1ODUA

Crystal structure of thermotoga maritima alpha-fucosidase in complex with fucose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
441
structure length
422
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEDLPGYKWEFTRGIGLSFGYNRNEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Thermotoga Maritima {Alpha}-L-Fucosidase: Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords PUTATIVE ALPHA-L-FUCOSIDASE
total genus 148
structure length 422
sequence length 441
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1oduA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1oduA01
3CZ8A 4P8XA 2WC7A 4PMQA 3AZSA 2HVMA 1EXPA 1KTBA 2XFRA 2D1ZA 2OW7A 3SCNA 3BAXA 1MW0A 1UQYA 3VINA 3EDFA 1BAGA 4W87A 2ZX5A 1K6AA 1HJXA 1C3FA 3DHUA 4CN1A 4ACZB 1C8XA 4D6IA 3BUBA 1GNXA 5LA1A 4MJ4A 1R46A 1CLXA 3BMVA 4BCEA 1ZS2A 4PCSA 2YL9A 1SZNA 5GNXA 3AXHA 2BVTA 3GXFA 2WZIA 3ZIZA 3SCUA 4CD8A 1ISXA 3DX1A 3CV5A 2J4GA 2V3FA 3VGEA 5D8WA 3KLLA 2JEPA 3GH7A 2G3JA 2VZUA 3BVWA 1MQQA 3VMNA 2WBKA 4M82A 4MB1A 5JIPA 3AFBA 1KBKA 3WNMA 2QHAA 1C7SA 3ZJ7A 6CGTA 2XJ7A 3HG3A 3NSXA 1CYGA 3HJEA 5HOSA 1UHVA 1E71M 4PUDA 4TOQA 4AMCA 4D6EA 1Q6FA 5JBEA 2VL4A 3IK2A 3M7SA 4PTVA 2WVVB 3UG5A 4J27A 3WQ5A 3HU7A 3OGRA 1BG9A 3LXAA 5HPOA 2ESCA 3BLKA 1OIFA 5EFDA 1JXKA 1ITCA 3SUSA 2C7FA 4CU8A 4V2XA 5FL1A 4HMEA 2PBGA 1SFSA 4MADA 4M1RA 2ZUMA 1EHAA 3EJRA 3RMEA 2X2HA 2VO5A 3SUTA 4NZCA 1FHDA 1WP6A 4A3HA 3L4ZA 3AIUA 3SUVA 2IGTA 1DHKA 3OGSA 4FNQA 2J74A 3GH4A 1EH9A 2PWEA 3VIMA 4AZ5A 2OYMA 5E70A 3HG2A 1GW1A 3WD1A 2VX7A 4AY1A 3B9DA 1UD3A 2FH6A 1B3WA 3QGVA 1D3CA 3AXXA 1KXVA 3PZMA 4AC1X 2A3BA 2VTFA 1QI3A 1QNQA 4GO9A 3WKZA 2FHCA 3WH5A 4M81A 1H3GA 1BF2A 2DDXA 2UY3A 4P7RA 3D51A 3WQWA 1MQPA 5GNZA 3AS3A 4Y7EA 4U33A 4GI9A 1LQ0A 4YN5A 2F7PA 4UZUA 3VIIA 2W5FA 4B16A 1V6UA 3PZGA 4W5ZA 3WQ6A 4NZJA 1E4MM 3MANA 1B30A 4B15A 1J10A 1H1NA 2VZSA 2W67A 3CZNA 4Z2GA 1Q6CA 1QNOA 5CGTA 2WNWA 1DWHM 1CENA 3AMGA 1BSIA 1DWGM 1CLVA 3ZR6A 4QAWA 2OYLA 1U33A 1J12A 1C7TA 3L4XA 3EJTA 4OOZA 3VIGA 1A47A 3EDDA 1BYDA 1AQ0A 2XVPA 3WIJA 2QMKA 3H53A 5DO8A 5CG0A 4NF7A 4MNMA 4CU7A 1KB3A 4AISA 2VOTA 2OSYA 3AS1A 3PTQA 1TVNA 2D0GA 5HNNA 2XGBA 4D6FA 4MAVA 5AC4A 2XM1A 3OLDA 4J28A 5ABEA 3UR8A 2YL5A 3SUWA 2E0PA 1G1YA 2D2OA 1ZU8A 5D9NA 3ARSA 4W89A 5JIWA 2ZIDA 1CIUA 4BQ3A 3BMWA 3S2CA 1W32A 5A8QA 3FNDA 3VIOA 1WZLA 5IHRA 4F9JA 4DO6A 4F9DA 1VFUA 3ZT5A 3FAXA 1WCGA 5A2AA 2VI0A 3CUHA 3PZIA 4AZCB 1CXEA 4EAMA 3LPPA 1AMYA 4QDMA 5E0CA 1CXFA 2YDRA 2CCRA 4BF7A 2EABA 2AMGA 1EQPA 2EPMX 2WCAA 2DSKA 3BSHA 4M8UA 2G8ZA 7CGTA 2PB1A 4UR9A 1JDDA 3M6DA 5C70A 3DECA 3VSVA 1K9TA 3WY4A 2FE0A 1UWTA 2EAEA 3KEHA 3RM9A 3I3EA 3T08A 2WC3A 2WHMA 4WJXA 2VCBA 3D52A 1TQWA 1V03A 2A3HA 1EDQA 2VZVA 4FNUA 5A6MA 4OBRA 3WD2A 3FN9A 4DO4A 4P8UA 2VRJA 3VDHA 1FH9A 4CN6A 3ARVA 3BAKA 4URIA 4ZE4A 3IJ7A 1ISVA 1E9LA 3T2PA 4L4PA 3MUIA 2ZUNA 4MNJA 2CXGA 1E0XA 1UWRA 3A22A 3W26A 4MTVA 2WMIB 4MB5A 1C90A 1J0YA 2GUYA 1FH7A 1HKMA 4HU8A 1XSJA 1CPUA 1ISYA 3WFLA 1XV8A 3OGVA 1B2YA 5LA0A 1XYFA 1MWOA 2VQTA 3L4WA 5E6ZA 4NRSA 3MSDA 4GI6A 2YOCA 1OT2A 3CMJA 2NT1A 3WDPP 1O7DC 1UR9A 5IDIA 2G3IA 2OWXA 2A3CA 2WMJA 4AW7A 2GJXB 5I2UA 2W66A 1E73M 4IUGA 2DIJA 2BXZA 3I3DA 1HVQA 3TTOA 1CNVA 3AISA 1HP5A 5BROA 5A6BD 4FNTA 1QI5A 3VX1A 3FW6A 1JFXA 1GOIA 2WLZA 2EACA 4AYGA 1W2VA 1I75A 1EO7A 1I1XA 2G3NA 4CCDA 3K8MA 4UOZA 1E15A 1W3HA 3LX9A 4LGXA 3AS0A 1QI0A 4CD5A 2J7EA 3AMDA 2PWGA 1H0IA 2J7CA 5M3WA 1EQCA 1C8YA 2A3AA 3SCWA 4U3CA 2WANA 5CLWA 2J7FA 2XVKA 3U7VA 1UZ4A 3BSGA 2OWCA 1BGGA 4BQ4A 3UG4A 4FNRA 3O2LA 1ISWA 2YBTA 2BY3A 3GNPA 2JIWA 1PJ9A 3VD4A 2WVUA 4MJ2A 3CHDA 4D1JA 1W9BM 1QBBA 3RPMA 1HXKA 4D1IA 1US3A 3AZTA 5TD4A 3IAQA 3CUJA 5A6AA 1DWIM 4AMXA 2F8QA 1X1NA 2ZUUA 1MFUA 1V6YA 3D3AA 4PTWA 3FAWA 2ZX8A 2QF8A 2XGIA 2D24A 3RO8A 4GZIA 4LXFA 3M46A 4WSKA 4C7FA 1MFVA 5GNYA 2WZHA 1AQMA 4DWSD 3ZJ6A 1WDQA 1OGSA 6TAAA 3WBAA 5DFAA 3ZT6A 3T0AA 3SCPA 4TX6A 1B3ZA 2WHKA 4QLKA 1XD0A 2PC8A 1JI1A 2YLLA 2WAGA 3SCRA 3VIJA 3IJ9A 1JXJA 3EJPA 5CPSA 2NT0A 1V3KA 1Q4NX 3VDAA 3POHA 5A6KA 4PCTA 1VAHA 3AZRA 1M01A 2XVNA 3ZQ9A 1HKIA 1C91A 4BZYA 4FLSA 1VFOA 2PBOA 3K1DA 4H8HA 3CUIA 4GXPA 5D9PA 5AC5A 5EFFA 4BS0A 1MVYA 4PMXA 4HZ8A 1W9XA 4J3UA 4H8UA 3W28A 2WVSA 1OINA 1B3VA 1LJYA 1YQ2A 4ATDA 4AIEA 4MB3A 1BHGA 1KWKA 2CBIA 3CZEA 1H0GA 4H04A 3VKKA 5D9OA 3VGDA 3M07A 2VNCA 3WNKA 1FP8A 3WEZA 3A4XA 2BVYA 4AZBA 3WF2A 4AIOA 3CHCA 3VD3A 2OLHA 1JD9A 1XH2A 5IFTA 2DIEA 3AROA 3S5ZA 2D20A 5EBAA 4J3WA 2MANA 4W85A 3AICA 1FH8A 2OWWA 1SR0A 1JI2A 1F4HA 2DT3A 1GJUA 2VQUA 4CCCA 2WMFA 1G01A 4YHGA 1H41A 3BLBA 5BRPA 3AMKA 4HOZA 1U2YA 3GXTA 4Z2LA 4GZEA 3LRMA 1VBUA 2VC9A 4QLLA 2F7RA 4JFTA 2J79A 1J0ZA 1SYTA 4P7NA 2DEPA 1KCLA 4NXKA 5A8NA 4OIFA 2ZUTA 1HN1A 3WH9A 2CIPA 1V0NA 3GBEA 1HNYA 2V3DA 2V5DA 3L4UA 4B9YA 3UERA 3LXCA 2BVDA 2J47A 1QW8A 2VRQA 2EXOA 3VPLA 4AXNA 1JFHA 1E6SM 2YA2A 1BPLB 1UH3A 1BG4A 2UY4A 1CXLA 2O9RA 2WMGA 2OYKA 1DP0A 1JDCA 1W1PA 3OBAA 5HBFA 4B9ZA 1NP2A 4HTYA 3THDA 3H55A 3W37A 1WZKA 1HKKA 3AJ7A 3K4AA 5DMYA 1CBGA 1JZ7A 2ZE0A 4XV0A 2WMIA 4HA4A 1PZ2A 4OGZA 1BQCA 2WCGA 3BUIA 1VRXA 2IXUA 