1ODUA

Crystal structure of thermotoga maritima alpha-fucosidase in complex with fucose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
441
structure length
422
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEDLPGYKWEFTRGIGLSFGYNRNEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
total genus 148
structure length 422
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1oduA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1oduA01
1OIFA 1HJUA 2XVLA 3FHQA 3FXYA 5BCAA 4D6GA 2YL9A 4GO9A 1FHDA 3ZOAA 1EDGA 4YN5A 5A6LA 2E9BA 1X6LA 4PMVA 4OKDA 4JFSA 2CBVA 1IZJA 2DSZA 2BVTA 2PB1A 2YL6A 2VCBA 3BMVA 7CGTA 2F7RA 1H0IA 4TTGA 2OW7A 2VCCA 1C7SA 1UWIA 4U5KA 4QLJA 3A47A 1VBUA 3WDPP 1HXJA 4UCFA 1U33A 2XM2A 5JBFA 5E6ZA 1WPCA 3ZSTA 1XYZA 2WYSA 1C3FA 4MAZA 1G9HA 3W28A 1LJYA 4AZ6A 1BGGA 2X0YA 1QNPA 4MNLA 4HPGA 2D0GA 2V5DA 2WMKA 3PBGA 1IT0A 4AC1X 4GINA 2YA1A 5A95A 2XSAA 1TR1A 2VX5A 1NOFA 1E4MM 2VZSA 3BSGA 2DT2A 3VKKA 1ISVA 1E72M 2WMGA 2DIJA 5E9AA 3LRKA 3ZJ8A 2BY1A 4WSJA 1UR0A 1W3JA 1AMYA 1BGAA 1BYDA 4WKFA 1JYNA 3KE0A 3VVGA 2WSKA 1ITCA 3L4XA 2WVVA 1TFVA 3TTYA 4BF7A 2CBIA 1GVIA 4MAVA 1HL8A 1E15A 3WH8A 1SFSA 1MQQA 4M56A 1C92A 1UD3A 2WMFA 5A6MA 1HJVA 5A2AA 3O2LA 4HZ8A 4WLCA 2OSWA 4MNJA 2ESCA 1QNQA 4DWSC 4RL3A 4QDMA 4DUXA 3GXPA 5CGTA 5CXPA 5I0DA 3KWXA 1H1NA 3U5UA 1JAKA 1XD0A 1OD0A 3WF4A 3RIKA 2CIPA 1R87A 1AVAA 2WWDA 3TOPA 1JZ8A 1G0CA 3MMWA 2XTKA 1VFOA 1V0MA 1QW9A 2J62A 1HF6A 2BV9A 3MV01 4MJ4A 4M24A 3UR7A 4BS0A 1TA3B 3PZOA 3ECQA 1MFUA 3WH6A 4DO4A 4AZCB 4UFHA 1LLOA 3WD2A 2XGBA 3AIWA 4P7NA 3UETA 2QMJA 3N11A 5CG0A 4B15A 3VIIA 3A21A 1IV8A 3KL0A 3F5KA 1CXIA 1UKTA 3AHTA 4DWSD 4JZ5A 4HU0A 3QR3A 3CZKA 4W88A 1EOKA 4MJ2A 1ZJBA 1HKMA 2EQDA 3DX0A 3K8KA 2D2OA 3LMYA 3AS0A 3UEQA 2F7PA 1DP0A 1HJSA 2X0HA 3BAJA 2VR5A 2G41A 2PC8A 3JUGA 1CGYA 3CPUA 3ARYA 4W7WA 3OA5A 4Z2GA 2O92A 1GPFA 2ZX8A 5IHRA 4WIWA 4MPKA 6CGTA 4LGXA 4MNMA 3SCRA 1QWUA 1E6SM 2TAAA 3ARSA 4D1IA 1UKOA 1VFMA 1J18A 5BXTA 5LA2A 2V3EA 3PTMA 3CMJA 5CSUA 1PS3A 3IJ8A 2D73A 4UZSA 1ZBWA 3SCSA 1MW0A 2QHAA 2VL4A 4TOQA 4Q22A 2BNJA 1JDDA 2CYGA 1GQIA 2CETA 1TCMA 2ZICA 3L2LA 5ABFA 1HWWA 2WMIB 1I1XA 1LL6A 1VEMA 2GVYA 2XN2A 1EGZA 3U5YA 5M5DA 1BHGA 1V02E 1KQYA 1QI3A 4XV0A 2XVKA 1KBKA 3EDJA 2DT3A 4W87A 1CZ1A 2GJXB 2YBUA 3WD4A 3T0BA 3PZIA 4R5EA 1MVYA 1XH1A 2XJ7A 3HG4A 1P6WA 2CPUA 3UG5A 1DWGM 2FGLA 3AMCA 1WDRA 2VC9A 3F5LA 2WLYA 5CGMA 1JAEA 5EFFA 2ZOXA 3S2CA 5DEZA 4W89A 2F2HA 3W25A 3CV5A 4AMWA 3BCDA 4D6DA 4EANA 4C7FA 1LF1A 3OZOA 4W8LA 2YBTA 2EXOA 3TA9A 2YA0A 2E9LA 3RM9A 3A5VA 1E0VA 1ZBVA 4UTFA 5BRQA 3VU2A 3E1F1 1J0JA 2C0HA 4CD5A 1B90A 3SIMA 4JAWA 3WEOA 3DC0A 3ZJ6A 1JYWA 2DPEA 2ZUVA 4OGZA 1UWUA 4D71A 2J8FA 3N13A 4MB3A 1NH6A 4LYQA 2PWGA 1UR1A 1R7AA 3ZJ7A 2YDQA 4JKMA 1KXVA 4HPHA 2D0FA 4MB4A 3N9KA 1LQ0A 2F61A 3WENA 2F7OA 1GOQA 1WO2A 1LG2A 3A6OA 2WHLA 3SUWA 4QFUA 3I3BA 4ATWA 1JXKA 5D9PA 3VDBA 3ZIZA 3AROA 1H09A 4LYRA 1TG7A 1MXDA 3A23A 2XUCA 3WNKA 4UQDA 3BUQA 4GKLA 1BPLB 3SCNA 4H04A 3VIFA 3WH7A 4GI9A 3HG2A 3VD5A 3CUFA 2CHOA 4ZXLA 4EAMA 1OSEA 3DDGA 3CTTA 3L4ZA 4A3HA 4GI8A 2GDVA 2G3JA 3LPGA 3GH7A 3MO4A 3VPLA 3OGVA 3DYMA 3ALGA 2WLZA 5D8ZA 5A6KA 3AIBA 1CEOA 1JGIA 1FFQA 4PSPA 3K46A 1QOXA 2W5FA 4AY1A 2ZXDA 1ZBCA 3SUTA 1B0IA 2DT1A 3VUPA 2XVGA 4LQ1A 1LWJA 3M6DA 1WZKA 1PX8A 4PCSA 2DT0A 4W5ZA 3VGGA 1SR0A 3AYSA 2VVNA 4D6CA 2OSYA 3OLEA 2XFRA 1BG4A 2F7QA 1VAHA 2J7BA 5ECUA 1DWJM 1EQPA 1CWYA 3OLDA 4E8DA 3QOMA 2CERA 2EO7A 2BVYA 4AD2A 1ZS2A 3J7HA 2W4XA 9CGTA 1W1VA 5CSYA 1A3HA 2V3DA 1B2YA 4ZE5A 2XHYA 4GPNA 2JFEX 2V5CA 1SYTA 4PN2A 1VB9A 4H8UA 3GM8A 3WQ4A 4GZIA 5HBFA 2NT0A 1I1WA 1UD4A 3VSTA 2XN1A 1J12A 3BUPA 4ZEPA 5A69A 2D20A 3TTQA 1GVYA 4FNRA 4FNTA 3LPPA 1OCQA 2ZIDA 3AZSA 3A4XA 3K1DA 1GNXA 3LPOA 1EXPA 3LXCA 1E6QM 3KZSA 5FIPA 3UERA 3VIMA 3BAYA 3NDZA 2EAEA 1E0WA 1KB3A 2FH6A 1US3A 4PUEA 4DM2A 1KTBA 2WSPA 1E70M 2EABA 3QHNA 5ABEA 1EIBA 5JBDA 1IZKA 1M03A 1EOMA 1D7FA 3W6MA 1MFVA 4BQ3A 1E4LA 1OGBA 1ODUA 4HZ6A 2FHCA 5CPSA 2A3HA 1VFUA 5DT7A 3W29A 3UR8A 1H41A 2CESA 3S6TA 5FCZA 2Z1KA 3DX1A 4HOZA 3WH9A 4TXEA 3W6LA 5C71A 1UKSA 3AICA 1XD1A 2W63A 2Y5EA 1XCXA 1HJXA 1VRXA 1KXHA 1GOMA 2FHFA 5IFPA 1NP0A 1B3WA 2O9RA 2JF7A 5GPRA 4UFMA 3BUBA 1CXHA 4KH2A 2PWHA 4F8XA 2VRKA 2VZUA 3U7BA 5E0FA 2PBGA 4PTMA 2O9PA 2DH2A 2CKRA 5BXRA 5A8OA 5I23A 1PPIA 1E1FA 3W4RA 4HP5A 3K8LA 1CENA 1TQTA 4HTYA 3MMUA 1I75A 1UHVA 1E5JA 1JZ5A 4DWSB 3WELA 1T0OA 1FH7A 2VQUA 1SZNA 1V3JA 1FOBA 4P7OA 3T2OA 3H53A 2RGMA 5JUVA 2F8QA 1FA2A 1BSIA 5BRPA 3CMGA 3WQWA 4OZOA 4P7RA 2QLYA 1UASA 1V3LA 1TMQA 2WC7A 3OLGA 1J0IA 1PZ2A 3VOCA 3WF3A 1NARA 3W0KA 2MANA 2DSUA 3MV11 3W82A 2DEPA 3DX3A 2YA2A 3AMKA 8CGTA 2VT0A 2J25A 1WKYA 1OBAA 4A3YA 3SCPA 3BVTA 1AQHA 3CZ8A 2WVTA 1ZL1A 4EKJA 4AD5A 1VENA 4UOZA 3ZMRA 1E6XM 1XH0A 1B9ZA 3N15A 4NZJA 1HJQA 6TAAA 4K68A 5D4YA 5IFTA 3CZGA 3POHA 4WJXA 4EK7A 3WBEA 1JD9A 3L4WA 1R85A 4MTVA 4CU7A 1F4AA 3VGHA 1O7DC 1JXJA 1TQVA 1CBGA 4YHGA 3GBDA 1S46A 3AYRA 4N42A 3RPMA 1GQLA 1K6AA 2WKGA 4MB1A 1HX0A 4IUGA 1KGWA 2XFFA 2WXDM 2ZX6A 1MWOA 2BHZA 3SUSA 4LYPA 1WDPA 5FL1A 4AZGA 2J7FA 