1ODUA

Crystal structure of thermotoga maritima alpha-fucosidase in complex with fucose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
441
structure length
422
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEDLPGYKWEFTRGIGLSFGYNRNEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 148
structure length 422
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1oduA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1oduA01
3WD3A 2A3CA 2BHUA 2AOSA 3DC0A 3BSGA 3A47A 1W3KA 2OWWA 2FDMA 5ABHA 1DP0A 5A6KA 4PMRA 3AFBA 1QHOA 2XVNA 3OBAA 1CWYA 5IFTA 1JZ7A 3VX0A 6TAAA 4KRUA 3B9DA 3WMCA 1FFQA 3ZT7A 2DIJA 2VZVA 5E6ZA 2GJXB 5CPTA 2VRQA 1WPCA 3ARVA 5D9OA 1CNVA 1QWUA 3GNPA 4WLCA 3WNKA 4BF7A 3WD1A 2CPUA 5ECUA 1EOKA 1MW0A 1M03A 2VX4A 4P8XA 1XYFA 3EDEA 5CZKA 3AHTA 4CD4A 4S3JA 3F5LA 3N9KA 2WLZA 4IISA 5CSUA 3VO0A 4JFTA 1AMYA 4GIAA 2J62A 3G6LA 1NQ6A 1PZ3A 1MFVA 4HOWA 1CYGA 2VCCA 1GPFA 1UKQA 4J3UA 3KWXA 1SMDA 3ZT6A 3CUHA 2DSUA 3AI0A 2VURA 1UD3A 5ABFB 2JALA 1OM0A 3AMKA 4FLRA 5CGTA 1MFUA 1E6XM 2EXOA 4MNLA 4B15A 5ABGA 3FHQA 4F79A 3VIPA 3GH5A 5DMYA 1X1NA 1GQJA 3W37A 4M24A 3WN6A 2BVDA 4PYSA 5I79A 2F7OA 1FH9A 1SR0A 2UY4A 2WHMA 2QHAA 1D3CA 5A8NA 2G3JA 2VQTA 3AZSA 4BCEA 3BAIA 4LYQA 2XIIA 3D4ZA 5HDRA 2QLYA 1TFVA 4W85A 1AVAA 3UERA 3E1F1 3LPPA 3UG3A 3RJYA 3EMQA 1UD8A 3N15A 1B3YA 4PMOA 1WDSA 1PIFA 4ATLA 3ARSA 1K6AA 3L2MA 3VU2A 4BS0A 1KTBA 5FD0A 3SCTA 4EKJA 3DYPA 3T0AA 1UR8A 4DUVA 1JFXA 3SIMA 2XPKA 4EK7A 4J3VA 3VD5A 4XUYA 2VCAA 3EDDA 1XSIA 5M17A 2NT1A 5M3WA 1MW3A 2E40A 5GNXA 4PMDA 4UFIA 1WKYA 3UR7A 4QCEA 1XH2A 4AD3A 2XVGA 1F4AA 2XVLA 1GVIA 3VIIA 1SYTA 1W9VA 4YHEA 1EDQA 3M07A 2A3AA 1GHSA 5DF0A 3O6AA 3BLBA 4JAWA 3AS3A 3WF4A 3MKKA 4NZFA 3O2LA 2DT1A 4Z2IA 4UQEA 4M82A 2X09A 4MJ4A 2TAAA 3LXAA 1O7AA 2WZIA 4U3CA 4M81A 3ZSSA 1C91A 5JBEA 1DTUA 1VFUA 2G3IA 3CUIA 4D6CA 3BUDA 1C92A 1E4MM 3CMJA 3HN3A 5BCAA 1GCYA 3DX0A 3VSVA 4JL1A 4PMVA 2EPOA 1H41A 3CHCA 1CBGA 2CXGA 3AYSA 3BUIA 2PB1A 2X05A 1OWQA 1B3XA 1L0PA 4MNKA 1CGYA 1FH8A 2ZXBA 4U5KA 1JFHA 1UWSA 4ZE4A 1H1NA 1E4NA 2Y8VA 4U5IA 3ARPA 2ZX9A 4WKAA 5CSYA 3VTRA 4QLLA 4QCFA 4RE3A 1VJSA 1W3LA 3EJRA 3L2LA 4C7GA 1FP9A 1V08A 4NI3A 4XZWA 1DHKA 4X0NA 1HJVA 2WC7A 4QP0A 4FNUA 9CGTA 2GUYA 2WPGA 1UD2A 3K8KA 4FNQA 8CGTA 4OGZA 4D6JA 5A69A 1JL8A 1QPKA 1UR2A 3PZGA 4E4PA 2VX5A 1JD7A 4TTGA 3JUGA 1V6XA 1KXQA 2AAAA 4PTMA 3WL1A 4D6DA 3SURA 2WMFA 4CD7A 4DWSA 2CIPA 4GI6A 4AMWA 4TX6A 3ZT5A 2G41A 2OYKA 2CERA 3KE0A 5BRQA 2W4XA 1QNOA 2WMKA 2BVYA 2IGTA 1V0NA 4UTFA 2RGMA 1ISZA 3MUAA 2BHYA 2J8FA 4AD5A 2ALWA 2PI6A 4CD5A 4JCLA 1KWKA 2WK2A 4UZUA 5HBFA 1OT1A 3S5YA 1VFFA 4NF7A 5IHSA 2D22A 1UR1A 2VO5A 4D6IA 4C7DA 4JFSA 1C8QA 1CPUA 1PPIA 3TV8A 1TVNA 5HXMA 3WH5A 1BYBA 2F18A 1XC6A 3WY3A 4B9YA 1UKPA 4WSJA 3G6MA 1RPKA 3AJ7A 5A3HA 1JF5A 4MB3A 4GQRA 5D9PA 5EFFA 2YL9A 5AYIA 4EAMA 4GXPA 2CKSA 4BQ2A 2WVVB 1QI5A 3IJ9A 4W88A 2DIEA 1HNYA 4QDMA 3IK2A 2Y2WA 1QNRA 1R8LA 3FHAA 1V0MA 1E9LA 4CGTA 3AOFA 1DWFM 3T2PA 4PEEA 1QNSA 2FHBA 3VGBA 1NP0A 4PCSA 1XYZA 3WQ4A 1H3GA 4YN5A 1TQTA 5HPOA 2DGAA 4J28A 1FA2A 3WH7A 3MUIA 3GTNA 1UR9A 1C8YA 3ZJ7A 5JBDA 4M80A 4AD2A 3N17A 1W9XA 5CG0A 2VZUA 3ZR6A 1WB0A 4RL3A 4H7VA 2VR4A 1W32A 1YQ2A 2VQUA 2FE0A 3NDZA 4TVCA 5IFPA 3W24A 2A3HA 1K9FA 3WF2A 5HPCA 4XX6A 3GM8A 2CITA 3SUSA 4UOZA 4JFVA 1W1PA 3BLKA 3AXIA 3NJ3A 3WEZA 1B30A 4TX8A 4IUGA 2WMIA 1BAGA 1J0IA 3MU7A 3QOKA 5BWFA 5I78A 5E0CA 4WKFA 2XJ7A 3IAPA 5GNZA 3CBWA 3QHNA 2D0HA 2XGBA 1NOUA 4CVWA 2BS9A 2X2IA 1E1EA 3POHA 1BPLB 3AICA 3LRLA 4FNRA 2V3DA 3S6TA 1XCXA 5LA2A 1E6NA 4F9DA 5AC5A 4MNMA 1KBKA 3BUPA 2BY1A 1WZLA 4AIOA 1TA3B 2Z1SA 3M6DA 4YPJA 5I24A 5FL0A 3S5ZA 3DECA 4H04A 3VD9A 3ARQA 1C3FA 1WZMA 3N11A 1W1VA 3PTKA 3VMNA 2WZEA 1PX4A 2PWFA 3KLLA 1BF2A 4JFUA 1JAKA 1C90A 1F4HA 3QHMA 3L4WA 3N12A 1KQYA 1BVNP 4ACZA 3MSDA 4J7RA 3LPGA 1R47A 1CDGA 4A3HA 4B9ZA 1BFNA 4IM4A 2GK1B 2CKRA 2V5CA 3MMUA 2XN2A 2VUYA 1OD0A 3PHAA 2UY3A 2O9PA 3WD2A 4HU8A 4UFJA 3FNDA 2ZUVA 3GBEA 4P7QA 1HKIA 4H8UA 1E6PA 4NRRA 2VVNA 1M01A 3K4AA 1LL6A 2FGZA 4KGJA 5AY7A 4PTWA 4W8LA 6CGTA 2WKLA 1R34A 1E5JA 1EXPA 1BSIA 4MAVA 1JYVA 3WEMA 4OUEA 1V6UA 5E9AA 4J3XA 1GOWA 1MXDA 1W9PA 1GHRA 1JG9A 1X6NA 2GDUA 1XH0A 2X8RA 2WMJA 3PZ9A 3VGFA 3FN9A 3VNYA 4ACYA 5E0FA 2VOTA 3WF1A 3A21A 1MQQA 1UYQA 1PJ9A 2QMJA 4XV0A 2ZWYA 1ZBCA 3ALFA 1QI3A 4XB3A 3IJ7A 2W62A 1XRVA 2G4FA 3AS0A 5D4YA 1ISWA 3WMBA 3GXIA 3A24A 5EB8A 3CZEA 3AMCA 1EHNA 3WH6A 1BVZA 4OZOA 1DWIM 5DEZA 4R27A 3BVWA 1Q6CA 3F4VA 3D3AA 2WB5A 2V5DA 1KXTA 1WZKA 1PX3A 4W5UA 4D72A 5I3DA 2Y4SA 3ZQ9A 1WDRA 4QLKA 2XTKA 2CBUA 2VNCA 1QHZA 1L8NA 2X1IA 3AHXA 1XHGA 4V27A 2D0GA 3VIOA 3EMCA 4D1JA 1Q6DA 1HP5A 2D1ZA 1ZL1A 2DH2A 4B3LA 1I1XA 2W61A 1HIZA 4IPLA 4J27A 1NH6A 4RE2A 3IGUA 3T0BA 3DDFA 2WBKA 4GO8A 1H0GA 2C8NA 4HA1A 1X6LA 1FOBA 1QX1A 5FIPA 5BYWA 1LQ0A 4XZBA 4CUCA 1RH9A 1PIGA 1AQ0A 3BMVA 5KEZA 1OBAA 2OW7A 2E0PA 2E8ZA 4N0RA 1W1TA 1ODZA 1SFSA 1FFRA 3KL0A 2J7EA 1KGWA 1QW8A 5HNNA 1HT6A 1VFMA 4H8VA 5I0DA 1KR1A 4AW7A 1HJQA 1J9YA 4WJXA 1E6RA 4K68A 5LYRA 1ZBKA 1LF1A 1VEPA 2BHZA 3UG4A 3TTOA 3QHOA 1J0KA 1AQMA 