3GNOA 4ML4A 1R87A 3WY3A 4TTGA 1EGZA 3SEPA 4JIEA 4NI3A 2Y2WA 2C0HA 3PZUA 1NOFA 1SMDA 4UFKA 4HZ6A 4JCLA 3A4AA 2G4FA 4U2YA 1GORA 1RH9A 3ARUA 4YPJA 2OSWA 3RCNA 1UWUA 1UR1A 2EADA 1HF6A 1VIWA 5C8BB 3LPOA 4KMQA 1TVPA 1KGXA 1Q6DA 2YLAA 3N1AA 3PHAA 4W5UA 4AZHA 1E4IA 2WHJA 1U30A 3GBDA 1NM9A 5A1AA 1JF6A 2J7BA 1UH4A 3SCVA 3E1F1 3DX3A 3AIQA 4PN2A 2JEQA 3PZNA 4PUEA 1HWWA 1WB0A 4UQBA 1E0WA 3BAJA 2VZTA 4LQ1A 3DYMA 1ZJAA 3VDBA 1B9ZA 1PIGA 2WKLA 9CGTA 4E2OA 3OA5A 5AYBA 1W91A 1QHOA 1LLOA 1PPIA 4CU6A 5BXTA 1J18A 2XG9A 3BUDA 3WDQA 4PTMA 1WZMA 4OBSA 3WQ8A 2DSUA 3CHFA 1E43A 2QV4A 2J78A 4W7VA 1BLIA 4PBGA 1J01A 1CECA 2EJ1A 3FHQA 1GQLA 4JL2A 4KGLA 1QPKA 4UFHA 3ZSSA 1JZ5A 2BS9A 2CBJA 4NRRA 3VOCA 1NWSA 2EO7A 5FL0A 3AHTA 3HG4A 4DM1A 4AZ7A 1CGUA 3LXBA 1QOXA 3VD9A 4UFIA 3OIHA 3TTQA 1VEOA 5ABFB 4AEEA 1QBAA 1KQZA 3RM4A 2RGLA 1NWRA 3TP4A 3RILA 4DUXA 1CXKA 1UR8A 4D6HA 4QCEA 1XRVA 4BQ2A 3W4RA 3SIMA 2DH2A 4DUWA 4PMYA 1UD2A 4MAZA 1V6WA 3J7HA 3AHVA 3AYSA 1UOKA 1TCMA 3WNLA 5ECUA 1UKQA 3W0KA 2VX5A 4JAWA 4P7QA 4HA1A 3SCQA 4F79A 2JF6A 3MUY1 1KXTA 4HZ7A 5C71A 3W6LA 3VNZA 5I79A 4FK9A 1E1EA 1W9UA 4AZGA 4A4AA 4FMVA 2CERA 2CHNA 5I6SA 1HP4A 1KR1A 2CBUA 4FNPA 1JYXA 3W38A 1RPKA 2F1AA 4XB3A 1PBGA 3AOFA 1E5JA 3GH5A 4YHEA 4CCEA 1DEDA 2J75A 3PTMA 1VJZA 3B9EA 2WSPA 2XN0A 1R7AA 2O9TA 3UCQA 3T0DA 4MDOA 2J8FA 2YFOA 4V28A 4DO5A 1E0VA 1G0CA 2W63A 3CTTA 1CGTA 1MXGA 1XGZA 3OLIA 4C7GA 3CUFA 1GVYA 4NZFA 2EPNA 3NSMA 1NARA 1W9PA 5ABHA 1E3XA 1KCKA 3WUBA 2WKGA 4MB4A 4OOUA 2WMKA 3H54A 1BTCA 2DT2A 2O9OA 3T0BA 1UR4A 4UNIA 3L4VA 1L0PA 4ATWA 3HN3A 3WMSA 3KWXA 3VDCA 5KEZA 1XH0A 4W8BA 1BFNA 2D22A 4UCFA 4CD4A 3BVVA 1TA3B 2DT1A 3W27A 3AQUA 1LL4A 4CN4A 3UESA 4E4PA 1UR0A 3PZ9A 4LX4A 4WF7A 1SMAA 4DM2A 5ABFA 3VVGA 4CD6A 4ACYA 3WFZA 1UR2A 3WSUA 3ARTA 2ZXBA 3A23A 1TMQA 4PRWA 3A24A 1GOMA 4OKDA 1HX0A 2OW6A 2WVTA 2CPUA 1ZBKA 1JZ2A 1R85A 1V02A 3KL3A 3AIVA 1UG6A 1JZ3A 3G6MA 1XH1A 5CXPA 2EEXA 5FD0A 5F7UA 4QLJA 4JCMA 2D23A 2BHUA 1XCWA 1JDAA 3BVUA 3A4WA 2XYLA 5CZKA 3K8KA 3TTYA 1GZJA 2W91A 1S46A 4EANA 2XHYA 1N82A 5LA2A 3ZJ8A 3BUPA 4IISA 1B1YA 3NYDA 4KRUA 1V3LA 1V3JA 5D9MA 3BVTA 2VCCA 1E6PA 4LPCA 2PF0A 2W4XA 2ZXQA 3GXDA 4FNSA 1LL7A 1V08A 1F4AA 4V27A 2CNCA 4GKLA 1LG2A 2GJXA 4CGTA 1CDGA 1KGWA 2JFEX 4PMNA 4W84A 5E9AA 2WLYA 5JUVA 1M04A 3G6LA 5IFPA 2XPKA 3GM8A 2F18A 1LG1A 5CQ1A 3VMPA 1E6QM 3WEOA 4HA3A 1H2JA 4W7WA 3DHPA 1Q6GA 1UD5A 4W93A 1GOQA 1EA9C 3OB8A 3OZPA 3GZAA 4E8CA 2VT0A 3QOMA 4S3JA 2FYVA 1W9DM 1Q6EA 2WSKA 6A3HA 1JZ8A 2JE8A 3BC9A 4AZCA 3DYPA 2VVSA 3WBEA 3EMZA 3WY2A 4ZXLA 3AIWA 1WNOA 4RE2A 3CHEA 1B31A 4AEFA 3AHXA 3ZMRA 1EDTA 1O6IA 5D4YA 4GIAA 2JALA 1XC6A 3NJ3A 1R33A 3MSGA 3KZSA 3LRLA 2WHLA 4HOWA 2JIEA 1AQHA 2V3GA 3ARPA 3LPFA 1KTCA 1TA3A 3ALFA 3NCOA 2FHFA 3QHOA 1OBAA 4LYRA 2QMJA 1CXHA 3IGUA 1M03A 1O7AA 3N18A 3QR3A 1NOWA 5A95A 2Y24A 2QPUA 3QHNA 1QI2A 3W82A 5FKYA 2Y5EA 4JKLA 4OUEA 2BV9A 3L4TA 2Q8XA 3MMWA 1G5AA 2VRKA 1VB9A 3MS8A 3WH6A 1J0KA 5CGMA 3GYCA 1QHZA 3CO4A 8A3HA 2AOSA 1JZ4A 4S3KA 4UQEA 5A6SA 1FHLA 4IPLA 5CJ5A 1WAWA 2GVYA 3EDJA 3ARXA 3WEMA 2CBVA 4H7VA 2FDMA 4J3SA 5BRQA 1QHPA 3CBWA 2DPEA 4XX6A 4D6CA 1OT1A 3MI6A 4UQAA 1J11A 1GONA 1HJWA 3MU7A 4UZSA 3L2LA 4JKMA 2VR4A 2HISA 1FFRA 5DF0A 3CGTA 4WKHA 2VX6A 3WMBA 2J7DA 1TFVA 5A2CA 1KXHA 4TVUA 2VZOA 4PMOA 1E40A 4CVUA 4TVDA 3A5VA 3VO0A 2BY0A 1E6NA 1ECEA 5CSUA 1CXIA 2GJPA 3D4ZA 3VU2A 3MMDA 3D50A 1DWFM 3VTRA 3VM7A 2GK1A 3DX0A 1GUVA 5KZ6A 1VEMA 4AIUA 3GXIA 1KWGA 3T2QA 2O92A 3O9NA 2XWEA 1B3XA 1W3JA 3DX2A 2E8YA 2GSJA 3N9KA 1MXDA 1W3LA 1KGUA 1UUQA 1JGIA 2CESA 4GQRA 4U5KA 4C7DA 1W1YA 1D2KA 4X0VA 2WM0A 5A6LA 1A3HA 3ARYA 4AWEA 5A8OA 5A6BA 5BXRA 4ACZA 3JUGA 3UR7A 2WW5A 3WL1A 1ZL1A 5A94A 4EE9A 2ZXAA 1MW1A 2XN2A 4W7UA 1VFFA 1KXQA 5M03A 2AAAA 3ARRA 1NWUA 3FY1A 1WDSA 3NDYA 2G41A 1UKPA 1W9VA 3VSTA 3RJXA 3TV8A 3POCA 5FCZA 1UKSA 3L4YA 4JL1A 3B8SA 4HPGA 4N0RA 1OIMA 2E9LA 2W92A 3BAWA 3CUGA 1V6XA 3WL0A 3UETA 4J7RA 1BVZA 2Z1KA 1R75A 3F5LA 4GPNA 4OZOA 2VVNA 2D0FA 4CVWA 3PZOA 1AVAA 4TXEA 4MPKA 3WH8A 4H8VA 4UQDA 1HJSA 4AMWA 3WDJA 2F7OA 3PTKA 3IAPA 3RM8A 3N11A 4GO8A 3WUFA 2WK2A 1E6RA 1E6ZA 4HMCA 1TQTA 1E4LA 3VD5A 1J0HA 1JIBA 1KFWA 5EMYA 5A69A 1OD0A 4GZJA 4EK7A 4PEEA 1TZ7A 1ZBCA 1K9EA 3FXYA 1ODZA 1BYAA 5BWFA 1UQZA 4TTUA 3EYPA 3CZJA 5AYIA 2ZWYA 1PS3A 2WCSA 2VX4A 1DWJM 4M24A 4TUFA 2CYGA 5A8MA 1HJUA 3WNPA 4DWSA 2Y8VA 4Z2HA 4XUYA 5A3HA 1OGBA 3MV01 1NH6A 2EPKX 5IHSA 1DWAM 2ALWA 5GPRA 4UFLA 3U57A 4Z2IA 1J0JA 3F4VA 1LL6A 3RDKA 1V0MA 3SCOA 2XWDA 4P7OA 3CH9A 3BUQA 3KE0A 2DSWA 4PSRA 1JF5A 2ZX7A 3HMCA 3EMQA 3WF1A 1GOKA 4XZWA 1GJWA 3WMCA 4UFJA 1OCQA 2ZXDA 3ZT7A 1ITXA 5I3DA 3WUGA 1HT6A 1V3IA 4ZE5A 2YA1A 3MV11 1B3YA 3W81A 1JAKA 3U5UA 2VURA 3BAIA 4ZFMA 3VILA 2E4TA 1X6NA 1VFMA 4J3VA 3S6TA 3BH4A 4HU0A 3OG2A 3I3BA 2J25A 1JNDA 1QNPA 1EHNA 3AMCA 4WK9A 2X09A 3GXPA 5E1QA 2DH3A 2DQXA 3DDGA 3PBGA 3LMYA 4MNLA 3CPUA 1XYZA 2YL8A 1G9HA 2F1BA 3A21A 1K9DA 2V38A 3PN8A 4AD1A 4KH2A 3ZSTA 2GFTA 2ZOXA 1BGAA 3LRKA 2VCAA 4RL3A 1US2A 2BHYA 3WH7A 3ARQA 3II1A 3ARWA 3A47A 2V5CA 5HPCA 4PTXA 1HXJA 1GQKA 3VUPA 5I23A 4IPNB 3N13A 1OB0A 3CZGA 1PEZA 5A6JA 