOLA 1INEL 3B05A 2AV1B 2NLIA 3KXQA 1FQ0A 4AWJC 2VFEA 2XFGB 2HZGA 3U2CA 4JFPB 1QAWA 2B1HH 1S5HA 2IWFA 1IC7H 1M7XA 1FL5B 3XISA 1UM4H 4AK2A 4Y4HA 4PI0A 2R29H 4G7VH 7ENLA 4XPBH 5ABHA 1Z8AA 3I75A 5I1GL 4IS6A 1R3KB 2FPVA 3TZVD 1OY0A 3UZEA 3GG0A 2DEXX 1UXSB 1V5XA 4F37F 5FYLD 3FB6B 2IPFA 2H8PB 5IT2H 4JDEB 3V6ZB 4P5UA 1PTGA 4J8QA 5H2BA 2DQ6A 1VR6A 2IQ9L 3QULA 3I2CL 5AL8A 2XYLA 1TVDA 2A3BA 2E9LA 1FH8A 1GGBH 4K4KA 5D38A 3SYOA 3WFEH 4D9QD 1GOFA 2Y0FA 4A38A 1UUMA 4C6BA 1TZHA 4QITA 5CUSL 3HG5A 5C0AA 3U7WL 3AMGA 1F2JA 1AXTL 3RX7A 4Z7QB 5IEHB 1NWUA 1HE7A 1E5NA 4YDKH 4HPHA 1TZOA 3AC0A 4MS8D 5CKGA 2DQJL 1YMYA 3NIDE 4P46B 4PL2A 2Q8BL 3AOFA 4Q0XL 3CX2A 4M8RA 4DZ8A 4TVUA 3CNKA 4AISA 1G7PA 4OGAD 2VCAA 2DLEA 5BW7A 1G7LA 5ABAA 1IXPA 2ZKMX 3I6KB 3MYJA 4PRIA 4P04A 1HK6A 2H9AA 1CFBA 3RVUC 1MJJB 5C0DB 2H47C 1ML0A 5ICYB 1TE1A 2EZ0C 3QQ3B 4EKXA 5LZLA 4IJTA 1YPZE 3SJVE 3L65A 2FEDC 2QVMA 3MKVA 2AAVA 3IDGB 5KBKA 4WWPA 3M7SA 2B59A 1QEXA 2CLZA 4WJ5A 2WMJA 4ALDA 4HMDA 4AXWA 1TMHA 3VI2A 5CJ8A 4AYFB 3MLVH 4ELMA 5KVFL 5DZJA 1IGTA 1ERNA 4MA1C 1A3RH 1T2QH 1IEXA 1GKQA 5C9RA 2Y5EA 3HKZA 2BFGA 1A4LA 5JHAA 3QQDB 3L7RA 1H3XA 2GJRA 1E6RA 3H22A 3SIZA 1TVPA 1UB6B 1ND0B 3TCEA 2CLHA 1JG9A 4DP6X 3UYRL 3D7PA 2OX5B 1EK3A 4ORGA 3AWGA 3HG1B 4MGXA 4HHAA 4JIPA 3A0OA 3MJ8A 4FJYA 4POYA 1MVYA 4U6HA 3NL2A 3W1AA 1G7JA 1SFDA 4K3JL 1JZDC 1TPUA 1Q6CA 3UJTL 5E2UL 4PB9L 4AX6A 4U2YA 2RDUA 3B4UA 1JPSH 5LXXA 2ZXQA 3IIVA 2PYED 3UESA 4K94H 1FGNH 4HFWA 3TJHD 3EKCA 3BGJA 1AMYA 4YN5A 4E4PA 5I1DA 2XBZA 3G9AB 4C65A 1OE2A 3RWJB 4YDMA 4AIZA 3G18A 2ESVB 4LPWA 4EF8A 4LARL 3OPSA 3BQ6A 1WHOA 4YHMH 5J6GB 4J2MA 3HV9A 4J3BA 1C9SA 1NUDA 4DIXA 2NY0B 4PJAA 4G3YH 2ICEB 2ZCHL 5DHVA 3TLLA 5CP3A 2PDNA 1KCRL 3G8RA 