4PSRA 4MB1A 2WXDM 4WK9A 2VRKA 1V0KA 2J77A 2YA2A 5IXEA 1M53A 4DO6A 3SCQA 4LYRA 3ALGA 4PMYA 4X0VA 3I3EA 4FLSA 1KQZA 3DYOA 2OYLA 2BNJA 4HMCA 4AY1A 4UNIA 3WNPA 1KFWA 3ZIZA 1VEOA 3EBVA 4PUDA 5LA0A 1CXHA 3UESA 3WNOA 3PZMA 2YL8A 5D8WA 5AC4A 4J3SA 1J0YA 4S3KA 1ZBVA 4E8CA 4WIWA 1TQVA 2WHLA 1JZ4A 1QI4A 1JZ5A 2WMGA 1B3VA 4F9JA 3J7HA 4HZ8A 2YKKA 3VDHA 1GQLA 4GZJA 4OOUA 1W3HA 1W1YA 1UWQA 2W91A 2WMHA 3NIYA 3UR8A 4JCMA 3DDGA 3CGTA 3RMEA 5A8PA 1CGTA 1H0IA 2DQXA 2CHOA 5EMYA 4PMXA 1VENA 3SCNA 1G0CA 1KGUA 4PMNA 1GQIA 1MW1A 2J7BA 4PMUA 3CO4A 1ZJAA 1IZKA 4KGLA 4LQ1A 1V0LA 3VIGA 1UQYA 2PWEA 1JIBA 3VPLA 2BFGA 1FHDA 2F2HA 2F7QA 2YLAA 3W29A 5JUVA 1GORA 3CIVA 1CEOA 1TQWA 1ITXA 4UQBA 1MXGA 3WUGA 2QF8A 1QI2A 4HPGA 4IPNB 4HA3A 3BC9A 1E4IA 3CHEA 1HVXA 3EDFA 3PZUA 1FHLA 1HF6A 2O9OA 4TVDA 3IJ8A 2VVSA 5A95A 4AZBA 3WQVA 3MMWA 2DSWA 4PMZA 2XVPA 2WCGA 2A3BA 3OLIA 4JFWA 1PX8A 2W63A 3A4AA 3CZNA 2O9RA 2OSWA 4HTYA 3TTYA 1EA9C 2WBGA 2WW5A 3FY1A 4ZXOA 4MJ2A 1TMQA 1UD6A 5CPSA 2ZUNA 3KZSA 2JIWA 2YOCA 1BYDA 1TG7A 1XSJA 4M8UA 3ZMRA 2VX7A 2VJXA 1UWTA 3ARWA 4WF7A 1CLXA 3NSMA 7TAAA 1V02A 1WP6A 4JKKA 4AD4A 2D3NA 3WBAA 1UA3A 4AMXA 4D6EA 4MAZA 4MDOA 5I23A 1JZ2A 1KXVA 5I6SA 2EPKX 1EGZA 1CIUA 3NYDA 1UWIA 1UQZA 1V6VA 2J8GA 2E4TA 1GONA 2YA1A 2F61A 3VMOA 1UH2A 1XCWA 4MPKA 1JYWA 4QFUA 1OCQA 3OA5A 4L4PA 3CHFA 3CUGA 4JIEA 4LGXA 1TUXA 5A6SA 1CGWA 3MV11 3HG4A 7A3HA 2EO7A 3WH9A 3CV5A 4D6FA 1H4PA 1E40A 4FNTA 5CPQA 5BXRA 3BCDA 2QPUA 4AZCB 3VM5A 4URIA 3VDCA 3SUTA 1KBBA 1UH4A 3W27A 1CXIA 5ABEA 3BVVA 1WZAA 2FYVA 3BAKA 4M56A 4UQCA 3SCWA 3VKKA 1I75A 1PZ2A 2GJXA 1AQHA 3AIQA 1LL4A 1JI2A 4JHZA 3CZSA 4KWUA 5A6BA 1R7AA 2PWDA 3WQ6A 4FLOA 2DT3A 1ITCA 4GO9A 2W67A 3BVXA 3NSNA 3HJEA 3U7BA 1J01A 3II1A 2XFYA 1I1WA 4KMQA 3ZJ6A 4W7VA 4M29A 4MADA 5A2CA 3PZVA 4LPCA 4M1RA 5EBAA 4W8BA 1MVYA 1BYCA 2J7GA 5I5RA 3OZOA 4EE9A 1K9DA 1UZ4A 4P7NA 2J47A 3WDQA 3WQ8A 2VRJA 5ABFA 4CCDA 1OB0A 8A3HA 1QBBA 4PN2A 1VFOA 4W93A 2E9MA 2ZX6A 3WDJA 2WM0A 1YHTA 2XFFA 3A23A 1GW1A 3THDA 1VF8A 2WSPA 1FP8A 2ZOXA 3THCA 2EADA 3AXXA 3L4TA 4ATDA 2ZX7A 1ODUA 1CZ1A 1HJUA 2UY2A 4DUWA 3GXNA 2ZXQA 4TOQA 1QNPA 1QNQA 1TCMA 3PZIA 5A1AA 1NARA 1W9DM 3K8MA 4AC1X 1BGGA 1B31A 4PUEA 1M7XA 1S46A 1B1YA 3GXTA 3CUJA 2EAEA 3A4XA 3EJTA 1H09A 3WDPP 2ZUSA 4NXKA 2XN1A 1G9HA 5D9MA 2WYSA 4UCFA 2OSYA 3CZ8A 2YDRA 4FF5A 1V6YA 1VBRA 3U7VA 2F8QA 4CKQA 3GDBA 1O7DC 5M03A 2XWEA 1NWRA 1UWRA 4FLQA 2GDVA 4C7FA 1VIWA 3RCNA 4AWEA 3OG2A 3ZR5A 1GOMA 3TOPA 1BG4A 3SEPA 3WH8A 2AMGA 4AZGA 4KRTA 1H2JA 1LWHA 2XGIA 3W28A 4A4AA 2DT0A 2XWDA 1UKOA 4P8VA 1BLIA 2JIEA 3N1AA 3W6LA 2V3EA 3L4UA 4TVUA 4AZ6A 3MV01 3SCVA 3W6MA 3K1DA 1R75A 3OGVA 3VGEA 5KZ6A 3KL5A 4F8XA 5A8QA 2WVTA 3MANA 3AMLA 3EMZA 1US3A 3EYPA 1XD0A 1WDPA 1GJUA 3LRMA 4U31A 4H8HA 4HPHA 2GJPA 2PC8A 1LJYA 1OGBA 1BG9A 1G5AA 4BQ4A 4U2YA 2E9LA 3LMYA 4FK9A 3HG2A 3AYRA 5E70A 3AHYA 1UZ1A 2YL5A 5CGMA 2JFEX 4BQ3A 2XM2A 3W82A 1EH9A 3ZM8A 4P7OA 3QGVA 1C8XA 1ISYA 1K9TA 3A5VA 4AMCA 2EACA 4AD1A 2WKGA 3VILA 2DT2A 1JF6A 4BA0A 1ZS2A 3AISA 4LYPA 1SZNA 1E15A 3BGAA 2WWCA 1OSEA 4Z2KA 1US2A 3SCUA 1GNXA 3U5YA 2BXYA 2ZWZA 3EDKA 1HL9A 3TTSA 2CBVA 2WCAA 3RDKA 3L4YA 1Q6FA 3D4YA 3T0DA 5A6JA 3B8SA 4GI9A 3SCRA 1HKJA 4A3YA 1R46A 1W91A 1D2KA 1XH1A 1Q6GA 1NWUA 2FH6A 4DWSD 1E73M 4MNJA 3VGHA 1NWSA 2FHCA 1GVYA 5F7UA 3SUUA 4E8DA 1JNEA 5A6MA 3OB8A 2Y5EA 2XN0A 1OINA 2ESCA 1QW9A 4UOJA 3BUBA 2JEQA 4Z2JA 1KB3A 2V3FA 4PTXA 1BYAA 1W2PA 3CZLA 3T2OA 4HA4A 3AS2A 3PZQA 4YHGA 3OLGA 2PWHA 1CECA 2ZXAA 3MS8A 1CENA 3DX3A 4UZSA 3EJSA 2J78A 3CC1A 4W86A 3AIVA 3RIKA 3WQ5A 1E56A 2D73A 2B31A 3KL3A 3EDJA 3F5JA 3LXBA 3T2QA 4DM2A 4AIEA 5A94A 3RM4A 1BGAA 3LXCA 4W5ZA 1K9EA 1UA7A 3WY2A 2ZXDA 3WF3A 3DX1A 3GBDA 3NUKA 1E70M 3FW6A 1P6WA 2J75A 3WUEA 2CEQA 3F5KA 2X2YA 2EJ1A 1JYNA 1UKSA 3H54A 2HISA 3VD3A 3D51A 3L4ZA 4ZXLA 2XIBA 1HJWA 1HP4A 2Y8KA 4J3WA 3B9EA 2OWXA 4FMVA 1CLVA 4UFMA 2WVVA 2Y24A 1UD4A 3TTQA 2W5FA 2WHJA 3WNLA 2JF6A 1EDGA 3RM8A 1KCKA 3B9AA 3T08A 4AEFA 4UFLA 3WFZA 1GQKA 2WNWA 1JAEA 2YL6A 3UETA 3OLDA 3AHVA 4JHOA 2WANA 5I77A 2V3GA 3QR3A 1V3MA 4UFKA 5IDIA 2ZUTA 4HMEA 5E6YA 3GXFA 1PBGA 1QI0A 2A3EA 3RILA 5C71A 4DWSB 2J7CA 1EHAA 1HXKA 3OIHA 1U30A 4U3AA 3GYCA 1MYRA 1CXFA 4Q22A 1QVBA 2DH3A 4UFHA 3VIKA 4D1IA 1C7SA 4CCEA 1GOIA 4Z2HA 1J0ZA 2YBUA 2FH8A 1E6QM 1T0OA 2QPSA 2UY5A 1QWNA 2ZX5A 3VSTA 2DPEA 3VIHA 3CZKA 1E0XA 5BROA 3AROA 3VGGA 5CXPA 5CLWA 1DWAM 3W38A 2NT0A 3GNOA 4W8AA 2VR5A 1XSKA 2WC4A 1KTCA 2PBOA 3DHUA 1UD5A 1W2VA 4GZIA 1E4LA 5LA1A 1E0VA 4X9YA 1JZ6A 3RO8A 2WVSA 3HG5A 2JE8A 1JDCA 2BY0A 2X2JA 2BY2A 3BUQA 4RE4A 3WF0A 3CUFA 4ZENA 1TA3A 1O6IA 3OZPA 4P7LA 3BCFA 2XUCA 2NSXA 3ZO9A 4P8UA 1B0IA 3BXWA 1HXJA 3NSXA 1H11A 1GOQA 3PZOA 1LG1A 1FH7A 4GINA 7CGTA 2CETA 1J18A 1HJXA 2VZTA 1J12A 3ARYA 1H49A 3ECQA 2VMFA 3VSUA 3TP4A 2YJQA 3ARZA 3PN8A 1EOMA 5E1QA 4BZYA 4OOZA 3EJQA 4OBSA 2VX6A 3RM9A 4QLJA 4AXNA 3MO4A 1JZ3A 2WC3A 4U33A 2CESA 1E6SM 1CGUA 4PBGA 5FL1A 5M5DA 2ZUMA 2FGLA 4MB5A 2VT0A 2GK1A 2D20A 2QV4A 1HWWA 5A2AA 1ESWA 2XSBA 3LPFA 2UWFA 1HVQA 4V2XA 3LPOA 1R85A 3A3HA 3AZTA 2D3LA 1B3WA 2XHYA 2W66A 3PBGA 