5E6YA 5CLTA 3CMGA 1R86A 2TAAA 2GJRA 2BFGA 2XIIA 1OD8A 2W61A 2ZICA 3OLEA 1V0KA 5FIPA 1EOKA 2D73A 1JNEA 3EBVA 1UA7A 4UOQA 3GNRA 1H49A 4PYSA 2CHOA 1XD1A 4CUCA 3EDEA 3TA9A 2UWFA 4UOJA 2XN1A 3WF3A 3A6OA 3AHZA 1H11A 4PMUA 2ZX9A 1BYBA 4QCFA 3FHAA 4LYQA 1RP9A 4H2CA 1UYQA 3N12A 4M29A 3SURA 3RIKA 2VUYA 7TAAA 4Z2KA 4WIWA 5DT5A 2WC4A 5E0FA 1R47A 5BXPA 4JHZA 3WNNA 2OSXA 2UY2A 2E9BA 1B0IA 3HG5A 4AYSA 4WLCA 3ZJKA 2E8ZA 5M5DA 1WDPA 1VJSA 1E55A 5GQBA 3WQVA 3AMLA 1I1WA 2QLYA 5I5RA 3K46A 2BNJA 1TUXA 4R5EA 1CGXA 2ZUSA 3U7BA 4PMVA 4IM4A 4HOXA 5HDRA 5I24A 1HL8A 1ESWA 3WELA 2ZX6A 2PWFA 1ZJBA 3BLPX 1QW9A 2IXVA 1KR0A 1Z32X 1UZ1A 3TTSA 1JYNA 1CGWA 1H5VA 4EKJA 3K4DA 1HTYA 3WN6A 1H4PA 5BYWA 4DUVA 4P8WA 2Y8KA 2XM2A 3OLGA 3VIPA 1IT0A 3UG3A 1GCYA 1PX4A 3PZVA 3S5YA 4DWSC 1UH2A 3BXWA 4B3LA 5A2BA 1VEPA 1KBBA 3AIRA 1HL9A 1NQ6A 2A3EA 1QVBA 4KRTA 3BCFA 2RGMA 1CZ1A 1V3HA 1GHRA 1VBRA 3APGA 5I0DA 1W1TA 1V6VA 1W3KA 4FLQA 4D6GA 3AXIA 2X05A 1R34A 3CZKA 3DX4A 4ZEPA 2ZUWA 1UA3A 2J62A 4N42A 4TVCA 3BGAA 2BXYA 1WDRA 1HJQA 3CC1A 2WBGA 4UTFA 1WKYA 1GOWA 1JD7A 2F61A 4NSBA 4E8DA 3F5KA 1TQVA 3N17A 1DTUA 3O6AA 3BAYA 4X9YA 3ZOAA 3IANA 1YHTA 4UFMA 1WO2A 1UD4A 3MUZ1 1FFQA 1CGYA 3SCTA 5BXSA 1JYWA 1R7OA 1HVXA 4U3AA 3PZTA 2EPOA 2FGZA 3THCA 3KL0A 2X2IA 3AI0A 1X6LA 1B90A 3NIYA 4CKQA 1K9FA 2E3ZA 1MW3A 2XTKA 1FP9A 2O9PA 2WWCA 4QP0A 3W24A 4U5IA 3AIBA 3GDBA 1W2PA 3QOKA 4K68A 4BA0A 3VSUA 2DGAA 2GDUA 3WENA 1IZKA 2BHZA 1TE1A 3WD3A 2DSZA 5EB8A 1ISZA 3ALGA 2YL6A 1PX8A 1PX3A 3L2MA 1GHSA 5IXEA 2WB5A 1FOBA 3VM5A 4NX0A 5BCAA 2DSVA 2XFFA 3WDHA 2PWDA 1W1VA 4JZ5A 2Z1SA 5DT7A 5AY7A 1M53A 3KLKA 1QNSA 2GDVA 3GXNA 2XSBA 3VIFA 2BY1A 1PIFA 1E1FA 1QNRA 4Q22A 4U31A 1CTNA 2W62A 3B9AA 3WD4A 3VGHA 3TOPA 2FGLA 4D72A 2QPSA 2PI6A 4BQ5A 4JHOA 3U5YA 4JFSA 4PMDA 1E5NA 4OJYA 1QWUA 3ZO9A 4F8XA 4KGJA 2WVVA 1LWHA 1CEOA 4ZENA 2Y4SA 1HIZA 5DEZA 5JBFA 3W25A 1VF8A 3VGFA 8CGTA 1L8NA 2XSAA 3BCDA 4PSPA 2VR5A 1GOOA 3NUKA 2VJXA 3WF0A 4JKKA 4P8VA 1NOUA 3ECQA 1WPCA 1C92A 1GPFA 4QFUA 3NDZA 1WZAA 1CGVA 3D5HA 4FF5A 2J8GA 1UWQA 2X2JA 4U2ZA 2EPLX 2YIHA 2WMHA 3MKKA 5I78A 3CLWA 1BVNP 4WSJA 2IUZA 1JYVA 4AD5A 3VX0A 3VIHA 2YKKA 4JFVA 5E09A 2D0HA 4FLOA 4WKAA 3GTNA 3VMOA 1G94A 4AZIA 2V3EA 3CZSA 4NXSA 2BY2A 4KWUA 2VMFA 5JBDA 3SCSA 2JF7A 1JZ6A 2FH8A 3CIVA 4HMDA 1PAMA 2ZWZA 1ZBVA 1GQJA 3D4YA 1TQUA 4HP5A 4M80A 1BYCA 2B31A 2YDQA 2X8RA 3KL5A 2G3MA 4TX8A 1OSEA 1OM0A 4FLRA 1E3ZA 2YA0A 1XCXA 2EBNA 2F2HA 3UEQA 5CPQA 1NWTA 4ZXOA 2X0YA 1H09A 1D7FA 3ZM8A 3LPGA 3AHYA 1IZJA 1MW2A 5LYRA 3VD7A 1XSIA 2WXDM 3ARZA 3VGBA 7A3HA 3ZR5A 4X0NA 3AIEA 1JG9A 4PMZA 2J7GA 2E9MA 1QWNA 1E4NA 1UKOA 4DWSB 1E56A 1ZBWA 5HXMA 4J3TA 2E40A 1EOMA 3W53A 2NW0A 3EJUA 2J7HA 5I77A 4J3XA 2YFNA 3WDRA 2D3LA 2XIBA 1CWYA 3MO4A 1NP0A 3WDIA 3F5JA 1UKTA 2C8NA 1RD6A 2X0HA 4PMRA 1JAEA 4W8LA 1XSKA 1V3MA 4RE3A 3IJ8A 2CKRA 3AS2A 4AZ6A 1XHGA 4XZBA 3T09A 3WY1A 2YJQA 3SUUA 4UQ9A 3BVXA 3WUEA 3WQ4A 1JL8A 1LF1A 3EJQA 3HZ3A 5D8ZA 1J0IA 3VNYA 3VIKA 4AD0A 4ATLA 3DYOA 2WZEA 4M56A 3GXMA 1QX1A 5FOOA 3T2OA 4AD3A 2CKSA 2XUCA 2XVLA 1FA2A 2YDSA 3DC0A 1UWSA 1HKJA 3CZLA 3WD0A 3DDFA 1MYRA 4MDPA 1EIBA 1VENA 4L4OA 3W6MA 5M17A 1EO5A 3AYRA 1UASA 1V02E 4GI8A 1MQRA 3A3HA 2GK1B 4HPHA 1J9YA 4LYPA 1GVIA 3PZQA 5CPTA 1TR1A 2XVGA 3EMCA 5CSYA 3MMUA 4AD2A 1E6XM 4Z2JA 3TONA 3QHMA 4WKFA 2EQDA 4D6JA 4B3KA 1IV8A 3RJYA 1C93A 4Q7NA 4F66A 1R8LA 1M7XA 4A3YA 1PZ3A 2WPGA 4W8AA 4H41A 2XFYA 4P7LA 2D3NA 1LWJA 4AD4A 2CITA 2PWHA 1P6WA 3W29A 4JFWA 3OZOA 1RP8A 3MUAA 2ZUVA 1E70M 4W88A 2CEQA 2WWDA 3EJSA 2WYSA 1OWQA 4UQCA 3K8LA 4RE4A 4JFUA 4MNKA 2UY5A 3VGGA 2YBUA 1WE5A 3WF4A 3EDKA 1TG7A 1GQIA 2DT0A 4W86A 1T0OA 1C8QA 1UWIA 1Y7VA 2X2YA 5ABGA 2NSXA 2X1IA 2F7QA 2FHBA 3NSNA 2J77A 1HJVA 1V0LA 1KQYA 1QI4A 4GQQA 4R27A 4GINA 1EDGA 1OGGA 1TQSA 4D6DA 1ZB5A 4D71A 3N15A 1ODUA 4CD7A 1UD6A 2CETA 1E72M 3WNOA 5A8PA 3N04A 1UD8A
chains in the Genus database with same CATH superfamily
4JTEA 1WUEA 2V7HA 3AVEA 2B9BA 2WC7A 2K1MA 2Y7NA 3UJTL 3AZSA 1JRHI 4Y5VA 2EG8A 4NSKB 3ONBA 4I77H 3ATBA 4OLWH 3TYUA 2P5WA 4X4YB 1KTBA 3S37X 2DUXA 1BBJA 2OW7A 5HDQH 2BP0A 5D05A 4U1KB 1BAFH 1BX2A 1MCOH 3FOLA 4CMMB 2YGNA 3VINA 5E4IA 1WKFA 3A5FA 4LNVA 2HUHA 1VADB 3Q58A 2BSDA 3FOMA 2DQ6A 3GDCA 1DVXA 4QOKE 2V81A 1UWEL 1C3FA 3DHUA 3SO7A 4JJOA 1PSKL 4ONHB 2QKIB 5CGBA 2J5WA 1GNXA 3GU2A 4MIMA 3REWB 4MJ4A 4QKXB 5JLZB 4LRNL 4XMZA 4R7WA 4GJJA 3WJSA 5FYKH 4BCEA 1ZS2A 4RMRA 2DW5A 3EJZC 4JLRB 1I9JH 4GQ9L 5IHBA 4RDQF 5LN8A 1CD1B 2XIDA 1DQDH 4N2DA 3AXHA 2BVTA 3C12A 5C0EA 1MFDL 4JDEB 4NAMA 4HZLA 2WZIA 3AU2A 3SCUA 4CD8A 3WBYA 1ISXA 2J4GA 4Z0XB 2V3FA 2C4XA 4LCWD 5AAMA 1WBJA 5JMUA 5I07A 2DKMA 3KLLA 2ZQKA 1A3XA 3C86A 4IQLA 3BVWA 1ITUA 4GMEA 1MQQA 3TT1L 3BEWB 2WBKA 3RIAF 3FYYA 1I8LC 4MF4A 2FB4L 4FG6D 4X99B 1A1MB 2NNCA 3C9NB 3WQDA 3VD2A 2PC4A 4QR6A 3AFBA 1DBKH 3WG7B 3ZZSA 4RZBA 1C7SA 1S3RA 1QRNB 2ZG3A 1OK8A 4GAAA 2XJ7A 3NSXA 3UABA 3UTTA 3CMFA 3K5XA 1KC5H 2P24B 2YAPA 1EUNA 3HJEA 3SD5A 1WUNT 2XTLA 5CZRA 5D7SH 3T6CA 4TOQA 4B5XA 3DIVA 3P4NA 4WFED 3EB2A 2NUTB 4XN5A 3UXLA 5ABTA 3N3EA 1B57A 1G9MH 5JBEA 3FFCA 1X9UA 3PG2A 4HUXB 4P2QB 