1ODUA

Crystal structure of thermotoga maritima alpha-fucosidase in complex with fucose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
441
structure length
422
Chain Sequence
b'RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEDLPGYKWEFTRGIGLSFGYNRNEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 148
structure length 422
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1oduA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1oduA01
3WDQA 5ABGA 4WLCA 4OIFA 5BWFA 3LMYA 3AIVA 4CN6A 1EGZA 1FH9A 4OKDA 3GM8A 1K9DA 3UERA 4L4PA 1UD4A 3H53A 1ODUA 2QMKA 4KRTA 4W7VA 4KMQA 2G8ZA 3N1AA 1I75A 3HU7A 1V3MA 4RE4A 3NCOA 1D7FA 4AZCB 1H3GA 3UCQA 1YQ2A 3M07A 4XV0A 3VIIA 2PWDA 1NOWA 2YL6A 2X09A 2WM0A 2J77A 1QI5A 1TVNA 1UA3A 4FNQA 2VX4A 3K8KA 2EAEA 2EO7A 1AQMA 2VX6A 1TVPA 1V3LA 1JAEA 1I1WA 3RM8A 3BH4A 1TA3A 2XWDA 2TAAA 3THCA 3RJXA 1GQIA 1C93A 1VBUA 3ALFA 3WDHA 3VUPA 4B9YA 2RGLA 1UYQA 1B3VA 7A3HA 1EXPA 4HU8A 5CG0A 3LXCA 5TD4A 3SCVA 2BFGA 2VRKA 3PZVA 1UR0A 1KWGA 2ZXAA 4RE3A 3CHDA 2EXOA 4UQBA 3WDIA 3MI6A 1V6XA 4J7RA 1GZJA 3I3EA 1G94A 4M1RA 1JF5A 3AISA 4TOQA 2CHNA 1GUVA 3L4XA 2YDSA 1PPIA 2W66A 3T2PA 4MNLA 1ECEA 3W27A 4ZE4A 4CKQA 3WD3A 3APGA 3VU2A 4DWSC 1UASA 4QDMA 3D4ZA 2CITA 2X2HA 3RDKA 5D4YA 1EA9C 2X2IA 2DEPA 4CD7A 4WKFA 1WDPA 3VD9A 2PWFA 3PZGA 1B9ZA 5E09A 4H8HA 1KBKA 1KXTA 3VGHA 1KWKA 2EPKX 3G6LA 4AIUA 2PWHA 1ZS2A 5A6MA 2EPOA 3WMCA 2F7PA 3MMWA 4GZIA 2J79A 3LPOA 1ZBVA 1R46A 3IAQA 4BQ3A 4M8UA 3LRMA 4Y7EA 1S46A 1UWQA 3WUFA 5JUVA 1CECA 2F2HA 2XN0A 3UETA 2EADA 3GXNA 1E43A 4M56A 1JI1A 4ZEPA 4HA4A 3SEPA 1J0ZA 1UWTA 4P8VA 3W38A 1NP0A 1CXEA 1TQUA 5CQ1A 1EHAA 2D24A 3LRKA 4MJ2A 4UFLA 3A47A 5FL1A 1E70M 4CD4A 1JI2A 4UQ9A 1DEDA 3SCTA 3BC9A 3RMEA 1KTBA 5ABEA 1E55A 3BLPX 3BVTA 1TZ7A 3CMGA 3FHAA 3EMZA 3D3AA 4D6HA 2BY3A 3RM4A 5ABHA 2WC3A 1MWOA 3ZT6A 4PSPA 5CGMA 4P7RA 3CC1A 4V28A 3GNOA 3WEOA 5AC5A 1E5JA 4JHZA 3SURA 2F7QA 5A6SA 3N9KA 1XCWA 5CSYA 1M7XA 2EABA 4WSJA 4C7GA 4W84A 5IHRA 1W9XA 3PZQA 3PZNA 5A69A 3WF0A 3A23A 2GK1A 1JZ7A 3ZJKA 4IPNB 3BXWA 1G0CA 5D8ZA 1SZNA 2FGLA 5BXPA 3WUEA 2WB5A 1HJXA 1LL7A 3WH8A 4PMRA 4R27A 1GOQA 1MQRA 4HTYA 1R33A 4AZ5A 1OGGA 3K1DA 4PMQA 4Z2GA 4S3KA 3OLEA 2D73A 3LXBA 2QPUA 1US3A 4CGTA 3AIWA 1B3ZA 5DT7A 1C8YA 1CZ1A 3VIKA 2DT1A 1G9HA 4JCLA 2ZUSA 5ABFA 1BVNP 2VR5A 2W63A 3AZRA 4H2CA 1QX1A 2DQXA 4WK9A 3VIJA 1BGGA 1W9BM 1FOBA 1UOKA 2XN1A 4M81A 4UFIA 3VOCA 2VCCA 3WL0A 3PTKA 4JFUA 1HKJA 1WDSA 2ZIDA 3T2QA 4ZFMA 3KLKA 4AD4A 2WMHA 1HJVA 1E0VA 3WNNA 1XSIA 3OGVA 2CHOA 2BVTA 1W32A 2WVVA 1SR0A 4PSRA 1CXHA 2VQUA 3WIJA 2D0FA 3WY3A 1JZ8A 1LL6A 1O7AA 1JYNA 4MAZA 1JAKA 3CZEA 1XGZA 3A5VA 3VGBA 2DIJA 3WDJA 1O7DC 1QHPA 3A21A 4PBGA 3IJ7A 4HPHA 1PS3A 3CGTA 5GNZA 4JCMA 3GH5A 1CENA 2VZSA 4QP0A 2WAGA 4P7QA 1LG1A 1VFFA 1XSKA 2Q8XA 4TX6A 3WQ6A 1JYXA 5A6JA 3WMSA 1M03A 2G4FA 4L4OA 1E6ZA 3S2CA 4MNMA 1D2KA 1M01A 3AHVA 1CXKA 1XHGA 2PF0A 1N82A 3GBDA 2GVYA 2VZVA 4UQAA 5A2BA 3OIHA 1E56A 1H49A 3U5YA 5JBFA 3ZJ6A 4TTGA 3AXIA 4QLLA 1MXDA 5AYIA 3DYOA 3MV11 1CXLA 3PTMA 1GNXA 2NW0A 3RO8A 3FY1A 3H55A 5GQBA 4WKAA 3WY2A 3L4UA 2E3ZA 3H54A 3L4WA 1WNOA 3AXXA 4J3VA 4HMCA 1JZ5A 8A3HA 2FHBA 5A8NA 5CZKA 4A4AA 3DDGA 5JIPA 4UOQA 2X0YA 3CHCA 2ZX6A 2A3CA 3EDJA 4YN5A 2WCSA 2WPGA 1GW1A 3VVGA 2WWDA 5M03A 2OYMA 1BSIA 1L0PA 4JZ5A 2FHFA 5CLTA 4PUEA 1KTCA 2OWWA 4U5KA 5BXRA 4W8BA 4MB3A 3MUZ1 9CGTA 4D6EA 1CTNA 1CGWA 2BHUA 1UD3A 1VFMA 2WVVB 3NYDA 3WD1A 3T0BA 4PEEA 4TVDA 1H0GA 3GXTA 4TXEA 4DUWA 4GKLA 1WE5A 1KGUA 1W1PA 2WYSA 3DHPA 1JZ2A 3WFZA 4ZXOA 5D9PA 4XUYA 4MPKA 1OBAA 3A22A 1EO7A 4HZ7A 1ISVA 2DGAA 3GTNA 2ZX9A 5DF0A 2HVMA 4PCSA 3ZO9A 4F9JA 2DSKA 2GJRA 3CUGA 5JIWA 1XSJA 3N13A 1K9FA 3VDCA 3WH7A 1EIBA 2OWCA 2YA2A 2PI6A 1WPCA 4FNUA 3WEMA 3G6MA 3B8SA 2V3DA 6CGTA 5A8MA 2XGBA 4P7NA 4J28A 3BMVA 1V6WA 3QHNA 3AMLA 3I3DA 4FNPA 4Z2KA 4MNJA 2GSJA 3O2LA 2VC9A 5LA2A 4FMVA 1J0IA 3B9DA 4GZJA 2G3IA 2VX7A 4GIAA 1E0WA 2VT0A 3WF1A 3VM5A 4QCEA 4QLJA 3UG3A 1HXKA 3OBAA 1JXJA 1K9EA 3VKKA 2ZUWA 3ARTA 3FNDA 5DO8A 1R47A 3CBWA 1XRVA 1FHDA 3KL5A 1BF2A 2XFYA 1UZ1A 4LQ1A 3FAWA 1EDQA 2DPEA 2W5FA 4DO4A 4ML4A 1CGUA 1B30A 3NIYA 2PBGA 1G5AA 1BGAA 1DHKA 2XSAA 3CO4A 3BUIA 2J7DA 3ARVA 2A3BA 4DWSB 3D52A 2ZE0A 2WBKA 1UR2A 4URIA 2G3NA 3BVUA 4FK9A 4U3AA 2WSKA 1V3IA 3O6AA 1J0HA 4NI3A 2CERA 1PJ9A 2JIWA 3WF3A 2WMJA 4LPCA 4E8CA 1C92A 1G1YA 3WKZA 4AMWA 3EJPA 2G41A 2F1BA 3OLDA 5D9MA 4V2XA 2WK2A 1KXHA 5BRQA 3E1F1 5M5DA 4B3LA 2ZXBA 3GXMA 3S6TA 3F5JA 1UR1A 3AHXA 5I6SA 3ZJ7A 2GJXA 6A3HA 5A8OA 2XVGA 1X6NA 1C7TA 1C3FA 1UH3A 3WQ5A 4CVUA 3SIMA 3HG3A 3D5HA 5A6BD 3D50A 2XM2A 4MJ4A 3WBAA 2XJ7A 1KR1A 5D9NA 3HZ3A 3B9EA 1W3JA 2XHYA 1SMDA 5BROA 3ALGA 3EYPA 1B1YA 4B16A 1R34A 1G01A 1MW1A 2HISA 1JDAA 1E4MM 3T2OA 5EFDA 3FN9A 2VX5A 1MVYA 3N18A 3GXFA 5CLWA 2VUYA 3VD7A 1FH7A 3ARZA 2YFOA 4B9ZA 3N11A 4XB3A 4NSBA 4K68A 1VFUA 1QNRA 4HP5A 1RD6A 2FHCA 1NP2A 4TUFA 4XX6A 1BYCA 3QOKA 4Z2HA 3ZR6A 3VMNA 2Y8VA 3KLLA 3UG4A 3VILA 4R5EA 2BV9A 4OUEA 4MDPA 1VEMA 1HNYA 2E8ZA 3ZT5A 3UR7A 2J7CA 4AISA 4AYSA 1H41A 2WMGA 2BHZA 2YDQA 4N0RA 3AJ7A 1E1EA 5BRPA 3RPMA 5C71A 