1OEDB

Structure of acetylcholine receptor pore from electron images
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
250
structure length
127
Chain Sequence
PLFYIVYTIIPCILISILAILVFYLPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVVVLNLHHRSAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 45
structure length 127
sequence length 250
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedB00
5LG3A 4TWDA 4TWHA 2XQ4A 4A97A 4TNVA 2XQ7A 2YKSA 4F8HA 1OEDB 3RQUA 4LMLA 4ILBA 5IUXA 3TLTA 3RIAA 5CFBA 2XQ9A 4HFHA 5L4HA 4HFCA 2XQAA 4A98A 2KSRA 2BG9C 2BG9B 2YOEA 5HEJA 3EAMA 4ILAA 3RHWA 4HFIA 3UU5A 4IL4A 2YN6A 3TLVA 4QH4A 3P50A 2LM2A 2LKHA 5HEUA 2XQ6A 4TNWA 3RIFA 4TWFA 2XQ3A 5J0ZA 1OEDA 3UU4A 4COFA 4IREA 3UUBA 2XQ8A 4HFBA 5HEHA 3LSVA 5L4EA 5HCMA 2VL0A 3UQ7A 2M6IA 3TLSA 4HFEA 3TLWA 4HFDA 3RQWA 3TLUA 3UQ4A 2LLYA 3JAEA 4ILCA 2BG9A 4ZZBA 2LKGA 4QH1A 3UU3A 1OEDE 4QH5A 4NPPA 3RI5A 3UU8A 3ZKRA 3JAFA 4Z91A 5HCJA 2M6BA 4ZZCA 1OEDC 5L47A 3P4WA 4LMKA 2MAWA 4LMJA 4X5TA 5HEGA 3EI0A 4IL9A 2BG9E 3EHZA 3UU6A 5HEOA 4Z90A 2XQ5A 3JADA
chains in the Genus database with same CATH superfamily
3ZT6A 4X1KE 4EZHA 3EVYA 5GONE 2D5UA 5LYJE 3AE8A 5M4YA 1ZV4X 4IIJE 3TLTA 5ABGA 1ZOYA 3AEDA 4UXNB 1MNEA 3KV5A 4WBOA 3KV6A 2V26A 2CEAA 4L0RA 4ZEYA 1UX5A 3D0TA 1D1AA 4KBMB 4LFBT 2DWKA 3AVSA 1HF8A 4N78D 4O2BE 3MKDA 4TNWA 2NTXA 4YSYA 2V7MA 5J0ZA 1XZYA 4U2ZA 2VB6A 2ZM8A 5C3JA 2M67A 3UQ4A 2FJAA 4DR7T 5JDNA 4XZCA 1OEDE 5H6RB 3PJAJ 3CQGB 3HKEE 2C5JA 4MHCA 1YD8G 3SFDA 3JAFA 3P4WA 1JNZA 3EHZA 5FY1A 2WMOA 1VCSA 2XAQB 2KZ7B 4DR6T 1XDOA 5FL0A 1E1HB 3AEGA 1HX8A 2D9DA 2W4XA 3LK42 4TX5A 2XSBA 3L3PA 1X79A 3JC6C 5HWXA 2VKHA 4EIWA 5IUXA 4NIQA 3LK3B 3BQKA 5JQGE 5FNVE 4AKRB 2BVLA 4HE8A 4TV8E 2NTYA 4CI1B 4ILAA 2WP9A 1T72A 1HTJF 5L2LA 2YDQA 5L3CB 1E7PA 3FHNA 3ZC1A 5CB4E 4BAYB 2LKHA 4CXWA 2J47A 4DR5T 4QHOA 4B3TT 