1R2TA 2PZ0A 3UJ2A 4ECLA 4PTVA 5C9UA 4Q32A 1GGBL 3F1QA 3HCVB 2QPFA 3GS4A 3T65A 3GY1A 1EX0A 3WQ5A 1IC0A 5AG8A 3F6IA 5CBEB 5FM5M 5HPOA 5TIMA 2HCZX 1UR3M 4MFDA 1IEWA 4JFQB 4IIQC 4R88A 3H2CA 4A05A 3SUSA 4LEXL 4Z0BL 1XF5A 3X1EA 2GWNA 4FR6A 2OMXB 2WKJA 1NKOA 1UC5A 1HQRB 2YXWA 3P14A 2DQCH 2PETA 2C1HA 1J8RA 2PBGA 3H9SE 1NBQA 2ZUMA 1RU9L 2GUBA 3RNKA 2GW5A 5GS0L 1M1BA 4FD0A 5D1ZB 1HGWA 2H8PB 4JO3H 1R5VA 4G9DB 3W53A 3NQ8A 5HWMA 1EA0A 1PKOA 4UZGA 4DFIA 4A3HA 4EF3A 5HGGS 4CNSA 5M2FX 3GMOA 3L4ZA 3IWUA 3PFQA 3WJMA 1NFGA 3AIUA 4LVGA 4TIMA 1BWWA 4YPGA 3VKBA 4PLNC 1I3VA 2B3IA 3C8HA 1TJGH 3STGA 4MWAD 1DSWA 1EH9A 1LILA 4C4BA 1FVCB 2X88A 1DE4B 4RNIA 5E70A 2JJTA 4BK5C 2DIBA 2R0ZL 4QJ1A 2LV4A 3WNJA 3W70A 5EMUA 2BSCA 3KHQA 1UD3A 1CFQA 1N5AA 1T1XB 4JFED 2WXNA 5EO1B 1PYFA 4QRTA 1TYRA 1B9KA 3CFKB 3LMJL 1VBHA 5IDZA 1OT4A 3OXRA 4TNWK 2E86A 3H3KA 2R8SH 1D3CA 1YPFA 3IVSA 3O0FA 3ISRA 2OI9B 3PZMA 5EC1B 3NZUA 1WICA 4J4KA 1J8VA 5TNVA 4I1PA 3WH5A 3LU2A 2G4JA 5E8DH 4WEUD 1YDVA 1HC1A 2IBGA 5IB3B 3F85A 4M81A 5HJLA 3KDPB 2GJLA 1H5BA 1U93A 1RJQA 2UY3A 5BRBA 3TH4T 1AP2A 4PJFE 1CLZL 5LGZA 1AGCA 4O4WA 1T03H 1OW0A 5F4XA 1M3JA 2X38A 1ZHBA 3P0VL 1Z9AA 3KOWA 2A6KA 5CC7A 2ZPKH 3OKKB 3HQPA 4Y7EA 3T5WA 2F7PA 4NHCH 5AOJA 2OMVA 2DTSA 2AV1B 2FYYB 3FQNA 2AF2A 1JHLL 4YHZH 3UYOD 3TBVA 3GHUA 5IJVA 3VIIA 2FEJA 3MJ8B 4YSOA 2FB2A 3LSBA 4Q97A 4OV9A 1V6UA 2NV1A 2Y7FA 1PZ5B 2NY0C 1A6WH 4TNWF 3EYSH 5I17A 1E4MM 1SZRA 2Q3RA 5I71C 1DOSA 1OGAE 4M9PA 4Y16B 3RUGB 1OFEA 2JKJA 4LPVA 5F6IB 2R23A 1K70A 1MQ8A 2Q6ZA 4O1FA 1FRBA 3MP5A 4Z1DA 4Z2GA 1B3IA 1XLBA 3AMGA 1CENA 1KGIA 3PXLA 4UB0L 5HVHB 5JMRA 3WLSA 1CLVA 1FL5B 4MQTB 5KS9A 3RYSA 3LV3B 5E5MB 4QRRD 1ZANL 4WKZA 4Q8NA 4DSYA 3B06A 1U33A 1C7TA 1KRCC 2DW7A 4Y9EA 4YHLH 2CRMA 4G6AD 3I68A 2YEZA 5EU6B 2ALDA 1QUPA 2H1PH 4ERAA 1BYDA 3MWAA 4DVRL 3RWEB 4PJ9B 3WIJA 2ATSA 4FXJA 3FZUC 2TRSA 1GC1C 4PVLA 4NJAH 2XZAL 4X8XA 4ZMYA 3G1XA 5DRCA 4BHYA 1ZT7B 5AW9B 3NAAH 1L9RA 1E4JA 5LCVH 2OLAA 2AEIT 4TRPL 4NNAA 1H3XA 4Q0XL 4G83A 3E6HB 3ATYA 1XLHA 5EO0B 5C9XA 5KITA 2D0GA 3WTVA 2ZC1A 4DB7A 1A0QL 2NY0D 3FQWA 5AC4A 1YEFH 4GXFA 4JUSA 3S9ZA 2ZRUA 4H0IA 4J4PA 4MWAB 1YNQA 1OALA 5C0BB 4AQLA 4GAGH 5LWYH 1RHHA 4WZ9A 5D1QD 4Y4KB 4Z6AT 3ZKQD 1J5CA 5GGTH 2QJIA 3MO1B 1OWRM 1AD4A 1NGWA 4H7CA 3WCYA 4NQDB 5AAWC 2XICA 3P67A 3GMNA 1ZHNB 3ARSA 4OJEH 5LGKA 1KJ2B 1JK8B 2ZIDA 3DROA 4AIBA 4RDBA 2V30A 3BMWA 3PAZA 5G4OA 2AV1A 2Q6WB 4D9RD 4LS1A 1OOWA 4GQGA 5AKRA 1TVHA 1U3ZA 3T77A 4AH2A 1CMOA 1E1CA 3C2OA 1AY1L 3L0GA 3G18A 4G6ML 3FAXA 3GK0A 2OL3L 3J27A 3M17B 1P7KA 4DGIL 2Y7LA 4HUWB 3IGXA 1BLNA 3P30H 1OZQA 4AZCB 2AQTA 3NIFF 1TWWA 4IOFD 3SYCA 4TNGA 3PG8A 4XPAH 4PJ8C 1M68A 5KSWA 5E6IC 1V77A 1LM1A 15C8L 1CXFA 3H2WA 2ZOTA 2B15A 4OLUL 4BF7A 1MEXH 4JJ5B 2ZZ2A 1S9XA 1GRWA 4CADB 2EPMX 3PWUB 3WTYA 1UURA 3S5LG 4CDGC 2WCAA 1DIDA 1S2UA 1YTEA 2HWGA 3WLJA 4PE8A 3VFWA 5D7LA 3BSHA 1SHMA 4DJMA 7CGTA 3R5EA 1Z9OA 1SPQA 2YAFA 3VI4B 1JDDA 2NR6A 2DM2A 3JR2A 1Z0NA 3M6DA 2YK1L 3DXAD 2RUSA 5C9KA 4NQCA 1YBQB 4UTUA 2DTMH 1B4LA 3EG9A 3LLDA 3FO1B 1WJ3A 1EC9A 3VI4F 4Z0BH 4W9DC 5BQ7A 3OKNA 4AJYV 1VRDA 5F1VA 2EAEA 1NCHA 1XYMA 4KHXH 1DYZA 3T08A 4ZSUA 2WHMA 1DN0B 3ATZA 4WJXA 2VCBA 4HWEH 2XETA 4Q8QA 3NL5A 5ADOL 4QG8A 4DY1A 4FABH 4NIRA 3OJ2C 3HB3C 1EJ8A 1T6MA 1N6QL 4B0MB 4ZTEA 3NPSB 1BVOA 2HMCA 3KBNA 1N2RA 4GLRH 4K4KA 3A12A 4G7EB 4KCUA 5L7XL 2FFIA 5EIIA 4MD4B 3KPLA 4Y5XC 3N9RA 3I6TA 3NZGA 3VDHA 3UCDA 4CN6A 5DMLA 3BAKA 3GVRA 3W2LA 2G0WA 4NX5A 4B2DA 1MXSA 3AW5A 4NRYB 3T2PA 2AQRA 3JWNC 5J9PA 4K5PA 2NUTA 3ULVE 4L4PA 1H49A 3WIAA 2ZUNA 5CZJA 1SF5A 1AO7B 1GS6X 2CXGA 3GSQA 2V2TB 4AQAB 3QC5X 1A4BA 4N1EA 5E9DA 3TURA 5DBTA 1NANH 1NY1A 3WSQH 5DLCA 3W26A 5AVZB 2ETWA 1VLXA 3MLVH 3P4MB 1Z9SB 3W57A 1CVRA 4TSCH 4YJ5A 2XKNB 5I8KH 2GUYA 1NGXB 1HKMA 2POZA 1BIHA 4FTVA 4PRAB 2Q8BH 2J5LB 1CPUA 1E5BA 4HK0A 5CEYB 2R56L 5L4IA 1AR2A 1ERNA 1ISYA 1LO3H 3TW6A 5B3JF 1XG3A 4OB5L 1JCLA 2VEFA 3O81A 3CZFB 1B2YA 3S1WA 1MWOA 5KYUA 2VQTA 3BWAA 5JYLA 3GFYA 1URIA 2VE6A 5I8OL 4NJJA 4S38A 4XZNX 2PYEB 3L4WA 4XMLH 5E6ZA 2IADB 1C9DA 4NRSA 5D4IA 3VFVB 3MSDA 2Z34A 3OG6B 4GI6A 2YOCA 1WX0A 1GH7A 1OT2A 3QJTB 4LESA 2OEJA 2YGYA 3H7RA 3UA4A 1F4XL 3BH8A 3BIKB 3MGTB 1DN2A 1O7DC 1YMYA 2L7QA 4PJCA 1U8CA 3CFBB 4RV3A 5IDIA 2XA3A 4WU7B 3U6WA 2SEBA 1DBML 1F2QA 4B5ZA 4Z0SA 2OWXA 4J3OF 2E7LC 3N2XA 4LVEA 3UC0L 1F4WL 5I2UA 4R5XA 3BO8B 2W66A 4OZIF 1HILB 1XGRA 2JV6A 5FW7A 1E73M 3TIEA 2JKPA 3D2TA 1R3QA 1HYRC 5E1GA 3L9EA 5EU4B 3TTOA 3N91A 3FCUB 2JJWA 4HBCL 3L13A 5A6BD 4ODWB 3QJQB 3V6FA 3FW6A 4A66A 4G6JL 3C61A 4PUBH 4TRPH 1JFXA 3W2NA 2XWRA 2OFQA 3OB0H 2FB4H 1YECH 1QRNA 4V1DA 4YSDA 3TEVA 2JNZA 2YPLD 5EC1A 2E5BA 1JNHB 4XVDA 1J7VR 1L7TL 1OD7A 2P1YA 3H2PA 5A3ID 4W4QA 5DCDA 2P52A 4BWTA 3K8MA 1T8QA 1E15A 5BS0D 2ZKWA 3T1FB 3QIUA 4P5SA 4MA1C 4DZBB 3IDIA 3BGMA 1I9CB 2G3XA 1O9WA 1QI0A 2PFHA 4LGXA 3AMDA 1QWKA 4IK7A 4JPKL 3P4OB 3CEUA 1LQSR 2AXGA 2J7CA 3M0IA 1EQCA 2ATKA 4JMXA 2MCPL 1C8YA 4R2GB 2A3AA 3SCWA 2CO4A 3HUJE 2VD9A 4NFBA 2GC4C 2DN7A 1WWAX 5I3JA 4JZNA 1DSFL 1AHMA 4LRTA 2VLLA 7REQA 5SX5K 1F58L 3EUUA 2FKPA 1TDQA 1ZK5A 