4FNUA 2YL8A 4HMDA 2VR4A 1SMDA 3GXFA 2YLLA 2PBOA 2BY0A 3EJQA 1KCLA 1H5VA 4AMCA 1RH9A 4GIAA 1W1PA 1W9DM 3MUAA 3WD3A 4HZ7A 2VX6A 5CLWA 3AS1A 2G3NA 1EO5A 3MMDA 1F4HA 2VRJA 1UR9A 3VDAA 4PMZA 4B9YA 3DECA 4WSKA 4DUWA 2GK1A 4M82A 3WDHA 5A8MA 1R75A 3CH9A 3F4VA 1UD5A 2EJ1A 3KL3A 3WBAA 1GOKA 1JDCA 2DIEA 3HG3A 4CN4A 3RM4A 4NX0A 4AIEA 1E5NA 3VGDA 1CGVA 2ZXQA 2D1ZA 3ZO9A 3IJ9A 3B8SA 3GZAA 1QHPA 2VURA 4Z2KA 2GUYA 1D3CA 3WNMA 1E55A 3VSUA 2OYMA 2WWCA 4GI6A 4C7GA 4IPNB 5I6SA 3M7SA 1HTYA 4Y7EA 3EMCA 5FOOA 2WCGA 1H4PA 1JD7A 1E43A 3CUGA 4GO8A 4PMXA 4BZYA 3BLPX 2IUZA 5BXPA 1NWRA 3L4VA 3BCFA 3I3EA 4FLRA 1MYRA 2Q8XA 5CQ1A 3EDEA 1K9FA 3BAXA 4ATLA 1DWHM 1GJUA 1BYAA 4PYSA 4V28A 1PJ9A 1VFFA 1BFNA 2OYKA 1JF6A 4RE3A 2EEXA 1NQ6A 3QOKA 4E8CA 1WDSA 3RMEA 1V3MA 2WMJA 4A4AA 1B1YA 1J0HA 4F9DA 1JI1A 1VF8A 1W9UA 2VQTA 1WB0A 1UYQA 3G6LA 1OINA 1TZ7A 2YDRA 3TTSA 2WHMA 4DUVA 4U2ZA 1UKQA 1CGWA 2WANA 1JZ7A 2HISA 1EDTA 2JALA 1B3YA 1GHRA 1M7XA 2NW0A 3WD0A 1BVNP 2WAGA 1QNOA 2VX4A 2PWDA 2DDXA 2ZX5A 2QPUA 2V3GA 3CUHA 1CIUA 2RGLA 1UA7A 4MNKA 4QLLA 1B3VA 3B9EA 3APGA 4NSBA 3FN9A 4P7QA 4KGJA 2WC3A 3AXIA 3ZQ9A 1UWSA 2J74A 3PZNA 1ZU8A 3MI6A 4NF7A 3HZ3A 3KLLA 4PMYA 4H8HA 1JG9A 1V3HA 4AW7A 2WVVB 2IXUA 4PMDA 2ALWA 4HU8A 3GXDA 5KEZA 3CIVA 2FDMA 5ABFB 1UUQA 2E8YA 3AFBA 1EH9A 3ZR6A 4J28A 1U2YA 2CCRA 4PTXA 4AIOA 3KL5A 3BAWA 2YL5A 5AYBA 3LXAA 2C7FA 3TONA 1PX3A 1V0KA 5IHSA 3H55A 2X2HA 2DQXA 2VCAA 3B9DA 4PUDA 1KGUA 3UG4A 2EPLX 1KBBA 3W53A 1CYGA 5DF0A 4Z2LA 2ZXBA 4CN1A 3LXBA 2E40A 2WMIA 1UZ1A 5CPQA 3GXTA 5C8BB 3IAQA 3WF2A 3IANA 2WMHA 1HKJA 3WUFA 3WIJA 2O9TA 4EE9A 5M3WA 2YKKA 1TA3A 1HNYA 1KTCA 1GZJA 3FY1A 3BUIA 3BGAA 1HVXA 5DO8A 1XYFA 2YIHA 3BLKA 3EDDA 1PIFA 4HMCA 1HL9A 2G4FA 2J8GA 1HP4A 1JZ6A 4UNIA 1UQZA 2J7DA 3ZR5A 1HVQA 5BYWA 3TP4A 2WVSA 3MUIA 2WHKA 4RE4A 3PZQA 4HOXA 4S3KA 4H8VA 1WNOA 1R47A 3QHMA 4HA4A 1ISZA 3T2QA 4ZFMA 4AMXA 3GXIA 3D4ZA 3NJ3A 1QI5A 5GQBA 4B16A 3AHXA 1BYCA 4QP0A 3VMPA 1UKPA 2DGAA 3N04A 3DHPA 3I3DA 1JNDA 3B9AA 1FFRA 3SEPA 1GQKA 3ARTA 1J9YA 2ZUWA 4W8BA 3SURA 4DO5A 1DWAM 1DWIM 2AMGA 1W3KA 1XSKA 3A4WA 2CBUA 1CXLA 3POCA 4JCMA 1KR1A 4JHZA 5EB8A 2D3LA 5HOSA 2ZX7A 1TQWA 3MSGA 2VZTA 1EHNA 2J78A 1Q6EA 1KWGA 3WN6A 3VILA 1DTUA 2J47A 2PWFA 2J7GA 3MANA 2F18A 1Z32X 8A3HA 1E56A 7TAAA 1SMAA 3VIHA 3HU7A 2WKLA 3EJRA 3NCOA 5A1AA 3RM8A 1QWNA 4W86A 4J3TA 3GTNA 2OLHA 1QI4A 4QCFA 5A6BA 2W66A 3M07A 4CVUA 1UR8A 3WDRA 4UZUA 1TQSA 4UQBA 5CPTA 3AMGA 1HXKA 1K9EA 1OWQA 3VIPA 3VD7A 4UFJA 3FHAA 2XVPA 3IAPA 3AIEA 2FYVA 2YDSA 3SUUA 2FHBA 3WDIA 3WFLA 5CLTA 1QBAA 1QI2A 3NSXA 4JFUA 2J7HA 4W84A 3FNDA 4AD3A 3S5YA 1W3HA 2VJXA 3GNOA 4U3AA 1N82A 2XN0A 4AYGA 4HA1A 5BROA 4LPCA 3THCA 3WQVA 3MU7A 1W91A 3K8MA 1W1YA 5D8WA 2E0PA 4KWUA 3WDQA 2BXYA 2XYLA 4FLOA 3FAWA 4J27A 1X1NA 3SCUA 3BVUA 4AISA 2X2JA 1W9PA 3D5HA 3VD3A 2QF8A 1ODZA 1J01A 1V03A 4Z2JA 5AC5A 3VSVA 3GDBA 5EFDA 4D1JA 1D2KA 5A8NA 4W93A 1M53A 4FK9A 4OUEA 4D6FA 2DSKA 5E0CA 4Q7NA 4KMQA 4J7RA 2CKSA 2WVUA 3A24A 1JFXA 2XWEA 3U57A 4TVCA 4HMEA 3LRMA 3WL0A 3QGVA 1OGGA 1EA9C 1QNSA 3T0AA 3EJUA 4TUFA 1ECEA 5ABGA 3VD4A 1J0KA 1GQJA 1EQCA 4U2YA 3RO8A 3THDA 1FHLA 4P8WA 3WQ8A 3EDFA 4AEEA 1NP2A 3NYDA 4JFVA 4J3VA 2WM0A 2B31A 3ARXA 4PMNA 1LL4A 1C8YA 3ZM8A 1J10A 1B3ZA 1WCGA 1XGZA 4AWEA 2BHYA 1OIMA 1PX4A 4U3CA 1QNRA 4AYSA 3DDFA 3UG3A 2ZUUA 1TVNA 2VO5A 3WNOA 3ZJKA 4AD0A 3BVVA 1NWTA 4FLQA 2A3BA 3CGTA 1V6XA 1GONA 3WY3A 1ESWA 3ARVA 3AIRA 5E09A 3EMQA 3K4DA 4CVWA 1MXGA 4ZXOA 3SCOA 4AXNA 2VUYA 4PCTA 2XIBA 1UA3A 2D23A 4NZCA 2V3FA 1V6WA 4F79A 4AD1A 1E9LA 1KGXA 1E73M 4B3KA 3F5JA 3OG2A 4PBGA 4BCEA 1VEPA 4C7DA 3ZSSA 3CO4A 4CD6A 3SCWA 1KQZA 2UY3A 3AHZA 1E6PA 1E0XA 1MQRA 3VIGA 1CTNA 4OOZA 2X2IA 3DYOA 2OWXA 4JFWA 2NT1A 2WCAA 2FH8A 1W1TA 1MW3A 3RJXA 2W61A 1YQ2A 5KZ6A 2GJRA 3T08A 4M8UA 4FNQA 2CITA 4FNPA 1KWKA 1MW2A 3VNYA 1JF5A 2Z1SA 2WBGA 4Z2IA 2WCSA 1CXKA 2YFOA 2Y8VA 4H2CA 1DEDA 2X09A 1E3XA 4UOJA 3CLWA 3W37A 2ZX9A 1Q6GA 1E40A 1LG1A 4N0RA 3AMDA 2EACA 2WW5A 2XVNA 3WY1A 5AYIA 5FL0A 3ZT6A 1NOWA 4QLKA 4X0VA 1BQCA 3VX0A 3WFZA 2V38A 1H11A 4P8VA 2JEQA 4X9YA 3WUBA 4H41A 3WKZA 3WDJA 2QV4A 4D6JA 4XB3A 1H2JA 4CU8A 3PTKA 1UWTA 2XFYA 3WY2A 1JZ2A 2EPNA 1V3IA 3G6MA 4CD8A 4GQRA 3EDKA 4QAWA 4TTUA 4YPJA 4NRRA 2G3IA 2BS9A 3NSMA 3ARPA 4E4PA 3AMLA 3IJ7A 3AS2A 4PRWA 3D3AA 3S5ZA 3ARQA 4D6IA 1EDQA 2BY3A 1W32A 2ZUSA 2XWDA 2JF6A 5A8QA 2PF0A 3VD9A 1BG9A 4CU6A 1V0NA 5M17A 3LX9A 2XPKA 5E6YA 3CC1A 1OT1A 3HJEA 2WC4A 3ZT7A 5JIWA 3O6AA 1VEOA 3AXHA 2WZEA 1UG6A 3DX2A 2OWWA 1HT6A 3T0DA 1R7OA 1US2A 4GXPA 3QHOA 4J3XA 3SCTA 2CEQA 2UY5A 2GJXA 3RILA 4JKKA 4TX6A 4L4OA 4WKAA 1M01A 4IISA 1GW1A 5A2BA 4WK9A 4TX8A 4GZEA 3GNPA 3WNNA 2ZUTA 1C8QA 3HG5A 4AZ5A 4PMRA 2J7CA 5GNXA 2W92A 3MUZ1 2W67A 2VRQA 4CGTA 2OW6A 2BVDA 2GDUA 2E3ZA 4AZBA 4HOWA 1W9VA 4AD4A 2WBKA 1PZ3A 5C70A 2BHUA 3A22A 4DWSA 3CUIA 1JZ3A 1B30A 1XSJA 4CUCA 1GORA 2ZUNA 3AIVA 4JKLA 4PMQA 1UWQA 3BAKA 1UR4A 3VMNA 4CD4A 2G8ZA 2X8RA 5D9NA 1BVZA 1UH4A 3RCNA 1Y7VA 2E8ZA 3PZGA 1V6VA 1LL7A 3T09A 2J75A 4UQEA 3PN8A 1FH8A 3VNZA 2YLAA 3GNRA 3EJTA 4MDPA 1BF2A 3BXWA 4L4PA 4NZFA 3WEMA 3WUEA 