3GXMA 4GQQA 4ML4A 2J25A 4HZ7A 4CU6A 3AHZA 3EJUA 5BXPA 2BV9A 2Q8XA 3D5HA 1DWJM 3SUWA 4QAWA 2E9BA 4NX0A 2F7RA 5CJ5A 3MI6A 1JD9A 2WCSA 3WENA 1LG2A 2CNCA 1BHGA 1ISVA 2CCRA 3VD7A 1VJZA 5FCZA 2D24A 1TQUA 5A6LA 1OIFA 4UQ9A 3VM7A 2WMIB 2VZSA 3IAQA 4MDPA 4TTUA 3VGDA 5CQ1A 1WAWA 4H2CA 1Z32X 2CHNA 1E5NA 4W7WA 3DYMA 2EABA 1ZB5A 2ZUUA 2DSKA 3AIEA 2FHFA 1OT2A 3KLKA 1UHVA 4CVUA 2F1BA 2GSJA 5GPRA 1BTCA 1A3HA 5EFDA 1JZ8A 3ZOAA 3BMWA 3GXPA 1QOXA 4BQ5A 1JDAA 2DDXA 2BVTA 1E72M 4V28A 5A8OA 2C0HA 1OD8A 1HKKA 4ZE5A 1RD6A 2Z1KA 3AIWA 1JGIA 3VOCA 4W89A 3SCSA 2ZUWA 4NXSA 2WLYA 2W92A 1B2YA 3WIJA 3FXYA 3BLPX 4P7RA 1V3LA 1Y7VA 5FOOA 1E3XA 4AZIA 1ZJBA 4L4OA 2D0FA 3WMSA 2WAGA 3W26A 4ACZB 4CU8A 2ZICA 4DO5A 3BSHA 1ZBWA 3VDAA 3AIRA 4W84A 1NP2A 1PEZA 2YFOA 4OIFA 3WDRA 3CZGA 2VC9A 3N04A 3OGRA 4D71A 3MMDA 3NDYA 3ZSTA 2HVMA 1NM9A 2YDSA 1OGGA 1CTNA 3WY1A 3DX2A 3CHDA 1E1FA 1RP8A 1KGXA 2IXVA 2DSZA 4NSBA 1R86A 4UQDA 2J7FA 1VBUA 2MANA 1V3HA 2PF0A 3APGA 2XFRA 4JL2A 4ATWA 1QBAA 3BAJA 4OKDA 2J7HA 2WWDA 1B3ZA 3VINA 5GNYA 4NZJA 1UUQA 1Q4NX 2XYLA 4HMDA 3AZRA 1BQCA 1B90A 1KR0A 3I3BA 3NCOA 1CGXA 1E6ZA 1E3ZA 3MSGA 4JKLA 3T09A 5DFAA 3WQWA 4LX4A 1TZ7A 4D6HA 3AIBA 5IHRA 1GOOA 1W9BM 4DM1A 1B9ZA 2YLLA 4R5EA 5C70A 1HTYA 5A2BA 3W0KA 4JKMA 3VNZA 4MB4A 1MQRA 3VIMA 5GQBA 3BAXA 3FAXA 1IZJA 3W53A 4J3TA 2NW0A 5E09A 4H41A 1TQSA 1V3KA 1EO7A 5BXTA 6A3HA 4CN6A 3SCPA 3VX1A 3FAWA 2J74A 1EO5A 3IANA 4AIUA 5JIPA 2X0YA 4AZ5A 2GJRA 2C7FA 4DWSC 1V3JA 2O9TA 5DO8A 1LWJA 3U57A 3RJXA 4GPNA 3HU7A 3VIJA 3WSUA 1V03A 3VIFA 3K8LA 2YIHA 2EPNA 1CXKA 1J0HA 4LXFA 2CYGA 2XG9A 4KH2A 3WEOA 5BXSA 3AIUA 5HOSA 1E71M 1E0WA 1V02E 3PTQA 4CCCA 2VCBA 3EJPA 2WHKA 1KCLA 2CBIA 1MWOA 1WNOA 1QHPA 3QOMA 3ZJKA 4DUXA 4HU0A 1G94A 3GH7A 4D6GA 3U5UA 2OSXA 2DSVA 3WNNA 3KEHA 3L4XA 4Z2LA 3A4WA 1W3JA 1J0JA 3DX4A 3GXDA 1EDTA 3WUFA 4HZ6A 2VI0A 4W87A 3O9NA 4HP5A 4AEEA 4PMQA 3VVGA 1RP9A 2YDQA 3UG5A 1KXHA 2G8ZA 1JNDA 2WZHA 1EIBA 4OJYA 2D23A 1NOFA 1UASA 1GJWA 1LLOA 4Z2GA 2F1AA 3WELA 3GZAA 1V6WA 1MW2A 1VB9A 3GH4A 4Y7EA 2XM1A 2PBGA 4WSKA 3PZTA 5A6AA 4OBRA 4EANA 1OGSA 2VTFA 3OLEA 3M46A 2QMKA 3UCQA 2IUZA 3CH9A 3SCOA 4UQAA 3CZJA 1GOKA 3CLWA 2EPMX 2CBJA 4GI8A 4B16A 3CTTA 1UH3A 1JYXA 1CXLA 3BAWA 2G3MA 3VD4A 1R7OA 3POCA 4AYSA 1PS3A 5CLTA 1G1YA 3H53A 2D2OA 2E8YA 1J10A 1TE1A 3BVTA 3RPMA 1UR0A 1U33A 1XGZA 3AXHA 1ZU8A 4UR9A 1CGVA 5I2UA 2ZE0A 4CD8A 5DT7A 3D52A 1ISXA 4PSPA 3WNMA 3ARRA 1G01A 3DHPA 1WDQA 4HOXA 5DT5A 1JI1A 1XV8A 2EQDA 3HZ3A 4CN4A 4PTVA 4AD0A 2X0HA 5TD4A 1VEMA 4P8WA 4GKLA 2JEPA 1WE5A 5BRPA 1GZJA 1WCGA 3L4VA 2IXUA 4U2ZA 3BVUA 2GVYA 1GUVA 3A6OA 2E3ZA 3AS1A 3VDBA 4B3KA 1MQPA 3D50A 1R33A 2EBNA 5JBFA 2OWCA 2OLHA 4PCTA 1A47A 4WKHA 3HMCA 1HN1A 1IV8A 3ARTA 1D7FA 1HJSA 2V38A 1JDDA 4E2OA 2J79A 1HL8A 1EQCA 3VMPA 4W7UA 1DEDA 2XSAA 1LL7A 4MTVA 3LRKA 4N42A 3GNRA 3WD4A 2ZX8A 3PTMA 1DWGM 3N18A 1E43A 2OYMA 3WBEA 1TVPA 1Q6EA 3W81A 3K46A 4FNPA 4AZHA 1JXJA 5D9NA 4CN1A 3MUZ1 4AZCA 4NRSA 2JF7A 5C8BB 1M04A 2O92A 4AZ7A 1DWHM 1HX0A 2PWGA 3ARXA 2BY3A 3VUPA 1NOWA 3WKZA 5A6BD 1WO2A 4DO4A 3HG3A 3WY4A 1SMAA 1HKMA 1PAMA 1JXKA 1C93A 2YBTA 4FNSA 1IT0A 3AMDA 1UOKA 2YFNA 1ECEA 4PRWA 2ZIDA 3WDHA 1C7TA 1EQPA 1CXEA 3W4RA 3A22A 1H5VA 1W9UA 2VL4A 2X2HA 1J11A 4HOZA 1U2YA 1NWTA 3WL0A 4Q7NA 3WDIA 1E55A 2J4GA 3PZNA 1XD1A 4CD6A 3CPUA 2EPLX 2XVKA 3AQUA 1R87A 2YA0A 3WD0A 2BXZA 1TR1A 3SUVA 3W25A 3S2CA 2VZOA 3CMGA 2J7DA 1N82A 4AISA 2WSKA 3TA9A 2WVUA 4TUFA 3WUBA 4CU7A 2EEXA 4TXEA 4F66A 1VRXA 3BH4A 2GFTA 1VAHA 1UR4A 3UEQA 5JIWA 3TONA 3K4DA 2DEPA 3WFLA 4GZEA 5FKYA 3AMGA 3OGSA 5AYBA 3BAYA 3H55A 4NZCA 5D8ZA 3ZJ8A 5A8MA 3LX9A 2F7PA 1UG6A 4ZFMA 2RGLA 3MUY1 3I3DA 2G3NA 1UKTA 1UWUA 1V3IA 3N13A 2OW6A 4ZEPA 1KWGA 3ARUA 3M7SA 4JZ5A 4UOQA 1OIMA 4AYGA
chains in the Genus database with same CATH superfamily
2WLLA 2HTKD 5KUKA 2R7EB 4I5BA 4AY8A 2EE0A 2E7DA 4PMRA 3OBAA 2G3XA 1NCCH 3ZT7A 4ZZKA 3EJJX 3B2UC 4HJEA 1FGNL 3OPZH 5K4ZA 1B9KA 1KD0A 1AD4A 1TF4A 4D0BB 1ZLSH 4FYTA 4AJYV 3JW7A 4Z7AA 2WJEA 1JRHH 2E9WA 1V7NL 3TT3H 1FKXA 2VCCA 2UZXA 1EQWA 5ABFB 4E41A 1IWAA 2AQQA 3MCLL 5DT1H 1X1NA 4F8QA 5AB1A 3QY6A 3AAMA 1U8QB 3QH2A 4LVBA 4JFFB 2QDGA 1FH9A 1N64L 3MLYL 3FYYA 3S88H 4Q9QH 3PULA 1T0NA 1L6WA 4LPVA 5LN8A 4RKAA 1XGTA 2AXGB 1A25A 4FRWA 4A05A 1CUOA 1R38A 3VB9A 1LO4L 5EL1A 4J3VA 4P2RB 2ZUQB 3T3ME 4XN5A 2Q86A 4N9BA 4Y1TA 1PFCA 4JYFA 4UFIA 3DRTB 4JFZL 4QCEA 4NO0A 2PF8A 5F3FA 2NY6C 4W9TA 1GVIA 3L8QA 5IV2A 4JKWA 4GRLA 5TPWL 4FXJA 1BZQK 2W6RA 3MODH 4LHUD 2WXFA 1ZLPA 4C6JA 2X09A 1GG0A 3GHBL 2TAAA 1OTUC 2CRZA 4X7SH 5KTLA 3T1FB 1VFUA 2G3IA 3BUDA 4TQHA 2CHXA 2B3RA 4MAYC 3DX6A 4OQ1A 1N10A 3HQ1A 3C52A 5EFIB 2G30A 5ALBL 1WBXB 3U0WL 4UTWC 3C08H 2Q6WB 4KEMA 3IJYA 1SLVA 4DPAX 4ZMAT 4X9GA 4XOEA 3MYPA 4U5IA 5ES4B 4YFLF 4C7GA 4I0PA 4AU0A 2VLKB 1SJHA 5F4WA 2Q09A 4XTRC 4O0QA 4DLFA 1H5BA 2WZTA 4BF5A 3D4CA 1CT5A 1AHKA 1V6XA 4L7ZA 5KVEH 5EC2A 5EIVA 3C8KA 1Z3GH 4RGNC 4TX6A 1HH6B 3RZCA 3ZT5A 2G41A 4OJDH 1BZ7B 3KE0A 4POYA 2MHAB 3ZK0A 1BWKA 3UPRA 3WO8A 4G8FA 3QIBB 4G7EB 2EVGA 1AZRA 4RUBA 1OAKH 2ALWA 3GMNA 3VACA 4JCLA 1VFFA 3DI1A 4NF7A 