2WLYA 4J27A 1C90A 1ZJBA 2VCBA 5GPRA 1GQKA 5I23A 3OZOA 3ARSA 2ALWA 2ZX7A 4UTFA 1JFXA 1JD9A 1HVXA 1VJSA 2D1ZA 1MW2A 4LGXA 1UQYA 1UA7A 1E5NA 1R86A 1E4IA 4AZBA 1E4NA 4ATDA 3EJSA 1E6QM 1LJYA 4NRSA 3LX9A 2ESCA 1J01A 2WW5A 2EEXA 3MO4A 3VNZA 1QHZA 3AIRA 1E6XM 3CUHA 1OIFA 1V08A 3ZSSA 1KCKA 1GHRA 3T08A 3MSGA 1MQQA 1HF6A 4D6JA 3MUIA 2W91A 1FFQA 3F5KA 2CKRA 3WELA 1NWTA 2VZOA 3VIOA 3ARPA 5CSUA 3BSHA 1WAWA 5I0DA 3CZKA 3A4WA 4RL3A 3S5YA 2WC4A 3JUGA 5IXEA 3U5UA 1TQSA 1CNVA 1Q4NX 2WVUA 3KL0A 6TAAA 4OBSA 3SUSA 4AWEA 3ZIZA 2OWXA 2NT1A 3TTQA 4AMXA 5I24A 4U31A 1XD1A 2DDXA 4PRWA 1JIBA 1M53A 1H11A 1UG6A 1US2A 1O6IA 4UR9A 5BCAA 4J3UA 1V03A 2XG9A 4H04A 3RJYA 1OCQA 1VRXA 3CIVA 3EDDA 3TOPA 3WNLA 4M24A 1BVZA 2F18A 2WCGA 4ATLA 2VO5A 4W5ZA 4D6IA 3T0AA 3WNMA 3CZNA 2JF7A 1W3KA 3QGVA 1PZ3A 4D71A 1CGXA 4W86A 2X0HA 2AAAA 2F61A 1OD0A 3O9NA 2D20A 1CBGA 2V3EA 4AYGA 3PBGA 2WZIA 4PTXA 1BPLB 4EK7A 4DM1A 4U33A 1NH6A 3VSTA 2D0HA 3CUFA 3VIHA 1TA3B 1KB3A 5E0FA 2QMJA 3IGUA 2W61A 3D51A 4BA0A 3L2LA 1TE1A 1UUQA 4AEEA 3VMOA 1MQPA 1VJZA 2J47A 1BYBA 2C8NA 4U2ZA 4UOZA 4M82A 5E0CA 4U2YA 1EOMA 3VD4A 3AMDA 1LQ0A 2CNCA 3CZ8A 1Q6DA 1W2VA 1JNEA 1UR8A 2A3EA 2WWCA 3SCSA 1TG7A 3AOFA 1DWFM 1ZB5A 5CPSA 5DEZA 1WO2A 1JF6A 4BQ5A 3FHQA 2XVLA 2EPLX 4M29A 3VMPA 1QNQA 4X9YA 3CUIA 1V3KA 1F4AA 3UESA 4UCFA 3WQ4A 4ACYA 3K46A 2ZX5A 3LPPA 4IISA 1LWHA 2FE0A 2F1AA 4PTVA 2OYLA 2YBUA 3EDFA 1E72M 1E3ZA 4ACZA 3A24A 2DSVA 3AHZA 4Q7NA 3SCQA 2WC7A 1CXFA 1KXVA 1B3XA 3PZIA 3WNKA 2CESA 1UWRA 4D6GA 2VJXA 2Y2WA 1JNDA 2WZHA 1V6VA 1WP6A 4JIEA 3W25A 1JYWA 5JBDA 1UH2A 3WN6A 3GDBA 3AIQA 1WDQA 3U57A 5FL0A 1IV8A 2WHKA 2CXGA 4F79A 1V6UA 1MW3A 3W0KA 4LYPA 1PIFA 1HN1A 4W8LA 3L4YA 3L4TA 1RH9A 2JFEX 2D22A 5FD0A 4CN1A 2QV4A 1HJWA 2YL5A 3W4RA 2DT3A 3PZTA 1U33A 1B0IA 3L4ZA 3I3BA 2YKKA 3WH6A 3VSUA 4PMOA 2QF8A 4YPJA 1VEOA 5FCZA 2VURA 3W24A 2XVNA 1J11A 2QLYA 4FLRA 1V02E 5HDRA 2VL4A 2YL8A 3DDFA 1J0YA 3WD2A 2XPKA 2Y8KA 5DT5A 1MYRA 1ITXA 1HWWA 3TV8A 1UD6A 3GBEA 3MV01 4GPNA 3BGAA 3ZMRA 4WJXA 1X1NA 1W9UA 1V3HA 2YOCA 1IZKA 4JHOA 1EO5A 1AQHA 1GHSA 1WB0A 2E9MA 2Y5EA 2VMFA 3GXPA 4IPLA 4GQQA 4GO8A 2XM1A 5A6AA 3BVXA 3D4YA 4LXFA 3DX1A 4KH2A 2YA1A 1HKMA 1J10A 5KEZA 4AXNA 3EJRA 3QR3A 3HG5A 3VDBA 2ZX8A 2WVTA 4NZJA 4TTUA 4N42A 1XD0A 2VTFA 1MFUA 4EE9A 1WZMA 1JD7A 1UZ4A 4RE2A 3WEZA 1DWHM 1EQCA 3DX2A 1PX4A 1XYZA 4CD8A 3WMBA 4ACZB 3MANA 1QI3A 1BG4A 2GK1B 1NWUA 1QNOA 1QI0A 3KEHA 3DX4A 4M80A 1CGYA 4MNKA 3GNRA 3AS2A 1RP9A 2F7RA 4PMXA 1NQ6A 1HL9A 3ARXA 1TUXA 2YLLA 1J0KA 1CIUA 2XGIA 3SCOA 4W89A 2X1IA 2WZEA 2XFRA 3MS8A 2OYKA 1EH9A 1AVAA 3POHA 1GONA 4AEFA 3HJEA 5JBEA 5LA1A 5ABFB 2VR4A 3K4AA 1R75A 2E8YA 1GOKA 1QVBA 2BY0A 2OW7A 2VZTA 2YJQA 3CLWA 3NJ3A 2CBUA 3N04A 3SCUA 1NOUA 3ZSTA 4BCEA 3DX3A 4AZ7A 3TTOA 1UHVA 2W4XA 2VVSA 2W62A 5I5RA 1XV8A 4UZUA 1ZL1A 5A8QA 4P7OA 1GOIA 4CU6A 1NOFA 1KGXA 3BUDA 1UD2A 3UEQA 4HU0A 1E1FA 3SUUA 4QCFA 5I79A 2WHJA 1GVIA 2X05A 1BG9A 5IFTA 3U7VA 3AI0A 4KGLA 1UH4A 1HP5A 4D6CA 3WF4A 1NWSA 1RPKA 5EB8A 1GQJA 4JFTA 3TTSA 4HOWA 5HNNA 1LF1A 5I2UA 1QHOA 1H2JA 1OM0A 3TA9A 4GQRA 2XUCA 4HOXA 1DWAM 3EJUA 1QW8A 1OGBA 4OJYA 4AD2A 3CZSA 1FHLA 3IJ8A 3AHYA 1PX3A 2DH2A 4TX8A 5HOSA 3ARQA 1B90A 4J3SA 3GXDA 2EPNA 4NRRA 3PN8A 1WKYA 1EQPA 2OSYA 3T0DA 2DH3A 1OSEA 2J7BA 5LA0A 1R8LA 1ISWA 1W1TA 4ZENA 2WMIA 4DUVA 2W67A 1E6SM 4B15A 1UD5A 2C0HA 1TQWA 1J12A 1PBGA 4X0NA 1BYDA 4A3HA 1UWUA 5A6KA 2V5CA 1OWQA 3MSDA 4CCCA 3WL1A 3QOMA 3L4VA 1MW0A 4QAWA 3WENA 1JL8A 4P8UA 1WZAA 2C7FA 3ZM8A 4OZOA 1OB0A 3WUBA 5A6BA 2QHAA 3OB8A 4DM2A 1ZJAA 3NUKA 4BQ2A 4YHGA 2AMGA 1XH1A 4UOJA 3A4XA 1BFNA 2E9BA 3AS0A 4ATWA 1JDCA 3OG2A 1VIWA 4C7DA 5ECUA 3WY1A 3WQVA 4ZXLA 4PMVA 4WIWA 1H5VA 4MTVA 3MMDA 1HT6A 4FLSA 2FH8A 2XFFA 3W37A 5BYWA 4TVCA 3A4AA 2WMFA 4GI9A 5AYBA 2YBTA 1UWSA 5M17A 4DWSD 3KL3A 1BHGA 2ZUVA 1AMYA 4W7UA 1XH0A 1E0XA 1VENA 5CPQA 3ZQ9A 3KE0A 4H8UA 1V0LA 4CVWA 3ARYA 1KR0A 1OIMA 2VVNA 3NDZA 3NSNA 2CPUA 3AROA 1HJUA 3VM7A 2GDVA 5EMYA 2WHLA 3WD0A 1LL4A 4CU8A 4F66A 1CEOA 5I78A 4FNSA 1LG2A 2ZICA 2VOTA 4JL1A 2GJPA 5A6LA 2F8QA 2YL9A 1HVQA 1PIGA 1SFSA 2V38A 1Q6FA 2BNJA 4W93A 1DWIM 3AFBA 2BY1A 2CBIA 4XZWA 2BXYA 1EDGA 5A2AA 2B31A 2E9LA 3MKKA 2WHMA 1H1NA 3GH7A 3HMCA 1DWGM 1R87A 2WVSA 4AIOA 1QWNA 1QW9A 4PMYA 3VDHA 3KWXA 3VGGA 1HKIA 4H7VA 5BXSA 1PZ2A 3ARRA 1ODZA 1V6YA 1HL8A 4MADA 1HJQA 1W9VA 3PTQA 1JZ3A 4W88A 3CTTA 1JYVA 5FOOA 3CUJA 4UFKA 2DIEA 2E40A 3AHTA 1V0KA 3VGDA 7TAAA 2JEQA 4D6FA 5GNXA 5HBFA 2OSXA 1C8QA 2NT0A 5FKYA 3VO0A 3GH4A 2DSUA 4HMDA 3K8MA 1GORA 2UY2A 2YDRA 1KXQA 1CXIA 5CXPA 3SCPA 5E9AA 2JIEA 4AD1A 1JZ4A 4LX4A 4KGJA 2EBNA 4CN4A 3J7HA 1J18A 2CIPA 5DFAA 3VIGA 1P6WA 3VTRA 1UKSA 1E6RA 2J7FA 3WQWA 3VX1A 1FP9A 1GOWA 3ZR5A 4FNRA 4Z2LA 2D3NA 3RIKA 2CBVA 2VCAA 3WDRA 2FH6A 2O9OA 1KQYA 2JF6A 3ZOAA 4BQ4A 3VIPA 3LPGA 4MAVA 5A2CA 1W3HA 1QI2A 2BY2A 5A8PA 2YFNA 3W53A 3QHMA 1KQZA 3AIBA 3WFLA 3SCNA 2AOSA 2XIBA 3WDPP 5FIPA 1IT0A 2WBGA 3NDYA 3VD3A 4LYQA 2GJXB 5DMYA 1VB9A 3U7BA 4JKMA 3DECA 4OOUA 3POCA 4D1JA 1PEZA 4JFWA 2WMKA 4AZGA 4Z2JA 1ITCA 1VAHA 1E4LA 3VNYA 3M6DA 3EMCA 2JEPA 4J3XA 2XSBA 1KCLA 