5I3DA 1O7AA 5CJ5A 3NSNA 4FMVA 1L0PA 3ALFA 5LYRA 1UWRA 3CZLA 4DO6A 1J0ZA 1PBGA 1VJZA 3GYCA 5LA1A 4W7VA 3CZNA 5DMYA 3BLBA 4UQ9A 3EBVA 2WHJA 3HMCA 3W81A 5I77A 2OSXA 3W24A 4DM1A 5E70A 1J11A 1XC6A 3ZT5A 5EMYA 4FLSA 1K9DA 3WQ5A 1W9XA 3GH4A 4AZCA 4NI3A 3VDHA 2D3NA 2F1AA 1J0YA 3CHDA 2XGIA 2X2YA 1CLXA 5TD4A 3BC9A 4R27A 3PZMA 5HDRA 4BQ4A 1HKKA 1CXEA 2HVMA 3EYPA 4OBSA 3OLIA 4D72A 2J77A 1H0GA 3KEHA 3N18A 3AXXA 1FH9A 1CNVA 1C7TA 5A8PA 1W3LA 1W2VA 3CHFA 1B31A 3LPFA 1CGXA 4UFIA 4BA0A 5FD0A 1XCWA 1QX1A 1G1YA 3L4UA 2J7EA 4S3JA 4W7UA 4KGLA 4J3UA 3D4YA 1BAGA 4TVDA 1H3GA 1ISWA 4NXSA 1E71M 1TQUA 2VVSA 5ABHA 1CECA 1RP8A 5D9MA 4D6EA 1AQMA 4OJYA 5E1QA 1OD8A 4D6HA 3EJSA 4NRSA 2C8NA 1GHSA 4F66A 1FP9A 4AZHA 3WH5A 4UQAA 1WDQA 3AQUA 3L4TA 3RDKA 2O9OA 3MSDA 2Y4SA 1R8LA 3AS3A 1V6YA 4AEFA 4CN6A 4AZIA 2ZWYA 1WZMA 1ISYA 2GJPA 1CLVA 1UH3A 1HKIA 3VINA 2G3MA 5A6SA 1QHZA 2EBNA 3WMCA 4JHOA 4AZ7A 4UQCA 1O6IA 4XZWA 5A6JA 1JL8A 2XIIA 3OB8A 2DSWA 3PHAA 4PTVA 4OIFA 1OM0A 1U30A 2E9MA 3CHCA 4U5IA 1Q6CA 3OGSA 3BMWA 5BXSA 1UD6A 3O9NA 3AIUA 1UD8A 1ISXA 2A3CA 5CZKA 3GBEA 4GQQA 4PMUA 4TVUA 1KXTA 1G01A 1DWFM 5M03A 1G5AA 2BXZA 3EJPA 1RP9A 1G94A 1Q6DA 4MDOA 3BSHA 3VX1A 2BFGA 3PZ9A 3WUGA 2D0HA 3AHYA 4UFLA 4CCCA 3BVXA 2UWFA 3T2PA 1RPKA 5JIPA 3WNLA 1UR2A 3U7VA 4ATDA 3FAXA 3VIJA 1PEZA 1GOIA 1XH2A 2PI6A 2PWEA 4YHEA 5AY7A 1QPKA 1WP6A 3NDYA 1QHOA 4X0NA 3W38A 1KR0A 4KRTA 1QI0A 1E6NA 3WF1A 3CHEA 2WK2A 2X1IA 4FNSA 3L4YA 3UESA 1EHAA 2CNCA 2XG9A 3W27A 2IXVA 5I2UA 4NXKA 2J4GA 1NWSA 1PAMA 2DSVA 1GOWA 1E6RA 3OZPA 4V2XA 3WY4A 2NSXA 2QPSA 2EPOA 1XRVA 1E3ZA 3BUDA 3PZVA 4XUYA 5A6BD 2Y2WA 5JBEA 1ZBKA 3AI0A 4J3WA 2W91A 2E4TA 4M29A 5IXEA 4U31A 3TV8A 4ZENA 3GXNA 2WPGA 2BY2A 5HXMA 2DH3A 2GFTA 1WZLA 3OIHA 3ARUA 4QCEA 2FE0A 5A2CA 3II1A 4F9JA 4CCEA 3VDCA 5GNYA 4PEEA 2OYLA 2WNWA 4IPLA 1E1EA 1JNEA 3IK2A 4IM4A 1TUXA 1V08A 4XX6A 2VZVA 2WZHA 4OBRA 2VOTA 3VM7A 1C91A 4M81A 4LX4A 1Q4NX 4ACZB 2D24A 4M80A 3PZTA 1V6UA 5LA0A 2GK1B 1UOKA 1KXQA 1MW1A 4P8UA 5IDIA 1CXFA 4P7LA 3VTRA 1C90A 1JYXA 4M1RA 4E2OA 1BTCA 3VGEA 4MB5A 3N17A 3A3HA 3WL1A 1UZ4A 2IGTA 1VBRA 1R46A 3IGUA 4WKHA 3KLKA 3GXMA 3WF0A 1NOUA 1R86A 5A6AA 1QVBA 2XSBA 5DT5A 1TVPA 3RJYA 3D51A 1NM9A 1YHTA 4WF7A 3NUKA 2CHNA 1L8NA 3PTQA 3D50A 1DHKA 1KCKA 1HIZA 1XV8A 1GCYA 3BAIA 3MUY1 2Y8KA 4P8XA 3A4AA 3UCQA 2ZWZA 4BQ2A 2D22A 4W85A 3VGBA 1UD2A 3NIYA 1OT2A 3AIQA 3WMBA 1BYBA 3AOFA 1CPUA 4XZBA 1V3KA 5GNZA 4PMOA 3WMSA 2CBJA 2GSJA 3W26A 2YJQA 4BQ5A 1OB0A 3CZJA 3ARRA 4CD7A 4J3SA 2YFNA 4AIUA 2J79A 2YOCA 3D52A 4JL1A 5I78A 3DX4A 3AZRA 1ITXA 4FF5A 1WZAA 4JL2A 3GH5A 1RD6A 3BH4A 4PTWA 2XM1A 5A94A 2VMFA 4JIEA 1QBBA 2Y24A 1LWHA 4URIA 1V0LA 1V02A 5DFAA 3N12A 7A3HA 1KFWA 1A47A 3H54A 6A3HA 5AC4A 2JIWA 1C8XA 4ML4A 2VNCA 4UFKA 5EBAA 2VI0A 3LRLA 2VTFA 4UR9A 5I79A 4LXFA 4JFTA 1JFHA 4W8AA 2CXGA 2QMKA 2UY4A 2F1BA 3HN3A 4KRUA 5I5RA 3CZEA 4B9ZA 2VX7A 1JZ4A 1M04A 5FKYA 2WB5A 2VZOA 1W2PA 2W62A 1R33A 1ZJAA 1W9BM 3WEZA 3SUVA 1MQPA 3MKKA 2FGZA 3AHVA 1UQYA 3M46A 4CCDA 4UOQA 1WE5A 2ZE0A 2ZUMA 1TE1A 2OWCA 4MADA 3AJ7A 4HA3A 3CZSA 3SCQA 5HPCA 1X6NA 3K4AA 5F7UA 1VJSA 2A3AA 5I24A 1CDGA 1ZB5A 2EPMX 3BVWA 4RE2A 2EADA 2JE8A 3SCVA 1E4NA 2JIEA 1CGTA 3MS8A 3L2MA 2JEPA 1BLIA 1XHGA 3PZUA 3CUJA 4CKQA 1CGUA 1JIBA 3VIOA 3VGFA 4ACZA 1B3XA 3WNPA 3VIKA 2UY2A 3VO0A 1QW8A 4U33A 1PIGA 1HJWA 4H7VA 4V27A 1NWUA 2ZXAA 1Q6FA 4ZE4A 1H49A 3OBAA 2EPKX 1GUVA 5A3HA 1HP5A 3VM5A 1HN1A 3DYPA 3AISA 3WQ6A 1GJWA 4B3LA 3OGRA 2X05A 3VMOA 1FP8A 4GZJA 4ACYA 3EMZA 3WSUA 1OGSA 4PSRA 5BWFA 1K9TA 4OOUA 3ARWA 1AQ0A 1E4IA 1JI2A 2AAAA 2WZIA 3TTOA 5HNNA 4W5UA 3FW6A 1JYVA 1WAWA 1JDAA 1VIWA 1C93A 1UH2A 1XSIA 4Z2HA 4JCLA 3ARZA 5HPOA 3AZTA 3CBWA 1E6ZA 3DHUA 3N1AA 2A3EA 5D9OA 1EO7A 1R34A 1GOOA 3WD1A 2AOSA
chains in the Genus database with same CATH superfamily
4WUUE 3O0RL 4C4KT 1D5IL 4OCRL 3H4GA 4LEXH 4FQXA 1ME9A 3OAYH 4I5BA 1JQVA 3ML8A 4BFFA 1BD2A 3HZMA 1ZHLA 1LUCB 2DPKA 1RY8A 4OLEA 2JQMA 3NFPB 1XLJA 3R8RA 1VADA 3M0LA 2VUOA 4EIBA 3LKQA 3ZOAA 3C5QA 2W9DH 4EN3D 2Q8LA 3HMWH 4EMZA 1JP5A 1OY3B 2VXTL 1MJ8H 1HKVA 2BMBA 1L6SA 1QUPA 2J5WA 1J1OH 3ZKMD 1LDSA 2E9BA 2FMNA 1DO6A 1Y6KR 3RL1A 2JF1A 2IMMA 2MCPH 2AK4E 3T2NL 4FZEL 1UFUA 1OF2B 3O2DH 1XCQA 3IFNH 4JFSA 1IVLA 1WBXB 2CBVA 5J04A 2HX7A 3U4EB 5EF2A 1PKNA 3DSNB 1VKXB 4CNPA 2XIJA 2F7RA 1TZ9A 5IB3B 2R1XB 3UBXG 3TCXA 5AYZA 1IRAY 1QSEB 4J8RA 4U1MB 4HPOH 5HMFA 3PYCA 4U1LA 4L4TE 2DJLA 2XC8A 2CZDA 4XVTH 3CVHA 4X4MA 2WZ5A 4JFDA 2XM2A 4IMKA 3WO3B 3C2RA 3D85B 3FFCA 5HPMB 2R2BB 1JWUA 3S5LG 5IKCB 5AZ1A 5L6UA 3W7PA 3CQJA 4IIQB 2WYSA 4MAZA 1KEML 4ZUUB 3ZE2F 3M0YA 1XLBA 4PP2A 2BSED 4GMTH 4PRNA 3KPTA 2UX7A 4AYDC 1GSMA 1U41A 2Z65C 1EKOA 2V5DA 3LRHA 3FVDA 2YBVA 3PV6B 1FLRH 1UUNA 3KPQA 4W9HC 3G8EA 4AC1X 1WIUA 1DANT 4PGBA 5HGDB 1TR1A 2VX5A 2XSAA 43CAB 2HRPH 1NOFA 3DSNA 3BSGA 1GKRA 2DT2A 3T6QC 1XCQB 2LV4A 3F2LA 3WKNA 1OTSC 5LCVL 1TQCB 4GAJL 3LRKA 5IJDC 4CEXC 3EWUA 4CSZA 3Q67A 5F2LA 1OFOA 3LKRA 1UR0A 4YO0B 1LQ2A 3QNYA 1RVGA 3G5XA 4WKFA 4A2RA 3KE0A 3TNBA 3BWWA 2A77L 3RWCA 1IGCH 2WSKA 1ZEAH 5C08E 1WAUA 5I28A 3PP3H 4JICA 4NI6A 