2OJZH 1KRMA 5F4WA 3RJQB 1UTDA 1MIMH 4ZSOB 4M3HA 4IHOB 4K9EH 5IVOA 1UZ4A 2B59A 3U7VA 3IIXA 2Z7UA 1OK0A 4ERSL 1Q63A 3OC5A 5CZVH 1YY9D 5LBVA 2YBTA 2EYSB 3IS0X 3PBYA 4XXDB 5I76B 4MFHA 4O19A 2F53B 4UTCA 4K8GA 1JRHL 4QGYA 3SDAD 3VD4A 1S1PA 2G60H 4XSMA 4DNMA 3BXNA 3ZL4L 5KSBA 3X17A 1QBBA 1JNJA 4QGCA 5LDSA 4C91A 1HXKA 1NCAH 1E27A 1ZSDA 3AG1B 4PTUA 4IMKA 4RV8A 3QQ9C 3NOYA 5DSCB 3FU5A 1OK6A 2VP8A 2H41A 3DGDA 4ZQKA 3L68A 3URAA 5EOTB 3AZTA 3FH8A 5EG6C 2NZ1A 3WTWA 1ZPTA 4A6YL 4HNNA 4OU1A 1F1GA 3ME3A 5MERA 1GYVA 7PCYA 4HNVA 4Z7WE 3N25A 3GNNA 4GP5B 2IG2H 5IMLA 1NDZA 3NH7H 4GEIA 1NJJA 1CQKA 2ZUUA 1V6YA 3ABMB 4L4VB 2A0LD 3LQAC 4A67A 5F8RC 1W5QA 1AACA 4JN2A 2NLJA 2D24A 2XGIA 3LD5A 4XCEA 1GC1H 3OGOE 4LVNB 2OKTA 4WI9A 1MFVA 4TX9A 5GNYA 4P4KD 1AE6L 4AKOA 4C6EA 1F4YL 3RWHB 5J3HC 5IJKA 1HDMA 2CHRA 3M43A 3UYRL 4QHUA 3BGMB 4DZ5A 3EADA 3ZJ6A 3D87B 2Y22A 2FLIA 3B4YA 3RWDA 3AAZB 4NIKB 1U91A 5D9SB 1N6QH 3SE3C 3FFCE 3T0AA 4YEFA 4WWKA 3M44A 4Z7VB 1B3ZA 1IE7C 3IFPA 5A5WA 1XD0A 1DSYA 2PC8A 1CYXA 5H2BA 1JI1A 4DT2A 1N5YL 1VF5C 2GUOB 4JLRA 1E8YA 3NTCH 2DWTA 4OF3A 3AFLA 4G8IB 5E9NA 5GSRA 2NQ9A 1XF3B 3HE6A 1JXJA 3EJPA 2FT7A 2QQKL 2HMID 4LEOB 4D0CB 3D0AA 5HBFA 4H9VA 5KSVB 4CQBA 2L7EA 2C79A 3N2JA 2REQB 1A6WL 1Z3NA 3V8OA 3ZQ9A 5HGDA 4HUWA 1TV4A 4XZ9A 1Z3GH 1Z48A 3DIFA 3TBSA 2VELA 3GDTA 3V5FA 3EBGA 5J5EA 1VFOA 2PLKA 2PBOA 3RITA 1C1EH 2BSRB 4UAHA 5DMGC 3V4VB 3IN0A 1JSYA 4B9GA 1JF1B 4ZR8A 1WTGT 4PJIA 1AGEB 2NTSP 3CUIA 4O28A 3TXAA 3FTSA 5KN5B 2J8TA 4KK6D 5JHMA 1YN7A 2DJLA 1YUHA 4F0LA 1MVYA 5KSUA 3CCHB 3O0KA 3W28A 3OVPA 4HPYH 3D85A 1HOCB 3GAKA 1SM3L 1AGFB 2RH0A 2KI6A 3E6FB 1LCOA 1KB5H 2I7OA 2NY5H 4ZW7A 4AXWA 4M02A 4P5TB 4OTXH 4AIEA 1W3NA 2OZ8A 4QXIA 1KWKA 2R2HB 1XRFA 5IREA 1YUKB 3CZEA 3N1PC 4FTVE 4LDLB 3ALPA 1D3HA 3NZQA 1H0GA 3S5SA 3RVVC 4Y9NA 5DMKB 1LEGB 4P9HC 4XNUL 3ALXA 4LVOC 1FP8A 3L3OB 5GJSL 4TSAL 2HJFA 4GKNB 4S1SL 2R0ZH 2BVYA 3HE6C 1IJNA 1A7RL 2KPNA 3T44A 3TVMC 1F8IA 3C0JA 4D7BA 3ONCA 4QBXA 4WI6A 2NWRA 2IQ9H 2YQBA 4TLUA 4X7CC 4XN7A 4QNPE 2R8SL 1JD9A 1PZDA 4OF6A 4GW1A 4U6XA 3HS0B 5G4EA 5CBBA 5IFTA 2H0PA 1TWIA 1HNFA 3MO7A 2G4GA 2C14A 4BKNA 1YEGH 3S8HA 1MWAA 1KFJA 3S5ZA 1VYPX 4Q6IC 1SFDA 4AL8L 3QSKB 43C9B 3MBDA 4ZTYA 4ZL1A 1M1XB 4JFFB 2JF1A 4QWWD 1F4HA 2WQXA 1GJUA 2W9DL 2XFGB 5T3XD 4BUGA 4X2PA 5J11C 1X5MA 1G01A 1KRBC 1OAUL 3PWPE 5F9AC 3MYZA 4YHGA 4DEPB 1XF2B 2ICWA 2QR0B 1H41A 4U5IA 4NNBA 4KPHH 3WLIA 1T0MB 4JB9L 2J73A 1FWJC 4IKKA 1KIUB 4KKQA 4OLWL 1TJHH 5F21B 4HSAC 1QFUL 3LQAH 3SKOA 4AJWA 4L2LA 4PJCE 4AHOA 2H3DA 3TE9A 4YHZL 1BGXH 3GXTA 1XIEA 1LK3H 2F8IA 4F7PA 3I9AA 4ILSA 2Y3AA 3RVWD 2HG5B 4J1UA 3FBQA 4AV4A 2C3GA 1VBUA 3Q2VA 1YEIH 2WQSA 3QC6X 5DDHB 5I1LB 2QSCH 2B0SL 1U3HD 4YIQB 4MMYA 1OIOA 2DEPA 2KERA 1I9RH 1NFIA 4NXKA 4P2YA 1VPXA 4PL1A 2H0JA 3DSNB 3LCLA 4ELME 2VDLL 3WH9A 5B7ZA 3RCYA 2KKQA 5CH9A 3VOFA 3GBEA 2ID5A 1HNYA 1SJHA 4P57B 4KTGA 5KOMC 4E0RB 3EWUA 4RW3A 4O51A 1KMGA 3OKDB 4HYTB 5EEYA 3MRPB 2A77H 4PJ5A 1I8MB 3WGUB 5AZEL 2J47A 3LHPL 4DIAA 1QW8A 5KINA 4PGEB 1H8OA 5JPNB 4X9HA 4B3VA 3BO8A 2GCYB 3CNKA 5AZ2L 4F92B 5JHDD 3KCOA 3VPLA 4AXNA 4Y4KD 4GRWE 3N1QC 3NXFA 2VDKB 1SDDA 3IBOA 4WEBH 1BG4A 4U4BA 3F7YA 5E93A 4LNCA 5AWNH 1M6UA 5K69A 1NGPL 3QSRA 5FAJA 2BZCA 1KBWA 2Y36L 2XG5A 3T3ME 1YLVA 2WMGA 1V5XA 3ILQC 4LSBA 3EW3B 5HJBA 1QSEB 3Q3GB 2OYKA 4LLUB 5D1XD 4CW1B 3NEEA 2XXCB 1RIUH 3VA8A 1W1PA 4BF5A 3IJQA 4F3HA 3GWQA 2FZNA 1RI8A 2V5BA 2AJUL 3SZKC 1NZRA 4H25B 4OZHB 5FF6A 1FDLL 4ZTOL 3CLFL 2PXYB 1JPIA 1HFUA 1K85A 5L2KD 4ZTPL 3W9EB 4RGNE 5K9QI 2VHLA 1WZKA 4M7KL 4LLVB 3ZDZB 2FEEL 1CBGA 1JZ7A 3HJZA 2PW1B 4R9XA 2EXYC 12E8H 3QISA 3P4MA 4M7ZC 3G7TA 4HFWB 5ICZB 2WCGA 4NO0A 3CAQA 2WQAA 2XZQH 3BUIA 1VRXA 3CL7A 3GC2A 3D6NA 1RUPL 3MNWA 2VQ1A 3VWKB 3OM3B 1DFBH 4L56A 2YUXA 3JVGA 2E67A 1NFIB 3GSUB 4YFLF 1CLCA 4Q9QH 4MDIA 5F9OH 4JE4B 1ECZA 5F3BB 3S4SA 3RWGB 1DEEA 5AZUA 2HRGA 1EGZA 2DUAA 3MCG1 4UC5A 1YYML 2YR1A 3VKCA 2C0HA 3UOAB 3RMJA 2X4NB 3JS3A 4MX7B 4UFKA 2B59B 4I0PD 3EOBB 4N0UE 2AKRA 2R29H 2VABA 2ATMA 1FO0L 3H70A 4JCLA 4LU5H 1S5HA 4BGLA 1FF5A 4LL9A 2ISDA 3IMBA 1KEGL 1KPVB 3IE4A 4JR9H 4X98B 1MY5A 4PRHE 4TVPL 2MOVA 3BWUC 1X38A 1GORA 4GUHA 5BNXD 4ENLA 3A9BA 4YZFE 5TTRA 1A5CA 2FJUB 5AFAA 3NPZB 2VH5L 4NKQB 5FSEC 4R84A 3HEIB 4GH3A 1UR1A 2EJAA 5DK2B 5C8BB 4XPBL 3DUUA 4UR7A 4TL4A 3QFJA 4WWOA 3H2NA 1VKFA 2H9GB 2CMRL 3SJVA 1KGXA 4UMBA 1BZOA 3D4GA 5E2VH 2PDBA 4XHJD 3TN0B 3NQCA 4G11A 3UGUA 3W7DA 4K8RL 4L3CB 1W1ZA 1H6TA 4AYFB 1BYNA 5CJMA 4QF1A 3U36B 3U82B 5A1AA 3R7RA 3L95A 3MRMA 1QP1A 5DS8B 1RJLA 1YJDH 2EF9A 4PUBL 2NPLX 3R43A 4ZPTA 4BCYA 2R2EA 3APNA 1Q9KA 3P5YA 3SCVA 2PPAA 1AKJA 4PUEA 3BP5B 3LSOB 1HWWA 1PTZA 2W07B 3QUML 7PAZA 3K4WA 3TSMA 5GGUA 2Z31B 5EU7C 5BRZE 1H6EA 4KDTC 4TOYH 2Y61A 3NZHH 4Q8OA 3F7LA 3VDBA 1J5IA 5LIUX 5D2WA 2H3NB 3Q9PA 5DQ9A 3QHFL 3Q37A 4C6OA 4EX4A 3MSYA 4PJIE 2PF6A 3KVQA 5ADPH 3EHBB 1J05B 3PGFH 2E7DA 1QHOA 3IETA 4QTFA 2EH8L 2Q86A 2UZPA 2HUEA 2ZCZA 4EBQL 4YC2B 3TJEL 5I6XB 1BJ1H 3BUDA 4NYLA 4QKTA 3T77B 2EINB 2Z4QB 4OD2B 3QRFM 1V7AA 1PMYA 4OCLC 1UW9A 3CTLA 2V2CA 2E6DA 5CKGA 1KBPA 3WDQA 1H3WM 