1R7OA 4D72A 1FP8A 3GYCA 4U5IA 3EDEA 3BMWA 1V0MA 3NSXA 4DO5A 1GVYA 4Q22A 4OGZA 3FW6A 1TCMA 3AZTA 3QHOA 3CZGA 3K4DA 3PZUA 1GCYA 2J78A 2G3JA 3N15A 4PTMA 4UFJA 1CGVA 5IHSA 4OBRA 2XVPA 3AXHA 1CLVA 5EBAA 4JKKA 1JGIA 3N12A 2FGZA 2PWEA 1W9DM 3MU7A 4GI6A 4X0VA 3WF2A 2Z1KA 4GO9A 1WDRA 1SYTA 2D0GA 3UG5A 1CYGA 3BUBA 4WF7A 1Q6CA 2ZUNA 1M04A 1IZJA 1UQZA 1CLXA 1W3LA 1WCGA 2D2OA 5D9OA 2VRQA 1B31A 1QI4A 4BF7A 4PMUA 3VGFA 4HZ6A 3DYPA 5C8BB 4NX0A 1CDGA 2ZWZA 2PB1A 2Y4SA 3BAWA 5A3HA 1MFVA 3TP4A 1KFWA 1ZU8A 3W6MA 3ARUA 4NF7A 3CZJA 3WD4A 2UY3A 2CCRA 2EJ1A 3SUTA 1W91A 1E6NA 4UFHA 4D6DA 1HKKA 2PBOA 4GINA 3DC0A 3DYMA 3IJ9A 2WCAA 3OZPA 3AMGA 1TQVA 3VINA 3AICA 2XVKA 3BCFA 2ZWYA 4FLQA 4CD5A 4B3KA 3AYRA 3BAYA 1B2YA 1CWYA 2GUYA 5AY7A 5GNYA 2EACA 3VIFA 2BHYA 3AIUA 4AD0A 2WKGA 1HX0A 4P7LA 3W26A 1A47A 4P8XA 4UNIA 1RP8A 2IXVA 4BS0A 1GJWA 3M7SA 2PWGA 3CH9A 2X2JA 3W82A 4OOZA 4KRUA 2J8FA 3SCWA 3OGSA 1QOXA 1ISZA 3MUY1 4ZE5A 3BLBA 5HXMA 4AMCA 1GPFA 1I1XA 4PMNA 3WH5A 1ISXA 1NWRA 1Q6GA 4HA3A 2RGMA 1HP4A 3AZSA 3A6OA 5IFPA 3TTYA 4DUXA 5E6YA 1K9TA 3AS1A 1JG9A 1QWUA 2VZUA 3F4VA 1BTCA 3AMCA 1UR9A 3VSVA 4AZIA 2YIHA 2WANA 2DSZA 2VRJA 3F5LA 3VPLA 1GOMA 3GZAA 3THDA 3OLGA 2Y24A 2A3HA 4QLKA 4FNTA 4H41A 3GXIA 5A94A 3W6LA 1WZLA 1QBAA 2X8RA 1BYAA 4MB4A 4WKHA 1FH8A 4CCEA 2DSWA 1KBBA 1TMQA 3PZMA 4AW7A 2XN2A 2XTKA 1OD8A 3SUWA 3AQUA 4J3WA 1HTYA 2UWFA 3OA5A 3CPUA 4V27A 1DTUA 4QFUA 1XH2A 1W9PA 1VF8A 2WKLA 1U30A 2WXDM 1EDTA 1JXKA 1H0IA 4MDOA 4HZ8A 3S5ZA 4MB1A 1Z32X 1WZKA 4W5UA 3ECQA 4J3TA 4IUGA 1XYFA 3CHEA 3BAXA 3HG2A 1E6PA 2JE8A 1SMAA 1K6AA 1Q6EA 3WSUA 4PYSA 5M3WA 3IK2A 1C91A 5A1AA 2UY5A 3BUPA 1LLOA 2EPMX 4PMDA 4W7WA 1F4HA 1ZBKA 1U2YA 3EMQA 3WBEA 4AY1A 3BCDA 1DWJM 3WUGA 5AC4A 2CETA 5BXTA 2PC8A 1UR4A 4PMZA 5HPOA 1HJSA 1OT1A 4NZFA 3EBVA 1ZBWA 2BVYA 1W1YA 3CHFA 4LYRA 3WNOA 5CPTA 1E40A 1W1VA 4EANA 1PX8A 3BAJA 3RM9A 1Y7VA 5LYRA 1VBRA 4IM4A 4U3CA 4EAMA 4HPGA 3CZLA 4HMEA 2BS9A 1E9LA 3ARWA 1B3WA 3HG4A 2V3FA 2J25A 1C7SA 1C8XA 3VD5A 3BVVA 2ZOXA 1QBBA 2O92A 1BLIA 2D3LA 2YLAA 1UKPA 1JFHA 3BUQA 2WNWA 3EJQA 2EQDA 2QPSA 3VIMA 4DO6A 2VNCA 1TQTA 1MXGA 2D23A 3ZJ8A 3IAPA 2W92A 3CMJA 4AD5A 3AMKA 4JAWA 2ZXDA 2F7OA 3AIEA 3UR8A 2IXUA 3TONA 2UY4A 3WY4A 3L2MA 1AQ0A 1BAGA 1QPKA 4H8VA 2J62A 4UQCA 2ZUUA 5E6ZA 2YA0A 4GXPA 3W28A 1D3CA 2BXZA 1V02A 3W81A 1J9YA 4W87A 1UD8A 4D1IA 4E8DA 1GOOA 3VX0A 3KZSA 3SUVA 1VFOA 4W8AA 4HA1A 4PCTA 2XWEA 3EDKA 3K8LA 1UKQA 1T0OA 1GQLA 3WNPA 3DX0A 4DWSA 3PHAA 1E73M 2OSWA 2J7EA 1TR1A 1GJUA 4F8XA 2GFTA 5E1QA 2OLHA 5A95A 4AZHA 3ZT7A 3RCNA 1TFVA 3BAIA 3AS3A 4AD3A 7CGTA 4MB5A 3IANA 3NSMA 3FAXA 2X2YA 1QNSA 4XZBA 3A3HA 2J74A 3BLKA 5EFFA 3BVWA 4EKJA 1NARA 2FYVA 3CV5A 1J0JA 2CBJA 2J8GA 1EOKA 1BQCA 4GI8A 4CD6A 3BAKA 1XC6A 2IUZA 1CPUA 4TVUA 2IGTA 2J7GA 3M46A 2OW6A 4JL2A 4PTWA 3FXYA 1HIZA 1JDDA 4GZEA 3MUAA 1FFRA 5CGTA 1CGTA 4A3YA 3MMUA 5I77A 1ISYA 1X6LA 4JKLA 2CKSA 1XCXA 2J4GA 3T09A 1NM9A 1QNPA 3RILA 1E3XA 4UFMA 2ZUTA 2CYGA 2J7HA 4E2OA 3II1A 5F7UA 1V3JA 2O9RA 1PAMA 2O9TA 2DT0A 2V3GA 3B9AA 1E15A 2BVDA 1VEPA 1H09A 1KGWA 3W29A 2Z1SA 1DP0A 5C70A 5D8WA 2XYLA 2VI0A 4HOZA 4E4PA 5HPCA 5KZ6A 2CEQA 8CGTA 2V5DA 5I3DA 1OGSA 1V0NA 4FLOA 4YHEA 3OGRA 4NXKA 1UWIA 4AZCA 4Z2IA 4PUDA 2NSXA 3PZOA 4UZSA 1HXJA 1FA2A 1JZ6A 3EJTA 4KWUA 2E0PA 4PN2A 1B3YA 4CU7A 3N17A 1EHNA 3DHUA 4NXSA 1ESWA 2WMIB 3LXAA 3OLIA 1H4PA 2DT2A 2ZXQA 1E71M 2XIIA 3LRLA 1OT2A 4BZYA 1ZBCA 4UQDA 1R85A 1R7AA 3BSGA 2O9PA 2E4TA 1A3HA 3HN3A 5IDIA 5E70A 3PZ9A 2VQTA 2J75A 4WSKA 4JFSA 4JFVA 3GNPA 1L8NA 1UKTA 4C7FA 2WLZA 3AYSA 1OINA 4AC1X 4W85A 3WQ8A 2GDUA 4CUCA 1W2PA 4FF5A 4F9DA 4CCDA 3LPFA 2A3AA 4AZ6A 2JALA 1LWJA 3VDAA 4UQEA 2G3MA 4P8WA 4AIEA 1UKOA 2FDMA 2WSPA 2MANA 3SCRA 2ZUMA 3VGEA 5CJ5A 4S3JA 3WH9A 4NZCA 1YHTA
chains in the Genus database with same CATH superfamily
4ZOBA 4IFKA 5BWFA 3EH1A 4NRZB 1PB0A 4LT7A 1JGUL 5F0MB 5CLYA 3SI9A 3M41A 5C09D 1JMZA 1FQ0A 1L3NA 2AK1H 5H2BA 1S2EA 1RZMA 4DQWA 4ZW6A 4O16A 4GBXD 1QPPA 2CKNA 1CJYA 4C6NA 4POYA 3UGXA 1FWTA 5IVNA 3W5MA 1PWLA 1JRHL 1Q0XH 1TPVA 3RJXA 4JHVA 1C93A 3F7YA 5L4MA 1HG3A 4B9YA 4IMAA 5DK2A 2UVEA 2BSSA 2Y7FA 4GA8A 3SCVA 1HWHB 2KYIA 3L17A 3CHDA 3NK4A 1KEGL 4UTLA 1Q8MA 5E6RB 4RR4A 4XZUA 4X5RA 1LMIA 1P4CA 1MCWM 4ZE4A 3N06B 1XR9B 3WTXA 2VDRL 4WDUA 4BKLB 5FLVA 4BEIA 2AK4E 1UASA 2DBLH 2WXFA 3RDKA 2X2IA 3L3HB 4N90E 4YLCA 4WVRA 1KXTA 2EPKX 3NACH 3HTWA 1U9KA 2Z2BA 1MZYA 3WK2A 4XNZC 3IJQA 1IAOB 2FT7A 4X6CF 1MMFA 4LRIA 2BOGX 3GXNA 1MFEL 4D8OA 4K3EL 3W38A 3QYNA 1FLRL 1A7RL 5E2VL 3BE1L 4IK7A 4WWKC 3BP5A 5A2JH 2Z7UA 1ZKAA 1UJ3A 4RIRB 1NANI 5ABEA 1HKLL 2O7QA 3EMZA 4N1CA 4QXWA 4LSVH 4N22A 3VFGH 3LCWA 4NQCD 5F9WC 5LDSA 2DMCA 4GLEA 2FBOJ 3PIQB 4L9ZA 1T99A 1HSBB 1RY7B 4PFMA 3IPFA 3PTDA 1Q7MA 4IPNB 5DD3L 1MFAH 3KLAB 1HJXA 3WH8A 1MQRA 1BWLA 4PMQA 3VDGA 1KFKA 3BAEL 5CINH 3FSTA 1B4TA 5FUZL 2VLRD 3QRHA 4DPPA 1SFJA 1IJ9A 4H2CA 4JXCA 5KG9B 1T2XA 2AQ3A 3QRFM 4Z18A 1MI5A 1HKJA 3QFJA 3FT4B 1HK6A 4K7FA 3OGVA 4FG2A 2WVVA 5KANI 2D0FA 1VGEH 5D72H 4G7FA 3US9A 5CJBA 5HYQA 1B4JH 1HDMB 4NHVA 5K7JA 4ENEC 1XYAA 1UP0A 1OCWL 3GZPA 3NPZB 