3TTYA 4QTHB 2VGGA 3N14A 1J9QA 1CBVL 3E12A 4YXKH 3B9NA 2ED7A 5I6OA 5D32A 4BY3A 5B38G 3TROA 1HL8A 4DVRL 4JY6B 4TULL 4I87A 1EJ7L 1SFSA 1T83C 3AUVA 5HJLA 4ZFZB 1MQQA 4I7ZC 3WEBA 1C92A 3NDOA 4KI5C 1UD3A 3NQAA 1KYOK 4HEPA 3OAUH 3CAWA 4NIRA 5EO1A 3EXRA 1P9MA 4IRJD 2Q7YB 5A16A 5F71A 1MFBH 4I85A 5AW2B 2APXA 1YNPA 3X1NA 2VHLA 2AQTA 4DUXA 2XSXA 5CBEB 2VJ8A 3RF9A 12E8L 3QWOB 4JO4H 5DSCA 3GXUB 1W1IE 2OMYA 5DX7A 1P2CB 2ATAA 4M7SA 2BSTB 5JYLA 3KWXA 4LLWB 4M02A 2FSEB 2YK1H 2P8MA 4K9EC 5E4EB 3ATBA 1NDMA 2CFFA 3B7SA 4MKVA 3IV3A 4GYPC 4ELKB 2NQDA 3QH3B 5IIEA 4LCQA 1B4TA 5C08A 3RIKA 3CS2A 4E9WA 2ADGB 3TCSA 4GP4B 4I9MA 5I16A 3R0KA 3P73B 1HQRA 3ZKXC 4M43L 4QNPE 5I17B 1YDVA 2J9XA 3IGSA 4E2BA 4L1BA 5HNTA 3TL5A 1QW9A 2ED8A 2BV9A 1I2QA 2J62A 5GGSA 4M24A 3UR7A 3EEZA 4LARL 3WFEL 3OVGA 4HWUA 4BS0A 1M3UA 1FNGB 2BNRB 4XH2A 1ZLSH 3LEVL 5CP7A 2P47B 4AZCB 4JM0A 4URKA 4G1MB 4CMMB 2XH2A 2ZUYA 3REVB 3I6EA 4UFHA 3I75A 2XGBA 1D6VH 4NO0D 3UETA 3EWDA 3VI4F 3U8GA 2V5RA 3NQ8A 1XF4A 5EZOL 1JVNA 3F62A 3ZE1E 1WUFA 5PTDA 3QI9D 1JWMB 5FA3B 4C6FA 3KLDA 4B15A 2R6OA 3PG2A 4M0XA 4B9CA 4BWUA 2FATL 4KK6D 4E6MA 2PU0A 1A5BA 1CFQA 3F5KA 3UJRA 2WP3O 3MCOA 2J1XA 2IKJA 4J2QA 1UKTA 2BWQA 4IMLB 4PY7A 1V77A 5BO1L 1RUQL 1OGAB 1T1YA 3BQVA 3NCJL 3QUZC 2ATMA 4O12A 5IT2L 4NT0A 4EF9A 3L0GA 4HIBA 3MRJB 1BWMA 3QEQA 3KS6A 3E2HC 1ND0A 3FQNA 2AEPH 1HKMA 2EQDA 3N85H 1P1XA 1QTPA 1XEDA 4G1NA 2OOGA 1OCZB 1ZCCA 1BZ9A 4NZ4A 3E5BA 3FDKA 4HBQA 5I8EA 4E8GA 2H2SC 3UXIA 4FL4C 4KK9D 3KWUA 3UEQA 2B20A 2CXKA 5DURB 4NWTH 4Q14A 1HJSA 3FS9A 1JGUL 1ORSB 1LLWA 2NY7L 2P5EA 3H9SE 4QPEA 1WC7A 2PZ0A 1FQ9C 4RDVA 3BAJA 5M1TA 2EE2A 4X8JA 5F9WB 3FSWA 1DYZA 5EU5B 4U1JA 3JUGA 1JZFA 2HN7B 3ZRFC 3QY6A 2CZVA 1XXFC 4GO6B 2GBVA 1GGOA 3OA5A 4Z2GA 1OO2A 2NXYB 3ZW3A 4F9PA 5IR1A 1H5BB 2GSEA 3MC5A 4IF2A 2EINB 4DN4L 4ETYA 3BEWB 4GUPA 1A5NC 2OX1A 4JG1H 2WIIB 3ZQXA 4H9MA 1T2XA 1QD0A 2CW6A 3LCHA 3A4DA 4NJAL 3SCRA 3B9KD 3VOFA 5L2JB 1N4XL 1CL7H 3ITOA 2TAAA 1IL1B 1XCTA 4F0KA 4HSAC 4KX8A 2F54D 5BOEA 5HDQH 5BXTA 2FBRA 3U57A 3SIZA 1KDJA 4KQ3L 4YXLH 5CSUA 1L9SA 3U6RA 2D73A 5DJ0B 1Y0LA 1R5VA 2H26B 1ZVHA 2CBTA 2NTSP 4W9GC 5L8JB 4YCOA 4JE4B 1IXPA 4PL1A 1NMAH 3VWJD 3LB6C 1A6WL 1AANA 1R5VB 1R3QA 3D48R 5DJ0A 3B43A 2J13A 5KAQF 4JIQA 2CYGA 1CR9H 4R9OA 3GZKA 4NQEE 4IGHA 4WI0B 2CETA 3VNJA 5I3KA 4OTKA 1IAIH 3MOQA 4I13B 4OHQA 4FNLH 1XLKA 1DCLA 3LHAA 5C0EB 2B1HL 3QP3A 2ZPKL 5D7LB 3S35H 1YEDA 2MNRA 3QUYA 1A50A 3GKAA 2CE6A 2GVYA 1MRDH 1TTAA 2EUXA 3EJZD 1W5PA 3MBEB 3WAJA 3QYSA 2E5EA 3BQUD 1CL7I 5HJDA 1L5GB 4LB8A 2VKZG 5EUOF 3SDCB 1V02E 2DZEA 3VFNB 4XV0A 3H9YA 3NDZE 1OT4A 3SDYL 4HD9A 5EU5A 2DT3A 1IB5A 1PTDA 4W87A 3W2NA 1S5VA 4TN9A 1MDRA 3CVBA 3C60A 2YMTA 1IZCA 5AOZA 1NJ9B 4ZUTA 2GJXB 3CWHA 3RLUA 4H7ZA 4FJ6A 1ZGLP 3FT0A 3VZZA 4Y9GA 2AK4B 1EA0A 4N26A 4ZTPL 5KSBF 4WV1A 3CSBA 4JFFD 1OG6A 2QDEA 2Z2UA 2NOYA 3H3BC 4X80L 3UG5A 3GHSA 1GGBL 2F74B 3S36H 1WA0X 3FQNB 5TE6H 1K8DA 2AJ3B 1CR9L 4PJDF 3U4BH 1ZXKA 2XTJB 2G96A 2QZRA 3C8NA 4KBPA 2V2TB 3RNDA 1OTTC 1IFRA 4JFYB 1EGVA 1REQB 3T1WA 1JPTL 4NRYB 1RJQA 4M8QA 5SWZD 3QW3A 4F66A 5ACMA 3BMXA 2A9AA 2FO4B 4GRMA 4F2EA 2I5YH 2YD5A 3DHFA 2V7NA 1JAEA 3EZ4A 3M5YA 4G5ZL 5EFFA 1NCJA 5AW0B 3RB5A 3S2CA 1GZ1A 3R7RA 2C7UB 3W3OA 3S1XA 1KBWA 2BP1A 3BFWA 1GVFA 1C5DB 5FO8A 3C0JA 1VESA 2ZKHH 1I9IL 4OD3H 4KKCC 1J8KA 5TPWL 3OKKA 4XPHH 2K45A 5DRXA 5GZOA 4GUFA 5DUML 1YN6A 1TVLA 4OT7A 5H1WA 4C7FA 3ZDZE 4YSQA 1RLBA 4JQXA 3T4YB 1X4XA 2P1YA 1A3RL 1LF1A 5CAHA 1NDGB 1ZVSA 4UQ2A 4ODSH 4Z7IA 3RZCA 2F8VA 4QXGH 2EXOA 2YBTA 2YA0A 1I1YA 4U3SA 2FJKA 3GNDA 3KRZA 1FPTH 3RM9A 1VHCA 4HJFA 3SY5A 4WU7B 2X10A 3ROOB 3UR5A 1ZBVA 5I8EB 5LIKX 3CCHB 2N7SA 3FB7A 1IKNA 1KCBA 2XFXB 1IBGH 2E59A 2NY3C 3E1F1 1W16A 3VU2A 1LHZA 4M1DL 5DZ9A 4MD4B 2CNZA 1SJBA 3TO4D 5RUBA 4JAWA 1T8QA 2ZF9A 5HHPB 5IQ9A 3TC6A 2VM9A 5DMKB 2NUWA 1SSGA 3GSOB 3P82A 4B90A 3RVTD 3BRGC 1RJRA 4JPWL 1CDBA 3S37X 1N6UA 1WCQA 4HIEB 1LDPH 4NENA 1IIHA 2GVEA 3HGSA 4DXKA 2DPEA 1BQHA 1BXCA 4G8IB 4GT7A 4F7TB 4FXGA 3FF7A 3MUJA 1JDEA 3DXIA 4MY9A 3NO5A 2GTWB 2G75B 3VFSB 2AXFA 5IOPB 4YQXH 4MA7L 4Y8DC 2EXYD 4ZFQA 2Y0FA 4LUSA 1MFEH 4Q4KA 3GTTA 3KD4A 3HB3B 2REQB 1OK8A 2J55A 3FF8A 4OD2A 2NXIA 3N13A 1MH5B 3QDHA 4LYQA 2PWGA 1UR1A 1JPFB 4G43B 4YX2H 4DP8X 4PJEA 1A4AA 5CBAA 2HQAA 3UR2A 1IEQA 2FBJL 4TUKH 5F2FA 4HPHA 2D0FA 2VXVH 4JRLA 3T1GA 2F61A 1R2TA 3MP4A 3NGFA 4YDIH 3NVTA 4FKHA 2CH8A 3KYAA 3MXWL 1ZAHA 2HH0H 3OZ9H 2G2RB 4QG6A 2BP0B 1EAOA 5DANA 4ATWA 1RIUL 4A3QA 1HQ4B 4NO0A 4FP8H 5E8NB 5TQ0H 1EHKB 1RZJL 1SYSB 5DR5L 5REQB 4NN6B 4OBTA 3CSYA 5FC9A 1F6KA 4OF5A 3ZTDC 3VOHA 4J3OD 5AVXB 1UB6A 1H0DA 3QUKA 4KRPD 1Z0NA 3BZEB 3GO1H 2VUNA 3S7GA 4F58L 4XBGB 5I1KL 1Z6JT 3BD3A 1BPLB 2EEBA 4WGWB 1DBML 4OUOA 3HC0A 3OD3A 4YZWA 3OPSA 1AZZC 3MLPA 3FQWA 3OG6B 2CK0L 3MVSA 3KS5A 3K1GA 5AW3B 3UTOA 1AHWC 1HE8A 3FUKA 4BINA 1QLFB 5AB2A 1S2TA 1JZEA 3ULVE 5EBGA 1ZA3B 3MHZA 5IGXH 3W01A 2G5UA 4WUUD 4KTGA 4A3RA 4GNKB 2QDDA 1M68A 5GS0L 4R9XA 1MNSA 4IIFA 3N2OA 2R2BA 3CCHA 4Z3FA 4ORGB 4TL5A 5T9BG 1ETA1 4KRNA 2WO3B 4A3HA 4BEIA 2EIBA 3QI9C 4X7CC 3TEXA 3GG1A 