3EABA 3AB3B 4X20E 4WW0A 3FB2A 3R84B 3TLSA 3HKDE 1NEKA 3KDSE 1SA0E 2ACXA 3WAKA 3UU3A 2BVMA 3L09A 3G06A 2QRXA 4BJMA 4ZI7E 4ZZCA 3BQIA 2UXNB 4PW8A 5BR8T 4IGUA 5KDMC 3PUXF 1UCUA 5C2TA 3QB5K 3FZLB 2X66A 5LG3A 4BA9A 4ISTA 2CLYC 4EAHA 3IHRA 2I0MA 2RA1A 5L3DB 3AE9A 2WWVA 2EHOA 4EEDA 5LGNB 2J62A 1S94A 2D0UA 2XTLA 1Z8UA 1UK5A 2BKPA 4DV5T 1T7SA 5AQKB 3EUHA 4GKJT 2XQYA 4OX9T 2X9XA 1OXZA 4I0UA 2RP4A 2KINB 1IJ6A 3ZMVB 2WZHA 4H9OC 4TWFA 2LRKA 3WI3A 4DR1T 4DBQA 2JQ9A 4X64T 3ZMTB 2WCAA 2NOXA 1WRDA 4O4LE 1HNXT 1KNPA 1MMGA 3TLWA 2CBIA 3RYCE 2E5LT 3K1SA 4JYAT 4KMCA 4QH5A 4B3RT 2BBHA 3NZQA 2LOSA 2Q9QC 3O4XE 4KX6A 2YDSA 3LBXB 4CN6A 3UU6A 3RIUA 3C51A 1I94T 3ONJA 3RRCA 3AXJA 1HCIA 1XNRT 4AI6A 4AISA 1OEDB 2A9UA 4XAXB 4LF9T 2KWIB 4UV8B 2LSJA 3CIRA 4HN9A 5HXEA 2V6YA 1D1CA 2YU1A 4V1Av 1HG2A 1MNDA 3ANWA 2VVNA 5EZYE 3RHWA 4HWFA 2XM1A 3MXZA 2FJEA 4QXBB 2P9BA 4WYVA 3VHLA 3AA7B 4EYUA 2F4VT 3VRBA 4EV6A 1BR4A 3P4SA 3ZJ1A 2X9WA 4IREA 4PJNA 2A3DA 2W0GA 1WFDA 2X0LB 4JV5T 4YXDA 4DV6T 5IHYA 2W00A 2PFVA 3IEEA 5F3JA 2YK0A 1MMDA 3RPUA 3RRWA 1EZ3A 1N36T 5LJNA 4P0AA 4JUYA 1WYBA 4LMKA 5HEGA 3OTOT 4IE5A 4HFVA 1VCTA 4LF7T 3ZYLA 2BZBA 4Z90A 4HWDA 3AE4A 4ILUA 3JADA 3K8PC 4TWHA 4DUYT 2W66A 3OKQA 2CXFA 4WZXA 2IAKA 3UUMA 2YINA 2CWOA 2L3LA 5F8PA 4L5GA 3N9MA 5LB7B 4A98A 2ZLYA 4AIUA 2WB5A 4AXPA 5LHIB 4H9RC 4G2AA 2IC9A 2XJ7A 4QXCB 2XSAA 3AEAA 4UV9B 4EGWA 4IL4A 3ZEFB 1OWAA 1MIWA 4U7IA 4DR2T 5AQQB 1D0YA 2KMFA 3LSVA 2B76A 2BBJA 2ES0A 3SWHA 2M6IA 3MK7C 4QKNA 4PK6A 4HFDA 3TLUA 3ZMSB 3DJBA 5JRCA 2LKGA 3A7MA 4E7ZA 2A72A 2L9QA 4KP3C 4KI0F 5FXVA 3ABVA 2WWUA 1HNWT 3AE2A 3CKDA 2LHNA 4GOUA 5HCJA 3PV0F 4OYKA 2WBLA 3IBPA 2CCQA 2WQYA 3KVBA 5LBQB 3PE0A 1YKHB 3MZKB 2E9XC 4O8SA 2DCFA 4PK5A 2MBGA 2ZM2A 5CA0E 2Y6XA 2LM9A 4TN7B 2QGSA 3AECA 1XMOT 4BJNA 1J5ET 5HEJA 3N9PA 3KV4A 2JMHA 4I55E 4EEBA 3FZHB 2XZEA 1SHZC 2W63A 3B5MA 4CN1A 3WAJA 2FBWA 