3LZOA 5BMWA 3N40F 1OSZB 4IL0A 4TX6A 1SHWA 2XA3A 3HS0B 5IW1A 5JW4Q 1X5ZA 1CXKA 4KNSA 4J12A 1S2TA 2WBWB 2PLMA 3VRIB 3QQXA 4JDTH 4GUCA 1FBAA 1XCQA 3CFQA 4HV8A 2O6PA 3U7WH 4Q6IA 1UCBL 5I16A 6TIMA 4KCTA 3TBYA 3H55A 5GQBA 1WF5A 1WQVT 3EUUA 1HGYA 3ZDXB 4RNHA 2O6FA 3QORA 4OB5L 2ZX6A 2WPGA 2RKXA 3FFDB 2CUHA 5C0AA 3KW7A 4FULA 3WXWL 3K1GA 3EOTL 1DO6A 4LIQE 4GISA 5IHUH 5L8KB 1Q66A 5EU6D 1FDJA 2E6AA 5C07D 4H8WH 43CAA 5E23A 2YMTA 3KUMA 2BMKB 4MPKA 1TPFA 1QBLH 4PWFA 5LQBL 3ZO9A 2WTRB 2C34A 2RDTA 3BEWB 1LBFA 4CQ9A 4TOYL 4Y9EA 2Z24A 5FECB 4ALAH 4JHWL 3UTTE 3ZYJA 4L8SB 1RHHA 3MCOA 1DBJL 5ICXA 4TKWA 2Q8AL 5LA2A 4X5LA 2VX7A 3NQIA 4QLJA 3IU4L 1VFHA 4KKRA 2X1UA 4NP4L 1T1XA 3NQ2A 1IVTA 3FRPA 2QCLA 1N3NA 2QR6A 3GS7A 4DAIA 3PM6A 5EO9A 4TQPA 1EDQA 1ORQA 3CNKA 4DO4A 3VE9A 1SBSH 4DEUA 3CTLA 4ZUWA 2AI0L 2V0AA 1WOBA 5IROA 4U1GB 4E36A 1BRLB 4UWQB 4D94A 4ZS6D 1KPRA 3BVUA 5DYOB 4W4NA 2OB3A 4K94H 3BQ6A 2WMJA 3C6LC 1NCJA 5MEQB 3HE7D 1Q72L 4BFFA 4WW2A 1WJ3A 5EEVA 5A6BD 3F12B 4Y4FD 2VGGA 3TCSA 4GS7C 3WIIH 5C3LD 2PCEA 1W3JA 5CCJA 1GHFH 1US0A 1B1YA 1R34A 4PJHB 3BKYH 1P1MA 5EFDA 3IYLW 3N18A 1P6CA 4O02B 3ARBD 4LCSA 4ADJA 1OF6A 2CZVA 3VQ1C 3N14A 3CVHB 3L1EA 3OKNB 3DGDA 4A68A 3VILA 4HYTB 3LEYL 3V5FA 4QHKJ 5I1LB 4HPYH 3ZVHB 2WINA 1DQML 1ACYL 1DBAH 1UWGL 2XZ7A 3BRFA 4JQIA 3RL1B 3MCYA 1AO7D 4N0RA 3FBQA 3HMJG 2VKXA 4WCJA 5JHLH 4CC4A 2VCBA 1NWPA 4FJ6A 2CLHA 2NXYC 3OGCB 3GI9H 5C0BB 5H6HA 4EN3B 3NZHL 3QI9C 4WI3A 1UQYA 3F62A 3IIXA 2E86A 3B8YA 5I82A 5KSUB 5D7KE 4XNQB 2OZ8A 5FYLD 1W3TA 2EEXA 2QFRA 2W5PA 1ZCRA 3FQ2A 1X4XA 4J8RB 2CLPA 3QNZB 4HJFA 5DJ8A 4D6JA 3OF6A 1YY9C 1QSFE 1UB6B 3EF7A 3F5KA 4D0DB 3QQ4B 2WTPA 5CSUA 3LHTA 5HGBA 4PV8A 2WVUA 4AX3A 4UILL 2H7WA 5HATA 3JV6B 4Y2DA 4EZKA 2O5NA 2BVEA 2ALRA 3FJ6A 3UFIA 3P74A 3NYZA 1P0BA 1EHLL 2OZ4A 3WNLA 1NCTA 4F37F 3QZEA 3W7IA 2G50A 3MMEB 2P5EB 5FOBB 1KEGH 1ZUAX 4HJTA 4QHMA 2F54D 2YXMA 3PBGA 2QZ5A 3GJFB 4Y5YC 4IXHA 1CD0A 5CJXC 3GKAA 2EDEA 3FT3A 1GKEA 4UMGA 5DFWH 2Z6FA 1IRAY 5U7SA 3BG5A 4KKCD 1VJZA 1YNKL 1VQTA 4H19A 1Z3NA 2ROXA 3N2JA 1SMOA 3DUSA 4M82A 3VXPB 4U2YA 4B6ZA 1EOMA 4NKDA 3SE6A 2WZPD 3ETSA 3PG2A 1UR8A 3M0IA 3HMWL 3UU0A 4S0TD 5KSAB 3X3GH 2CDGA 2YRZA 1EJRC 2HCVA 5D2LA 2J2ZA 2J1YA 3H7RA 4GX9A 2ZX5A 3MLRH 4DESA 1MFEH 2F1AA 3GPSA 1AS8A 5E2VH 1Q0YL 3BE1H 5BU6A 2PD9A 3R8BB 2IPUG 1JNDA 2AABL 1V6VA 5DQDH 3LDBC 1DEEB 1ONQA 4ZQKB 2NLIA 4NKCA 1HKLH 4KFMA 4HNNA 2VEMA 2CFFA 3AQXA 1NMBH 2DY2A 4PYHA 2ENSA 4L1HA 1MW3A 4M6ML 4DHLA 3KW8A 2ZOKB 4NFCA 4KI1A 3E74A 1XIBA 1I1AC 2JJTC 4O0QA 1AG0A 2ZG2A 1J11A 4Y7OC 5B7EA 3H21A 4MFHA 3PWGA 2BVQA 3Q6GL 3AWFA 1J0YA 3U1PA 1BD0A 5T91A 7TIMA 5DT5A 5A7BA 1JJUA 3I10A 1MYRA 1UD6A 1SLWA 3LS4H 3EOAA 4PWKA 2VN7A 4MZ2A 3A4EA 5FUCE 3N4EA 3G24A 5FUZH 3NQVA 2Y7DA 4LXFA 5IB5B 2ZYSA 2DQHH 4H40A 4N1EA 4OZGA 5KEZA 1HKMA 4X5PA 4QRUA 1ECZA 4HUNB 1IJNA 2FIRT 1QSED 4AJ0A 4AF0B 1TV4A 3VCRA 2A74A 2JK5B 1TQBB 4M80A 3CCHA 2QR0B 4XC1L 4TPRL 1HZHL 1V77A 1RP9A 1EJ6A 2JFCA 3BK0A 1JPSL 4YDVB 4XPBH 3SDDB 5EC2A 4RX0A 4K8EA 2XFRA 2HJKA 4AWSA 3S9ZA 1ZWIB 2YWYA 1OCWH 5FW8A 1AS6A 2BY0A 2OW7A 3TVMB 4UINL 1OGTA 1JNJA 5GS2H 4AZ7A 5I28A 4OI8A 4GH7B 2BHFA 3NO3A 4G7SB 4KBXA 1CDCA 2JKRM 2NX3A 1ILSA 3KTXA 3VOIA 2X4RA 3GVRA 3DFPA 1E9QA 5MI0B 1NTHA 5DQJA 4F9PA 5JHBA 1EX1A 3TSMA 1NC4D 2ORBH 4K3DL 3I6GB 4WEBL 4OB5H 1ES0B 3B8IA 3EGXA 4WU7B 5IQMA 4F80A 1PX3A 3Q3GA 3GXDA 3FQUA 4BSVB 4A55A 2IALA 3DFOA 1OAYL 1ISWA 4WGVB 1D6EA 1W2KT 3RGVA 5TQLA 5DK3A 3TIEB 2DWTA 3B97A 1OX5A 2XX1A 9XIAA 5LGXA 1AL7A 4P8UA 4YSEA 4NNPH 5G5DA 3W0WE 5LUMA 4PJCE 4PULA 3TYCA 3TFKC 5LQBH 2YGVA 2AMGA 4UOJA 3AS0A 3K71A 3QY8A 3GLDA 1W80A 2J56A 3GDCA 4U49A 3PF3A 1HT6A 3B05A 1AZVA 4R33A 4JHWH 4HHWA 1KCZA 2XV2A 1C8VA 3J8F7 5CFHA 4FALA 1Y8BA 1DBJH 2Q8AH 2QQNH 4W7UA 3GIYA 1E0XA 4WJEA 4TUJB 4H8UA 2PLKA 4U1MB 3VFVB 4ZW7A 3M44A 2A9CA 2ZICA 3CWGA 2AJYL 3N91A 3C8DA 4MDRA 5A2AA 3BGGA 2ZQ0A 2I9LB 4IGMA 4PJBE 5FGCE 4RWYL 3QCVL 2V2TA 1MQKL 3VXUA 2RH0A 4H7VA 5HGHA 1Q63A 1DUYB 2XG4A 3FQRA 3QG6A 3EX3A 3NA9H 1V0KA 2OSXA 3HI5H 2UYLA 3LKOB 4O13A 5I1GL 1MHHA 1E4KA 3ETBJ 5F97E 3QDJE 1KXQA 5LIXX 3V36A 5INDB 1LP9A 4M6OL 1IC7H 1EJWC 4LEXH 4FNRA 1DANT 4OV9A 3HZMB 3U7YL 1KC5L 2BNRE 5FEPA 2OR8A 4IKKA 3QQDA 5FGRA 4H26A 5J9PB 4JKMA 1UWGH 1T4WA 3M7OA 5FV2A 4RNIA 4MCYB 2PPEA 3ARGD 3N2TA 1ZLEA 1V0MA 4KZEL 1LDSA 3S35L 3NZHH 2IBZY 2R94A 4QTGA 5MHSE 2VN6A 3PNWB 1A9EA 4LRTA 3TAKA 4L3ED 4B7IA 4WSHA 1MIML 4UT7L 25C8L 4J4KA 3MCG1 4MWFA 3OBEA 4PJCF 2VR9A 4NN7B 1CYGA 3GAYA 3MKCA 1RZQA 5CP7B 4MQXC 4ZMLA 1E50A 1OY3B 3MLSL 4YR6B 1RQBA 2R1MA 1DQLH 4UILH 2E7MA 3B2UC 5KTLA 4JG0H 5GISH 3JYBA 4FLQA 5JOFA 1WA2X 2Y6SC 1CB7B 1TQCC 5GRUL 2Y7MA 3W26A 2WUBH 3AAMA 4KK8D 4UNIA 1GKRA 1AZCA 3FTGA 3BFQG 4OM1L 3C5JA 3GWJA 2ZCHH 5GZNC 5EN2A 4AQ1B 1WAUA 4X6FB 3WEBA 2CIIA 5TAOA 4FD0A 1GPOL 2F53A 4L37B 2OMNA 2OBGA 1QD0A 4GNJA 1ISXA 3QAZC 4P4KA 1YNKH 3DURA 2WXPA 1S7UB 2JJUA 4LRSA 1IB5A 1TJPA 4JG1L 2NY4B 4OIIL 2EXWD 3SOBL 4ZW8A 3F4VA 5DS8A 3HMWH 3KYMB 4F9LC 1TV8A 1LLZA 1HGWA 3MKGA 2WV8A 1WZLA 2ZXWB 1NGQL 1XGPA 1BYAA 2K3TA 1CWVA 3DBPA 4IIDA 