4HCRL 4AC2A 3TCTA 4IRZL 1OE2A 3INUL 4JFSA 4FA3A 2IDSA 4OVUA 4B9YA 3WLWC 1FO0A 2F54D 4YHNB 3O4OC 1CDUA 1GVEA 3E3HA 2XZAL 5EFFA 1XLDA 4U6XA 2FQGA 1UYWL 4ALAL 4XP5L 4A1RA 5FCSH 4GG6E 1HGYA 3IETA 1HXMA 3NWRA 1B4LA 6PAZA 4PEEA 3RU8X 1XYZA 1LE9B 5JA9A 3WQ4A 2WYHA 2RDWA 4O52A 3LU2A 3V18A 3AG3B 3ZJ7A 5JBDA 4YSTA 4GMSH 2CMRL 2B1OA 4UBPC 1NCIA 4XAYA 4GAGL 2HVJB 4TVCA 1A7NL 5I8KH 5LCVH 4XPTH 1W1PA 3QDJD 2A74C 2WMIA 2Y7GA 5FSEC 2VDPL 3UBHA 1NDVA 3QOKA 2Q0ZX 3QPZA 2J5WA 4K3DH 1FHNA 5D1XD 5GNZA 1AJ0A 2XN9E 5B39A 3HOJA 1G4PA 5IEKB 1QATA 3SN6N 3KG5A 1XCXA 5LA2A 4LARH 5IJKA 2A3TA 4JO2L 3QUML 1K8IB 3DECA 4P5TC 1C3FA 4H20H 1PX4A 4Z3HA 5F72S 3L5IA 4JGUA 3S1XA 1JHKL 3EYVB 2VLLA 2VELA 3M0IA 3C5QA 3DN5A 4HIPA 4G8AC 4IM4A 3OU8A 3VXSB 5E2TH 4K3ZA 1CFVH 3VFPA 1YPZA 3N4EA 4ISVB 2O4QA 2EYRB 4CBZA 3U3HA 1G87A 1URLA 4Z7VA 2IQAA 3NEOA 1EXPA 2Q7YB 2NY3C 2HMID 4MAVA 3RUGB 3S4SB 4UDUA 1UVQB 3NESA 1W5PA 1NCOA 2GB2A 2DFAA 3VNYA 4WFGE 1INEL 3NQ2A 3F64A 4BDVB 4NCC2 5EMLA 4F2BA 4XCFH 1FWTA 3VI3B 5TIMA 3PV7A 1MRDL 2YGQA 4LNVA 4TMCA 4TULH 4NT6A 1NDWA 5G1YA 3I10A 3WJSA 3MBEB 2FJUB 1UZGA 4FXRA 3NIDF 4PWJA 3CNKA 1WD9A 3MV8B 3FFCE 3CLMA 3ZE2B 4S1QH 3NPUA 1M71A 5D7LB 4EN2A 5TK2A 4CNNA 4Z7WE 3BGMB 3GSXA 1JDFA 3CDGA 2D0GA 2WMPB 4HIBA 3VIOA 1HP5A 3CSTA 3ARFA 5E00A 2GY7B 4HK3N 3KXFB 4PHXA 3CFIC 1UQSB 3EJZC 4PU2A 4GO8A 3KVMA 1IBYA 4QHKI 3VI4E 4Z77B 4MJHA 1X9UA 5E8NA 3T2LA 1AZUA 3L9RB 2PP0A 5JW3H 2AV7B 3DHFA 1OXYA 5BZDB 3BPLC 4FQCL 2BS8A 3SQOL 2BLEA 4DYEA 3WFEH 1Z3RA 2XNAA 4PJIF 4XP6L 4BM7A 4ZI8A 3RGVA 5DHDA 1FRBA 2WHVA 1A4AA 3WBWA 1I1AC 4PSRA 3KOZA 15C8L 2CIIA 3SQMA 3PFMA 4ABQA 3WIHA 5EF2A 4OGAD 2VB5A 2CBOA 4P2OA 1AQKL 3RIAK 4FLSA 1X98A 3L3JA 1U93B 4WHDA 4UNIA 1S9YB 1T80A 3PL6C 4LIQH 4QEHA 4YL2A 5HGGS 2CBMA 4F0HA 5CD5D 5I73B 2WP3T 3SRDA 3L3GA 1X4YA 4Z8FL 1GQLA 2IPTL 5HGBB 1DIEA 4ERAA 5KVGL 4L1BA 2PCPA 1JEZA 4RMBA 3M0XA 1U3ZA 2HFGH 4QQUA 1PU0A 4U05A 4HYVA 3N2TA 5E0KA 3OZYA 3ZDWA 3PWIA 1JGMA 1KV5A 2OFQA 4KV5F 4JTGA 2NX5E 4UAOC 4HPGA 4NBZB 4H4NA 4A7TA 2AKMA 3L68A 3NFPB 3IMTA 2DI8A 4F2UA 3R5EA 5E5UB 4L4VA 2Y7EA 3P93A 4R7VA 1O6TA 4X4XB 1QP1A 3P0VH 4JO5A 2D69A 1RQ5A 3NPVA 3JWDC 1KN2H 1XLCA 1MG3C 2QHRL 1I8AA 1DBML 1RUML 4DP4X 1X7SA 4UWQB 7REQB 3WLBA 2JIWA 3QEHB 4PJ8B 4HS3A 4M7TA 1MIEH 5H2BA 4X8GA 2OLDA 3HI1B 4AMXA 3E2SA 5GRYA 2GBUA 4F8NA 3QIWD 4NQUA 2QCNA 4PW9A 1VFBA 1F4YL 5TE7L 1AS8A 4LVFA 3UPCA 1QMLA 5FX3A 1HFUA 2EEFA 1XCWA 3ISYA 3BZGA 3MJ9A 5I3KA 4TYUA 2C9XA 3PG2A 4JIEA 4HKJA 1TUXA 4WY7H 1MUMA 1OAZL 4FNTA 4NWUL 2QBWA 4UTKA 3M47A 2R7EA 3MTRA 5GGVH 4J23A 1GYWA 1BFTA 3CWGA 4JPGA 2OJZH 1NPUA 1NQKA 3KJ6L 1KM0A 3S2AA 4V1XA 5CKSA 2IXQB 1MAJA 1JV2A 3DGCR 5KBPA 2AGTA 3C6SB 3Q13A 4AUYA 3WQ8A 5ABFA 1V77A 2YAMA 1P4UA 4XE5B 3BVNB 5G2NA 3FXGA 1OK4A 2YZ1A 2ZX6A 1U8QA 4RRPG 4JFFA 1H51A 4DIXA 2BSED 2VN4A 5DDHB 3GIZL 4FFTA 2UY2A 5I1CL 3DURB 1QNPA 4I5RA 3UBXG 4AG4L 2NVDA 3EYSL 4KIRA 3LN5B 3WIIH 3CH1B 1E7UA 4LAQL 1SPQA 2HWZH 1XBZA 5I1GL 4P2RA 2VDKH 4IBQA 2NYYC 4H1LG 4X99A 4Q74A 1UUSA 2ADYA 1QTWA 3CHVA 2QAPA 1XL4A 3D06A 4NHUB 2DYSB 3BMXA 2KL6A 3P3UA 3MV01 4O1AA 2ABBA 2QVMA 1EX0A 3DVIA 5KZ6A 4JFHE 1YEEL 5B1JC 2V9TA 2WQUA 4IXXA 2B3IA 4JW3A 2WNNA 4FK9A 4PL2A 5TGBB 7PTDA 1WBXA 4M0XA 4MS6A 2Q6WA 3ZXAC 3UYPB 4AD1A 5HYIA 4P61A 2CA3A 2DT2A 4M6VA 3W1UA 2JKJA 2WWCA 3APCA 3S3DB 4LAKA 3EDKA 4FN0A 4NJAH 1HHIB 3A64A 2BIPA 1AKJD 3L4YA 4Y5VB 2VLKA 3LHTA 3QRHA 2AK1H 3SFWA 1RY7B 4XXCA 3MROB 5IIEB 1F97A 4H9YA 4L65A 4JS3A 4MKTA 1F4XL 3MCYA 3L7RA 4RIRB 1QCWA 4KCVA 1FF5A 1Z42A 1DL7L 4NI8A 4GNVA 3PE9A 4Y2DA 3OB8A 1HH6A 4JO4H 1BZ7A 3CU1A 4PEKA 1Y65A 1XWYA 3F7KA 2MHAA 4S2CA 1HAWA 4Y5YB 3CVHB 4DUOA 1TPEA 4FQ1H 4G7EA 3D4GA 3G04B 4QOKE 1D5IL 5C2BH 2QCMA 2NUPB 1WV2A 3UTSB 1HHHB 3W75A 2X1RA 4OI9A 3WN5C 3MLWH 3K80A 3D7PA 5BRZB 1H8NA 4Q4IA 4F8LA 1LDSA 3WJJA 3GR7A 4FTDA 4A6GA 4YHNA 1ONQA 2QTEA 3ZWTA 3STFA 2XIBA 5EA9A 3WXWH 2WNXA 3IWVA 3LB6D 1HS6A 4UC5A 3AHVA 4FXLA 2V3GA 1LE9A 3IFNL 1F6LL 4LEBA 1T99A 5EULV 1AJ2A 3O6LH 3B3IA 4PV8A 1YECL 1BWVA 1MAKA 3V52L 2MPVA 2HVJA 4UFHA 4C60A 4BRJA 4OSUH 5EN3A 4EIBA 2Q3XA 1T0OA 5FHAH 3DO7B 3R0DA 4XVTL 4NCC1 3LDBB 5HQLA 4KO9A 3QQDB 4HH9A 3D0VA 1UGKA 4JFEB 2ZAIA 4UTUA 3GNOA 2VR5A 1KTCA 5IEKA 4JHAH 1KRBC 2F58H 2WVSA 3QG7H 3HMXH 1JDCA 3RDJA 1UTDA 3OZPA 1UIOA 3FQRB 4CMHC 3GI8H 1K8IA 1P4IL 4ZFFB 2VC7A 1R9ZA 5H4ZA 5C0GB 1CCZA 1KBVA 5J5RA 2J8HA 1E9YB 3U9UA 1Z9NA 1EJUC 1M05B 2EXWD 2HRGA 3QYCA 5FCUH 3EYVA 3SGEH 5ESVB 2WC3A 4U33A 4AKPA 5CN2A 5FL1A 3OWEA 1OW0A 3H0TB 3VXSA 4MJIB 3BW9B 4JBRA 4GQGA 5D7JC 4G6FB 1KCWA 1R85A 2ADIB 3RJOA 2CBPA 4ISVA 2W9LA 4CU6A 1ASQA 3ATYA 2E9BA 3MI6A 3HE7B 2OODA 2Q7YA 4IL0A 1JGUL 3K2UL 3S4SA 5I6XB 3PJTA 2V8ZA 3OTRA 2HN7B 4HX1B 2I5YL 2VZSA 3D69B 1JZEA 2Q76B 3UABA 1FYTD 4BDVA 2FHFA 3IDYB 3VI3A 3LA4A 4FEZA 4C1NB 3LYEA 1JZ8A 3QPXH 1JDAA 1XF0A 1MNNA 3MBEA 1RD6A 3OB0K 5MP6H 1BM3H 4B3EA 3FB7B 3MRMA 1JPGB 4UF7C 5EBLB 1LDPL 5I28A 1B2YA 3MV8A 1A5FL 1LILA 4PJ7B 1XIMA 4K23L 4G3YH 4IUOA 3F62A 5D7LA 1Z0MA 3MKCA 3BGMA 1ZUAX 1OGAE 2WMPA 3OHXC 5BW7A 1J8KA 1MH5B 1JULA 3UYCA 3KXFA 1F6KA 