3LPGA 4Q6IB 2LAGB 3OC5A 3MO4A 2Z8SA 3VPLA 4F1ZA 4H6QA 4UI2A 4LANA 5D8ZA 1KENH 5EUKA 4F0HA 4RZCB 4IFKB 4XSMA 3CWOX 4UTAH 3ZN6A 1CEOA 1CS6A 1XAKA 4HGWB 3EWBX 3QQWA 3K46A 4NVTA 3L9RA 4PGEA 1TOXA 4PH8A 5ECVA 5AN7A 1E5CA 4R7VA 4HFUL 4Y9CA 5DZJA 1PLAA 3DV6A 3SUTA 4KTEH 3RTQD 1G7LB 3W1UA 1B0IA 1H3UA 4KKNA 5TQLA 3TYDA 3KPPB 4ZMGA 4B4HA 1RSFA 2FEDD 2R29A 3W5NA 4D8AA 1I8IB 1J9TA 2RAGA 4LQ1A 3QC6X 4MFHA 5HJXA 4BR1A 3UTTB 1WZKA 1F5WA 4P46B 4F2MB 1TKKA 4DHGA 4WVRA 3VGGA 1BQGA 1CW2A 4K8EA 1M6JA 3F8UB 2C0AA 3VI3B 1G84A 4L65A 5BU6A 1GCFA 1FVCB 1UZ6F 2DQTH 2IFFL 4NKIL 2LQRA 2OSYA 4RZ6A 5KVEH 4YHIA 4HIHB 3KH3A 1XI3A 1J93A 5D1XC 2XTJE 3C09B 1Z44A 5DK0B 3C09C 1GVSA 1AQKH 1MFMA 2F7QA 3Q2NA 4JO1H 4NPKA 4XO9A 2AK4A 3DIVA 4LGSB 3JXAA 3QQ1A 2ZA3A 1NFIB 4O4YL 4AY7A 1BBDL 1L7IH 4HIQA 1Z9AA 1XF2B 3OLDA 1AL7A 3EYQD 4E8DA 3MLYH 3F6LA 3W39B 2I1OA 2CUMA 5JW5B 3O3UN 2CERA 4JFEA 1JHTA 3FIGA 1KYOJ 3HC2A 4Q9BA 4WI7A 3IIOA 4AFYA 4Y5XB 3J7HA 4IW4C 1GW0A 2FGWL 3D2TA 5CJXC 5E4AA 1TREA 2CLEA 4O00A 2RB8A 2L4OA 5CSYA 3V0IA 4BF9A 2W60B 3MR9A 1GZHC 1ZT4A 2ZWSA 4KESA 1D8CA 4KEVA 2WZPD 2JFEX 5HHMB 4XAYA 1D6EA 4TVPH 1PKOA 3ULUE 4D6GA 2HZHA 3H8AA 3RHWF 1OPOA 2H9GB 4PN2A 5E5LA 5JIQA 5E23A 3S6OA 4GZIA 3QEQD 1VZHA 4MQ7B 5HULA 3H21A 1CF8L 2NT0A 2NMSA 3TF4A 2NNAA 2Z4QA 3VFPB 5D96C 1LOSA 1UD4A 1X5JA 2XN1A 3H7BB 4NU7A 1HYSD 4ZEPA 1ZVYA 1GW9A 4C1NA 1Y0LB 2H26A 5DD6A 3IARA 1BF5A 3I68A 4BA8A 4G11A 4HWNA 4URTB 3UFIA 2GYSA 5CSZB 1BBDH 1L7IL 3FRUA 3WBXA 2P43B 1OCQA 4JFZL 4GQ9L 3V4VB 4ETQA 1J5CA 1P6BA 3S96B 2JIXA 4JRYB 4RZKA 1PYMA 3HC4H 2WLKA 3VYLA 1EZ2A 5HMEA 2B1OA 3WHXA 1RVFH 1TCRA 1UB5A 2PGFA 3X11A 1MJ7H 4WW1A 1E4WL 4NOBA 4PJBA 4O57A 1XCFA 1DSFL 3NPUA 4RCAA 3CFEB 3VFOB 3UBGA 1E6QM 1EXPA 1PL9A 4N02A 1NAML 2FQDA 5F8RC 4KQ0A 3D2UD 1YXYA 2ZZ5A 3BAYA 3MBWA 1S8DB 3QZ6A 1F05A 4WR3A 2VYRE 2D03H 4BI5A 3TBBA 1CD0A 2Z93B 5K39B 4O2EA 3VRJB 1E0WA 4G9FD 1CLCA 4GKSB 4JZNA 1W1ZA 4OLZL 3DXAB 2W6RA 4DM2A 1FL3A 3QDJB 4RGOL 5IQLA 4FR6A 5XIMA 1W0WA 2Z0UA 3DHMA 4N8VG 1A6WH 3VXNA 4F33A 2PN5A 3INUL 1EIBA 1INEL 5HGHA 4UUJB 4PIRF 1T22A 1FAKT 2YS4A 2Y25A 4M48H 5I15H 1MVUB 1W0WB 2EO1A 2VDPL 2ZKYA 4UV7L 2Z27A 1D7FA 5FJTA 3LDBC 4Y5VB 2QCGA 3V35A 1KJ2H 1ECYA 3HBGA 2MEJB 4Z0SA 4N8CL 2VDIA 3E2SA 1WFUA 3P11H 2QTEA 4HUVA 1DIOA 3C8FA 3P4NB 3HQOA 3M0XA 2CSPA 1IC5H 2E5CA 4DKDC 1IBZA 3CBRA 2QDGA 3CIAA 1T04B 4PJBE 4FJYA 3IGHX 2V8LA 1R3IH 3UA3A 3W29A 2AJVH 3IRCA 4KH9A 4WNJA 1A5AA 3U7AA 1R3RA 3S6TA 3WJSA 5FCZA 2P8LA 4ZOBA 4HOZA 3C2EA 4RW5A 4FQXC 4JYDA 4PC8A 4HUCA 4YIWA 4YVNA 4GSXA 1XD1A 1F73A 1M4KA 5INDA 1IM9D 2NZLA 3SFKA 4S1DD 4D9QD 1G7MA 4AWTA 2Z29A 1FNGA 2BNRA 4XH2B 4GG6B 1A0CA 1VRXA 1GOMA 6FABH 3W00A 1VYRA 1NP0A 4XZ4A 3G1DA 5IFPA 1PYWA 4H26B 4F7CB 1BVNT 1BWVA 1TO3A 2C9UA 2AEOA 2X4UA 3Q7JA 4F2FA 1K03A 2YW4A 5FF6B 3N1FC 3TBTB 3MW7A 2GUBA 1YE6A 1CXHA 4MNQE 4KH2A 3VWKA 2DLTA 1AJ0A 2WWMD 5LG1A 5JOPE 4FA7B 1ITQA 3LOWA 2VZUA 4LEEA 5HD8C 4WKZB 2ENPA 1N6QH 2PBGA 1S9WB 4R6UA 1FUNA 3DCPA 3QEGL 4N5ED 4XP9H 4JDTL 4LP4A 4D9RD 4BK5C 1K3IA 1N55A 1MIEL 2P8MB 5DUPL 1NEZG 4QYAA 4JZJA 4WW1B 4CC4A 3K8LA 3QUML 1NF0A 4NSKA 1UWXK 2OMYB 4XO6A 4WY0B 4G9FE 2CRIA 3T4CA 5BPPA 1TF4A 1I75A 4L1TA 5FF7A 4G8TA 1FCGA 4AITA 5K33A 1A9VA 1UHVA 1E5JA 1ZTVA 5FEXA 1CLYH 1L6GA 1HZHH 2Y6ZA 4DWSB 1AQDA 4TNWK 5IBLC 2B59A 3I6GA 1IC7H 2V2WA 5LN4A 1ILUA 3SD5A 8FABA 4KROB 4H9ZA 4LC6A 4UM8A 4BUHA 3H7BA 4X4ZA 4UAOB 4WGKA 5EMUA 3UPAA 3WSQH 1R3KA 7FABH 1FA2A 4NQVB 4X42A 1BSIA 2KDGA 3CMGA 3O0RH 4ELMB 2QLYA 5C0BE 3IRZA 1UASA 1V3LA 1G9NC 2D4DA 2HTLC 4NT6A 2WGXA 3CUPA 4R0LC 3VWJB 1JPDX 1J0IA 3G0UA 4I6VA 2Z7WA 1IIIA 3VOCA 2LFEA 2MANA 3GDRA 1GHFH 5DO2C 5F7EL 2DSUA 2OTWB 3AREC 1TJGL 1OK4A 3CASA 1F00I 4AT6A 4MCZA 4ZUWA 3CK5A 3FK4A 2IDFA 3DX3A 1Q1JL 1Q9KB 5BUGA 8CGTA 4FI7A 1G7PA 4HHGA 4L8SB 3HJZA 3HO8A 5D30A 4KC3B 2VT0A 2VW4A 5KVDE 5C86A 2HT4D 2Y36H 3BYYA 2VE6B 2WAHA 3MUGA 3DETD 3LBMA 4WUIA 3ARDB 3MQIA 5ID1A 2YYUA 2F5AL 2AMUA 3RFAA 2ISSA 2XU9A 3BDYL 1QRNE 1Z5YD 1NGZA 1VHPA 4KVPA 5HI3C 2XU2A 4GYPA 3SGKC 1BFVH 2BSDA 2WVTA 4PJAA 5HNRA 2YBGA 4EKJA 2ZADA 2F0CA 4UOZA 1C1EH 1IBYA 1JRHH 2CBPA 2E7CA 2OMWB 4OT1H 4U1NA 3E02A 1FVDB 1B9ZA 4H19A 4MNQD 1W1A1 1UWAA 1S9YB 3HB9A 3EJJX 2H2PD 4HIHA 5HPMA 5IKCA 3N15A 4LCYB 4K68A 5D4YA 3UTZA 4Q0XL 3POHA 4EK7A 1ID5I 1TQBB 1JD9A 2HKHH 1CD1B 2N1TE 2DYRB 5FUZH 5LGHH 4MTVA 1AW2A 1CG9A 2DY3A 2UWEB 5FEBA 4IPIA 5K9KB 1EK3A 4G3YL 1FO0A 1O7DC 1TJGH 5HTSA 5HHNB 4MAYA 1DQUA 1MSSA 4YHGA 3GBDA 2E9JA 2EC8A 3AYRA 4QDWA 3MLTB 3OKNA 2FR4B 1GQLA 1T1XA 4NBZB 1NWOA 4NRXA 1G7LA 4GAJH 2BXVA 1B2WH 1H0DB 3QUKB 2OCJA 4MB1A 2CK0H 4MCNA 3A6CL 2IBZX 3G5ZA 4IUGA 4M6VA 1ZLUH 5L7XH 1R3HB 3S36X 4ZAKA 4EIUA 3VQ1C 2C3WA 3IXTB 4ONVA 5DJ8B 5F96H 1QRNA 4RMQA 1MWOA 2AXWA 2AV1B 3MCG1 4LYPA 3SUSA 3BV4A 1WDPA 5DRIA 1AKPA 5FL1A 2YEZB 3QUZA 3QIUB 2CUAA 3WX7A 5ISZD 1VBJA 4HMDA 1LEGA 2VR4A 3O4LD 3GXFA 4X98A 3ZBMA 4LCCB 1RU9H 3GVRA 3I6SA 3JTTA 1JRHL 3FNKA 3M17B 2BY0A 1O6TA 4IGBA 4AMCA 2Q2LA 4TVPE 2VLRB 2LT9A 3ULUH 1K6WA 1X39A 2ZWKA 5FKPB 4M19A 4OIIL 1RH9A 5C8JB 4UNUA 3WD3A 2QCCA 4MXWL 