4L9YA 2ZXEB 5KYYB 4R53A 1Q0YH 4TQIA 2CO1A 2G97A 4MNQD 2UWFA 2AABH 3ZZQA 4I1PA 1F00I 1F45A 1RUPL 1XLMA 4KTEL 2NX5E 3CC5A 2UXGA 1OKEA 3PSWA 3ABMB 2PP7A 4MDOA 2COVD 5IVXE 3S5ZA 4M6MH 4MB1A 4PR5A 1W5MA 4KHTL 2KZKA 4AY8A 2VDNL 3Q2VA 4OFDA 4IKLA 2PDIA 1BFOA 3MBEA 2J4WL 3Q6GH 5IB3A 2PC8A 3DV6B 1SXBA 3UGUA 4NZFA 5HI3C 1UA6L 4ERGA 4H7ZA 1NC2A 1YTDA 4HIIB 5CR1A 4V15A 4LT9A 5EN3A 2PDFA 3ARDC 3WIHL 3QIWA 1A7OL 2YLAA 2HKHL 4X7TA 1V7NL 1Z6KA 4XC1H 3WS3B 2Z1WA 3OJ2C 2ICWB 1J79A 4MMYA 1JPSH 4AVHA 2E7HA 1QPKA 4Z5RB 4IS6B 2QCDB 3KZPA 4YDIL 1ERNA 5XIMA 4W87A 1UD8A 4UINH 2EDYA 5DU7A 5LXVA 4W8AA 3CQHA 5IGXH 1K4GA 1GPWA 2O0TA 2J7EA 4GVGA 3V52L 1R0MA 5HHOB 3ETBF 1IEWA 2LFGA 1RSFA 1T5XA 3RPBA 3JWNE 4K3DH 3PPEA 2FYVA 4GGBA 1KRAC 4KROD 4BKTC 1EOKA 2R0KL 1Q9OB 1YDOA 1GGYA 5DMNA 4JL2A 4PTWA 1G7VA 1M7IB 5D7HA 1OF2B 1A5OC 4QIUA 5CGTA 1XLDA 3UF9A 4YBLC 3UJJL 2DZWA 3MRCA 5AOLA 3VCNA 3P0GB 1DJQA 4X6DB 3MQTA 1OAYH 3CQJA 2HT3D 5RUBA 3C5QA 2VEGA 3MREB 5AOUA 4D9PA 4AEHL 4BM7A 1TPWA 3N9SA 4U1LB 1A8JH 3L6FA 3OYZA 3I7RA 3DK0A 3FONB 3S8WA 3RGBA 5BWAA 2HSAA 4AC2A 3RAJL 2VR2A 3FVDA 3O3EA 4UQ2B 2PDPA 2OT0A 3RBSA 5HPCA 1L6PA 1RK0B 1IEBB 5DDHB 2H3NA 2VE6B 3GHEL 1Y07A 3QEQA 3HPJA 2XWXA 3SRHA 1P9MC 3TKFA 3HIJA 2P8LA 2VB5A 1BAWA 4CL7A 5HUOA 3UJRA 3DMMA 2PDNA 2FTWA 4P2OD 4U1SA 1IGFL 2DWEB 3VA8A 3HN5A 1YEFL 3EH2A 4G1EA 5T3XD 1WA1X 2ZG3A 5IJVB 3BZFA 1AGDB 4O1EA 1UG9A 3VXMA 3K6FA 1FTXA 2OO6A 1RJQA 3AYTA 3DPBA 3VU1A 1NFIA 4FZ8H 2WXKA 1PSKL 4N9CA 5I1JH 4JPKL 4YXLL 2AJYH 4CCDA 3QP3A 1ZSXA 2NDGA 5E8OA 2FLRT 1MOEA 4DK6A 4PM1A 3MC5A 4NZCA 2FGBA 2CRMA 5ABGA 4WLCA 3FFCE 2QAFA 4JQVC 4XMKH 2DZAA 1N64H 3QCVH 4CN6A 1MQKH 1NIUA 1WWWX 4Y2OA 1FHGA 3UERA 3WKML 4L4PA 5I3IA 4HIJA 1KRCC 2ARJQ 2V33A 1WX0A 2EECA 5AZ1A 3HU7A 2E68A 3DK2A 4JK0D 3D33A 3IIOA 3HHSA 2DKMA 5IF0A 5M95B 3IGSA 5I0YA 3G1RA 4I3GA 5D8JL 3QC5X 5I6MA 4EDXA 2XXMB 4ZFQA 1UA3A 4P5TA 3AU1A 4YVPA 1TA3A 4DJDA 1WV2A 4OLVH 3FB6A 5EZLB 3VG9B 3GHSA 3LEVL 3WUZA 4Y90A 3FNKA 4OZIB 4LP5A 3D85B 5TDNA 1A5CA 1J8HE 3U7YH 3KAOA 2HK0A 4LB8A 4DX3A 3USZA 4FFZL 3O2DL 2TSBA 1EGMA 4KT2A 1E90A 3C2RA 3AU0A 1TTIA 3O8XA 1HHJA 3LEXA 3TEVA 5BOEA 4HISA 3H2CA 1GOGA 2J71A 2Q6WA 1QMLA 1ECEA 5GRVL 1V27A 3PU7A 2GITA 2W0KA 3G0UA 1C1EL 4D8AA 4FFYA 5AC7A 4JPGA 3U79A 3W00A 3SZ8A 4NAEB 4QT5B 4BH7B 1IT8A 4WKFA 2BIPA 4KZEH 3S35H 3LYRA 1EC7A 3LD5A 4KEMA 1A5LC 3WUWA 3LNEA 2VUKA 1MIMH 2B4GA 1UYWH 2E6PA 3CSYA 3I9GH 4BQ3A 2J1KA 1BQGA 1UWQA 4HUXA 1ZVSB 1UB5A 4CADA 1GKQA 4HX1A 1OPOA 2FECI 3PUUA 2X4QB 1XINA 1E5BA 2YD7A 3FQWB 2DQCL 3MLSH 3LRKA 1JGDA 2R9HC 2E27L 1E70M 4XPFL 3SE9H 4Q8UA 5F7LB 3BPOB 4JZOB 3UTSB 2ZSVB 4M3KB 4KDWA 3TQ0A 2MUCA 4AC7C 3KRUA 1R0AH 4ZMOA 1Q0EA 4OJDH 5K1VA 2XZAL 1UC6A 3IDIA 1W9XA 3PZQA 1BVLB 3K30A 5GRUH 4GABA 4DJFD 2E56A 2GL5A 2VW7A 4JIRA 3KVMA 5C9WA 4OM1H 3X3FH 4I3RH 3MRFB 4JN2A 3PG8A 4YSSA 2PXYB 3L3DB 3VXRD 2APTA 1GPOH 1G9HA 3VWJB 1E27A 1A14L 3MPCA 3IKKA 4AE0A 3NL6A 2G9HB 2BNRB 4JG1H 1IWBA 4OIIH 1UOKA 4L4TE 3PXHA 4UFIA 3SOBH 3UVAA 2XQBL 1NMCC 4AD4A 4NO5A 2E9WA 3IJEB 3ZYOA 2YD3A 1KBGL 3HE6C 3FUKA 4HH8A 4GVIA 5AVRB 1KJ2A 3EJZD 2HEJA 2FKPA 4QEEA 4P23D 4UU9B 4QP0A 5L2JB 1QUNA 4WNSA 4ILSA 5TQ2L 3K2UH 4EX4A 3QDHA 2IFFL 1HXMA 5HWMA 4ZTOH 1OM3H 1D6VH 4KTEH 3BT2H 2AKRB 3AXIA 1JWSB 4EZJA 4UI2A 5CEWA 4KHTH 3FY1A 5DRZA 5CLXA 4HEPG 4LCRA 1WNOA 4J3VA 1P1VA 3S3CB 1U58A 3S37L 1CICC 4I9TA 5JA8B 2H0JA 1S7RA 2HYMA 4JLRA 3WMQA 2J1WA 2Q71A 3QWOA 2OYMA 4GXVL 1KTCA 3TC7A 2YCKX 1L0XA 1T04B 4ZYKA 3DNKA 4LBRA 4K9JA 3T0BA 3W73A 5H94B 1QASA 4OE7A 3ZUCA 2X0VA 2HKHH 3CAQA 4P2VA 4LCCA 3TXVA 4DBUA 5BUPA 3DHPA 1JZ2A 4M7ZC 5INCA 1QNIA 5FUOH 1ISVA 5I8OL 3N29A 2EG6A 2ZX9A 4ASTA 5LBSL 4DF9A 4QTFA 3MBXL 3TLRA 4YDIH 3WEMA 1H6UA 2EE6A 3TJEL 5ID1B 2FZ3A 4Q8PA 4Z2KA 4BQBA 5C6TH 4MUPA 1KY7A 3V52H 4OCXL 1O4UA 3MV8B 1GTFA 3UW6A 5C0GA 1HXKA 4NRYA 2WJFA 1IM3D 2DQDL 3V18A 4FQ1H 1TREA 4QR6A 4M5YL 2FEJA 3MXVL 1TYEB 4YHLL 4PJIA 2DPEA 2XV6B 5FKAB 4KI5E 4G70B 2BCKB 3C6EA 4X50A 4G8IB 2Y25A 3G9VA 1KXVC 4KX8A 3KLHC 2NSQA 4CJ1A 4NI3A 2LOEA 2JIWA 4KO9A 3I7QA 1ZHLA 3OKOA 1P7HL 3NQGA 2F1BA 3OLDA 3RVVC 2DJ4A 1AMKA 5CPOA 4X7EC 4XNZB 4B4HA 1F6FB 2F8VA 2ZUXA 3RAJH 4GAYB 1EAQA 3V5HB 5IESL 1GR7A 2GJ6A 1HZKA 3ITLA 3UAAA 3FYOA 1Z0MA 1G43A 2HPIA 4U4MA 3GHEH 2PAJA 4WWKB 2WZ0A 4PAZA 2WO3B 3KBVA 1MY5A 3UTQB 1HQTA 1PXGA 3SDAA 5T1LB 1I0BA 2UY7A 5D1ZA 3UGEA 3KBEA 5F9WB 3VFUA 1HNYA 4J3OD 4LDCA 1VR6A 2XDHA 5IBTH 2NQ5A 5EOQL 3NZRA 2XUWA 4I0PA 2WLYA 4G5DA 4BHYA 1XX1A 1PSKH 3ROLA 3ARSA 5EA9A 2FX7H 4HBCL 1JD9A 2FGWH 1R86A 3MYOA 4BWUA 1A6WH 1JGVL 3OHXA 1QHZA 5DLML 1AGBB 3DI2B 4B9PA 1FWEC 1Q9LB 5KOVC 5C8JA 2WWMC 4ZG1A 2Z3FA 4PJBA 2NYYC 5BZAA 1VKFA 3IRDA 3KL0A 4G7QB 2J1XA 4UQ3A 4OAWA 3SD5A 1LOQA 2AFNA 3ZTNH 1ITUA 1HHIA 1ZT1A 4QGTA 1OCQA 5JXEC 3CIVA 2HG5B 4F58H 3S83A 3EA1A 4W9GC 4ATLA 2VO5A 4K9EC 1RBLA 3NIFF 2XOTA 5BNXD 3NVTA 2NCEA 2D20A 4OJFH 1KBWA 5E9DA 2F58L 2BZDA 4HZLB 2AGKA 2A99A 3SO3C 3DENA 1FFTB 3IGUA 1OTSD 2F8OA 4NNXA 4O1BA 3K0YA 4C91A 5ITFB 3ELFA 1GIGH 3F4CA 2VD9A 3D3VB 3AMDA 4PRNB 2CNCA 5J13C 3CZ8A 1H63A 1B4LA 3LRHA 5SWUA 