1UQSA 2ORBH 1C9SA 1TWSA 4NO3B 3V0DA 1VBGA 1KGIA 4KMLB 4Z77A 3APGA 2D3JA 1SHXA 3DJRA 4ATWA 4KXBA 2J7HA 1NCWH 5F1OB 4IRJD 3L9RA 2Z3FA 3NK3A 2AV7A 2EINB 1KR0A 3ASOB 5BZDA 5PTDA 1LO3H 5I02A 2Y5QA 3MSGA 2EDYA 2CZNA 1G4TA 4W6YB 4UT7H 2YPKA 4OBTA 2CLVB 1BD2B 4LASH 1FCBA 1MQRA 4HTBA 3TF7C 4F8TA 3FRUB 1TYGA 5E09A 1V8HA 1V3KA 4YFDB 1ULVA 2I7OA 5GJTL 3SCPA 2Y5JA 3QNYB 1U91B 2GSIB 4DETA 5K9OB 5JW5B 1U93A 1KYOK 3U57A 3B8IA 3K8LA 2OO0A 1S9YA 5BPPA 4KH2A 1ADQH 4LS1A 5HOSA 1CS6A 1RZFH 5JVLA 2GJ6D 1UOLA 4CCCA 5LIYX 3MV9B 5C2CA 4H5SB 5HGBA 4EPDC 2V5BA 3MACL 3Q1SL 5KJRL 1R3IL 3QWNA 3LSCA 1VFTA 3BICA 2AAVA 4AEEA 5CGYC 1W1B1 3WLQA 2WWMD 4OJYA 2WKJA 3GSOB 3CXOA 4JE4B 5KMYA 5EA0H 3TCEA 3RTQB 3WIFA 3BEWB 1P7QD 3GTIA 3VCCA 1CG9B 3ZE1B 3I7RA 1B9BA 3CZJA 1GOKA 2B7OA 4Q0XL 1FZOB 1S5MA 4LOUD 1AUSL 2WQ8A 4NJIA 1URZA 3S0CA 1ORQB 1MFCL 4ZFZB 5GGSB 3T0EB 4FD0A 3RX4A 2O6DA 4OZFB 3AXHA 3G6JF 1CGVA 3U9PH 3QEHA 3P67A 4PJ8A 1I8UA 5GGQH 3P84A 1W56A 2APXA 2WZ0A 3PAUA 4YSRA 1JI1A 4W9LC 1E0TA 4P8WA 3WLMA 4O11A 5AYUH 4YHMH 2C4FU 4P8QA 4XMLL 2NQJA 4K3JH 4AJVA 1FORL 4LMQI 2J88L 4DXVA 3FO9B 3HPLB 4HN4A 4C6QA 2OZ4A 1KFAL 4UTTC 4TOYL 2XTJC 5FAJA 4YX2L 2YZRA 3TYDA 4MFDA 3OG3A 3GNRA 3HG0A 2OK0L 1QFWM 1VACB 4ONFH 5MENB 7PAZA 3R10A 3NURA 2VDNL 2OP4H 4R90L 2ICWJ 4YBLB 2F7FA 3PWAA 4JDVB 2QQQA 2X28A 3GMRB 4FQPA 2A6DB 3ULVD 2FGWL 4PJXF 4TSAH 4O4YH 3FC8A 1X96A 3MJYA 4NYLB 1FGVH 3WSQL 2Y07H 2DF3A 2KHAA 1E55A 3IGKA 5IJCC 2FB4H 1P7KB 2EPLX 5FLVA 3GS6A 3C6SA 4RZ4A 2NX9A 3NO3A 2OXHB 5CS7A 5FYLL 3ZPDA 3BVNA 2ETWA 5BOPA 5XIAA 4U0RB 5CC5A 3MFFB 3GSNL 3PJNA 3LX9A 2G75B 3E6HB 5DDHA 3LIZL 4ZFMA 2IPKA 3UZZA 4HXAH 3JBG7 4LPXA 3ISRA 3SSZA 2C71A 3L17A 2A3CA 1NVMA 1KZYA 1YEJL 3CH1A 1RCQA 2GK0B 4MMXB 2IH1B 1QNZL 5E6ZA 3EGXA 3FT0A 4XP1H 5CUSL 1JMZA 3L5XH 2NUWA 1ROCA 3BQUD 3US9A 3GBLA 5F9WB 1PFOA 3MLVH 4NHUA 3FV9A 1JCLA 3HR5B 4A7QA 3VNDA 4IISA 4R6UA 1WX0A 4MUPA 3I9GL 1NQ6A 1KF9B 4XN2A 4B2DA 3KWXA 1SUXA 3OD3A 5L9DH 1LP9B 5C0EA 1RZGB 2QQLH 3KGTA 1P4CA 1QAWA 1QSED 4OCYL 4YBQD 4JAMA 3DXIA 5LBGA 1EP3A 1KPVA 4NBXB 5TGBA 2Q8ZA 3CWHA 1FTXA 2W65B 5DD3H 3K3QA 3WJXA 4N22A 5D1ZB 4W85A 3UYPA 3IGHX 1TZ8A 4R7NB 1AE6H 2AFNA 4PMOA 4NJKA 4TSBH 3RGHA 1IKFL 3HG1D 4W9DC 1JPTH 3O11B 4Y5VA 4FI4A 5LHDA 4AYDC 5IIEA 2FBOJ 3T8VA 3HURA 3RI5F 2NQLA 4FXKC 3MOBH 4LF3B 4RIRA 1CLYH 4GE8A 4FQHB 5CZXC 4NENB 3VIIA 3DEQA 4JNYA 5IB1B 4WRLA 2IMMA 3AS3A 2WLIA 4Y5YA 3GK8L 4HFUL 1FNAA 3AG1B 2LFGA 2R69A 2QPDB 4DN4H 3SY8A 3UVIA 2VW7A 2NUPA 4K9EC 3UTSA 5F89B 4DNHA 3AU0A 1CZ8H 2GQ8A 1A5LC 3SKJL 3ZO0A 3GVRA 3QZWB 4HWBL 4DEWA 2CXGA 2D7QA 3AYSA 5HVGB 4WV1A 4CNIB 4MNKA 2OOFA 4BGLA 1C9DA 4NJHA 1DSFL 1YAIA 3ZN6A 1BF6A 1R3QA 3QCTL 4ZVJA 2ZXGA 2Z00A 4Y88A 3KAOA 5A16B 4L9XA 4D6JA 3E0LA 2K45A 1TTBA 4DYJA 4XBJA 2HMCA 2EC9U 2HRPL 5D1ZI 1S78D 1AG6A 1SLUA 4M02A 3SBRA 4YSCA 5E1AB 4UMBA 5K1VA 3ORJA 4OJFL 3NIDE 3V0WH 3H24A 2NSMA 4IPIA 1N4XL 3DO7A 3MUAA 2NZ9C 2PI6A 3DFPA 1R2TA 4UZUA 3QQDA 5IHSA 4JFEA 2X5PA 1SBSH 5HXMA 3MW7A 2V9DA 3ELFA 5HSFA 4N2FA 3FN3A 4WSJA 3FQRA 3ZTEA 4OLXH 2J20A 1FVEB 2R69L 5D70H 5ERWA 1IT9L 1PLAA 3QBUA 2E27H 1ZDQA 3V4LA 3CPLB 4MF4A 3IDGB 4Y4FD 2RR3A 4KKLD 5J6HA 2EIDA 1A7RL 4S2BA 5ESVA 4RV8A 2D31B 3AOFA 6ALDA 2FHBA 3MRLB 3H0TA 4X8JB 3HI5L 1PAZA 1OF0A 4X6CB 1QRNA 1AL8A 1TJGL 2R8WA 2WB1A 2DKUA 4YWGL 2VZUA 3GNNA 3HE7A 3S3GA 1EUUA 3T6VA 3IPFA 3HC0B 2HN7A 1OARL 3D69A 3EYUL 2AERT 1UACH 1HEZA 1ZHNA 2HT3C 4LVGA 5KETA 3WG6A 1QR7A 4F9DA 3N55A 1IAOA 4AQ8A 4ICCX 2VDRL 1M3UA 4JM2C 2WZ5A 2E7LA 5EBLA 1UM6H 5FEZA 3ZYIA 5LDSA 2X9XA 1E30A 1ITQA 1JAKA 2DD8H 1F4HA 3T3PB 4Q56A 1J05B 1KQYA 1GY2A 3NZ1A 3IBOA 4LC6A 3KWWB 2VEMA 4S1RL 1AD1A 3QUXD 4Q58C 1MH5A 1T0NB 5CPOA 4KV5E 4GYJA 1KG0B 5LGYA 1EUTA 2XBTA 1XGTB 2B4GA 4NO3A 2HCVA 1LZOA 2FGZA 3GSRB 4G56A 4IGBB 3HQPA 2B9AA 4F80A 1JCYA 3R25A 5MKGA 4Z7OF 3UJEA 3C4UA 3GJFA 4PB3A 4NO0B 3HCVB 5C2XA 3S98A 1JCKA 4XAFA 1QI3A 2JCCE 2CLVA 1BD2A 2IG2H 2A4AA 1M1BA 2GW5A 4RWYL 2VGLM 3PQYD 3A24A 1LD9B 3BIKB 2X89A 3QNYA 3AMCA 5F9JB 1U91A 2GSIA 5FW8A 3KBPA 3S5SA 5K9OA 4JR9L 5JW5A 2CZVA 9RUBA 2E5BA 3N9GL 1WZKA 4JJOA 2ANUA 2HLFC 5CZ0A 2DLTA 2H7WA 1JPDX 1W5OA 2ZFAA 4WI4A 4DWHA 4M6MH 4Q8MA 2W61A 1DLFH 2HFTA 4C56E 3MLRH 5JHDD 2OT0A 3MV9A 5JH1A 2VEKA 4ZMNA 1GQNA 2DJ4A 1X4XA 2G2RA 3FZUC 1N8ZB 3QDGB 3O6FC 3RVTD 4G71B 3BL3A 4GQ9L 1PIGA 1I8LA 4DY1A 3BMVA 2OVLA 1H5BB 3KBFA 1OBAA 1NQBA 4Q8TA 2PXYD 3S8GB 3KL0A 2VDPB 4CEXC 3COOA 5TFSH 1WQVT 1E6RA 1CD8A 5AVUB 3RTQA 4DKFH 2TRYA 4PJDA 1FIGH 4MQXC 3BEWA 1LF1A 3UPRB 1THFD 5GRXG 1CG9A 1DQTA 4G8FB 2WBJA 3QC5X 3RVUC 1W8SA 3N2CA 3QIUC 1AL7A 3NEVA 3QUMB 4PCFA 2YA2A 2X1OA 5AHNA 4RDYA 1J8HD 2W9DL 4XG1A 3LEYH 3T6CA 3HFML 5TTRA 4O4WA 1TKKA 4IEFA 4Y4HD 3CC5B 1SOQA 4NUWA 1ORQA 3RG6A 4M7LL 4D8PB 3T0EA 5KSUA 5GJNA 1F4WH 3KOYA 5EU7E 3PZMA 4OZFA 1MFAL 4JKPL 2HK1A 1A80A 5H37G 1I0BA 5SV4A 5IESL 5ADOL 2OULB 3HGRA 5D33A 1ME7A 1H7WA 3NIYA 5JPMB 3V4BA 2DQXA 1TJXA 1KGUA 2GL5A 1UOZA 1IZKA 2CO7B 1H7NA 5D1QA 4YGAB 3FO9A 1D3HA 3IFLH 3B97A 3QC0A 5AB0A 2TSBA 1LEGA 5T33H 3OF6A 4AZUA 5JZ7D 1I9CB 1TB3A 2KLSA 5DMMA 3QW9A 