3OXRA 2FX8L 1NBYB 1PVNA 3G0SA 1RIVL 3LQZB 1U8JB 1TT6A 3AM8C 1PDKA 2GBAA 5GGUB 1C12A 1EO5A 2WWMC 4QAMB 1R5IA 3BRDA 5H94A 2ON3A 4YBQD 3F7YB 4L64A 2F5BL 4FQLH 3MTRA 1S5MA 5HNUA 1QMLA 2QKIB 2I9LB 4GPVA 4Z5RB 2GY5A 3RWGB 5IJBC 5F8QC 3NPSC 5J57B 3CJPA 2VDQL 3WDHA 4M82A 4QXTB 4N0YL 3H2FA 1HKLH 3ZR4A 1AH0A 1KB5A 2Q7NA 3RVVC 4RRPA 4E9VA 3FV9A 2EJ1A 3DMMB 3KL3A 3WBAA 2DKUA 3QK0A 2IFFH 2R1WB 4LPUA 1Z9SA 2DIEA 3QJOA 1AO7A 4PY8I 4NX0A 2B14A 3GB7A 4P49A 5KJ7E 4KPLA 1CGVA 2ZXQA 3BP6A 3FB7B 1XZ0A 3B8SA 1EAQA 3WLSA 1P7TA 3GZAA 3D3VA 1QHPA 4LCWE 4YMPA 4XBEH 3FYOA 4Z2KA 3TFXA 5MHBA 1BD2E 1ONQB 3QNZB 4HEME 3QQDB 3EH4B 2OMNA 3QEUA 4IGBD 3VSUA 1E55A 4F7EB 4JDZA 4N9GA 2YC1B 1EPFA 5DTFA 3DX5A 4Y19D 3VC6A 3D09A 4BHUI 3TPUB 1JFQL 2QT6A 1Q8AA 3C3NA 5HYJB 1DSWA 3BV7A 4Q8NA 5GS2H 5FOOA 4YWGL 3BOFA 5EZOH 1ZMYA 4OFYD 2QGHA 4PMXA 2WSQA 4BZYA 2XV2A 3FTWA 2AKRB 4C4KO 1VZIA 3H2CA 1NCDH 3S6DA 3R1GH 3QF0A 3GNXA 3L4VA 4NWUL 3N44F 4FLRA 4YDJA 1J5HA 1F3DJ 3GZOA 3VFTA 3ZE1F 3H2WA 4E5XA 4JO5A 4EI5C 1A53A 1MYRA 2Q8XA 4H1ZA 2HPIA 1GVRA 4CNIB 4ATLA 3OKYA 1OLLA 1DWHM 1D2OA 3GSXA 4L29B 4Y2DC 5GISH 4JFYA 3AREA 1REQA 3DFHA 4PYSA 3NCJH 2LTQB 2ZT9C 4Z7QE 3IB4A 1QR1A 3V6BR 5JHAA 3OP2A 4OZIF 5KBLA 1BG1A 4M8RA 1V7NL 3GF8A 4L9DA 4BQCA 4INFA 1IAOB 4KKAC 4PJ9B 5F4XA 4BWLA 2XFXA 3LTYA 2EEXA 1NQ6A 4YLCA 2D7TH 2IMRA 4E8CA 2AEIT 3GBNH 1NGPH 4LSSL 1XMEB 4PVMA 4YL4A 1QWGA 3TNNA 3TJLA 3QPQC 1PTZA 3SDXF 2OFQA 5AOKA 5LVEA 3ZDZB 5KVFH 1NTHA 4F0RA 5I6XC 1L7TH 5SWZE 3KAAA 3BHBA 5KS9B 2Q8BL 4P4KA 2PO6C 3SE8L 5D2WA 4X7EC 1BD2D 1QATA 1J48A 4N0FB 3HBLA 1WB0A 3OA3A 1A0QH 1L5GA 2YDRA 2C3VB 1AC0A 3QJUB 2OXNA 1OSPL 2JCCB 3SSJA 4WXYA 3MBEA 3UGEA 3EOEA 2VDGA 3MCLL 1FWDC 4O10A 1U92B 5ABFA 3S0PA 5D2LA 3GSRA 4Q4IA 5K9JL 1A6ZB 1RMFL 4G9DA 1GK8A 4IJ3C 5IEHB 2IDCA 1M7XA 2J1KA 5J6HA 3NTYA 4MJ6B 4MMYA 4OZIA 5E7FA 1NZRA 1QNOA 5FI8A 2QCHA 4RXGA 3RX7A 2VX4A 2ODOA 2E6PA 4S1SL 3WD5H 2GOUA 1V7NH 5JDSA 4KKCD 3H9HB 2VDPH 2DDXA 1ET5A 1QTYT 3Q13A 2FTWA 3HRZB 1CIUA 2HFTA 3FSVA 1U1HA 2PDCA 1DJXA 3C6SA 2H8XA 3FTGB 3BHBB 3FT3A 5KS9A 5I3HA 5HGAA 4QLLA 4LVHC 3BDXA 3B9EA 4JS7A 1G6RB 4LSPL 4WEBH 4GNVA 3TK7A 4KFOA 2RJMA 3O3BB 2Y70A 1XBDA 1C9WA 2NR6A 2MRYA 4F92B 3L68A 1UMLA 4AEHL 2DRUA 4EJ1C 3PZNA 3WDRA 1H9VA 2EYTB 2CLIA 2JSFA 5AW6B 4GUPB 3HZ3A 3KLLA 2C1PB 4LLVA 1JTPA 4K9EL 5D2LE 1IXQA 3RXZA 2ZXGA 4AW7A 2HJFB 1OCWL 2WVVB 5EOQL 2BRQA 5AUMB 5EZPA 1V3HA 1O1ZA 4YLBA 1XLGA 2PPGA 1ADWA 2Y5JA 2P5NA 2C1IA 5T26A 4ZMQA 5D5MF 4PV9B 1UC6A 4LT9A 4AXKA 1RCOB 3P7YA 4WXZA 3T07A 1ASQA 2OZ8A 3V52H 4WRLA 1QFWI 3ECBB 3PPCA 1IGJA 2AQOA 4UTJA 3GIZH 4HDIB 3W0WE 2CCLA 4HXBL 1U2YA 4ZODA 3ZR6A 3PTDA 4HSCX 5C6PB 5I1CH 4WJ8A 3STCA 4GBXB 3MSPA 4IJRA 2VXNA 1YEKL 3TF7C 4N2HA 5C8JA 3MA9L 3I50L 5GGQH 1S5HA 4I4WB 3EEGA 3LU2A 2R23A 3HF3A 3TPUA 3TONA 1V0KA 4NDMA 4HS6A 3F7RA 1YYLH 2V30A 4PTTB 1P7QD 3NJLA 1JPTH 2XUWA 4IOIA 2BODX 1KGUA 1OFRA 4HSNA 2Z1XA 5IJCC 3Q6GL 1KCSL 4W6XB 1EFQA 4EP8C 1UPPA 5EY5A 2ZXBA 4U3HA 5LXXA 4K3JH 2D7MA 4YFEA 2UZIH 1H15A 5GGTA 5JW4M 4P59L 3N9SA 3BWUF 1I1FA 1RPXA 3BT2L 3KHQA 2HFGL 4OD3L 3I75B 3MROB 3N06B 1OJXA 4YJ5A 4XZUB 4M5TA 3K2UH 3RGHA 1HKJA 1O60A 4B6ZA 4EE9A 2YBRA 4B5VA 3GLZA 3EO9H 4NO5B 1DJNA 4FFWD 1AKJB 2Q2EB 4AUYA 1KTCA 1FPTL 3AQZA 5TDNB 5JNYA 1RY0A 3HPJA 2P80D 1I3GH 5GZND 5EKYA 1XYFA 3G1SA 1W6TA 4DKTA 2BFVH 3MA9H 4M4PA 3OVPA 1NOLA 3KW3A 5F7EH 4ZXBB 2X30A 3O6DA 1JN6A 1TZIB 5ICZA 4KVNH 3VKAA 5C7VA 4XWUA 3O2VL 3R4RA 3NOYA 3ZR5A 1HVQA 4U6XA 3MUIA 2Y36L 2I9UA 4GKNB 4FPSA 5CSBA 1TPWA 4R97B 3PZQA 3CK0H 4WDIA 1MG3C 4HOXA 1FGNL 5BW7A 3G1YA 3VI2A 5I3FA 2VN3A 2VN4A 1DBJH 4H8VA 2UZIL 5D7JA 3IJHA 4ZDHA 4G2DA 3CVDA 1BRLA 1R3HA 4MAUL 2ZRYA 2D4FA 2KZWA 4MRBA 3N40F 2DQDH 4Z3HA 1CFNA 5ANME 3FU0A 2CDEB 2R69H 5DHMC 3TV3L 1LP6A 1EDYA 2NTFA 2CA4A 5TFSL 3KVLA 2NDGA 1LE9A 3N04A 4P2OB 3L9YA 1ZS8A 3DHPA 2AI0H 3HRPA 4XCEB 2VELA 2FLRT 3I3DA 5JHLH 5FO2A 3D08A 2AEQH 3V0WH 4MJIB 3ZYZA 1A3XA 3FLUA 1J9YA 1XIWA 2F58L 3MUXA 4HKPA 2B77A 3LCWA 1W3KA 2Q3RA 1Q94A 1RV6X 2YARA 2PRMA 4X9IA 3ILPB 1RJLB 3BP7B 4ZNEA 2I24N 2OO6A 1NCAL 2O6CA 3GO1L 5D7LD 1U3HA 2PF6A 5EB8A 1KCUL 5K3VA 4F58H 1HYRC 2VAJA 2ZX7A 5F7KC 4BCXA 1QO3B 2VZTA 2JELL 4A68A 2J78A 2OQJA 1Q6EA 3LTPA 2KQNA 1DBJL 1OX5A 3U5YA 2XH7A 3SDAA 1TTRA 2IH9A 1DTUA 2X4RA 5D6CA 2MTAA 4LHJB 2Q71A 4JZJB 3O9WC 2E9IA 3S3BB 3EXSA 3BESR 1LP9F 3MLXL 4G7VL 2F18A 3H85A 4JPVL 1N18A 3MCYA 4LKCA 2BC4A 3PQYB 1FWWA 3ULUL 7TAAA 4JFOB 4MMXC 1OGTA 5KETA 3EGXA 7PAZA 1ZCRA 5HYJD 3FRPG 5FIEA 4AIXA 1XS2A 2X1WL 4L2YA 5ICXA 3V0HA 2PP3A 1DLFH 3LJ3A 3HU7A 4GYKA 4ICWA 2YPVH 2WUCH 4RXFA 3V5CA 4U1KB 2DBLL 3UEZA 1XO8A 1LBLA 1XYCA 3FU7A 4K8HA 1AFVH 1QWNA 2F58H 3LHYA 5GS0D 4W86A 1HHGA 2PLTA 3UJIH 4IU3B 1DJQA 1NLBH 2IMNA 3LV3B 4ZB5A 1QFWM 1HCVA 4ABQA 1UP0A 4HPYH 2ARJA 3SY0B 1CLOH 4IRSD 5SX4H 4V2CB 1ETB1 4JG5A 1TQSA 4HK7A 2HUEA 1R1CA 3PXJA 2IPUG 1DQML 1E90A 1FX6A 4HU2A 1F86A 4Y2LA 2OMUB 1AHKA 1WQ5A 5IWLA 2XVPA 4JANA 4IH3A 1U8NA 2FYVA 4RX4A 2YDSA 2FZ3A 4PJGE 3IPEA 3B04A 3NEVA 4L4JA 1A4LA 1DPMA 2FHBA 4LIQH 2A0NA 3WDIA 3QDAA 4A2LA 3T0ED 3MACL 4LUTA 