3P4RA 2WS3A 2YU2A 3NZPA 2WZIA 4UF0B 5HEUA 3LK2B 3S4UA 2WM9A 3PUWF 2DI4A 5LMUT 3GA8A 1U4QA 5ETWA 5LGUB 3FZKB 2WDQA 4AQGA 4YHJA 4ZI3C 4IE0A 2CA5A 3HKCE 3ESLA 2D2SA 4DMWA 2BS3A 2EHOB 3OBVE 4MLKA 1BR2A 4LF4T 5ADXL 3RH3A 4WBNE 3F2EA 4J2CA 3AAIA 2MAWA 2NW7A 1HG5A 2FJDA 3PJAA 4EZ4A 2UUBT 4JI6T 2BS2A 4TWDA 2CWYA 2V7KA 2VKDA 4A97A 4JEHB 2NP9A 2FUPA 4DV7T 1NAFA 1KK7A 5KMGP 2XQ7A 4CXYA 3O1HA 3CPZA 3P7IA 2V7LA 2AE9A 2PBIA 3FZFB 3PU3A 4FI5A 5IWAT 3Q5XA 1IBKT 2XAHB 5FP3A 2JMKA 2BG9C 5ABHA 5AQNB 3ONLC 2V1DB 5FVLA 3UU5A 4EYYR 4O4JE 2CRBA 4DR4T 2XAFB 5LBMA 1YW0A 4UEMA 1LRZA 5FVKA 4ANJA 2C0SA 4WNKA 2XASB 3EDUA 3ZN0B 4YTMA 3JC6D 2DL1A 5AQFB 1IBMT 2VL0A 3UFGA 3ZYKA 2H89A 5J1GA 4AQFC 3IA3A 2LLYA 3AXJB 2V6XA 1R8IA 4JLEA 3PUYF 4YFSA 4AKLA 3RI5A 2V6YB 4CZZB 3K3NA 2B1EA 1OEDC 4YY3T 3ANWB 3KINB 3KFWX 3B13A 4X65T 2DNXA 5LXTE 5LJMA 4OYJA 2UUAT 2IW5B 1E2AA 1KFYA 2SPCA 3E0ZA 5JDFA 1FIOA 4JI5T 4CI3B 1Y01A 5LP6E 1VOMA 2MTQA 3J9X1 4PAGA 3U78A 3HA4A 1QUUA 5L3FB 4UF0A 3ZT5A 4PFPA 3Q5WA 4UVBB 4QXHB 1YQ3A 3ZYMA 4QWNB 5AQRB 3AA6B 2IC6A 1IZNB 2YOEA 2CXDA 3V5UA 4QX7B 4ZXLA 3UUXB 3L8RA 3C98B 3ZLIA 1LKXA 3T1HT 3CQCB 2KLQA 3PUZF 2I6HA 4HKAA 4M1PA 2BKOA 3MA9A 4IHJE 4OHFA 4HFBA 3ZCIA 4H9PC 2QA7A 1FMWA 4ZI2C 5C8YE 1ZKEA 2OLTA 3O1IA 3AE5A 2J4GA 4IDNA 3PUAA 5FXWA 4IE7A 3Q9DA 1X9BA 1LVKA 4ZI2D 2LRLA 4Z91A 4DV2T 3NRYA 4X5TA 3AEFA 1JNRA 3DTOA 4EB6E 4DO0A 5JR9C 1BR0A 3LDQB 3PU8A 4U74A 1US7B 3QNUA 5AQPB 1IJ5A 2LOPA 4JBWF 4PK4A 5HWYA 4O4IE 2XQ9A 1D0ZA 2CXLA 4IDZA 2PTFA 2RPAA 3PTRB 2Q9QD 5JRCB 4JEUB 3KV9A 1HX1B 3IF8B 1DU2A 1MMAA 2MOZA 3UULA 3ZSTA 3CMLA 3MJXA 2UUCT 2MYSA 4DV1T 3ZT7A 1WCRA 5AQVB 2GK9A 1MIVA 5LA6E 2FJBA 4DR3T 3P8CD 5HXHA 3CWZB 2V8SV 3RYIE 2DHRA 1IBLT 5FL1A 1UX4A 2NWBA 4OK0A 1SUMB 5LG4A 2LSKA 3NVOA 4NPPA 3FBZA 3N2OA 3ZKRA 3I9WA 3N9NA 1XMQT 2ZM6T 2JIWA 2X0HA 4NXMT 3RKOA 3QK6A 2N9DA 4DIDB 1HNZT 4JI7T 