4MCZB 2QS8A 5FJIA 4HJJL 3TBSB 2ADJA 2DOCA 3WQ8A 4N8CH 5JUEL 5I6KA 4EIGB 1HKLL 2UXGA 4PL2A 3FQXA 5IBTL 3CHFA 1TMCB 4U7MA 4GB9A 3ISYA 1PV8A 3WLNA 2MHAA 4Q8WA 4C1NA 1HXMB 3MRIA 1A6ZB 3TZVB 1QK2A 5C9ZA 1NCDL 2Z24A 1MDLA 2GK0A 1WF5A 2Z31D 4WDTA 2APSA 1DZ0A 3QUMA 2O1AA 1FPTH 1EEZB 5JIHA 1AOZA 1EKOA 2QJDA 1U1JA 3GBNL 3QNZB 4OHQA 3OAZH 3FO9B 4P49A 2HFGH 4JL2A 5C5YA 2O5XL 4NJGA 3BP7A 3AUOA 4LJ3A 1RZFH 2F74B 2IWEA 2OJEB 3BKML 5ESAA 1YEHL 3ES6B 2X4SB 1OOAA 2P10A 2P5ED 3W9ZA 4JPWH 7ODCA 2ZNXA 4PRIE 4ELDA 1ZPUA 1NWSA 3DVFA 1IFGA 3MBXH 4HG4J 1ETB1 3DGGB 1H15B 3QIBC 3L3OA 1M6OB 3IJHA 3B2MA 2NYZA 3JUZA 3MCKB 3ATEA 3EX2A 4NILA 3VD9A 1A4AA 4UFIA 3S3CB 4M93B 3NVQA 5DMKA 1VEOA 1M3UA 5ABFB 2JKEA 3GMLB 4FQXD 1A5BA 3VNIA 4AEEA 1OE2A 4TMBA 5BW7C 1EB3A 4PCNA 3ZTEA 2HKHH 3ZTCC 3O6LH 4OD1H 1X5LA 3BICA 5AYZA 3RM4A 1L4IA 4M3PA 1NWRA 3WK0A 3TP4A 2NUPB 2V37A 4KO6A 3ELQA 4NM8L 1RUQH 1CXKA 4XKYA 3U4EA 2P1FA 1KM0A 3ZHNA 4LGRB 1XZ0A 4N0YH 3EJCA 3EYVB 4GP4B 4DUWA 4PMYA 1NINA 4NDMA 1CLYH 2L8AA 2P8LB 1QOQA 5LKNA 1N64L 5DYOB 3ESMA 3QQNA 1V6WA 4ERGA 1S3KH 4FQQB 1L9TA 4LHUG 4IOIB 2ZOOA 3CBKB 5FEZA 4M61B 4PJHA 3DMMB 4NQSA 5FDWB 3DVGB 2CO7B 1FAKT 3QQDB 1PUDA 1V79A 4U28A 3V1HA 5K9XA 3W0KA 1MHPH 1KB9J 1VDGA 2VX5A 4GY7A 5SWUA 4EDWH 5DR5H 1A1OA 3G0SA 3GUWA 3MRGA 6FABH 4JM2A 3TN0C 2QPXA 2GPZA 4ICCX 4XPFH 2EYTA 1U92B 4NRXB 3U1SL 1GIGL 2R15A 3W6LA 1PKLA 3KBWA 3PJUA 3G0UA 4AYFA 2QNEA 4FK9A 3MREA 3CFTA 1HI6B 1TWDA 1W9UA 1CFNB 3UP1A 3BE7A 3V6OC 4A39A 1AFVL 1SBBA 3KRUA 5JORA 4A4AA 1JN6A 3NCFB 1T4WA 1RSFA 2HDJA 5I6SA 3HV9A 4E5XA 1NEZB 2Q1EA 2WY3B 3W38A 3MDJA 2Z00A 4UV7L 5F7DA 2VDKH 3ZE0B 1PBGA 1X9RA 2IADA 3GG1A 2Y7QB 1YMHA 1EHLL 4ZX3A 5B1JA 4YWGL 1W0WA 3ZMNA 3PTMA 2WO2B 4TLSA 1ZGDA 2Z6IA 3ZQWA 1P1XA 2WSPA 1R7AA 1RQBA 4JPIA 4JRXB 1KD0A 3WIHH 3T0DA 2YSSB 3IJYB 1G0XA 2O9TA 1UB5A 5EMMA 3SRKA 1UWFA 3VXMB 3L8QA 2JKRM 2YFOA 2XA8L 3RA7L 3SQMA 2DORA 4IT1A 5KETA 4A6YH 1CGTA 5AL8A 3CFCL 1ECYA 4TSAH 4Y9BA 3GNDA 4M19A 3SIZA 4C7GA 4M7ZB 1PFOA 1RLBA 3NSMA 4ZMVA 4APXA 2QTVA 1W9PA 3P62A 5ABHA 2R14A 3WGVB 4I2XB 4JY6A 4XH2B 3VFGH 3OW1A 4X7EC 4FP8L 4Z1CA 2WKGA 3N19B 4D8PB 1E28A 3LH8A 3SE4C 4L1GA 3QZWA 3MROB 4Z7WF 2IW0A 3ITCA 5CEZH 2OX4A 4WUUB 4M6QA 5HNUA 2IH1B 4PUNA 4WV1A 2HVKB 2ZCKH 3H54A 4NCC1 4Y9GA 5EBMB 1BTCA 4L4LA 3FO1A 1JWMB 3T0BA 2E6QA 2JQAA 2V5SA 3LQZB 4NN6C 1AG0A 1BIIB 5AW5B 5ITBL 4XWGH 5KEZA 2PR9A 5INDB 4GOSA 4LOVA 4N0CC 3BVVA 1TA3B 1OZUA 2DT1A 3RG1C 3TGXA 5I03A 3TBYB 3SDDB 1FIGH 2X4OA 3GKAA 1JPDX 3FQ4A 4YDKH 5BRZA 2R91A 4X6DB 3O8XC 3M16A 4DO7A 2HTLC 1IC7L 2XXMB 3O41A 4XN8A 2WXOA 2FL5A 3C8DA 2CNYA 2CDEB 4LCYB 4UQ2A 5HDWA 2UWEB 3WEAA 4LX4A 3NYKA 5KJRH 4HAFA 4F15B 4MD5B 4XBEH 3VVGA 2NW2A 2HT3D 4MASA 2AV7B 5SWZD 3VNMA 4DGWC 3SDCB 1UR2A 4LFYA 1I2PA 3WJXA 2JXMB 1MJ8L 1G7HB 3A23A 4JFFD 1TMQA 1TVDA 1JVKA 1O7SA 3M17A 3A24A 3JXAA 3TJEH 1GOMA 2QUVA 5JOFA 2O5YL 4OKDA 1ODAA 3AWFA 3H85A 1FZJB 1N26A 1NIAA 4KH9A 4IXHA 1CVSC 3DTDA 4R7OA 1G7LB 3B0YA 1IL1B 1FXQA 4DK3A 3QAZC 3NCBB 3WFDH 4EWND 4HJJH 5GS3A 1AZBA 1SN5A 2X3BA 5JMOC 1XG4A 3OA3A 3EOTL 5JW4R 2QVMA 1R85A 2XTJD 4UTAH 2AK4E 1L6FA 3ZTNL 1UG6A 3SIKA 3O16A 3RTQC 3HFTA 4EPSA 2IMRA 5CXPA 2O72A 3Q6GH 1DBTA 2QJMA 3W22A 2XXGA 3D39E 2YJLA 2XTJC 2Z0UA 2EKSA 1E4HA 1M05B 1KTDB 1RZJC 4R96B 2XZ7A 5FD0A 1JPTH 3TCSA 2F6AA 4LUSA 3CSPA 3DTXA 1X9QA 5ADOH 2BHUA 4Q58C 2YD9A 2QDGA 4ORMA 4H1LG 1IHIA 4I9TA 3SSJA 1XLKA 4XT1C 3A4WA 1I3RA 5AHNA 3FU3A 2XYLA 1EUAA 4DUOA 3CPLB 2PDCA 3AXKA 1S5IH 1KYOK 5DANA 4PJCF 3SQOL 1NAL1 1K4DA 4K8RD 1ORSA 4R26L 1MVUA 4BH7B 2D7NA 4JEQA 3AGVA 3O2DH 4FZ8H 5DS8A 2VISB 2QEJA 4JUTA 3F01A 3HB9A 3P7YA 2R1WA 4PRPB 3E9TA 4FA3A 1MOEA 2BSEA 3OMAB 4UINL 3KOXA 4AV0A 3QFJE 1WA2X 3WV0A 2F9RA 4IISA 2ENYA 2FMOA 2J7LA 1ZGLM 1IGCL 1UA6L 1N8ZA 3ECUA 4KRNA 5I8CA 1SHSA 3BVTA 3V5KB 2YX0A 4ZFCA 1TF4A 1E6PA 3FRUA 4LPCA 4LEFA 1YAZA 3SBWA 1OAQL 3VG0L 3LS4L 3KOFA 1ZS8A 1TT6A 3QORC 3FFDB 1DYSA 3UJIH 3KBEA 4WUUE 1PD1A 2NV2A 4V27A 4XGZB 3FX4A 4KQ3H 2XV6B 3QW3A 1AI1H 2J66A 5I18H 1I82A 5KBLA 5BOEA 1S3KL 2JFEX 3GVGA 5H8PA 3DKJA 5T3ZE 4EKXA 4W84A 3L3KA 2AERT 2Q8LA 3FS9A 3VFTB 4MRBA 4UTJA 4XZMX 1OP3H 1MHPL 5CD5D 4JHVA 5F1UA 2CLFA 1M04A 3E3HA 1Q5MA 3V0JA 2BOBA 2VDRH 3GM8A 1A9EB 1AL7A 2F18A 1LG1A 4LDCA 1NFDA 3L9BA 3T3PB 1J5HA 1W0MA 1NEZG 2V0TA 2YGOA 3WEOA 5D7IE 1H2JA 3N29A 1XGYH 2PDWA 5LWYL 2RJHA 3DN5A 3LA4A 3P81A 4MM1A 4W7WA 3BLLA 4C60A 3US9A 4X6CE 1QUNB 3DHPA 1Q6GA 1TB3A 3UY8A 1TTFA 1HHJA 5LAXA 3SSGA 3KOZA 4PH8A 4WI8A 3L3GB 3TNNB 3HQ1A 3V95A 4F8TA 2VJ0A 2Y6TE 4E9TA 3GZAA 1SW7A 1T7LA 3OZPA 4DZ8B 3S88L 3KEDA 2VT0A 2R1NA 5CEZD 4ZPTB 5EULV 1E9OA 1K3ZA 3FOKA 2OMVB 2XI9A 3FQNB 4C56B 1FWRA 4ERIA 3MLXH 5EV7A 1OX4B 1OCWH 1BRLB 3U0TB 2WSKA 3W11D 4N2KA 1Q6EA 4R33A 3TVAA 1RQEA 3HNVH 5FGBC 2I32A 4JAMA 1JZ8A 2IPUG 4NQDA 1TJ0A 2PR4L 3X12B 4HGXA 5IHZA 1MG2C 3VXSD 5JIIA 4XVEA 1UUOA 4PIBA 1L7TH 1NBZA 2VDQL 3MV7A 3L3DA 4AF0B 1VFAB 8PAZA 4MAUH 5BMXA 3KNBA 3K13A 3MC0A 3WBEA 1AS6A 2ZXWB 2HVOA 3WY2A 3G22A 1BFOA 1NMAH 2X2UA 1MWAB 3TN6A 3RJDA 5D1QA 4YVXA 2BIMA 1WNOA 1JTTA 2X42A 2IBZX 4I0PA 4U05A 2YEZB 2APFA 