1QBAA 1GZQA 2IH1A 3SYAA 3L95A 3DBSA 5FACA 2BSSB 1NBCA 3MGOB 4JFUA 3D0AA 2VWEC 1K2DA 2DLGA 1AQKL 3S34H 2J7HA 4ZXBA 4W84A 4YAQA 1BAFL 1LXMA 3CVHB 1E6OH 4BSJA 1LRQA 3ITCA 4GXUM 3F6IA 4P5KB 4MNQB 5D1XA 5KSAC 5L8LB 4LPTA 1QXLA 2QJMA 3EB3A 4U3AA 3ROLB 2JFCA 3UYRH 2WTRB 4JFQA 1T22B 4AYGA 1BKSA 4B53A 2RCSH 4AQEA 3TMQA 3O6FC 5F3HA 9RUBA 4OFVA 2QAPA 2DDQL 4A8NA 1TYJA 2DQEL 4Z42C 1OF2A 2FB4H 1MRFL 3SJVB 3VG9B 3QR2A 2V33A 2E0PA 3CO8A 1XR9B 3WN5B 5GISL 3DGGA 3KBPA 5GJTL 2D7NA 3DTXA 1YBQB 1IBFA 3FAWA 4JQ4A 3M16A 1JGVL 4OZGA 5E4EC 4DN3H 4AH7A 2BIQA 2BMKB 4PJ8A 4A6YB 4TVPL 4KUCF 1XMWA 4B9GA 5IDZA 2XZAH 2X2JA 4MCYA 3RU8L 1KG0A 3VD3A 3D5HA 4KY1L 5DT1L 1ODZA 5AHNA 4F15B 3GRWH 7XIMA 3G6JA 3TVMA 3WJJA 3QHFH 4KDTC 4Z2JA 2QVKA 2EIJB 4DP2X 1WA2X 3QUXC 1UACH 2R23B 1XL9A 1W72L 3RLGA 4D1JA 1M7PA 3O6YX 3ZMNA 2FLBT 3WNJA 1H7WA 1KGCE 1PV8A 4D6FA 2DSKA 1NIUA 3V0GA 5E0CA 4FEZA 1ZVNA 4KMQA 1QA9B 3GHRA 3PUDA 1X5FA 1SY6A 2A2IA 5I74C 4WCYL 3IWPA 2AQ3A 3IBEA 1JR1A 4QRNA 2VAAA 4TOYH 4MSSA 2B2XL 1E0UA 3L3JB 1DBKH 4MMZA 3LNIA 2H4EA 3BZFA 1E4WH 2IAMA 4BWWA 1ZIBA 3BH9B 2IEPA 3GGWB 1R9FA 2YSSB 2OZNA 4K3ZA 3V7PA 4EUPG 2I16A 3JW7A 1J0KA 2L3BA 3O3AA 4Q6YA 1S9KC 1H1ZA 4Y9NA 4E42B 3TR9A 4W81A 2YSSA 3BXNB 3C5JA 4XI5D 3EDFA 3RNQA 4H0HB 4OR1A 5D38A 3KYMA 3C6LC 3T81A 3RWEB 4GVHA 1OC6A 1GXEA 2P8BA 1GG0A 2EDLA 3V5DB 2IPGA 3ROLA 3QXUA 3EJCA 4WGVB 5D2NA 1HCFX 1XIEA 1N2RB 1B3ZA 1VZWA 1WCGA 1YYMH 4O1BA 2V67A 3UWYA 1RUKH 3EHBC 3QRLA 1I4NA 4MXVF 2Q8ZA 1W2KT 1PX4A 3PHOA 3P11L 5DK0A 5GJSL 1OIMA 1RAKA 1Z42A 3FTVA 4LUJA 4U3CA 3WHE0 3PK7A 1ZZMA 3V0TA 2J27A 2C1HA 2QQ6A 4LL1A 5DD3L 4KWVA 1TVNA 3PDDA 3VFUA 4FO4A 5D2XA 3ZJKA 1FL6B 2X4TB 1NDVA 3WIIL 1NWTA 4FLQA 1UT9A 4K5MA 1R3IL 1LQAA 2A3BA 4M51A 5G4MA 3I2CL 4PBXA 4E2VA 4A7VA 3TN0B 1DQLH 2B7OA 3UZXA 4MLSA 5KANG 2J9YA 1BFSA 3AIRA 1PD1A 4ZGYA 4XMLH 4B27A 3P2TA 2AJYL 4AXNA 4TR9A 3NSDA 3CHSA 3BGMB 4PCTA 2HRLA 2BNQA 1FIGH 1TDQA 3CHOA 1IGIH 2I60L 5CEYA 5B38B 2PTUA 1Y5WA 2D23A 3O8AA 4MD5B 5HWMA 1KGXA 1VBGA 1L6PA 4OKVA 3I50H 3NQVA 2CLRA 4B3KA 1MFDL 1IGCL 4ZK8A 2WO4A 2O4EA 3F5JA 4PBGA 4O02L 2IV9A 2K9FB 1WKDA 1QFOA 2CO3A 1HAUA 1KB9J 1LCOA 1XWYA 4C7DA 2VC5A 4HULB 3WFHB 6PTDA 4US5D 1GZHA 1UCTA 4LSTH 5ICXB 4HN4A 2NR6D 2E1DA 4AIBA 1F13A 1MCHA 1PG7X 1MQRA 4M6MH 4CAGA 5F7HA 4OJFL 1REIA 3MJMA 1EAPA 4YJZL 2VDKB 4WTWA 2A5UA 4G1KA 4B5XA 2VDKH 3QEGH 3DYOA 3JV4A 1YXDA 4P2CG 3RL2A 3WN5C 2NT1A 3NJJA 43C9B 3GWQA 1ZPUA 4CNNA 1MW3A 3RJXA 5HATA 3N3TA 4B3VA 4KW2A 1EGJL 5CEZH 3F85A 3U4AA 3K7UA 5HGBA 4JVWA 1LWRA 2X42A 4WW2A 3UWQA 3FQXA 1WG3A 4WWKA 3G6AB 3T08A 1KD0A 5KUMA 1S5IH 2ACUA 2NY6D 3RI5F 1MJ8L 2JCCE 4KQNA 4CJ1A 3VNYA 3GK0A 2WOBA 4FG0A 2D3VA 2GJLA 2NQCA 5T1LA 4M3HA 4QGYA 3AG1B 4FQXD 4HHPA 3BIKB 3ZTNL 3TN6A 3CFKA 3MZNA 3GD1C 5AOLA 2HK1A 2QTVA 4LK4A 1SM3H 2DQCH 4U1KA 4KVNL 4LSTL 3IUDA 5IBXA 3W37A 1JZJA 1Q6GA 5L9DH 3R8BB 5B1CA 1E40A 1SW0A 1E0OB 4Y1TA 3FMGL 3AMDA 4J6RL 4YU1A 5GSRB 4O4WA 4YK4B 1YEEH 3PRZA 4LBSA 1OV8A 3Q05A 3TBYA 2WW5A 2XVNA 1UGKA 4N6FA 3CYJA 3QTGA 2W9EL 4DKFL 1KPVA 1Z9SB 1TZHA 3KDMB 3QQ4B 4KQ4L 3KOYA 5FL0A 4HCFA 3GSNB 4XN2A 1KB5B 2FZDA 4YLWA 3WFZA 4O51B 2PCXA 2WUBH 3B2PA 1VPXA 4LCCC 5C2UB 4Y1AE 1FKWA 1LQBC 4H41A 3SQSA 2FWLB 2I9LA 3V2AR 3TV3H 1NMCB 1N67A 3TW7A 1GJPA 4NC2B 3NABL 2IVFC 4LVEA 4AKQA 1H2JA 5FSEC 4XP1L 3UPRA 1GYUA 4B50A 1UJ3C 3HRZC 4GRWB 1D5MB 3LEXA 2F6XA 3TCTA 5EIIA 1V3IA 1KACB 2A6KB 4GQRA 4GB9A 3DFNA 3EDKA 3H3PL 4PD4J 2VLRA 3BZDA 3JQOB 4Q0XH 5C9WA 5FEWA 4YXKL 1P7KA 4B41A 2DICA 1SO3A 4NRRA 5DD1L 3BP4A 4WU5A 1ULVA 3ABMB 2EVFA 3R0UA 3BKML 3IJ7A 2RR3A 4KMTH 4J5NA 3S5ZA 1A9EB 5A2JH 3GU1A 2BY3A 3BEVA 1W32A 3H9SA 4LLQB 4NN5C 1UWEL 2H0JA 1AIFA 2ZYRA 3T9WA 1I7UB 1S39A 2OL3A 2CBQA 1M6UA 3G5ZB 2XJKA 3ZIYA 1UENA 1FCVA 5DY2A 4MFDA 4LLQA 4LQFL 1JQXA 4FLHA 2UXTA 2Q87A 4RNHA 5TH2A 3DHDA 1VGKB 5E6YA 1YXCA 4PREB 4QF1B 1TZGH 4LKXA 1OT1A 1N4XH 1RU9L 3KPRB 4MA1C 5D7IB 4ZSOA 2YCJA 5K9QG 4WEVX 3HJEA 1OP3K 3PHQB 3U9PL 2WUCL 4OECA 3ZT7A 5JIWA 2F9BT 4NBYB 2C19A 3TJHD 1B3IA 3PABA 5F1KC 3W2DL 4G6CA 1UOVA 1F90H 4DVBB 1I3RA 5F0LB 1HTIA 3DX2A 2XKUA 4M43H 3LQGA 4JN7A 5TNVA 3L12A 4PFMA 4TUOB 1H60A 1RIVH 1US2A 4GXPA 5AFDA 3JR2A 1YDYA 1O7SA 2EDJA 3HI5L 4U1IA 3WO4C 2E6JA 4Y16A 2CEQA 3Q2DA 4HK5A 3VXPA 2UY5A 4M7ZC 1YY8A 1S6NA 4X6BB 1JV2A 5FX3A 2AQWA 4WJEA 1GGIL 3PQYD 1G9EA 2ZUXA 3N6JA 4TX6A 3FN3A 3Q8FA 3IFPB 4LRSA 2DBJA 4DAGL 2NR6C 1EXUB 1K4CA 4WFED 3TC9A 3MUGB 4ZMTA 4NQSB 4J3OG 3V4VH 4U1GC 2X4PB 1M01A 1XX1A 4WKAA 3SDCA 3BPOB 4WDUA 1S3RA 2VW6A 4HS3B 4RSVA 4XO8A 2YRBA 5JR1L 1KPVB 2CK2A 4K2UL 2HX9A 3V5HB 1GZPB 1XGEA 3C5XA 4Y4FD 4GZEA 2EYTA 4L3EA 1MUMA 1Q8JA 3BVNA 3UTPE 2NY5H 5E2JA 2QQNL 2P24B 5C6TH 4GP5B 1IM9A 4R4ND 3O3BA 4JR9H 4Y5YB 5T5FA 4DKEL 5BO1H 4A7QA 3H22A 3VNMA 4YYCA 2ZP8A 3MRHB 1LYXA 5GNXA 1Z5HA 1PLGH 2EIZA 2N01B 2YRZA 4REQA 1DL3A 4K0OA 4WI0A 1QDSA 2W67A 3AO0A 4LRIC 2NQ9A 1S7WB 4NHCH 2DU2A 3CN0A 2F74A 1YBQA 4ILSA 1MCOL 3PWPB 4HOWA 4HAGA 3AVEA 1W9VA 5T3ZE 2WXFA 3QLLA 4L1DA 3S2AA 2ZAHA 1GYCA 3L5XL 2KLTA 3O11B 1H7XA 2A6LA 2BOEX 2HVOA 4QOKE 2MUCA 1DVTA 3S5LA 4HSQA 3CUIA 