3IVKA 1E4XI 2JXMB 3GHBL 2R1NA 1G6RA 2EPLX 3VMPA 4E4UA 3MV9A 3M0VA 4JDZB 3SKOA 3O2WH 2E3VA 1W0YT 3DXAD 3R8HA 2CXKA 3QTGA 4MY9A 5EUKB 2DQCH 3LKRB 5FEBA 2HTLD 2CC0A 1F3TA 5FWQA 1GYAA 4XPFH 3BL3A 4FPSA 1SO3A 5DSCB 3AIQA 3RWHA 3LTSA 3GIZL 5J3HC 5J8OA 1NIEA 4W6XB 1WFJA 3LU2A 1KD0A 3W7RA 3NFSL 4F8PA 3L4ZA 1MEHA 2XZAH 4Y9OA 3ZTJH 3QZWB 3BKCH 3BEVA 1TELA 2C9PA 3W24A 5DJDA 4XNXL 3BSMA 4CSZA 2G5BB 2FD6L 2X4SB 3ANVA 3MXWH 1EEYB 1S5VA 1AQHA 4ALDA 3ZDYB 2CDEB 1YC8A 3DX1A 5LAPA 2P3ZA 4B2DD 1A14H 5AW3B 3OG4B 3KPTA 2XQBH 4HFWB 1DWHM 3LNHA 3HC0B 1XH3A 4APXA 5GJPA 4CQDA 5FESA 3V5KA 2GTWB 2ESVA 2FTAA 3C6LB 1Y0LB 3G2GA 2X1IA 4HK0A 3IMVA 4HJIA 4PJHE 1HXYA 1QVBA 3L0KA 1OQFA 2F38A 3S97C 1IEIA 1XSOA 3BO8A 5TQ2H 1NPNA 3P82A 4ZTPL 2IFFH 1Q1JL 3THAA 4GS7B 5F0PB 2W4XA 2ZCZA 4LQFL 5H35A 5I5RA 5A8QA 5TGBB 4CU6A 1A6UL 3NABH 4WJ8A 4LDEB 3MJ9A 3UEQA 3H4HA 2APVA 4NZ5A 3ZDWA 1GVIA 5IFTA 3C87A 1H61A 2M83A 3M0XA 3GSUA 3WF4A 2DQGL 5HY9A 5IVXA 5C0BE 1QHOA 4Z78A 4IIQC 1H8LA 1N2RA 5DCDA 1DWAM 1N8WA 4GXVH 2QKIA 3EWBX 5EU9A 2DH2A 2NXYB 1ZLPA 4R3SA 2EPNA 4OF3A 3DERA 2OSYA 3WZ0E 3QI9B 3M1CA 3V6FB 1DJNA 4XZNX 4Z7QB 4G6AC 4JTGA 3KOXA 2C1HA 4LU5L 2WLKA 1XAKA 5D1QA 2FL5A 4BSWB 3K7UA 4H6RA 4QE4A 4YIQB 3H6AA 4ZMPA 4F8NA 3NXFA 3DDMA 3MBXH 4IIZA 5CBAB 5ECUA 4XRCB 1P4IH 1EYEA 4S3EA 4PMVA 3TJEH 3P93A 3DZ1A 1NCAL 4L4TB 2EEAA 3SPVB 5E6UB 2P5EE 1NJ9A 5M17A 1BHGA 1K1DA 2WLNA 3RWCB 4AYMC 1Z0NA 3MTXA 4OCXH 3D2UD 3KYOB 1S7XA 2NXIA 5I9QC 4D7PA 4JANA 3ZYIA 4CU8A 1KV5A 3SDOA 2VOTA 5CGQA 1X39A 2V38A 2W9DH 1TO3A 3MXVH 3SJVD 4TUUA 4YDLB 1AD9A 3AFBA 2BY1A 4Y5YB 4N68A 1RFDL 4LV4A 3QFGA 4PLKD 3UJEA 1S5NA 1Z69A 5B1JA 5JU6A 2R1XA 4ONGL 2WXOA 3WLIA 4B4FA 1A6AA 5I17B 4DAFA 2BINA 1XGTA 4IRZL 4MD0B 4YCOA 1PZ2A 4MJZA 3U46A 1FBIL 3UBXA 4O12A 3HG0A 4F3FB 1JXGA 1YQVL 4WV1C 5HBFA 4KWOA 4P2AA 1FO0L 4LARL 2LLLA 4AGOA 4AD1A 3QZ6A 5IESH 3DTXB 5FJUA 3L3IB 3SY0B 1FP9A 2R0ZH 3L5XL 3LDBB 2ZRWA 3MDUA 5D6CA 2JV6A 3W75A 3HMXH 2J6VA 2WAHA 8XIMA 2K7PA 4OGYH 1KQZA 4KY1L 4BCZA 4G8AC 2DW5A 1AQFA 3DG6A 1VB9A 3QZWG 4POZD 5AG8A 3E3QE 1XMEB 1I1AB 1D9KC 1P1XA 4B50A 2JEPA 4R4NC 3P4MA 4HBCH 4WFEE 3WLWC 1WFIA 2HH0L 3HR5A 4XD4A 5K93A 5EIIA 2HRWA 4KKAC 3QNFA 1XUUA 1F3DJ 2Q6ZA 3A5FA 1CGVA 3KAAA 1JGVH 3HZVA 2FSEB 4OBRA 3ABXA 5DD0L 3G22A 2ED8A 3AT9A 4PMJA 2H26A 3K6DA 1EV2E 2QPXA 3CFEA 1L5GA 1N0LB 3NIFB 5D9OA 1A6VL 1TKKA 3P77B 1EGJH 3NZPA 4YVUA 1S39A 3UZ5A 3EWXA 4NF7A 2UY3A 2Y6ZA 3LIZL 4UFHA 1BEYL 1JPDX 4BFRA 2VLMD 3LNPA 3B0PA 4FX7A 3FS9A 3RZCB 5E5UB 3KBSA 4XVUD 1T03H 4KNTA 1L6GA 4AIZA 5HD8C 1B6DA 3QV9A 1CYWA 2G4JA 4A2MA 2JKJA 3L2NA 5ENLA 4OOZA 5L88H 3DRTA 3LLFA 3X12A 1YMHA 4YDKL 1A50A 1P84J 4K9EH 3FU7B 2Y69B 2UBPC 2HA1A 4LBSA 3KCJA 4JDEB 5CEXA 4A66A 1G67A 1XMWA 2I16A 4G1MB 4HCRH 1P0DA 1VZGA 3GHBH 2QCEA 4Q8BA 5IG7B 3NNTA 2C5DC 4YHML 1TR7A 2C71A 2X8RA 2EYRA 4MB4A 2GQHA 3WTWA 2P8CA 2X4NA 4WJG3 5ICYB 1M05B 3TBSB 2XTKA 4Q0XH 4B9JA 3FB5B 3UZZA 3HLKA 3PHQB 4F2UA 2R1WB 5G1MA 1VF8A 3P0VH 1FWWA 3GIZH 1JXKA 4BXSV 2J5WA 4JYFA 2UXFA 3DH7A 1EZLA 4JFXA 2BBFA 4IDLA 3CQ0A 5C0FB 3CB3A 3NFSH 2SEBA 3H26A 2BG5A 4E2VA 2WWKT 4JFHD 4TSAL 3EMQA 1R9XA 2CJSA 1XF1A 4RZKA 1JXFA 4ELMA 1RZFL 1W1VA 3PJLA 1VBRA 3N55A 4IM4A 3KGUA 1OALA 2EIZA 2YZ8A 4FQXD 1HOCA 3MOBH 4YTRA 4S2SA 3APFA 1U3HD 5HYSA 2WZMA 5EV7A 4QD2E 1ME9A 4TQTA 3F7KA 1AQDB 3FGCA 2ILLA 2P80A 1QK0A 3RX5A 4ACTA 3WG7B 3VNJA 1W8SA 4X4XA 3UNTA 2FQEA 4NT6A 4ZTPH 1T0OA 3TROA 1TX0A 2PETA 3CDYA 2GFTA 1SJBA 3ETTA 4CNSA 3AS3A 1W3NA 5HHMD 4LW7A 3CXHJ 2RBLA 4XZBA 3CH1B 1LO5A 4U7MA 4M8RA 4EKJA 4FKEA 1DFXA 2C9SA 2DQGH 3O8AA 4TVUA 2J7GA 3CVBA 5E9XA 1YN6B 3H0TB 4YLBA 3B4YA 3Q7JA 2Q3OA 2BOBB 5I77A 2BSBA 2QGBA 2Q87A 5J11C 5C08B 3PAZA 4NUPA 5DI8A 1S78C 1ZANL 4AJVA 5C0CB 3PP3H 2XZCH 1TG8A 3WJMB 5IFJB 1KM4A 4OM0L 1MCWW 2OELA 4ODWB 4WDWA 5DT1H 4NRZA 4ZW5A 1P5BA 3B8DA 3CK0L 2Q8LA 3QGKC 2VI0A 5HNUA 3MROA 1LUCA 2GUOB 4KDTA 5GS0D 1WUFA 4UIOA 1H4PA 3L9RB 2R29L 1NLDH 3WGUB 1FZOA 1VFBB 2IBZX 2ICWJ 3ARED 2H6PA 1AODA 4HIHB 3ZJAA 4KXCA 3TT3L 4RMRA 1E5AA 4LCUA 4Q9QL 2FB4L 1SF3A 3KPRD 3FCBA 1KIUA 4UMCA 2D7QA 1TQCB 3S42A 4AC1X 3WQ8A 3C8KB 4GSRA 3HBQA 2A3AA 3VYPA 4GFIA 1LWJA 2AJZB 2G3MA 1UKOA 3ELAT 1RFDH 1XR9A 3MP5A 2ZUMA 2VC7A 4BZ1A 5LAXB 3LVTA 1EAOA 4IRZH 1ZT7B 4YSCA 5E6ID 1UD4A 3V0GA 1FBIH 1TEFA 2FNBA 3N1AA 4EIUA 3RN6A 4GP8B 1RK7A 1YQVH 2VO8A 4N8VB 4HU3A 2WM0A 4D0CB 3TBBA 2X9YA 3BV4A 4LARH 4N0CC 4PJXB 15C8L 4WFGD 2PLCA 5GGSB 4L1TA 3VKBA 3AT8A 4BGLA 5CEZL 4NAFA 1JGUH 1T4KB 4Y5XA 7A3HA 4V2CB 2EVGA 2BVPB 5HPMB 4LBEB 3L1GA 2EXOA 4DP2X 3N2XA 4MM1A 5I2IB 4GIRA 4K15A 3BDXA 3TA3D 1XLAA 2KKQA 3O4LE 3CPGA 3T2PA 5A40E 1RZGA 4NDMA 2QELA 3ZLGA 4MJ5A 3WD3A 1AH4A 1JRHH 1S7VA 2W9LA 1S9XB 4IGSA 4LCQA 3T2NL 2HH0H 4EVZA 3I68A 3JRKA 1AJ0A 1E3FA 1KDIA 1DVUA 1FGNL 5I6OA 4L8CB 4YVXA 5KG9A 3JTTB 1BKSA 3ARDB 4JTHA 2FX8L 1ZE3C 2NY2D 3SEPA 4HA4A 3BGFC 2VDRH 1OAZL 3W9EB 3LB0A 2IAND 1S5HA 3FT4A 5HULA 4ADSA 4U6XB 3CX2A 4R2GD 1JF1B 3FTZA 4Q8MA 3E5BA 5I1DA 2F5BL 6PAZA 1E55A 4DF1A 2I7GA 4UTAA 2OX5B 3BHBA 1OSZA 2O5YL 3EYQC 3OKKA 5HHOE 5CSRA 5AC5A 5IOBA 5E1HB 