4BH8A 2C4FU 1HEZA 1W5MA 1Q0YH 1JQVA 4N28A 3M6YA 2JSFA 3QNZA 1KT2A 1HIML 2X6BA 4AEFA 2R0LL 5LQBH 4NAJA 3K91A 1O6IA 2QCEA 4B5SA 4GIAA 2NY6B 4PJBF 1IBGH 4KVPA 4ONOA 4WJEA 3PFUA 4EN3B 5I1EL 2B08A 3CHRA 4PZVA 4XX1G 3V0VA 3RNDA 3MSGA 3NABL 4Y8DC 1T83A 5K9QG 3SADA 4XZIA 4XCEB 1B88A 2FUQA 5HYFA 5ENLA 3BVNB 2WWOA 4TSBH 1YNKH 2WHLA 1B4RA 1TPB1 3S1UA 3TR2A 1XEDA 2JI3A 2F5BL 1NCDH 1Z9MA 4GG6F 3NJNA 5I1LA 3FJNA 1NSNL 1KTCA 5EWIH 3CHVA 2OS7A 1LWIA 3C2VA 3FN0L 1JK8A 2IKGA 1ZT4A 3ZS4A 2HKFL 2XQYG 3PB2A 1IU1A 1MJ8H 3L3GA 3TNNA 2FHFA 4YNYA 2EH7H 1YRKA 2DM4A 3G3DA 5MENB 3QTGA 4ICMA 2FSDA 3BQUC 2ITEA 1FAIH 2FATH 2VR6A 1OBAA 1OVDA 2OSLB 1ZHAA 3TA3A 1UB5B 3GZPA 3SRHA 1FFPB 4OM1H 4Z3EA 1O7AA 3EOLA 3LS9A 3MRHB 4UM8A 2HPTA 5J6GB 1DJYA 2BMKB 3NN8B 3IJSB 3QFGA 2IQ9L 2VGIA 2CPCA 4YS4A 5A95A 3WLMA 2AW2A 3IRPX 3WJJC 3HNSL 2DQWA 5LGJB 5IG7B 3QHNA 3HFML 1QI2A 5HGDB 5EZJA 4MSWA 1T8XA 5EO9A 1BZ8A 2XPZA 2GJJA 3BN9C 4KFMA 1F3DH 1P9MA 4OUEA 3W7LA 3CFKA 3RDJA 4P8UA 4KAQL 4MKTA 1ONQA 4JN8A 1GZQA 2Q8XA 4N5ED 3GHTA 4NZUL 2W9EL 2OXGA 3OJVC 4K7PX 2MWCA 2N7AA 3P4LA 3HI1A 4TLTA 2VRKA 3IPBA 3D3VB 4PREB 3QVAA 4W81A 3WH6A 1J0KA 3O3RA 3DJSA 2H9AA 2IH1A 3B7TA 3LTVA 3MCLH 2AOSA 2PYED 1YEEL 4KQ4H 4E38A 4TLKA 2IAMA 1N8WA 5GRVL 1RIUL 1WAWA 1OAZH 4FG4A 2HE5A 4HSNA 1OF2A 2ZYHA 3CE1A 5SWZB 3WEMA 3L7RA 1A3QA 4JFDD 4AENA 5I8EB 5KOVC 2FDMA 4J3SA 4H5SA 2OTDA 4JN6A 3LQZA 4P5TA 1QHPA 4C83A 3OF6D 3LNDA 4NOBA 1SM9A 1G87A 3MZTA 4XTRC 2DPEA 3ANUA 2P0IA 4JDYA 3PAYA 4C90A 2OZ0A 4MQSB 4XCCL 1OT1A 2IGLA 3FU9A 4G8TA 1OXYA 2HRWA 4HHLA 3SRDA 3TWCL 2GI7A 3IJEA 4ZS7H 1PZCA 3U0TA 4N2NA 2YSSA 3BKJL 3D05A 3MJ7A 4OGYH 5LBSL 2XOTA 3B2UD 1GZ1A 4NI8A 3L2LA 1E9OB 1WS8A 4JKMA 2VR4A 2OK0L 2Z91B 2BNQB 3CGTA 1WDDA 4H00A 3QAZB 4Y2DC 3S2NA 1CE6A 3ZGIA 2PGEA 3Q2LA 1K02A 1SUHA 4HIHB 2VX6A 5FJUA 2E7CA 1NUNB 1MFBH 3ECBA 1JMXA 4N20A 5GRVK 1KXHA 4HJEA 4IIDA 1MRDH 2FB3A 4YDIH 1TTJA 4NHUB 4M5YL 4Z0JA 3JVGC 1AD9B 3WEBA 1SQ2N 2V67A 2XIOA 4EI6B 2BY0A 1E6NA 4NRZB 1DBJH 2PDXA 5LO7A 5B21A 1E4XH 1PJWA 4JX4A 5C92A 1RKRA 1EK3A 1DWFM 2E09A 2IDSA 3OR6A 4BH8B 1F05A 1G4TA 1MRQA 3B8DA 3ARDC 3SI9A 3VTRA 4X4ME 4CSZA 2GK1A 1VCBC 2IGFH 1KACB 3F12B 4JRXD 5L7XH 3CJJA 2POTA 3P9MA 1F3RB 3MPCA 3GXIA 5DI8B 2ZZ3A 2YEVB 3T2QA 5T1MA 1BQ5A 1RMFL 2UX7A 1K8ZA 3PK7A 2O92A 4Z1YA 4APQC 2EP6A 4UTAA 2WJZA 1B3XA 3INOA 1GTNA 1MXDA 1W3LA 3SO3B 4K7FB 1MEWA 4HPJA 4NUQA 4WHYG 2RAGA 2BC4A 1LEGA 5KSAA 3CXDL 4GQRA 4R8WL 1J86A 2CESA 4GY0A 4ZNEA 4NKOA 5TFSH 1PZ5A 2HWZL 3HR5A 3NSJA 4K8RH 2IPWA 3ARYA 2VUOA 4KI5C 3WLKX 1F3DJ 2G3ZA 3FRPB 3KXFD 3Q1SH 2CZ5A 3CYVA 2ZKYA 3Q4DA 5A8OA 4I5UA 3LQGA 3V5DB 1ZLVH 2F68X 4BFGA 4HLZH 5DGRA 4ANXA 3MVTA 1HINH 2X10A 2Q3OA 1WHOA 3JU2A 5D04C 3O15A 4EE9A 2Q0ZX 2NR6D 1MW1A 2XN2A 1LP9B 5BV7C 2JKXA 2Z6JA 1FXPA 1U3YA 2QSVA 4AVHA 1VC4A 1XIIA 1WHPA 3L21A 4MKNA 5M03A 1NEYA 2Z8WC 2XFWA 5CZSA 5DTFB 2VMJA 2G9KA 2EVJA 1G69A 1U8HA 1NWUA 2HXTA 4QYOB 4NKCA 5D4QA 4IRSA 2GSGA 3TT3H 1I8KB 3VFRA 1WDSA 4GXVL 4JR9L 4IBSA 2GTWA 1DPMA 2GBTA 1PDYA 1W9VA 3VSTA 2G41A 3RJXA 1B2WH 3POCA 1QSEE 3TV8A 3V4PH 4XCFL 5TH2A 1BOGA 1UKSA 3UTPE 5CUSH 1JCJA 4G2DA 4NL1A 2R69A 4HPGA 2YR3A 3PXHA 2DQEL 2VH5H 1IAIM 4NWUL 3U7AA 3GRGA 3L3KB 3QH3B 5EC2B 5TE4L 2E7MA 1OIMA 2BOFX 3T1WA 5D03A 2QZQA 2HT4D 4XC3H 4BI7A 4PJDF 2IDUA 3BAWA 1SJVA 1ZY9A 4RGND 3W2DH 1ZGLB 1V6XA 5G2WA 3NSFA 3P54A 1BVZA 3UETA 2WYTA 3F5LA 4D8OA 2VVNA 4OZOA 3M1ZA 2VEKA 4WNSA 3GSNL 2ZD0A 5TF1H 1F13A 1FTXA 3PZOA 4M1GL 3LH2L 5B7MA 4XUGA 3QORD 4JO5A 2A0LC 3CHOA 2D2CC 5HJGA 1KSRA 4JO8A 1JGDA 2H1XA 4H8VA 4MRCA 5DI8A 5KUKA 1LUCB 3WH8A 3P9LA 4FFWD 4HFUH 3O6KL 4AMWA 5JR1L 3WDJA 4DZBA 3QI9D 1DVTA 1F9CA 1YYAA 2C91A 4LUYA 1QATA 5HDOA 2ZKXA 2MNJB 4E41B 4ENED 4YX2L 5I8CB 4OE7A 3UWWA 3H7UA 2RGSA 1A80A 3VE7A 3WUFA 1XDLA 1G4RA 3GSRA 3EKZA 3EXJA 1A6VL 3T3MF 3UAAA 5CPMA 1I8IB 4MJIE 4PRPA 2WM1A 2OMXA 5SWSB 3EYFA 2AJUH 1P7TB 1KFWA 5EMYA 1XLEA 2FFCA 3RX8A 3IXAA 5KUMA 1OD0A 1HHHA 1JPKA 1FWAC 1BLNB 1ZBCA 5F1IB 1EGMA 4FP8H 1FYTB 2B1AL 4M7KH 1ODZA 1R3IL 5LB1A 3H9ZA 3M41A 4FHBD 5BOOA 1JNLL 5BWFA 4C6KA 3U4KA 4RPPA 4TTUA 2YCLB 5D7JA 4AH2B 1E1CB 3MRRA 4MXWH 2WLLB 2WCSA 4PTUB 4KFNA 1KY7A 5FO9A 1EERB 3CWHA 2UXVA 4R0LB 5E5LA 2OZ4L 5FWRA 4F27A 4M24A 3AXLA 5KSBB 1MSPA 3QZLA 4Z2HA 3GTHA 2CJTA 4TUJA 4H0HB 4CVZA 3MZ2A 2N0KA 5DJCA 4XUYA 5A3HA 4J39A 4FXGC 1RZKC 2EPKX 4AWTA 2OZ4A 2WSRA 4ZW6A 4G7QB 3SKMA 4DERA 3U57A 4Z2IA 1J0JA 3F4VA 4BRVA 3T81A 3GB7A 1HCZA 1V0MA 4B4HA 2OTUB 2E9IA 4HGWA 1BMWA 1FDYA 2DIAA 1H3PH 5HPMB 2C18A 1ET5A 2J57A 4YHMH 2VLKE 5KSAB 1XGUB 3KWUA 2WWMC 4UWMA 2B0SH 2V5RA 3HC3H 2XWJB 3RVWC 4K7FA 4MA3A 3P3YA 3IT8D 1YDPA 5T1LA 3W87A 3FYIB 3KXQA 3T0EE 3U1SH 4M7SA 3MJWA 3D25A 5C3IA 3KVJA 4HXAL 1A3RL 5KMYA 2ZXDA 1OC6A 2AKRB 4RAUA 5GS2D 3VKJA 4KROC 4UBDC 4Y4HA 4V1DD 5EZLB 4EMZA 4Z1PA 5BW7A 2ZCLH 1KULA 1V3IA 3RNKB 4ZE5A 3SJNA 2VXVH 1PZUB 1TVLA 4ZQNA 3W81A 5EKYA 3FCPA 1JAKA 5E8EB 2KDYA 3BAIA 2D2GA 2VURA 3FNKA 1H6UA 3L1OL 5D7LE 1ML1A 1TREA 2E4TA 1X6NA 4ZFFB 3AU0A 1OFQA 2HKHL 1T5AA 4LKXB 4GFTB 4LCCB 4IRSB 4J3VA 4Y2NA 5F7MC 3WLBB 3I9IA 5J6GA 4FQCH 3R0UA 3BHBB 3L16A 