1EBPA 4W9DC 1J9QA 3JWOL 4N9BA 4F2MA 2YW3A 4LAUA 1G4RA 4PUUA 4KK9C 4WI3A 1E4LA 2VENA 3N2MA 1MWAL 4DYJA 3CIAA 3CH9A 4XRCB 1JV5A 4AT6B 3QHMA 5C8BB 3G22A 1MHPH 5E9DE 3LCWA 1LO0H 5E6IB 4Q7DA 4W8AA 1EFQA 1MUCA 3WLIA 2XH2A 2IXUA 3ULVL 1S7VB 3NVDA 2PPAA 3W0WE 2BB0A 3F2LA 2AJUH 4GQBA 2ZYFA 4N6QA 4LSQL 3ATYA 3U9WA 3HI6H 3BURA 4L3EA 4MQ7A 1YBQB 4LB4A 4MJ4A 1WDAA 4PYGA 4KDWA 2DYPB 4MZIA 5CJXC 4AGNA 3ILDA 2E1WA 1N8ZB 1T66D 3W28A 2O4EA 5K33A 2KDYA 2QDVA 1D8WA 5CJQH 4JPKL 4FZ8H 4QY8B 2XZAL 1ME8A 4CNTA 3GK8H 4U3XA 4ERGA 4KEMA 1OSPL 4PGJA 5BOZG 4GI8A 3MLXL 4YTSA 4IKJA 4JANB 1B3ZA 4BRVA 3PXJA 1PD0A 5HGHB 4S3AA 2CIIA 2JIXA 2WMKA 4R0LA 4OLXH 1RIHL 5ESVA 4ZSUA 1AQ0A 4BWLA 2ZVIA 1J0KA 3PUUA 2P5PA 3HAEB 1HEJC 3PP7A 2RJHA 3FTXA 3ZYZA 1FDYA 5EF2A 4Y16D 3S5LB 1BQLH 2BDNL 3ZUCA 5B7FA 3GD1C 2VCOA 2P8LA 4BA8A 3U5YA 3NK4A 1BD2D 4XNMA 4ZTEA 5FO8B 4ES4A 4MXWL 3QO1A 2BSRA 5JYMA 2ADJB 3RRAA 3OBEA 2EUVA 3MRDB 1YYCA 3BDYL 4E3VA 3N3TA 1DE6A 1SO5A 5HJBA 4D9LL 3IPFA 1J12A 5D1QC 5DS1A 3ITVA 4KH9A 5D2VA 4AE0A 1DLFH 2DQIL 4TS6A 2H6RA 3PUDA 4IPJA 2XTJD 4AM0Q 4GXVL 5LIXX 5BRZD 3TZVB 1FWXA 1UACH 1LRTA 1P4IH 4N0UB 5K9QG 1TV8A 2PDLA 2PN5A 3JU2A 2C1OA 1A21A 3T3PF 2HRPL 3SEPA 2NW0A 2BLFA 1UB5A 1LYXA 4JO1H 4DFIA 1ZA3A 1A14H 2IF7A 3ETBF 3BP6A 3MVSA 4TRPH 1A3LL 3BP4A 2YOAA 4O5LH 1VCAA 1TT6A 1AKJD 2Q7YA 4I2XB 4PYSA 4KV5E 1DKWA 2JKNA 4N2BA 4LSSH 2D03H 3LPWA 3R8QA 4M1GH 1D7DA 3ZX1A 4M43H 3ALPA 2PF8A 2ATAA 1X7SA 2VR8A 4I0PD 3VQ2C 5J1TC 5ANMB 5EOCH 4DZ5A 1QLEH 2C9PA 2ZPKL 2JJSC 1XWVA 4K5OA 4MDJA 3M88A 1QI2A 2VFDA 3V0WL 1AC6A 1H0GA 3B97A 1MIEL 5CD3A 4R96B 4IRZH 5DC4B 4DO4A 1U42A 4GX8A 3M1CA 1SM3L 2WLKA 2IMNA 2WOBA 4LBRA 3DOPA 3WSQH 1Q1JL 2DZEA 4XPAL 1Z3RA 5DMMA 3FUDA 4OQTL 3V5OA 