5K9QG 2Z2BA 1VACA 2OPJA 3MMWA 4MBRA 3QIBD 5EH1A 1TWIA 2Q5BA 3JWOC 1LWIA 4ORMA 1XIDA 4HTYA 4WJKB 2INEA 1S7QB 4ZZ9A 1OE3A 5B39B 1XXXA 5LB1A 3GMRA 2A6DA 3T4YB 3I84A 1UWTA 4NYLA 4ZO7A 3CHOA 7TAAA 2OR7A 4AD4A 4DZHA 4V1DD 4GUIA 1P7KA 3H70A 1NDMB 3HNSH 3ZGIA 3TE9A 4MAZA 4PR4A 3TEVA 3V7AE 2OXHA 4AK1A 5ANMB 4DGIH 2VLLB 1TTJA 5JQ6H 2Q87A 1K4DB 1V6VA 5C7HA 3H4WA 1EZLA 3H26A 5K59F 2CH8A 1XIGA 3VFPB 1NCAH 3RRAA 3MFFA 4UM8B 2FQDA 4LCSA 3E6HA 3OC5A 1H3TA 2Q3ZA 1FX6A 2NY2B 4Z7VB 4YXKL 4FNLH 4YSOA 2IQAB 4D6FA 1XL6A 2F53B 4HYWA 4MOZA 1Q8MA 4AZCB 1FFTB 2FFCA 1UFUA 4OECA 1KBBA 5GHWL 3RY4A 2FLMA 2GK0A 2VDQH 4MMXA 2POTA 2IH1A 2CBQA 5HHXL 2VFEA 3SN0A 5FK9B 1R2SA 1LL4A 4NASA 3PC0A 5D4QA 3WFCL 1AI1L 2W0FA 5KSAC 4JN6A 5C0AE 1J01A 5F7EH 5KZEA 3JWDH 5K1NA 3MDWA 4YHIB 3CVIH 1K3UA 5I5RA 3FK3A 4XMPH 1RZGA 4B9KC 2L3BA 3ULAB 3PUOA 1HNFA 4HALA 3ARFB 3R1GL 1K2DB 1GZPA 3THDA 3HC4H 4L5ZA 4C54A 4HFWB 3U0TA 2DBLH 2ZX7A 1WYJA 2AJYH 3GS7A 1CCWB 4XNYL 3U2ZA 3GRWL 4CSPA 3IEBA 5C92A 3H42L 5BXFB 2JKLA 4P06A 5G55A 2WCPA 3MJGX 5GZND 3O11A 5MEOB 2WLHA 3PS7A 1W72L 4M6NL 3OG2A 3RGVB 1PKMA 2VXNA 2NR6A 1TT6A 3LTPA 2FIKB 2XGIA 1NIUA 5AYQA 4DGYH 3MLPA 4DF9A 4FQHA 3MXWH 4NENA 1I53A 3E0IA 3TAOA 4N2AA 4W68A 5IB1A 2DKSA 5E99H 3L3JB 1VZIA 4HQQH 4ODTH 1WDPA 1XCFA 3PWPD 5F89A 1FWBC 3CYVA 4HVXA 2ODHA 3HG2A 1SN2A 2ZYFA 3EJCA 1S9VA 1C12B 3QZWA 4GKSB 5CINH 3W82A 4P7OA 2PCPB 4M8RA 5I6NA 2VEPA 4CNIA 3WFDL 4PWGA 3N4FA 4BA0A 1CBJA 2BXYA 4IFKB 2O5YH 2XU9A 1N9PA 1VQTA 3L3DB 3T0DA 3B05A 3VNJA 3WLNA 8RUCA 1U83A 4O1DA 3NXLA 4OFYD 3ZS4A 2J2ZB 3QEGH 2BWQA 4OLZL 1XZWA 4Z7UE 1IARB 3O07A 1J4EA 3EKCA 1K8ZA 3UTTD 1NM4A 4TQPA 1QABA 2GABA 1BYAA 3B7YA 3G6DH 1QA9B 4Y8EA 5EMJA 1OCWL 4UV4L 1O60A 2PRLA 3QYMA 3K91A 4P46A 2DB8A 3WLBB 1LTXA 4V2BA 3QPEA 5L7XH 3U0PB 4HS3B 4K7PX 2RACA 4WSGA 4LCWE 4FYSA 1K6WA 1MZYA 4GXVL 1UA7A 2ZXDA 1A5MC 1Z5YD 2FX7L 3NUKA 5I5IA 4PRHB 4ASTA 4HCDA 5F2FA 3ZQWA 2Z4TA 1UB5B 3CAVA 1FVEA 5JHMA 5EBGA 2Y8KA 1RY0A 3VOHA 3CPLA 1NCCL 3IDGA 4UFLA 3WV0A 1IGIH 1JAEA 2D31A 4HKJB 2TSAA 3OPZL 3MRLA 4GCAA 5E6YA 3SD2A 4X6CA 4Y9GA 4MY1A 1ZLSL 4DGUA 4TQIA 4ELME 1JRHL 5C8JB 4LC8A 5JPNC 2IAND 1J0ZA 3HC0A 1E0XA 3LTVA 4CNUA 5DT1L 5C07D 1DWAM 4ZK8A 4IOSA 1JV2B 1UD5A 4GZIA 4C6KA 1E4LA 3B1UA 4KK5D 4PB0H 1G84A 3F4CA 2O4MA 4Q9QL 3HZMB 4LGRB 5AW0B 4TNGA 2EPHA 4IS6B 2N3JA 4GWEA 5E6SB 3BIBX 5KVDE 1A0EA 5FF2A 3W2KA 1V7MH 1J05A 4M19A 5HTSA 2XU2A 3KWWA 1QFHA 2GVLA 3ANYA 5EMUA 1YQVH 2D20A 3T9PA 1KG0A 4I9TA 3NCYP 2WAQA 1Q6LA 1T5AA 3PBGA 4I13B 4WI6A 1RPUA 3AREC 5BQ7B 5D04C 1XAKA 2BCKB 1RPXA 3GSRA 3MODL 4IGBA 1BHGA 2VM4A 1VJZA 4KEVA 4CQ8A 1IIKA 4X7SL 1OIFA 2IDQA 2JI2A 4X99B 1UP3A 2AQ2A 3LBOA 3DYMA 3W11C 3HCVA 4HCRA 4HPYH 3G5XB 4TVPD 3TX4A 3HKFA 4IRZA 2YBGA 4Q6JA 2F1BA 4N2LA 5GPRA 3G6JE 1OD7A 3LKOB 4E9XA 1QOXA 4EXBA 3O9WD 2EDHA 3IIXA 1EL3A 5DEGB 1E72M 3C08L 4OU1A 1LD9A 3BIKA 4P4KB 4YXLH 1U3HC 5F9JA 4NXSA 4XBPB 5CMAB 3FXYA 5DJ2A 2G95A 1E3XA 2WWKO 4KJPD 1JPIA 2CZ5A 5SV3A 5JOPD 3UP6A 3SDDC 1R3JB 3C60C 2AVGA 5LCVA 3OGRA 3MMDA 1T03H 2XSKA 1YLBB 1RK6A 5KVEL 5FF7A 2N7AA 2DSZA 3U79A 1Z3GL 4N6FA 1KYDA 2DIAA 4Q9CA 2WKOA 3WLRA 1N8ZA 3QDGA 1CL7H 1UEYA 1XBRA 4C58B 5GNYA 3BQVA 3KRBA 4CQBA 3OR7A 2QEJA 3R0MA 1OAKL 5DFAA 1G9NH 5IHUL 3K6FA 4HJSA 4HPNA 2R2BB 4ODWA 4Y2DB 4PJXE 5AKQA 5BXTA 5L2JB 3VX1A 5SWZD 3ALXA 5BNKA 3FQWB 3QUMA 2ZKXA 4YH6A 1NCHA 2YPLD 3CC5A 2EPNA 1FL5B 2BG5A 2ZC1A 3MDUA 4D8PA 3WEOA 2DM2A 3QEZA 1O9WA 3D09A 3EJPA 2WHKA 2PO6B 1OK8A 4G7YL 1ONQB 2I7GA 4D6GA 1UJQA 4HUNB 3RPDA 4GMSL 5JPMA 4O2FB 1SY6H 5IROC 5HHPB 3OR6A 3UAEA 2Z1XA 4GHRA 3MPCA 1TTPA 1XIWB 3VQ2C 5I8KL 2CLFA 2CO7A 2RQ8A 1RP9A 5LCVL 1T41A 5K69A 2INZA 1SU5A 3ZHFA 3APNA 2B1AH 3AWOA 4N2KA 3RJQB 3GH4A 2CZFA 1DJIA 1ECQA 3B3IB 4PV8B 4WSKA 2D4DA 1HKLH 2CHZA 3U48A 4LARL 1S9KC 3AT9A 3SRFA 4HOMA 4LCIH 2FMNA 4C5ZA 4HH9B 1TQCB 3D0VB 1MELA 3VFNB 1YG9A 1FCVA 1U8NB 2ZXWB 3IXTB 1S7QA 3SYPA 3QR2A 3QHTC 3W85A 3T4YA 5I2UA 1U1JA 3TZVB 1PKQE 1CFVL 3TAKA 1PL3A 3KYMB 4DPQA 3DAQA 3RUBL 2I32A 1NDMA 2CCVA 1VEMA 2O6CA 3U9UB 2JEPA 1WE5A 2V37A 4F58L 3IARA 5BMFH 4L9DA 5TK4A 5ANMA 1PGRB 1GGIH 1FWSA 2V9RA 1K4DA 1R33A 1PKLA 4HHHA 3APYA 4OZIE 1TRDA 1W8GA 2VSKB 1JN6A 1E8ZA 2DW7A 1HJSA 4UM8A 3S9YA 4E2OA 4XCFL 2J79A 3S36X 4N28A 4L4TA 2C26A 2VM8A 3K46A 4L8SC 1EJ7L 3MV7B 2F53A 4XVDA 4LCCC 4AZCA 4K71C 2Y8UA 4GJ1A 2H0JA 2ISVA 4S1QL 5FEBA 1RCXB 2AJXH 5FK9A 1ACCA 1JXKA 1X9LA 2OZTA 2CWRA 4KFOA 4RXFA 3RGBA 2OR8A 1W31A 3BI9X 1GS6X 3MRMB 3BSZH 3Q01A 2ZPKL 4BK5A 2XXMB 5D96B 4YHIA 4XC1H 5I71B 3S2CA 3HE6C 4F2FA 4D9RD 5DFVC 4XN4A 2MCAA 2J8TA 2YGPA 3IVKB 1VRXA 3NA4A 5JW3L 1K2DA 4KDVA 4MJID 4HFWA 3ZJ8A 3WFEL 4X42A 1BIHA 2HVNA 3RKPA 2Q7NA 3RK8A 1UKTA 3TN3A 4KUCF 5MI0C 1UWUA 1KWGA 1AH4A 4WFED 2PU0A 2CRIA 3BLEA 1B5TA 2BHUA 2HT2D 4Z1YA 3A47A 5BXFA 1HZYA 3N41F 4M5ZH 3AFBA 2VDHA 1XISA 3B9DA 5MEOA 2V2TA 1ML0A 2YPKB 4W4QA 3WNKA 3WD1A 3WK0A 4LIQL 4B3VA 3U46B 2PP1A 2FIKA 5JIMA 5EO0B 5B1CA 4PLKD 5T1JA 3DKLA 1EP1A 4M8QA 2XX0A 3N9KA 4N8CH 5CZJA 2YXOA 1QWHA 3U0HA 2QUVA 4WEVX 1MLCB 3VO0A 4QE4A 3W0WD 2IWKA 2EHHA 3CN0A 3L7EB 