4DUZT 3PUSA 4HGAA 2Y8DA 5DJQC 2WSSV 3P4PA 2IIUA 2LSIA 4HTEA 2WMNA 1XDPA 2Y48B 3AEEA 1O3XA 4HWHA 3F57A 4B3MT 5FXZA 1IAPA 1T98A 1D0XA 2E2AA 1W0BA 5L4HA 1M62A 5HYAA 3ZCJA 1J5WA 1L0VA 4HFIA 5FYMA 3QC9A 3JCFA 4ZS3A 2W2UA 3ZN1B 3UTKA 4CXXA 5CGMA 3OYZA 3K3OA 2EHOC 2HN2A 4A56A 1VRBA 2LT3A 4COFA 2JPFA 3KVAA 3N9LA 3SS1A 2JRKA 5KX5E 3C4XA 1FJGT 3AE3A 2HN1A 3RQWA 3JAEA 4ILCA 2BG9A 2UXDT 3C64A 2V5DA 3OYXA 4QH1A 2LSGA 4UR9A 3TKLB 4DV0T 3A8YC 5FY0A 1ZEEA 4LF5T 4U33A 2Q9QB 3NKZA 2QYWA 2BS4A 5L47A 3EI0A 2VL8A 4P09A 5AQJB 2KWHA 4GYSA 4OFZA 2E8IA 5TAOA 3M65A 1HR0T 2DWGA 4GKKT 1CHUA 1Y64B 2CHNA 1XWMA 4TNVA 2X9HA 2IDOB 3KBUA 1B7TA 4Z8XA 2WDVA 2J1DG 3GN5B 4LMLA 2X9YA 4GK5E 4F6RC 3MACA 3RLFF 4HFCA 5AQIB 3UUNA 1YQ4A 4H63V 1V9DA 3RIUC 4P1NA 3RGLA 5J2TE 1CUNA 2VKJA 2YN6A 2JQKA 1W09A 3SFEA 2JJ9A 3AVRA 2LM2A 3GWHA 1WLXA 5JDGA 1J1JA 1FEWA 2XQ8A 2E9XD 2ODVA 2ZMAA 4UELA 5L4EA 3CX8B 3HL6A 3SRZA 2W67A 4HFEA 2ZM0A 3B57A 4A5XA 3N9QA 4KHZF 2K3WA 3PUGA 1I6ZA 4JI8T 1UUSA 1KF6A 3PUQA 2ODUA 3OVUA 3N5LA 2G0UA 5ABFA 5BMVE 3ZMZB 2VQET 4IL9A 4JI0T 2BG9E 4B6XA 2HPLA 3F31A 3W15B 4YJ2E 4CQIA 4ISSA 3RF1A 2CM0A 2K24A 2WU2A 4K0UA 4IE4A 5LNKA 2BDEA 5KXJA 4YSZA 4Q25A 4ZI3D 5LCYA 3RC8A 3CX7B 2CBJA 3AE7A 2H7OA 4HFHA 3LJCA 2E5VA 4FJOA 2CPTA 5FMNA 2OV9A 1QLBA 2DLRA 3VRAA 4KUMB 5FY7A 3EAMA 1MIYA 1NENA 1YKEB 5JR9A 4DV3T 3FXEB 3P4QA 1WR0A 2XUEA 3P50A 1ZHCA 5JDMA 3PDYA 4IE6A 1G73A 2Q9QA 4AKGA 3RIFA 1BR1A 5FXXA 3HKBE 3EDVA 5JREA 3AAEB 5HCMA 2R6GF 2UU9T 2CE7A 3VR8A 4PJMA 5JH7E 4IT4A 3Q5DA 4ZZBA 3RKGA 4ZS2A 3PURA 4DVDA 3ZSSA 5EK3A 3UU8A 2AXDS 3GN5A 2VQFT 2M6BA 3HR0A 2N1GA 5AQMB 4CN4A 4LMJA 3CVRA 1KNRA 2YDRA 4X1YE 2ACZA 2XM2A 5LHGB 4HWCA 4U72A 4U31A 3E22E 2V5CA 2E9XB 3AE6A 3OJAA 3QB5A 2LE8A 4IDOA 3RIAA 3PUVF 2XQAA 1N32T 1Z0PA 5JDHA 2V7JA 2KSRA 4UIGA 4IDQA 2WU5A 5AQHB 3NWIA 3K3QC 2IMLA 1WR6A 4LFCT 4UVCB 2H7VC 3O1JA 5EK4A 