3IVTA 3BZ4A 9XIAA 4ANUA 4C60A 1BFNA 1ZLSL 3IGXA 1G9MC 3MUZ1 3RPIB 4N5UA 5DMJB 1CIDA 3SDDC 4KVCH 4LRNH 3B0XA 12E8L 3GH7A 3DRQB 2A74B 1WDPA 3R06A 2Y7OA 1AXIB 2HJFB 4QTFA 1GYAA 4PS8A 1ZHKA 5GS2H 1D9KD 1GCFA 3ASWA 4QLJA 4QXUL 4X5RA 1DJNA 4ZPTB 4V15A 3AY4A 5IV2A 5EKYA 3ZZQA 2BVTA 4K7PY 4TSCL 2A2QT 32C2B 4DXXA 1IE4A 3WD0A 2CHZA 3R8BB 3GUTB 4F48A 3E5BA 5DO2D 3ZJKA 4PTTB 4YSEA 5ITFB 1WAEA 3C61A 1OT2A 4H9VA 3KRBA 4YIWA 5E2WH 5HVWA 3UGRA 2FJKA 4PAZA 4QBXA 4X4XA 4BUGA 2VZUA 3FFDA 1U3HA 5CEXA 2YPLE 5IMKB 3C5ZD 5FS5A 3NEOA 1EAQA 2HJLB 3PY9A 3VWKA 3APCA 2R1KA 1W1PA 2OZ4A 5FGSA 1R7AA 4FL4B 4JPWL 3GG7A 4CCEA 1HNGA 3KVMA 4L0YA 4LCUA 3RL2B 1V3LA 2FZMA 3RBSA 1NJ9A 4QAMB 2J66A 5XIAA 3WFDL 3ZTNL 2XXFA 1TQVA 2IDCA 3VFMA 4JHWH 3FCPA 2W66A 3FN9A 4DVRL 3TSBA 3FGCA 4FMKA 3EHBD 2H8XA 4UWMA 4FFVD 3RM4A 1BV8A 3VXOA 3U7BA 3F62A 3PWPA 1H9VA 2PYEB 4N3UA 3NPSB 1CFTB 2IDTA 1XR9B 5AHFA 5BUGA 3QORC 4H20L 3V0JA 2DW6A 5ACLA 3EG9B 2QT6A 4AEOA 1NKRA 3S9YA 4EZKA 3I6SA 2FK9A 3NQAA 1AW2A 1WO2A 2F53D 5HTSA 3LDBB 1FNSH 3MRNA 4PWKA 1GT8A 4XCCL 5FK9B 3BXNA 1JGEB 1N7MH 1P6AB 4HDIB 3R0UA 4NQCE 2NZIA 2NX5B 2PTTA 3T1FB 1J86A 1QVOB 3GEWB 1RP8A 3PP4H 1JV2B 3BJSA 3MO4A 3MRCB 5DFVD 4KKPA 2OXNA 2PO6C 3RTQD 3H3PH 2BSED 4PS4H 5PCYA 1VPOL 4HIXH 1I7TB 5IGXL 4HUCA 1AJ7H 1YYML 4JQ1A 3M1BB 5MI0B 2EDBA 2A9MH 2FBRA 4NKOA 4DGUA 3EFFA 1JZ8A 1IQDA 3K2UL 2ACRA 4KMLB 1G0XA 1XEUA 1DDHB 5F9JB 4Z1BA 5A40E 3N6JA 1A4AA 5F21B 5EU3B 3KBSA 4LVDA 4D0CB 4D0BB 3TPUB 1ZY9A 5J5EA 4S39A 4XX1E 3V6OC 2GFTA 5J7CC 1H5BA 5C0IA 3NCOA 4QAWA 2FWUA 4B16A 4OFVA 1DQKA 5FYKL 3N1MC 4G8FA 3Q65A 2JQZA 5K9QI 1EDQA 2OT1A 4XXCC 5I9QC 3ET9F 4PMZA 2OSYA 1RHCA 1C8YA 3NSYA 3QWOB 5HHQA 4IK6A 2H2PC 4OFYA 3H2CA 2ZUUA 2VXUL 