1OM0A 3AMKA 3MRKB 4ESKA 3B1TA 4N3UA 4MNLA 1QPXA 1PEWA 1ICQA 4HCGA 4PYSA 4S3CA 4LOCA 1CW2A 4XHQA 3I2CL 1TJIH 2R1LA 4B92A 2OCFD 1C12A 4GKSA 4YLQT 2PC4A 3QGAC 1EJSC 4I89A 1LRTA 2X16A 1PZBA 3QJOA 1K6AA 4IFKA 2DYPD 3L3DA 4DGWC 3CIAA 3P0VL 1TJ1A 2AEIT 2VDNB 4DUVA 4OLUH 2HJKB 2VCAA 1KN2L 3DGRA 3WIFB 4KHTH 4QHNB 3QR0A 2J2ZA 3NN8B 2J9XA 3RA7H 1MIEL 1GGCH 4U7SA 3DDMA 4S1SH 4FMFA 2FBJH 1KFJA 4KMTL 3DFNA 2DVTA 1X5XA 1QA9A 2EDKA 4U3CA 4EO5A 1C91A 1XLIA 5JBEA 2PDFA 4XC3H 1KZQA 1ZENA 1RZ8B 3U0PA 5LQBH 4N1EA 1X8FA 3MQIA 2BASA 3GSNB 1ELSA 4PHZA 1BQHG 5I17B 1H41A 5GRJH 3BUIA 4WY7L 4PRHA 4XAKD 1UB5A 1CURA 2DI9A 2UVFA 4KROC 1SDAB 5HVFB 5KJ7E 2HS6A 1V08A 5GGVL 1DHKA 5L2KD 1C1EH 5EB9A 5C9ZA 1E9QA 4GT7A 3AW5A 4M1DH 4KERA 1KXVC 2YMOA 5BUAA 1V51A 4R0LB 2OJZL 1NANH 3CK5A 3RPBA 4MA7H 4PJHE 1JK8B 3THUA 5F7AA 1I2QA 2IDTA 2CERA 1NCGA 5C8JA 2X2UA 5BRQA 1QNOA 1CI5A 4X2UA 3IPWA 2YRZA 2WJZA 1FXQA 3BWAB 2QSVA 2EXYC 5FHBL 2HX8A 1SVCP 3JVGC 2RJMA 1S5VA 3G1VA 3G22A 1C8QA 4HKBB 3N3EA 4HNNA 3DXAB 1UKPA 3RDTD 5HK4A 3HZMA 4K9EH 4IS6A 4KCWA 1MFDL 2OCCB 3EX4A 1A1NB 2HTLD 3WIIL 2OJPA 4X22A 2WVVB 3V6OC 4P5UA 4DRSA 5J1AA 2HWZL 3MUXA 4GY1A 1HU8A 4JFPB 1LHZA 3C61A 2VDKL 4KFPA 2HH0H 4MD4A 5DO2C 4PCSA 2IPKB 2ZOOA 1I3UA 5HPOA 2QTVA 5DD5H 4JTDA 1XR9A 3GTNA 4XZHA 1A7PH 2YXFA 4DWDA 1YY9D 1EEQA 5BQ7A 2BCKA 4RMSA 2AJVH 3EGXB 3FO1B 4ZSOB 5LHEA 2DU2A 5CCZA 3WEZA 5A40E 5KVFH 1QFWH 5B3JE 2NVAA 3G5XA 1Q5MA 2W59A 2KBGA 2XGBA 1XGYH 3LKOA 4AYMC 5DEGA 5AC5A 1EFZA 1RBAA 1KBKA 4AIOA 4P4KA 5C0EB 3G5YB 2PTDA 1AGCA 3UTOA 1AO7B 4JRXD 4XBPA 5CMAA 3P5ZA 4U4BA 2QCHA 1HHJB 2K4AA 4NJAL 4Y8DC 1W3TA 4JAMB 4ZQNA 1R6WA 1KPVB 3N73A 2AK1L 2RA1A 3H2QA 4B9ZA 5H4YA 1R3JA 1OSPH 3VOGA 2XN2A 2H6RA 2CNZA 3H2MA 2GJZB 3PNZA 4P7QA 3STBA 3WCZA 1V54B 4JO4L 4KGJA 1R34A 5TF0A 1R9YA 4R84A 3SDCA 1FV1A 4YNYB 3ZGHA 4FQ1L 3BZ4A 3MYOA 3GEFA 1GHRA 3NL6A 5C2BL 4HJWA 2P5EE 1OJXA 1NL0L 2OA9A 4QHMA 3G08B 2R2BA 2VOMA 3MLWL 4MZIA 1YO4A 5D4YA 1N6UA 2QLVB 2WLIB 3WFHA 5L2JA 3FQWA 3QK0A 3KGSA 2H2PD 2ZYHA 3V10A 1O12A 4WW1A 2HYMA 4W5UA 3NCYS 5LLIC 1WDRA 1LM1A 1QEWA 3WXWL 4N5ED 1J6OA 5CJMA 3SB3A 1FL5A 5DZJA 2QQNH 2VNCA 2X1IA 3AHXA 1D7BA 5K59E 3HQNA 4HZAA 2R8SH 2H1LM 2NMSA 4JRYE 4WV1B 2PO6A 3OODA 4ERGA 2CKBH 3VTTA 1IAIM 1QZNA 4BR1A 1E8WA 3O6LL 1IC7H 5BZWB 3VNKA 4O2FA 3RGTA 5LWYH 5HHPA 2IDCA 4GFSA 1XIWA 4GNKB 3QAQA 2RB8A 4OSUL 4S0HA 5FHAL 3SY5A 2V5YA 1TUFA 3P2VA 4LEXL 5K9XA 1T6VN 1HJQA 2ITEA 3GUTB 4HJJL 4JHAL 2F58L 3FS9A 3QG7L 3HMXL 3H6JA 4L3EA 5HANA 2J77A 3QNFA 3VQLA 3GI8L 1RLWA 4J4KA 3VFNA 1FI8C 4JGNA 4OFVA 1U8NA 3IXTA 1B54A 3TO4D 5LNSA 4I9XA 2D7TH 3REVB 3LVTA 1ZBVA 4ZOCA 2VLJB 2N1KA 3TZVA 2WLJA 1M7IB 3KYMA 2VKXA 5ERWB 4H83A 3UGXA 1ID2A 1IR2A 2DQEH 1VENA 5HMEA 4ZXBD 1LOSA 5JUEH 3ETSA 5J6HB 1V0LA 3FYOA 4HGMA 5JQ9A 2BDNH 4GP4B 1QAPA 2VFFA 3BRFA 4D9PA 5EOTB 1FA4A 1QRNB 3AU2A 5FYJD 1GOHA 1BQRA 3W3OA 3NSYA 3A3XA 3TVAA 1EF3A 3K0YA 2P1YA 3QPXL 1ND0B 1HL5A 4J3OF 1TYJA 4PJFB 4S38A 1OFDA 3MV7A 5MP6L 1BM3L 4O13A 4PMZA 5KVMC 4Q4EA 2QSQA 4NO5B 1RJZB 4G3YL 1FWHC 2CE6A 1HEZB 1A4KB 1ZHNB 1EA9C 4FS0A 1DSWA 5L4JA 3SDYH 2N01B 1KCZA 4LHJB 2AK4E 5CPSA 1IAOB 1WAEA 2VJXA 3V35A 4Y2NA 1DBKH 4KQ0A 1CLXA 1VHCA 1U42A 1J96A 4P2VA 2ORBL 3IMSA 4QWWD 2MSPA 2B0SH 3TJLA 1DXEA 2HK0A 3HPSA 3HNTL 1NCWL 1AR1D 4EDXA 3IVKA 4G8TA 1LO3L 3BOXA 2A6JB 4X4ZA 3SQSA 2E1WA 4UT7L 3TIMA 5C7XH 1QMUA 1BFVH 1LNUA 1CR9H 4LASL 3FU0A 4OLVH 4JCWA 7A3HA 4OUIA 4MWAC 1GGUA 3FBQA 4L9LA 3BCDA 1DVXA 5MKGB 2DZBA 3SUTA 2DUAA 1CXIA 3GJFB 3NPWA 4LVNC 2XPZA 3SKNB 1Z41A 4R5XA 3ZRSA 1IXOA 5DC4B 3EUDA 1MLBA 1TVDA 2Z1VA 1ADQL 3U46A 3SSGA 1L9QA 1A9EA 1KT2B 3MB9A 3P6LA 5EO0A 2XV0A 3HMWL 1RZFL 3EHBD 3IJQA 3U7BA 2HFFB 1C29A 1VD6A 4OD2B 3JWOH 1S5HB 4GW5B 4H9UA 1VPQA 1MLCA 3RPTA 5EUOF 4E41D 2JKIS 3YPIA 4DJDC 1J9RA 5T3ZD 3X3GL 1ME9A 3IGLA 3QQ9D 4WNSA 2VRJA 1Z5HA 1FAIH 4JZOB 4Q9BA 1E4KC 3L7EA 1FIEA 3MRKA 5CKGA 1MJUH 4J40A 1FNLA 2J88A 2WSPA 2OT1A 3VXMB 2QFPA 3P2TA 2W0LA 5EA0L 5FYKH 2G2RB 1XP3A 2BMKA 3TVMD 4NPJA 4WX2A 1J48A 2ATSA 1M7XA 2EUWA 3MUCA 5HDWA 3LLXA 2Y7OA 1DN0B 1OFBA 2TPSA 4G1NA 2WZAA 2HX7A 2HJKA 4FLQA 3LY0A 4NO0D 1UG9A 3I4KA 2ZXCA 2BIQA 1UUOA 4PJDB 3V0UA 3Q8FA 4KRTA 1LWHA 4GRLD 4QHNA 1ZD6A 3U9PL 4A4AA 3NN8A 4GXWA 4XQ6A 5GGQL 2Z29A 2WBJB 3L4UA 3H9ZA 2Y7SA 2OV0A 4KKNA 1BZEA 4IEFB 4DXXA 4RGOL 5F21B 3IB4A 1XD0A 4J35A 5AYUL 4YHML 1SSDA 4C4KT 1QBLH 5KSUB 4PS4H 4K3JL 1XDJA 4A7SA 1ADWA 1RZ8A 4JPQA 4JTIA 1MCRA 3GSNA 1YPIA 3P14A 3LIZA 5I17A 4IBYA 1L6FA 1C8XA 3S3CB 1UM5L 5DZPA 2PDLA 4I0PD 3KM1A 1A7OL 4ONFL 1PS9A 1TREA 2GUBA 2WNQA 5D1QB 4OGXH 2R0LH 5L8KB 3B8SA 2OP4L 3SCRA 3AWEA 5GZOA 1LEGB 1BAWA 4R0LA 5M95B 4HF5L 5SWQA 1KTDA 3RZCD 1E7VA 2BGQA 1BOYA 1JK8A 3A67L 4KWSA 4IGMA 3ECVA 2Y07L 4F2MB 2F8IA 4NNBA 3KHQA 5AOLA 1YVLA 3M44A 4M5PA 1P6BA 2C9VA 3OYZA 3ZYOA 4X2PA 4KQ3H 2EECA 3HLKA 4R34A 4WHBA 3BWAA 2P8MB 2L0DA 2DQTH 3RM4A 4IG2A 4HKBA 1W1ZA 1F45A 3DXAA 3R0NA 5LG6A 1QSFE 4HXAL 3RVWC 3VXUE 5DURB 1A1NA 1B3OA 1KM1A 3SE4C 1F3DH 4Q6IB 4PR5A 2WVVA 2X4RA 4TNVK 1MFBH 1W72B 4JFPA 4WEBH 5KWYC 4XP1L 3L5XL 2TYSA 4EXPX 3V0IA 