2YGOA 4N1HB 2HVNA 2ENQA 4MJ6A 4MMYB 4WWKB 3VXSE 3O6FD 2DI7A 1XSJA 2DQUL 2XJLA 1HXYB 3PP4L 3JYBA 3SI9A 3FUNA 1UWQA 1T7LA 3QW4B 4CD4A 1PMYA 4YTRA 1R3JB 5DT1H 5DMJB 4YPGA 4R83A 1JNNH 3AU1A 4N22A 2WBWB 3GIPA 3B1TA 2BZNA 4M1BA 3AC0A 2GPZA 2MQ0A 1KTRL 1BVZA 2UZYA 3FPYA 5DDHA 5IQOA 4HETA 3ZE1B 1J5OH 5BOZG 1QT1A 4GFIA 5HR6A 4DF2A 1NGPL 3HS8A 1J1XH 3L7EB 4X8JB 4ZQKA 4ATTA 1Q63A 1BYNA 3V55A 4XPGL 2O26U 3T09A 1QFWH 3J8F7 3LIZH 4PI0A 3TVMD 3REWA 4XB8A 2J75A 4QXGL 5LSMA 1FH8A 2J6WA 4M1GL 4NILA 4IBTA 4N6RB 4HZLB 1XYLA 2VFIA 4J4PD 3EJTA 5BRZE 1EUUA 3T3PB 1IGFH 1TTPA 4L4PA 4PG2A 1KFBA 4MSWB 3X13A 4BUGA 2VDLB 3TJEL 4RDBA 1BMZA 2FCBA 5DMNA 5CJ5A 1HHIB 1O7AA 3NSNA 2VFGA 2Z92B 1DUYB 4H0GA 5HYSA 2A7PA 1OGAA 1T1YB 2W0FA 4W9JC 1L0PA 5E8EB 3ALFA 2P8LB 1UWRA 3TUUA 1J0ZA 3V0JA 1MCKA 3HNTL 4GIEA 1PO9A 2WHVA 1XQKA 1N5AA 4R8WL 4OFYA 3WO8A 1HINH 5E5UB 4B5EA 3BLBA 1MRDL 1V55B 3EBVA 5C55A 4OLYH 2X0VA 4MA7H 3WLNA 3OZMA 1T1WB 2ODIA 1QFUL 2OSXA 3N4EA 4UT7H 2Y3NA 5AVZB 3VIJA 4BRJA 3HTWA 5E70A 2ZG1A 3SGKA 3OODA 3OF6A 3B03A 5EA9A 2IQAA 3O3DB 4GACA 1CE1L 4AZCA 2L5HA 2F1AA 5I5JA 5HANA 3ALXA 4M6NH 1A7PL 1ONQA 3LTVA 1KM3A 3YPIA 4HKXB 2ATPB 4FFVD 1S38A 1D7DA 5FW8A 3D47A 2G3FA 5D4JA 1KTKE 2OJEA 4WJ5B 1S5WA 4R27A 4G6KL 5HDRA 4QX4A 5AAWA 1K4DA 1A6TB 1MWAA 1H3PH 4MQXD 1TTFA 1NKOA 3U25A 2W8CA 3HI6H 2PCYA 3HMXH 3LH2H 1UOWA 4RMSA 3U2SA 4QOKD 2OPCA 1R30A 3RX8A 1N8IA 1PYFA 3SJVD 4LFHD 3BG5A 3EYPA 4AVHA 4KJYB 3NVDA 1C5BH 3SE9H 4Z5RA 1B0WA 3DJZA 1MIML 5FYLL 5FOBB 3DX6B 5D2TA 4P2YA 3DX7A 4DGIH 4DP9X 2HS6A 1RBAA 4BZ1A 2F6AA 4P57B 5C09E 4AXWB 3O4LA 3QUYD 5DRNA 1FHGA 2QZ5A 3QQ9C 1LBMA 1C7TA 3L5MA 4OLUL 5A8PA 3L4CA 2V2DA 1SQ2N 1JERA 3CPLB 5AZEH 1AFSA 4NCDA 3APFA 3LPFA 4G1MA 1B31A 3O0KA 1BEYL 4BA0A 4TRPL 5DA4A 1OD7A 1QX1A 2NLJB 3BYTA 4JDZB 5JIDA 2NNAB 2Z4QB 3VFPA 3VH8A 4F8PA 1XRSA 3S3PA 4S3JA 3UF9A 3N6YA 3BGFC 3QQDA 4LCUB 1TPEA 2OX5B 3DUSA 3HIZA 4GMTL 4UT6H 4C4BA 1A5CA 3I7RA 1ISWA 4P2RD 4GY4A 5L88L 5JA8B 1DUYA 5HYSB 3NP4A 5J6GA 1TQUA 3A67L 3QZWB 3GHTA 3Q58A 1IAKA 3GI9L 1RP8A 3DUGA 4EO5A 4IQHA 1OD8A 4NPYB 5E1QA 2ED9A 2DEYX 1D8WA 3QFGA 1F6AA 4UIKL 1KIQA 4KTEL 2O6FA 2EDFA 4HAFA 3T71A 1WIPA 4AZHA 4DELA 5BOOA 3G04B 3M7OA 1IGMH 4KY2A 3WS3A 1P4LA 3U30C 5LHDA 1S7UA 2O9OA 2WTRA 4JFQB 5T3ZL 3EOTL 2YZ8A 4Z76A 1D2PA 1ZHKA 2Y4SA 4RFNC 1F3WA 1AZCA 3AS3A 1SM3L 2DQCL 3MRBB 1QYGH 4E3TA 3DUUA 4JNMA 1A5UA 3P3YA 3DI2B 4DVRH 3WE6B 3QRFM 4UQ3A 5L9DL 4NKIH 4GSRA 4BXSV 3H2OA 3LDVA 5AOUA 4XP5H 4DRSA 2G3MA 2JKRM 3SKJL 5M95B 2I5GA 1MPAL 3QXWA 4TSCH 1H8LA 1KJVB 4QRSA 5A6SA 4QRPA 4L80A 1GZQB 3K6OA 4XOEA 4PJGB 5HVHC 1ONRA 5KJRL 2EBNA 4LP8A 3OZYA 3WMCA 4AZ7A 5HJYA 4IFOA 3LD8B 3OZ9L 2EDYA 3NESA 1RK0A 4C8XA 1ZTXL 4DNLA 1JL8A 1I8JA 4PJ5B 2QJGA 2XIIA 4OZHE 2H3KA 5EBLA 3IV8A 3W23A 4PTVA 4O9HL 3ULVD 4OIFA 4XD6A 3WQEA 2E9MA 1G7QB 3OKMA 3NEOA 4U5IA 1DVZA 2DYSB 3LKPA 1S7TA 5AW9B 3OGSA 3QO1B 2W81C 2C13A 3MHFA 3LAFA 1TFPA 2GTQA 1Q66A 5JIHA 1G4PA 4IU3A 1EYEA 2A3CA 3SBWC 4NZRH 3URBA 4GQQA 5IHUH 2H8ZA 3DROA 5FS5A 1A14H 5EBLB 4Y5YA 1AY1H 5C0BA 1DWFM 2H3DA 3HGJA 1DVXA 3SBRA 2NPLX 2QIWA 4LF3B 1G5AA 1MI5B 4MDIB 3JRKA 1DJHA 3PG9A 4Y9MA 2I17A 1RP9A 1L9TA 4MJMA 3M45A 3LHPH 1F3EA 2YLKA 3T4AA 1FDLL 4IBZA 4XP5L 5CH9A 5AB3A 1OGTB 4ORGA 1UZ8A 2ZCZA 3BSHA 4TUJB 5JUEL 3VX1A 1S2EA 1M1BA 3OVRA 3PZ9A 1TFHA 3MAWA 2UY6B 1AGCA 3WMQA 1E9PA 4CCCA 3WKYA 1FFNA 3L0NA 2Y6SC 3BVXA 1O5PA 3D85D 1BXAA 1JE6A 2BNUB 1G1OA 3U2JA 5FDWA 1A02N 1NUGA 3A5FA 5BZAA 4N2MA 3VQLA 5JIPA 2TODA 2IALB 4LQFH 3AY4A 2UY7A 4YHLL 3ECVA 5DJXA 1AZBA 1CFMA 1P4LB 2HP4A 3C2AH 3FAXA 1QO3A 4WI2A 4L8BA 5ID1B 5JQ6H 4ECLA 4YHEA 1FNHA 4LHUA 5GHWH 2VITA 5AY7A 3VKBA 3FPXA 5LGJA 1WP6A 3Q9QA 5HQEA 1QHOA 2NSQA 1LO5A 3FQUB 4X6CE 4WWID 5GS1B 3E6FA 4Y9FA 3QUZD 4ZZFA 2TPSA 3QA3B 3ME3A 2Y7GA 3FO9A 3QIBC 4H0IA 2DUXA 1QI0A 1U0QA 5MEND 4XOCA 4EWJA 3KPRA 4KPHH 1MRAA 3LNPA 2UX6A 3BUTA 3TKFA 5F1NA 1AG0A 4LY8A 3L4YA 2FMOA 2BP0A 2RAMA 4RA0C 3GZ3A 4F7CA 1QABA 4QGTA 1KCVL 2K70A 2ZYSA 3W27A 4NQVA 3O0LA 2PP1A 2RJGA 1QNZH 1OTSD 3KRUA 3KXFE 3DIFA 2J4GA 3MKGA 2YRPA 4BZ2L 1O6SA 1DQDH 1MDTA 1WWAX 2X88A 1YCSA 3RVWC 1T5AA 3K13A 1CCZA 1HXMA 3TWYA 4PTUB 4S11A 4EIVA 3W76A 4R9HA 1R2RA 4Y2DD 5E2WL 2YXWA 3MBED 5H37A 5I6NA 2JI2A 4G6AD 3SO3B 4APXA 1NFDE 2YQGA 3C2AL 4PRHE 4S10A 4UILH 2J8UF 5IV2A 2QCDB 2YD0A 3BTNA 1LZOA 5IVXA 4DNHA 3KBEA 3USBA 2RD0A 3UWWA 1BVKA 3I6KB 1G87A 2NQHA 4K2SA 3K4WA 1FYTB 4NHCL 3SN1A 2H6PA 4C5ZA 4H20L 5F2GA 3R12A 1KM0A 4HNCA 2EDKA 2XN9E 4UUIA 5IMLB 1JHLL 3L81A 5D6DC 3NL6A 3EYOA 3HG0A 1ONEA 2WPGA 5HXMA 2DH3A 2QQKH 3KW7A 2N56A 2GFTA 1WZLA 2YB4A 3TNMB 1J6OA 1ERNA 5CC5A 4PW3A 4UQ2B 2XX0A 3GSNA 3E0LA 4GYFA 2FE0A 4OJEH 1JUFB 2G4EA 2F54E 1KN2L 1SY6L 4HJEA 1OFBA 4ADSA 4CCEA 1B57A 4KHXH 3TASA 1PSCA 3VKDA 2Z64C 2C7UA 3TEYA 4U1SA 4HV8B 2XH0A 4NGHH 1SN2A 2BCMA 4PWIA 3T0VA 4JO2H 2IOOA 3PUGA 4IM4A 1J9CT 3S3SA 2QQLL 1BIHA 3B34A 1HHHB 2H3NB 3D3VE 3DJRA 4G8EA 1V08A 4L6DA 3EX6A 4XX6A 2VZVA 4Z1PA 2WZHA 3E38A 4F8NA 1UROA 3B0XA 1C91A 5T8IA 3LSCA 4M81A 1O1HA 5G2IA 2X87A 1LO0H 1SJVA 2DQJH 4L8DB 2OCZA 4HIXL 2WLJA