3E08A 2UXXB 1D1BA 4P0BA 5JTGA 5LMNT 2XQ3A 2IHR1 3UUBA 5HEHA 3ONXA 4YJ3E 2CHOA 4DV4T 2LJLA 5E0OA 3I9YA 4MALA 3T1YT 2X0YA 2X67A 3UT5E 3BQLA 3AE1A 3HI2A 2IUBA 5H6QB 4MFRA 4H9SE 3RC3A 3U3IA 3A5XA 4YTPA 4PJLA 4UVAB 4DNDA 1GQEA 4XBFB 2XPKA 3H37A 2L8KA 5J2UE 5HEOA 1UURA 4LF6T 3FZMB 4NXNT 3O9XA 5HXCA 3FBLA 3T8OA 2HH7A 2KXPB 5LOVE 2UXBT 1S35A 5FKYA 2UXCT 3H3MA 3SOLA 5AFUL 4TZ4C 3RQUA 3CQXC 5CJ5A 2X68A 3ZPOA 4LF8T 2JQQA 5JVDE 4JI4T 2LSYA 2QVAA 4JI1T 4ADZA 2C5KT 2BG9B 2VWAA 4ZOLE 4YHHT 4E7SA 2VKOA 1SE7A 2VASA 5ABEA 4YLHA 4IDPA 2WDRA 3VKGA 2OA5A 3QOFA 4ASKA 2I59A 1M7KA 5IYZE 5L3EB 4I50E 5JDLA 3H3AA 3OPCA 3UU4A 3UQ7A 2K48A 3M3ZB 5HXRA 2LHRA 4QX8B 1NWMX 3AAAB 4ZHQE 4CI2B 3ETVA 2WAUA 3L39A 2E9XA 1KNZA 4X66T 5A1LA 5CA1E 5AQGB 3NBXX 3FXDB 2H88A 4HEAA 3DP7A 2XY8B 3Q2MA 2A2FX 4DBRA 3N2GE 4AKIA 2CMRA 5L3GB 2WY2A 4H9QC 4U7YA 3VU7H 2LEHA 2C5IT 2NW8A 4F8HA 5AQUB 3VKHA 4ILBA 2BKNA 1LVFA 4YTNA 4U3CA 5AQOB 3ZMUB 5CFBA 4AKHA 5F5WA 3AEBA 5AQSB 2CLYB 3RX6A 2VK9A 5HXSA 3ETUA 5JDQA 1XNQT 1YXRA 3TLVA 4EXTA 1HS7A 3GMIA 4QH4A 5ABFB 4HWIB 3I1AA 1ZP0A 4MBQA 4PNIA 4YSXA 2XQ6A 5LHHB 3CX6B 3N2KE 2VURA 5DQVA 4H63H 5AQLB 2H3RA 5AQTB 3R6NA 3AA1B 3C50A 2W62A 2K5BB 4EOZB 2N2NA 4G63A 3VR9A 5DABA 3RYFE 1G8XA 3UFEA 4X62T 3Q5EA 3CK6A 4B3ST 2NR4A 4AQYT 4I43B 3AA0B 2PJQA 4K0KT 5HAXA 2X51A 2EHOD 5EK2A 5JR9B 2D0TA 2HHHT 1W0AA 2XQ4A 4ERRA 2XAJB 4H9NC 2XHEB 1HFAA 4KHPT 3KBTA 1KEYA 4GIWA 5LGTB 4JI2T 2V7IA 2YKSA 2VVSA 4L9IA 2NW9A 3LFMA 1WYCA 3V5SA 2W61A 1MMNA 1W9RA 3RYHE 5L3BB 1T8BA 2JQHA 3QUJA 4NUUA 3LBXA 4I4TE 4AQFA 1AJ3A 2K9AA 1UGOA 3I0QA 2MPKA 2XAGB 3ZJ2A 4NUVA 2Z6EA 4TV9E 1OEDA 4YT0A 3J7Yq 4TUYE 3X1DA 4JI3T 2YEVC 1N33T 3ZC0A 4O4HE 4GK0E 4LFAT 1FMVA 4PJJA 1N34T 5DQWA 3BK9A 4C90A 3LG7A 2PG8A 1H7CA 3C4ZA 1QSDA 3N9OA 4U2YA 2HPJA 4GYRA 1U5PA 2KNDA 4PFOA 4X1IE 3I0OA 4DMVA 2KT9A 3C4WA 4C91A 3NRXA 2XQ5A 4O2AE