4AQOA 4D9RE 4GG8A 3BFWA 2PYED 3TZVD 1C5CL 2EABA 2P8BA 4K3EH 4WVXA 4W84A 2ADAA 1DVFA 1FLRH 4FEMA 3HRZC 1A7RH 2QVFB 4NQED 4KBPA 2AEOA 2WB5A 1A0DA 1BD2B 1GVOA 2CJ3A 2JTDA 2NR6C 5JIKA 3QJOA 3NQDA 4JCLA 4LSPL 3UWVA 1QFUL 2UXTA 4X6DE 2Q2EB 3GG1A 4TLTA 4QNPE 3LTYA 2DQXA 4YN3A 2VXSL 1TLMA 2YCJA 4M81A 3GSRB 4BINA 3VOCA 4GSDL 4M8VA 3RO6A 4YBLB 2VDML 5DD3H 3P5ZA 4E0CA 3SGDH 3E9AA 5E24E 4MAZA 4UMAA 1JAKA 3BAEH 2AHIA 2C9AA 4Z76B 4PLJD 2OKMA 2GQAA 4JQAA 3A6CL 2BS8A 2PWVA 4YSRA 2NVDA 1U8OB 5AALA 2WTRA 2GVYA 1EHXA 3PGCA 4FOMA 1AC0A 3S46A 3TFBA 4ABUA 2CRIA 1R4XA 2JKIS 2R7EB 4O1DA 3L4WA 4XAYA 2R6OA 5GXBB 5J1AA 4XT1C 3MP4A 3ZDZE 1NCOA 2BNUB 1NCUA 3OZKA 4PLNC 5AHEA 2NNCA 3W3OA 4U1HB 3BVNB 1R5IA 2QSCL 2FO4B 3NCJL 3ILDA 4XN1A 4RMUA 3EGSB 4NM8L 1UCBH 1D5ZB 4TVDA 4JFEA 1G4RA 2DYSB 5TF1L 2O4MA 3X1NA 1WE5A 4IMKC 4Y19D 1EIXA 3TJIA 1NEUA 5DRXA 2R15A 1JVLA 4BELD 3IETB 5DYOA 2GGEA 3RDTA 1F97A 3SRDA 3T0EC 4MWAC 4AL8C 2MRYA 2KDGA 3WXWH 4N8VG 2DI8A 1XF2A 2WBXA 4PIRF 3EOTH 4Q4IA 4OZIE 5KZCD 4X5WB 2XGBA 4IRSD 1KM6A 2OO0A 2NLJA 4G80A 1RLBA 4XAWL 1AGCB 3V7PA 3NGJA 2CD0A 3ATAA 3MRMB 3VM5A 4AL8L 1PF3A 3UG3A 2I24N 3HBZA 2R8SL 1TZZA 3CVHA 3OKNA 3ARTA 3KBFA 5JUEL 4TOYH 3ZVHA 2ZC8A 3JBG7 4X6DF 4MOZA 2XJLA 4QNPF 2ATSA 3W3BA 2CKBA 3BGMB 5FF7A 1BX2B 3J27A 2DS4A 1AHWC 1DHKA 2AERT 3NQ8A 2ACSA 3N85L 2PP9A 4EN3A 3IU4H 1J0HA 4Y16D 4NP4H 1ZPTA 4MS8D 3DLQR 3MV7A 5FYJD 4YDMA 4G1NA 4FMKA 3GXMA 4P2QD 3GNXA 4JHAL 3DVGB 6A3HA 1LYXA 3QNZA 4OSUL 4WI2A 3UTSE 3D50A 2AI0H 3WLNA 1OCZB 3KS0H 4PG9B 1W0MA 2A6LA 2JKEA 1KR1A 1FP5A 3QQ4A 4GIYA 2V67A 4UF7C 1THAA 3VXSA 2Z91A 3IKCB 1NLBL 3VD7A 4G9DA 4B9ZA 1TV7A 2V69A 4M93C 4TUFA 3GFZA 4GW5A 1PNCA 5FK9B 3A4JA 3VAVA 3EYOA 3ZDZF 5F1OB 1PSCA 2PTTA 3ZWTA 1RA0A 1Q72H 3MX0A 4JTCA 2XWCA 4BQ8A 3RLHA 1DBKL 1IKNC 5DVMA 5E2UL 4Q9QH 4K8HA 1E1EA 1EJOL 3E6FA 3OAYK 2ALWA 4LLDB 4S1DD 3FU9A 4LLVA 1QTPA 2G5RA 1TTJA 2VDLL 4R5TA 4X6CA 3AXLA 3R7QA 4A3QA 3LG3A 2Q7YB 1Q9WA 4ICXA 2H2PD 3LEYH 1LP6A 1QFHA 1E6XM 2BVUA 1DQMH 1ACYH 3ZSSA 5C0IA 3SHSA 3VXPA 2ZKWA 2OTPA 1DBML 2IXQB 1U8CB 2APFA 3EAKA 4NAQA 4OZIF 3U5UA 5K39A 1JDFA 2CO3A 3L13A 1P4LA 3ZZ1A 3TTQA 3HE6B 3QPEA 3B1TA 2DDXA 3IRSA 1JIBA 3BMXA 5CEZH 1XI3A 3V5CA 3NQCA 5T9CE 3TFCA 4ZQKA 3AM8C 4MHHI 5H4ZA 2VLJD 5CWSA 3LCHA 2IOIA 5K1NA 2W65B 4QUOA 2XG5A 1T7YA 4F1SA 5T1KA 1HWGB 4QCIB 4QRNA 1TOXA 2Z00A 3DETC 2VUNA 1IC1A 1CICB 4LAUA 1EHLH 2BSCA 3L45A 4JPSA 3C60C 1WCBB 1TU2A 2OX1A 4OJCA 1R5VA 5ICUA 2WWCA 1JGEB 1EL3A 4JCWA 3BD5A 4DKDC 2EUXA 4M4RA 4YMZA 4PRPD 1ORSB 3BJLA 4JN1L 4I8YA 2QR0A 1CXFA 4M7ZB 4IP7A 4PCKA 4HNVA 4LAQL 2XV3A 3SDDA 3FDKA 4YHZL 3A3YB 2J6XA 5FL0A 2AK4A 2DQWA 5PCYA 1ZWIA 1CUOA 1ZE3H 3MV8E 5LNEA 3L4YA 5E8NB 2O5YH 3OX8B 4JTKA 5JLZB 3QMTA 1WXZA 5I5JA 1REIA 3MHZA 3WJZA 5EOTA 4KVNL 2EO1A 1WXYA 1Z1WA 5AENA 2AMUA 4LLAA 4QHUA 4QRSA 1HWWA 2WLJA 4I4WA 3QXVA 4WY7L 4RRPG 4YXGA 1E5UI 1CI1A 4L4LA 4BI7A 3G9AB 2P53A 1QFUH 4AXNA 4KJWD 4KRPC 2M2DA 5D93C 1ES0A 2VXSH 3STCA 2JF1A 1TF4A 3FCSA 1GL4B 3CPLB 3V0JA 3KYKL 3K2IA 2CO7B 1F90L 4ACZB 1TO4A 3PWNA 1REQB 4MNKA 1SDDB 1K4CA 3O4LB 4RA3A 2X6CA 2J8UE 2OKTA 4PRIB 3TIEA 2X1TA 3P30L 5KYXA 3S3SA 3O6YX 3BIAX 1R75A 2ZTJA 2YJQA 4XHQA 5IW6B 1YPFA 1MRAA 2GK0A 2Z34A 1B0WA 3PS6A 3TTOA 3ZTJG 5LGZA 3LN5A 5A7EA 2C1OA 1OANA 4UZUA 3ORJA 4TPRH 3HKZA 1HZHH 1XLIA 1A9BB 1KGXA 1DIDA 3PL6A 5F7NC 4A21A 2V9UA 3DCPA 3CN3A 4KH9A 1QPNA 2WHJA 3S3JA 3VB8A 3NRFA 4Q3MA 4OR1A 2ZCLL 4TUJA 3FF7A 4JFTA 3WQDA 5HNNA 4IBWA 3VFVA 1QU4A 1B90A 3IAGC 5JIHA 3PXJA 2OQJA 3GHRA 5L8JB 4DQOL 1R8LA 4Q4MA 4NM8H 2UVFA 2HFFA 3GHPA 4U1IA 5TF1H 2Z27A 2CMRL 3FQNA 5HJXA 3OVPA 3MSDA 1RUSA 4WEBH 5I1CL 5F89A 2BX5A 4ZO6A 3WK1A 4TLSA 1WZAA 5DZ9A 3STFA 3KFTA 1N6QL 5AVYB 1CFQB 3MBWB 1FIGL 2BGQA 2NQ3A 3N41B 3CV7A 4EZMA 5AG9A 1E8ZA 3LKOA 1SLUA 3C5ZB 4F24A 3BW3A 4WO4D 2QADC 4Q2ZB 3TSDA 5AYBA 1AR1B 4FFVC 1A4MA 3RFZA 3P2TA 4A6YA 2HFEB 1WV7T 3KE0A 1NICA 3QZPA 2IEPA 3HZMA 1DORA 1DDHB 4PWIA 1A3WA 5EB9A 3VM7A 4UIMA 1XR8B 3QVQA 4G6FB 1JVNA 5EC1B 1CG9B 2J21A 5KJRL 1F7BA 4AUUA 1SFSA 3E12A 3BW9B 5J9PA 1N9PA 1H0DB 2B31A 4G9FB 3D3VE 3SO3B 3AG3B 1V79A 2WVSA 3MJWA 4AIOA 2J9XA 5ADPL 3NJNA 4FX5A 1E9PB 5JO5A 2VABA 1HKIA 3ZQWA 1QP1A 1MUMA 1NBYA 4HWBA 3UTTA 3QY7A 3TEXA 2J8UF 3HPAA 5DCBA 1U5HA 1G5GA 3VGDA 3PNWA 5JXAL 2C7UA 3TESA 2QGYA 5DMGC 3ZDZB 1BXCA 4PH6A 3DHDA 4NQDD 2ISVA 2EBNA 3TWBA 5CP7A 4LPXA 2VSDA 3FO0L 4ADTA 4RWYH 2WXHA 4Z2LA 2A38A 2EXYD 1MEIA 3TN0C 1PL9A 3ZOAA 1JCKA 3LPGA 4FTVD 5AFAA 4XD6A 3SY5A 1JUFB 1XCFA 5FM5M 5AW6B 2FJUB 4MAYC 4L0ZA 3SKMA 5I1GH 5DMYA 4OOUA 1DBKH 2WMKA 5E2UH 3L1FA 4AZGA 1EJOH 4M6OH 2WM1A 3ZDYE 3H7LA 2GBVA 1P84K 1XIGA 3UJIL 4M4PA 3U2SA 3ENEA 4OF0A 3VYNA 4DO5A 3F6IA 4AQ1A 1XF4A 1KC5H 1N19A 5ISZB 3CZGA 4ZTXA 4L37A 3B2VL 2YRLA 1XKYA 1OSPL 1PTDA 4PJ5D 1GVFA 1S7UA 4IRJD 1MPAL 4NJIA 1ZIAA 1PLAA 2EDKA 1QRND 4PMUA 5E08L 3KYMA 1PYMA 3M16A 4HZ6A 2VENA 3WI9A 4O52A 1VPYA 4NX0A 5ABTA 1CF1A 3TP4A 5E4IA 4FB7A 2KLRA 2GYSA 3CL7A 4QQ3A 4D6DA 3V4VA 2XU2A 4K5LA 3T71A 5KYYA 5F9JB 4UT7H 25C8H 2ZRYA 3QQNA 2QUTA 3AYRA 1MH5A 4F37K 5MEND 4A8IA 3TYFB 3P3YA 