4K3ZA 1UGKA 4EIVA 4TLKA 1KFWA 5D8JL 1DSFL 3LNEA 4L0PB 1W9XA 5T5FH 5AY7A 3EWDA 4UQ2B 3PM6A 4J39A 1SSGA 4MHBA 2NXZD 3TYAA 1U83A 2V3GA 3DHPA 5GSVB 4KQ3L 2FZDA 4HKJB 1QWNA 1UCBH 4YHGA 5L9DH 1AXSB 4Y16B 4YBQC 1LUCB 2FZNA 3GXFA 1BD2B 2W65B 2NTSP 5DQ9B 1HWWA 1JK8A 2WLHA 3C2EA 4M48H 1RZ7H 3UJ2A 2E9GA 1P53A 5HYJA 3ZKXB 3RKPA 3QF0A 3H7LA 3R7QA 4FNQA 3LYEA 2WLMA 4AQEA 4OLUL 3QDJD 1JE6A 4L8BB 4G71B 1G4SA 4ONGL 2XTJB 4EZLA 3GKAA 5BRZB 2IUZA 3OGRA 4N2GA 1GR7A 4L1DA 1AR2A 3JT0A 3P3UA 3V2AR 3W9DA 3IE9A 2P5WD 2HRGA 3W00A 3THML 3LDVA 1JPEA 1HVXA 4LVEA 4OI8A 1A1MB 4N24A 2VTFA 1LHZA 1RLDA 1FIEA 3PV6A 3OQRA 1A49A 1ZWIA 4J2XA 6XIAA 1D9EA 3NIGE 4FALA 6REQA 2AMUA 3JWDL 5BRPA 3THUA 4GXMA 4L4VE 1AKJB 1ZBCA 3LEYL 2G60L 3IE4A 1WHPA 1V7NL 4UINH 2EECA 3PNZA 2W67A 1K3UA 1QAPA 4OUUA 2BP8A 4WFHD 4D6EA 5I76B 1LEKA 2O6DA 3B9VA 4JTAA 2QCGA 1HSBA 3L3HA 1BVLA 4I0PB 3BLLA 5H8PA 3NJVA 3OGCA 3T0EC 2DVUA 4Y2OB 1I8IB 3MU3A 3W7MA 4C6CA 4OF3A 1RZIA 3CAQA 1KELH 3TO2A 2LLEA 3S36L 2E25A 4O4VA 4WZHA 4UMSA 1OC5A 2VDQL 3EDFA 4KRPC 2VN6A 3FT2A 3QWRD 1ETZA 4IGBD 3K6SB 3UZWA 4E41B 5GNYA 3ZMRA 3VIPA 1IZCA 4NHCH 3PWUB 2XWXA 4F20A 5DMKB 1IUZA 5SWZE 1T5WA 2XN1A 1D9KB 2HBXA 2IFGA 3BYTA 2P1YA 1FWGC 1BWMA 5DWUL 1V02E 4QYOA 3S1GA 3RVWD 4ZMPA 3KBMA 5IR1B 5CU5A 3I7QA 3QIBA 3TBYA 2ADAA 3S8HA 3MHGA 3NQFA 1IO4C 4WO4A 3QYQA 4IMKA 4L4PA 3BOLA 2C5DC 3W27A 3LN9A 4RDYA 4P23A 3C5ZB 1IGWA 1RUMH 1MH5A 5AW7B 5BU6A 4L1TA 4HZLB 3F03K 2HTKC 4EUPB 5T1JA 1L0YA 4N5EC 3DOSB 3FBKA 2DQDH 3CS2A 4G7SB 4GOSA 2HPOA 4DVOA 1E1FA 3FSUA 4H00A 4QXTB 4HXBH 1AJ0A 4N2AA 1DFXA 1CYWA 4WU7A 1Y1DA 3MBEA 1NAMB 1WBJA 4JFOA 5I0VA 3EHBB 4M3KB 3N9KA 4L56A 1KBIA 1OP3K 2CZDA 4U6XA 4I5BA 1HWHB 4GVFA 3OZ9H 3LY0A 4K8RC 1JPFB 4JZJA