chains in the Genus database with same CATH topology
5LG3A 4TWDA 4TWHA 2XQ4A 4A97A 4TNVA 2XQ7A 2YKSA 4F8HA 1OEDB 3RQUA 4LMLA 4ILBA 5IUXA 3TLTA 3RIAA 5CFBA 2XQ9A 4HFHA 5L4HA 4HFCA 2XQAA 4A98A 2KSRA 2BG9C 2BG9B 2YOEA 5HEJA 3EAMA 4ILAA 3RHWA 4HFIA 3UU5A 4IL4A 2YN6A 3TLVA 4QH4A 3P50A 2LM2A 2LKHA 5HEUA 2XQ6A 4TNWA 3RIFA 4TWFA 2XQ3A 5J0ZA 1OEDA 3UU4A 4COFA 4IREA 3UUBA 2XQ8A 4HFBA 5HEHA 3LSVA 5L4EA 5HCMA 2VL0A 3UQ7A 2M6IA 3TLSA 4HFEA 3TLWA 4HFDA 3RQWA 3TLUA 3UQ4A 2LLYA 3JAEA 4ILCA 2BG9A 4ZZBA 2LKGA 4QH1A 3UU3A 1OEDE 4QH5A 4NPPA 3RI5A 3UU8A 3ZKRA 3JAFA 4Z91A 5HCJA 2M6BA 4ZZCA 1OEDC 5L47A 3P4WA 4LMKA 2MAWA 4LMJA 4X5TA 5HEGA 3EI0A 4IL9A 2BG9E 3EHZA 3UU6A 5HEOA 4Z90A 2XQ5A 3JADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG3 A;  4TWD A;  4TWH A;  2XQ4 A;  4A97 A;  4TNV A;  2XQ7 A;  2YKS A;  4F8H A;  1OED B;  3RQU A;  4LML A;  4ILB A;  5IUX A;  3TLT A;  3RIA A;  5CFB A;  2XQ9 A;  4HFH A;  5L4H A;  4HFC A;  2XQA A;  4A98 A;  2KSR A;  2BG9 C;  2BG9 B;  2YOE A;  5HEJ A;  3EAM A;  4ILA A;  3RHW A;  4HFI A;  3UU5 A;  4IL4 A;  2YN6 A;  3TLV A;  4QH4 A;  3P50 A;  2LM2 A;  2LKH A;  5HEU A;  2XQ6 A;  4TNW A;  3RIF A;  4TWF A;  2XQ3 A;  5J0Z A;  1OED A;  3UU4 A;  4COF A;  4IRE A;  3UUB A;  2XQ8 A;  4HFB A;  5HEH A;  3LSV A;  5L4E A;  5HCM A;  2VL0 A;  3UQ7 A;  2M6I A;  3TLS A;  4HFE A;  3TLW A;  4HFD A;  3RQW A;  3TLU A;  3UQ4 A;  2LLY A;  3JAE A;  4ILC A;  2BG9 A;  4ZZB A;  2LKG A;  4QH1 A;  3UU3 A;  1OED E;  4QH5 A;  4NPP A;  3RI5 A;  3UU8 A;  3ZKR A;  3JAF A;  4Z91 A;  5HCJ A;  2M6B A;  4ZZC A;  1OED C;  5L47 A;  3P4W A;  4LMK A;  2MAW A;  4LMJ A;  4X5T A;  5HEG A;  3EI0 A;  4IL9 A;  2BG9 E;  3EHZ A;  3UU6 A;  5HEO A;  4Z90 A;  2XQ5 A;  3JAD A; 
#chains in the Genus database with same CATH topology