3MLVL 5FXCH 3NFSH 1QR4A 1U30A 3FQYA 4FKKA 2ENJA 3TQVA 2VKZG 3FO1A 4ZSOA 3VSTA 1G4SA 4HIHB 4RVBA 5CJBA 4RDZA 4XPGH 2W0FB 1J5OL 5FAAA 5E4OA 4YUEH 5LA1A 4X9YA 4IXHA 2R4SL 4HWBA 3TJHC 5DD3L 4LV4A 3TQKA 2F6KA 3UAJA 1ZLVH 3G5YA 5CAHA 1AO7A 1AE6L 1GOQA 5HI3D 1GOXA 2REQA 3HHSB 1REQB 2NX1A 4TSBL 4YLBA 1HHJA 1WCBA 4OV6F 4LOEA 1GZPB 1JPTL 1YRKA 2D4FA 2Z25A 4R97C 4G2AA 2R23B 3U0TB 2ZUXA 1FWFC 1CLOH 1IC5H 1P5UC 4PY8I 1ILSA 3HB3B 3SKUD 3KJ4B 3ES8A 3MOBL 2EVHA 1M7OA 4M4RB 2GJZA 4BJHA 1FAKT 5F2GA 4IL2A 3FYIB 2A85A 1WUFA 3AY2A 1TIUA 2MNRA 1OP4A 5DUJA 1QTPA 3OZ9L 3OVRA 3V4UH 4YNYA 1TQUA 3H4HA 3Q2NA 4DN4L 1ZB5A 2VR3A 1C5BH 3AIEA 1B4JH 1CZ8L 3G08A 1VC4A 1F2XK 2ATMA 4C6IA 3HZVB 4QRNA 2GUOB 5U7SA 1EAJA 4QRRB 4L8DB 4MJ6B 4X6FA 1TTAA 4E9VA 4JANB 1GZGA 1CE6B 2H4EA 1LO2H 1XX9C 3L48A 2PCQA 4K5NA 4S1DC 3W26A 3ARFD 4R5VA 2DM4A 1AJ7H 4W84A 3A5FA 2YFOA 1S9VB 1L7TH 4D71A 3K1GA 4QLWA 1ZK5A 2HVMA 4JVWA 4F8OA 2YQ2A 1DQLH 3SDXF 4KWWA 2J8UF 5AW3B 4GH7B 4AY0A 4E9TA 2P5WB 4OGYH 5BZWA 3JZUA 2AQPA 2YMXH 3V0WL 5DTFB 5AL0A 1BDYA 3MHUA 4MRCA 3WZ0E 5B38G 3ULUF 1PSKH 2ZCLH 2GBAA 1Q7MA 4XPAH 1G1KA 3QEUA 1EANA 1A6ZB 4MB4A 3GUTA 1SBSL 4WENB 4H9MA 5MHSD 1XINA 1RUSA 4BCZA 4P2OD 3IANA 2G60H 2FLBT 4K38A 2C7FA 4OLXL 4P46B 5D70L 1LWJA 2EEAA 3CBJB 2C3WA 5IR1B 3RJXA 3SDAC 2E27L 4X0KB 3C56A 5F0JB 2CYGA 3CQJA 1SXNA 1E0WA 3REVA 1CWVA 1IEAA 4TLKA 2O72A 2VLJA 4I5XA 4BZ2A 1M7IA 4FULA 4YDNA 5AVQB 5SX5K 3DX4A 2OZNA 3BAEH 4EN3C 1KMGA 1FDYA 2P52A 4LRNH 3MUUA 2JTYA 3FTXA 4PJIE 5EOTA 2N56A 3G5WA 2Q8BH 4NN5B 3QUZC 1DYSA 4EANA 2GYSA 4L4VD 2ESVB 4YSUA 1ND0A 4PJFA 3HI6L 3MVIA 1SDYA 2WPBA 1AZNA 1UM6L 3GFXA 1M4KA 1I9RH 4NO5A 1RJZA 4NZ4A 3R79A 4HIJA 2DD8L 3VD4A 1A4KA 3DV6B 4KDTC 3VG9B 4XODA 1XGZA 6PTDA 3QCUL 2X4PA 3C5ZA 4IQHA 4GW4A 3W5NA 1F0LA 5DT7A 4PWEA 2TRSA 1XV8A 4JTCA 2KI6A 1USZA 4TUOA 1LK2B 3K2GA 4EIGB 5EYWA 4TL5A 1U5HA 2EEBA 3S1GA 5CIPA 4DN3L 4BZ2L 4LEOB 3D5OF 2A6JA 3QV9A 4DJMA 5AAWA 2QKIC 4UWMA 5GXBB 2J6XA 2IG2L 1DVFC 1BQLH 2Y1VA 4N42A 2LVEA 4R2GB 5GRUH 2GQ9A 1K5WA 5D9NA 3ATDA 3BDYL 2JF7A 3MR9A 2R56H 6FABH 4B6ZA 4LEFA 3SKNA 2QQKL 3QUYA 4JG0H 2A0LC 1Q3NA 3QXBA 3M8OH 1R3KB 3QM3A 1KT2A 1P5VB 2CXKA 5ISZE 4P4RB 1DIDA 4M6ML 5J06A 3A22A 1DLFL 2HFFA 4OD2A 4LO9A 1S5HA 5F4SA 3MZTA 4GW5A 3WDIA 2AQVA 2BFVH 4AQEB 1XD1A 4CNTA 2R82A 5DJ2B 1Z6JT 3ZLGA 5ABAA 3GNXA 4JZOA 2FZ8A 4JFFD 4F66A 1SFDA 3BLIA 5AHMA 5GJSH 4N20A 4GZEA 3BAYA 4GMTH 3BXNB 4Y5XC 2A7NA 3VXMA 3DESA 3JVAA 1PY9A 3NBNA 1PZAA 5TFSL 3I3DA 3S47A 4DKFL 2OMTB 2WJ7A 1FIGL 2DLGA 5ALCH 5K5YA 4PWIA 3DMMC 5TNVA 3OR7B 2FD6H 1DN0A 1DP0A 4KX8A 4P2RD 1R0MA 5A6KA 3LEYL 3GW3A 1ZLWK 1ZCCA 4K5MA 4ODWB 4IFOA 1A6UH 2CWNA 1RFDL 3SE3C 4OCRH 2WN2A 1F4WL 1N8IA 1F9CA 1XYFA 4HWUA 5JMRA 3AHTA 5I1AA 2BRQA 1YYAA 1BEUA 4MMZB 3G6LA 4DEFA 5HHQA 1CYGA 4AZ8B 3VFMB 4FJYA 2ZG1A 3FSWA 1AIFB 2WNKA 4NP7A 3IFPB 5D7IB 2EXOA 3FHQA 4LU5L 3ATEA 3VFGH 2EDJA 3M64A 4KI5C 5KSBB 2HV5A 2WHMA 3IFLL 1T0MB 3U9WA 1E9PB 5E8PB 4OJCA 4YSPA 1V55B 3GTVA 3MLUH 1DPMA 5T33L 2ICEA 2OGYA 1NFGA 3OR6B 1TVLA 5CJ8A 3EMQA 2WYTA 3ZU8A 3BLFA 3AAZA 4LKXB 2VLKD 3FRPA 2ATKB 4L61A 4RESB 4N68A 3DWTA 4X9FA 4J5VA 3R0KA 4F93B 4JQVA 2PABA 1ZRUA 4G6JL 1E2VA 5GNXA 4Y2DD 3QI9C 2XVLA 3VNIA 2KH2B 3HIZA 2QDVA 4YHEA 1EBPA 2VSCA 4JFDB 4QYOA 4F2MA 1TPWA 1TMHA 4AXWA 4GI4A 4GQ0A 3HNSL 4N8VG 4UQEA 5ANHA 3VXNB 2BP3A 4NZ1A 4DGIL 3H3PH 2VD8A 1VSCA 5JQ6L 2P8MA 1U3YA 3WJZA 1E4MM 3K81A 2ZC8A 1IC4H 1NCAL 2EDQA 1XIBA 3H9YA 4R3UA 2C14A 1B3XA 1LYQA 4FNLL 4W9JC 1F07A 4I9JA 1JFHA 3GRWA 3Q8BA 4QLLA 2RAMA 4Q6IA 4YDKH 5FOBB 3IIVA 1JN6B 2VDQL 3KTXA 1CLCA 1KCXA 1W72A 4FNQA 4OZHB 3C0LA 4L4TB 4PJ5B 1ZHAA 2L7QA 4GYPA 4PTMA 4X2RA 2PZ0A 1ZFJA 1KYOJ 5F7EL 1FNEA 2C1PB 3JWDL 4DKAA 2W4XA 2YSWA 4NUJA 5IW6A 3CVIL 3OG4B 4PTUB 4XCYB 2RGMA 1FCCA 2MPAH 4HIHA 2WK2A 2POZA 1FVPA 2D22A 5KYWB 2CHWA 4D9QD 3HC4L 2PLTA 2ZJSL 3OX8A 1KFBA 2TMDA 2DBLL 1IEIA 4JTSA 2XGZA 4HZMA 2X4NB 2AJYL 1RPKA 4GPVA 1SZFA 2TRHA 5IFJB 4XNBA 1QTYT 5LJYH 3HHSA 1REQA 4EAMA 3G5VB 5IQ7H 4EBQL 2PEVA 2DIEA 3VXSD 5CEWA 3E8UH 2NV9A 2R23A 4ROQA 1OHLA 4RX4D 1A50A 1MCNA 3AY4C 4ZFQA 3IJHB 4DGYL 4M4RA 3MXWL 3M6YA 2GPZA 1RK0A 3APFA 3BEVA 4MVAA 1EAOA 2VQUA 1BM7A 4RDQF 1EWHA 3T55A 2UZ9A 2V2TB 5HPCA 5JMUA 1RR2A 2YXGA 4XWGH 4HQQL 4ODTL 3QJUB 3FKKA 1BAGA 1J0IA 1Q0XH 2A9DA 3DX5A 5E0CA 3HAEG 4M8QB 2XJ7A 5B7YA 5AVZB 2BBFA 3MBED 1P0BA 1RULH 2V3DA 3PV6B 4HJ0C 5CINL 3HZVA 1GVQA 3MV8D 1MF2L 4AVFA 1I9IH 1XT5A 2GUOA 4QRRA 4L8DA 4MJ6A 2ZXEB 3SE6A 1W5NA 3MUGA 4H04A 5D7LD 1WZMA 3N4AA 4JANA 5KBKA 1CE6A 5J04A 1KB9K 3K30A 2O5YL 5IVNA 1F13A 3B40A 4HKZA 5JXQA 5GRVK 3KXFD 5GS0C 2JKEA 4XVUC 3GK0A 2R6OA 5AOZA 3W73A 3MMUA 4EACA 2FJHB 4UMAA 2VM3A 1O7DE 3QEGL 3FS2A 4ZQMA 3NIFF 5GJMA 2VVNA 2CD0A 2P5WA 1WCQA 5DTFA 3C2FA 3G6DL 4G9PA 5L88H 1OGTB 2DOCA 4GBXB 4BI5A 1OCOB 1IBGH 4G6ML 2GVEA 2V5TA 1TFHA 2MCG1 1A6ZA 1T83A 5LNGA 4NU7A 2JCWA 4GUPA 2CAKA 3V7AG 1PG7X 5IR1A 2ZZ3A 4O9HH 4DT2A 2WB5A 4AL8C 4X0KA 4QLKA 3ROLB 1I82A 1NUNB 4GY0A 4XAZA 4LLDB 1IGIL 5EBWB 2VDKB 4G9FE 3IE9A 4YMPA 2XXFA 4IPLA 3UG8A 1NH6A 2VR6A 2LU4A 1U3NA 2WBKA 4HA1A