4AITA 3DFTA 1E7VA 1IWPA 5AVWB 5EH1A 3IU3A 3U8GA 2IXVA 5DWUL 4UM9B 2A0LD 1YMMB 2X2JA 3N5AA 1H7NA 2G5UA 2IAMC 1GCFA 4V1DD 2WHVA 1QSFA 4UB0L 4XVSL 5I30L 2BW5A 2BX7A 5E00A 1F3JA 4M61B 3CFBB 1PDKA 4IIQB 3AZSA 3ZE2F 4X8JA 4R85A 1KF9B 4X8XA 2VZUA 3NOEA 4Z7QE 4LANA 3B83A 1RUQL 5C0DA 1UR9A 4PP2B 4RX4A 5LJYH 1F6LL 4IKNA 4WUUD 3T2LA 4ZNEE 2A3HA 3ZFHA 2IH8A 5EL1A 4FHJA 1TETL 5I66B 4LASL 1J4EA 1QFPA 1E6JL 3VWKA 4PGCB 1N5YL 1H5BB 3AQUA 1HTYA 4XH2B 2ICWA 3R18A 1VH7A 3QULB 4F7KA 2ZOLA 4HOMA 4GLRI 5D7JC 1EC8A 4FABL 3L3KB 2Z0BA 1DJGA 5GVJA 5I3GA 1E28A 1XBDA 3NMEA 3DARA 4GW4A 3KW3A 1WZKA 4NO0D 4J3TA 1ZFJA 1NGQH 2DQTL 3BLLA 1TRDA 3CXHK 3RX4A 4GQGA 4RWHA 3ZDYF 2OP4L 1BV8A 2Z31B 4KVNH 3EHBD 1O6TA 1TZIB 3SYOA 5I5IA 3NJVA 4GAGL 2JJVA 1VLIA 4I18C 1UZGA 3R1ZA 5LCVL 4V1XA 5I9QB 1RUPH 1JULA 4GY7A 4JDVB 2VXUL 3XIMA 2XWZA 4F2TA 1RKRA 2VM3A 4XVOA 1F2XK 2L7EA 1Q9OA 1BIHA 2ZOXA 4IM8A 2VDNH 1M7IA 3FN0L 1OF2A 5F1VA 4RBPH 3TWCL 4BQ9A 2QPSA 5K9KB 5IJKA 2K4AA 2J4WH 3F05A 1FWBC 2D23A 3RI5F 4GFTB 5AOZA 3MJYA 3QJXA 3MREA 1IEHA 1UA6H 3TONA 1Y18B 4WTXA 4U1LA 2MNJB 3QDMD 2HLAB 5J1SC 3KBMA 3FONA 4ZXBA 3W81A 3PUCA 1J9YA 4HHPA 4UQ2A 1VGKA 3QIUD 5T1JA 3WIHH 2XWEA 4A8NA 2CWXA 1A7OH 1WLHA 2PD5A 3FB8A 3MNWA 1RK0A 1KM3A 2MFNA 5DDHA 2VE6A 1V7NH 4YH6A 5F1KC 5J6HB 4UT6L 1NY1A 4QY8B 3BN9D 2EE9A 4ANWA 3NBNA 5HHNB 4JO1L 3L1OL 1UZHA 1SZRA 5GGQL 3EZJB 2ZCLH 2IMNA 1QVOB 1BQCA 5C0ND 3ATYA 4RGNC 1NDVA 4Z7QF 1HIZA 1D9KB 3GHUA 2GTZB 4IHOB 2VDRB 1FC2D 2X4UB 4YL2A 3OJDB 3QWQB 1KTDA 1BQHA 1FL6A 3P4OA 3NIFE 4Z3HA 1E15A 3GY1A 5I1CH 1ZT4B 3JZUA 1JZEA 1B5TA 2R0KH 2XYLA 3DIPA 2XIQA 1N6QH 4I9WE 5DEGB 1FIGH 4AYEC 3B0UX 3MRPA 5BV7C 2EVHA 4CLMA 3UJJH 3C2VA 4FC3E 1GG0A 4AEHH 4XAKD 3T9WA 1OT2A 3LM3A 2Y89A 4XO8A 2NNAB 4GH3A 4UTTA 4KRNA 1BZ9A 3PZ9A 3D85A 5BV7L 1OFPA 2J8UB 3MR9B 3OTRA 1WFNA 5AVNA 1S1RA 2GDUA 1UPPA 3BTNA 1RULL 4XWGL 4AQEB 3W0WA 4PJCA 4XXCC 4MWAE 1AZRA 5AOKA 1BBJB 1EJFA 1SY6L 1IGFH 4MKSA 4KKBD 3GMNB 1YEFH 4NAEA 4QT5A 1BEXA 2V0TA 1KGCE 2VEFA 1D7KA 3H53A 2DLHA 3TDFA 1TYJA 1S5IL 3KWTA 4YHYC 2APSA 1YQ2A 2CLFA 1G7HA 2YKLL 3M07A 5JXAH 5FF2A 4JPKH 4YXLH 1KFJA 2VC5A 5DMKB 3LOTA 3WQPA 1ZVSA 4H1LH 2OEMA 3WS6A 2X4QA 1B4RA 1S7TB 1DJHA 5I3HA 1SJMA 4KKPA 1UYQA 2I56A 3WKMH 5CG7A 1KB9J 2GJZB 4G5ZL 1XTMA 2YPLD 3UTSA 1UR0A 2ZSVA 2XH7A 4F1ZA 2E59A 2VIRA 3UAJD 3WDIA 1V6XA 3PABB 4J7RA 3BVJA 2K78A 3GSOB 1HSAA 5LNSA 5D8JH 2NV2A 2MSPA 2RH9A 4P5SA 3LEVH 4IOFC 3TBTB 4HJEA 5KWYC 5D4YA 4HK7A 3Q9PA 3UJIH 5I3FA 3BWAB 3MRFA 3QDJA 1EBHA 2PXYA 3L3DA 3G6LA 3HZYA 5MP6L 1IR2A 4FFZH 3O2DH 1YTKA 3G6AB 3VWJA 3ZQXA 3HO8A 2OR2A 1OSPH 3N2BA 3D0AA 2EDNA 1ZBVA 3IAQA 4M8UA 1RLCL 2CHDA 2G9HA 2BNRA 3AFLA 3M64A 4R7DA 1C1EH 1NP0A 5E08H 4OHQA 1EHAA 4UFLA 3WOVA 3OR6A 4KKNA 2EDDA 2ZRUA 3KHQA 1KTBA 1KTNA 4EAEA 1XIFA 2BY3A 4UM8A 3RM4A 3TIDA 4NRXA 3Q58A 3WEOA 3ZE2B 3SURA 1A5MC 1LXMA 3APMA 2HS6A 4AQZA 1G1CA 3ATZA 3CSFA 3GJEA 5E56A 3NO5A 7ENLA 2AKRA 4LS0A 1ZZMA 5AW4B 1E51A 3P8IA 5DJ2A 2E27H 3OPUA 3T5WA 4ZMWA 5DFVD 4UB0H 4F15C 3R0MA 4XVSH 3C08L 5I30H 3M17B 2B0MA 3QARA 5A2IH 5C08E 1W56A 5DTFB 4Y2WA 2GB2A 2XN1A 5C0CE 3FXGA 2VLLA 1FA4A 3QCUL 2EGZA 3QPQD 1XP3A 1U21A 5J11B 2QS8A 5TBOA 4PSRA 1HCVA 5H94A 4LESA 3RMJA 5E6SB 2G3XA 1E6JH 2OR9L 1PS3A 1L9QA 1CFNB 3CGTA 5ID0A 1N5YH 1CENA 2DZEA 4A3RA 2C16A 4APQA 1H9VA 1XSKA 3ID7A 3PAVA 1D2KA 2PF0A 3GBDA 2VDKL 1U8LB 3V4UL 5ID1A 1KBGH 4B5SA 4JNYA 4X5XB 3EGJA 2DQTH 1GRWA 2VFHA 3SZ6A 3DIVA 2OP4H 5GJNA 1WIUA 3RWJB 2R2EB 3P9LB 3CHCA 1DOSA 3TNMB 1QO3B 1XB6A 2R2BA 1JTPA 4PJ8A 4EI6B 2OWWA 3NJFA 3MUZ1 1W0VA 4D0BA 2XZ9A 3FTYA 3RZWA 1RZKL 4UDTA 4JTRA 2ZYFA 1V5JA 2CNYA 2H32A 4WEUD 4UIKL 1RQEA 1F18A 2BCKA 3SYPA 3FN0H 3IMRA 5ESQA 2NX5A 4MA8L 3TWCH 4G8IA 2WQVA 3S37H 4AXWA 4BFAA 1BZOA 5EWIL 5ABZA 3ZTEA 5AKTA 4PJXE 3QIBC 1LM1A 5LGJB 4PE8A 1XSJA 5CBEB 1WBZA 1QSZA 4XMWA 4O2CA 2YA2A 4HU2A 1I1YB 1Y6KR 4HLJA 2V3DA 1UC4A 3EYVA 4GAYA 3H8NA 3HQ1A 4NEHB 4J1UB 3V5HA 3ULUD 1F1GA 4J28A 4FIQA 3LNGA 1O9ZA 1V6WA 3WL9B 1YAIA 3LBMA 3PDOA 2CXEA 4KO5A 3BQUC 1RJRA 4UT6H 5I8OH 5LBSH 1HO1A 2AP2A 1A5FL 1TCDA 2NY3D 5T1LA 3VA2C 3H3BC 3SECA 1S5TA 1NINA 5GGQH 4AM0B 1UZ1A 3WXVL 2W5FA 2PC4A 1GZ1A 2JELL 3PHOB 1PD0A 1FNAA 1MREL 1FX6A 1AZUA 5LNWA 4YBQC 1JCNA 3O6AA 2QKFA 5IUSA 4KJPD 2DQDH 4QF1B 4AMWA 3WQOA 4X4YA 4M5YH 3S6TA 1AGBA 4YHLH 4S1FA 3TR9A 1C08B 5BVJB 4FF7A 4F8LA 1C3FA 2EIJB 1T0MB 4AAJA 3IMSA 4NHUB 3BGFB 5D7IF 3J2PA 5KYWA 3G1VA 2YO3A 3S0CA 3B3DA 2ADGB 3ORWA 3MO1B 4NENA 1M9SA 1QNRA 1CS6A 2PR4L 3H1ZA 5J0BA 3VMNA 1WC7B 3TBVA 1T83A 3QUZA 3SDCD 1BD2E 5KBPA 4NC1C 5BV7H 4QXIA 4JEGB 3HRZB 1A4BA 1B0GA 3H2MA 1S3HA 3WQEA 1KTJA 2V37A 5CSGA 4AZBA 3IE4A 2E1WA 1IL1A 2VWEC 1XZWA 1LJYA 4L8BB 4YE4L 1NSNL 3ITOA 4U6HA 1YDPB 2YW4A 3TO4C 1KCKA 3TAOA 1NAML 4PJXF 1G4SA 4TMBA 5EOQH 3QBUA 2ENQA 1S5IH 4MKMA 2JXMA 4FXJA 2WC4A 3JUGA 1CNVA 1NMAL 3U6WA 4AMXA 3QRBA 1DIKA 2QDWA 5J56B 1FNEB 4NKMB 5EUKA 5I09A 5DLMH 5I76A 4OTXL 5HSFA 2FEDC 2CBPA 3F5WB 3FO1B 5DSCA 2OTUA 2D7OA 3QUYC 2JKNA 4FYSA 3FFCA 2V9DA 1T20B 5I0WA 3B9NA 4QJ1A 4HJ0D 2QCMA 2PTDA 4Q7IA 3URAA 4U33A 3INUL 1NH6A 3G5XB