2QCLA 3E6EA 2ED7A 4IQDA 2F58H 5HHME 2J25A 1QNPA 1EHNA 2H26B 3NJHA 4AMKH 3CV6A 1YLBB 4MMZA 1TTPA 1KDIA 5E1QA 2PD5A 3AXMA 3BX7C 4I2XA 4XH2A 3MV7E 4MNLA 3WK3A 1PBYA 4FZEH 1XYZA 2NUYA 2ZDRA 5DZNA 5AHFA 5LLIC 3GM0A 5TQ2H 3ES8A 5DRZB 1GTFA 5T5FA 4YLQT 2WB1A 4XP6H 5HHOE 4X5XB 5C09A 4BXSV 5JYMA 2IPGA 4XMVA 1T7VA 5KSUB 4PR4A 3A21A 4D0BB 3RLHA 3PN8A 3DBPA 2WXGA 4KH2A 1N59A 2OPJA 4IL0A 5LXGL 2A4AA 1ND0B 1CF8L 4TULL 5E1IA 4DPCX 3BPOC 4BI6A 3II1A 3TFBA 3MV8E 4PEKA 5HPCA 3TBTA 3MLWH 5IHUH 3QXWA 2V5CA 3NO5A 3BWSA 1HXJA 5CWSB 4KRZA 4PTXA 4IKIA 2NQZA 4FF7A 1TU2B 2FWOB 2YMOA 3E80A 3NRQA 3O41B 5B39G 5I23A 1PZ1A 4GYJA 1SF3A 1UGKA 2FO1A 1DIOA 3A4JA 3AWEA 2LAGB 4IPNB 4LSPH 4WDUA 1MY7A 5C0NC 2DZXA 5DD1H 3ZRCC 2AMXA 2GFBB 2OR9H 3TU9A 1GVOA 3T78A 4K15A 3NESA 2IS7A 4OUUB 3CMGA 1U2HA 1TZGH 2N59A 1BAFL 5BJTA 2HS6A 2TAAA 2BO0A 3RIFF 2BFGA 3PUGA 5CPOA 4Y9MA 3QQWA 3EYSL 2XIIA 3NRFA 1TTBA 3NJVA 3QIUD 1OD8A 1KCWA 5JPNA 2AI0L 4ONFL 3UXFA 2ZICA 3HG1A 2O30A 5JIQA 1TPDA 2WIIA 1X6UA 5CGQA 3UT0A 5FIPA 3SKNB 3IN2A 3RFAA 3O6DA 3SDYH 5EORH 3HS9A 4IRJC 2CAKA 3X3GH 1YPZF 1UA7A 3B9KB 3QS3A 2R83A 4GMSL 3ZDYF 3EBVA 4UOQA 4XE0A 1J6OA 2YC1B 1NC2A 1MCHA 4MNQE 3FUDA 4YXKH 1W8EA 5GVJA 3ZHLA 3BW2A 3EDEA 1KTDA 1F02I 3TA9A 4KXAA 4HPOL 2CO6B 2ZRWA 3WF3A 1IIKA 3P73A 1N8IA 4HWBA 3UF9A 3HR6A 3SE4A 2Z4GA 1MCJA 1TO4A 2ZX9A 4PMUA 2XTJB 2JVUA 4OD3H 4LEQA 4HULB 4WO4A 4XVUD 4LYQA 2J8UA 4NZUH 4OD1L 1LORA 1RP9A 1MVUB 1G9NH 4U0QB 1XYCA 3PNRB 1XL4A 3L5AA 1OCWL 3NAAL 4ORIA 2PTWA 3NR0A 3X11B 4KCVA 3SGGA 3SURA 3KS0H 7TAAA 5AHIA 4OGAC 4Z2KA 2PU1A 3PAUA 4OF7A 5CJNA 4MMZC 3TWAA 4FX8A 5F7DB 4WIWA 2LTQC 1ED3B 1FYHB 3OKOB 4N8UA 5LBSA 1H8LA 3W0WA 5DD5L 3EZ8A 5DT5A 5BNKA 4DGVH 4XNYH 1R47A 3BLDA 2BX5A 3LRSB 3O2DL 2XRAH 2A73B 2OSXA 4KVCL 3ASWA 3BKCH 2B1HL 4XXDA 5E08H 1CU4L 3HG5A 4G8IA 1KCRL 2CIIB 2ICWI 4NKDA 4HKJA 5M5DA 3SYQA 3KTXA 4M1DH 4TVPD 2AEOA 2P44B 4AZ8B 5CCKL 3UTTD 3WQVA 3U0PB 3LZNA 2JWYA 4JJHA 3WFBH 4S0HA 3GO1H 3O8XB 2BNJA 4NO2A 2J6VA 4LCQA 5DC9B 3X14A 3QHTC 3IBEA 2A7PA 4NO3A 5B7EA 1P4CA 3JZYA 4HOXA 1X3DA 5HDRA 3B0VC 4X7FC 3UACA 3EBAA 3PLYA 4KK5C 1HKLH 1ZJBA 4LCUA 4NJIA 5EUOF 3GD6A 1KR0A 5DJ0B 5DA0B 4YE0A 1JYNA 2Y3NA 1DJXA 5IUSA 1ZGLA 1CGWA 4EKJA 1U1UA 1WBYB 4KV5F 2ON3A 4JM4H 4MUZA 2ACQA 1W3TA 4I9XA 4WTXA 3IS4A 4FC3E 3BD3A 5TQ0L 5LXXA 2DQJH 4LCVA 5HNRA 3ARED 1HE7A 5BYWA 4DUVA 2V2XA 3K4ZA 4AWJC 4OLUH 3KJ6L 3LEXA 1X8FA 2Y8KA 4RAVB 3LLXA 2A1WH 5E8NA 3IACA 3H56A 5DZAA 3MLYL 1O4UA 3PV6A 1K6QL 3LPWA 2QDVA 4K9EC 4OGXH 5LAXB 1IT0A 2GVGA 1I4FA 1XQLA 4XNQB 4B3LA 2VR3A 4YR6A 1OF6A 5HHVL 3G5XB 8TIMA 1KF9B 2UWEE 4KQ0A 3MNZA 3MBXL 1A5NC 2JH2A 3OAUH 2XG4B 3AIRA 4MLRA 4ONVA 5I6LA 2VAAB 2WOBA 5KTEL 4ZTPH 5GSRB 1T4KA 3LSOA 1UWGH 3R06A 3GSUA 3N06B 3OF6A 3PR2A 4B91A 1ZVNA 3MUCA 2ZYRA 1SYVA 4IDJH 1NTHA 1GHRA 1T1WB 5F1IA 2OO6A 2P8BA 2P5EE 1TE6A 5HULA 2YGQA 4J6IA 5K39B 1W1TA 3FSTA 3JBG7 4HXBL 3ZDYB 4J5NA 4WXZA 3H42H 3TJXA 4EOWH 4HCHA 4P5KA 4HIXH 2GEQA 2EVFA 1PGRB 4MXVF 2JGQA 2JKLA 2GUOA 1R34A 4QTIL 2QIWA 5D70L 4FFTA 1KFEA 4PJ7B 4LSVH 4ORGA 4HDIA 3UTZA 3N4EA 4N42A 1TJXA 4U6VL 4F0RA 3W1MA 5IG7A 1PHWA 2A0NA 1ZHKA 2EIJB 4E5XB 3ULVF 4N87A 4X9BA 5E7BA 4MWFA 2OMBA 4BEIA 4DXKA 4UTFA 4YTUA 3HBZA 4IG2A 5BROA 1A5AA 1WFTA 4J6RL 4NNPL 2XV3A 4L5FL 1NAML 1DXIA 1N18A 2ZCGA 4I18C 2H32H 3QH2A 4E8DA 2CWXA 4Y5YB 2OR2A 2OLDA 3VC6A 5C8JA 1HU8A 3LZPA 4FALA 4OF0A 3H2EA 3GBMH 4MAYA 4JNXA 2BWGA 2RMNA 2FQGA 5ABAA 4IJBA 3TXVA 3IANA 3U83A 4QG9A 3KBFA 3HNTL 5G2NA 5SWQA 4WV1B 1ZTXL 3I50H 5IJVB 1LD9A 3HJ0A 4HYVA 1I0DA 5ECJE 2AKZA 3BARA 2XWXA 5AEAA 4PP2B 3DERA 1UD4A 4QCIB 3QUYD 3S8GB 3SCTA 1JYWA 4MMXA 1HHKB 2ZYIA 1YNTF 2XJLA 3C2FA 2UVEA 4PAZA 3W1LA 1S8DA 4PVMA 3TLRA 2X4PA 4IM8A 2CLPA 1H15A 2EUXA 4QE4A 2NY7H 4JO2L 3AI0A 4O58L 3L7EB 5L0QC 4KNUA 3WS6A 4LCCA 3VI4E 3WLBA 1WKEA 3QFWA 4MQXD 2XTKA 1MW3A 3SGUA 3KXFA 3B2VL 5HYIA 4IKJA 2DLHA 4N0YL 5IZ7A 2WWCA 1JS4A 4BUHA 4QP0A 1NKRA 2L4OA 2XPGB 2D3VA 3QULB 5KS9B 3CSBA 3W24A 1FH5H 4N2HA 4Z7UB 1NMCC 4YSCA 1GHFH 2DMCA 1UATA 5AW4B 1JVNA 3JWNH 1W2PA 3GTIA 3QOKA 2N7BA 3AT8A 1J8HD 4NQDD 5D2NC 3TO4B 4BA0A 4QRUB 4Y19A 1KIUA 3CQHA 1TCRA 1IFHH 1EC7A 4G1MA 2C9PA 3N3MA 3PGFL 2BSSA 3QDJD 3W3BA 2DSZA 1ISZA 3ZRFC 3ISWA 2ODHA 2IWKA 2VDOH 2VMDA 4ILDA 4BHUA 2YD4A 2XXFA 3MOQA 3L9YA 1OHLA 4P2OA 4UTWA 1S2EA 1ZEAL 2ZP8A 2VWSA 1XGUA 4NUGL 3W2KA 5KVEL 3E49A 1LNUB 3PGDA 1AXSB 3FUKA 4PRHD 1GHSA 2WB5A 5ICYA 2PXYC 3KS0J 4HSHA 3KWSA 4AIZB 4MTMA 2ERJC 4ONHA 5HNNA 2QCCA 1TEFA 4QIUA 2DYSB 3KPTA 1G7QB 1W8OA 4PJEA 2PP3A 2YOAA 3FOMB 4ISVB 2HVJB 3A4EA 2Z27A 3P2VA 2HB0A 5EBGA 1MJUH 4YBQD 2OMUB 4GAJL 1CZ8L 2ISFA 4M7TA 3RXZA 4KO7A 1M53A 4E42B 1QKZH 1OCNA 4JNYA 2D2JA 4JFQA 5EWIL 1IIIA 3GXNA 3OJGA 2Z1WA 2XSBA 2BY1A 4FRWA 5B7FA 4JTUA 2QGHA 4QG6A 2IH8A 3GJFB 1QTSA 2EH7L 4HIHA 1Y0LA 2LFEA 1K5WA 4NPJA 4GSDL 1J6PA 1DQJB 4LV9A 1VFBB 2KBGA 3IVTA 2NQLA 2A9NL 4TL5A 1DORA 3Q06A 3EYQD 4KZDH 1JGEA 5B1JC 2EXWC 5CSZB 1R6WA 2EC8A 3EWXA 1MIML 1XIWA 4BZ1A 4C8XA 3H0TB 3BW3A 3DGBA 3WTSA 1UCTA 4E68A 1USZA 1FBIH 1IQDB 3W6YA 1PFCA 4D72A 4NQEB 1R30A 3P8IA 4HB7A 2PI6A 4ORGB 3CQIA