 3ZT6 A;  4X1K E;  4EZH A;  3EVY A;  5GON E;  2D5U A;  5LYJ E;  3AE8 A;  5M4Y A;  1ZV4 X;  4IIJ E;  3TLT A;  5ABG A;  1ZOY A;  3AED A;  4UXN B;  1MNE A;  3KV5 A;  4WBO A;  3KV6 A;  2V26 A;  2CEA A;  4L0R A;  4ZEY A;  1UX5 A;  3D0T A;  1D1A A;  4KBM B;  4LFB T;  2DWK A;  3AVS A;  1HF8 A;  4N78 D;  4O2B E;  3MKD A;  4TNW A;  2NTX A;  4YSY A;  2V7M A;  5J0Z A;  1XZY A;  4U2Z A;  2VB6 A;  2ZM8 A;  5C3J A;  2M67 A;  3UQ4 A;  2FJA A;  4DR7 T;  5JDN A;  4XZC A;  1OED E;  5H6R B;  3PJA J;  3CQG B;  3HKE E;  2C5J A;  4MHC A;  1YD8 G;  3SFD A;  3JAF A;  3P4W A;  1JNZ A;  3EHZ A;  5FY1 A;  2WMO A;  1VCS A;  2XAQ B;  2KZ7 B;  4DR6 T;  1XDO A;  5FL0 A;  1E1H B;  3AEG A;  1HX8 A;  2D9D A;  2W4X A;  3LK4 2;  4TX5 A;  2XSB A;  3L3P A;  1X79 A;  3JC6 C;  5HWX A;  2VKH A;  4EIW A;  5IUX A;  4NIQ A;  3LK3 B;  3BQK A;  5JQG E;  5FNV E;  4AKR B;  2BVL A;  4HE8 A;  4TV8 E;  2NTY A;  4CI1 B;  4ILA A;  2WP9 A;  1T72 A;  1HTJ F;  5L2L A;  2YDQ A;  5L3C B;  1E7P A;  3FHN A;  3ZC1 A;  5CB4 E;  4BAY B;  2LKH A;  4CXW A;  2J47 A;  4DR5 T;  4QHO A;  4B3T T;  3EAB A;  3AB3 B;  4X20 E;  4WW0 A;  3FB2 A;  3R84 B;  3TLS A;  3HKD E;  1NEK A;  3KDS E;  1SA0 E;  2ACX A;  3WAK A;  3UU3 A;  2BVM A;  3L09 A;  3G06 A;  2QRX A;  4BJM A;  4ZI7 E;  4ZZC A;  3BQI A;  2UXN B;  4PW8 A;  5BR8 T;  4IGU A;  5KDM C;  3PUX F;  1UCU A;  5C2T A;  3QB5 K;  3FZL B;  2X66 A;  5LG3 A;  4BA9 A;  4IST A;  2CLY C;  4EAH A;  3IHR A;  2I0M A;  2RA1 A;  5L3D B;  3AE9 A;  2WWV A;  2EHO A;  4EED A;  5LGN B;  2J62 A;  1S94 A;  2D0U A;  2XTL A;  1Z8U A;  1UK5 A;  2BKP A;  4DV5 T;  1T7S A;  5AQK B;  3EUH A;  4GKJ T;  2XQY A;  4OX9 T;  2X9X A;  1OXZ A;  4I0U A;  2RP4 A;  2KIN B;  1IJ6 A;  3ZMV B;  2WZH A;  4H9O C;  4TWF A;  2LRK A;  3WI3 A;  4DR1 T;  4DBQ A;  2JQ9 A;  4X64 T;  3ZMT B;  2WCA A;  2NOX A;  1WRD A;  4O4L E;  1HNX T;  1KNP A;  1MMG A;  3TLW A;  2CBI A;  3RYC E;  2E5L T;  3K1S A;  4JYA T;  4KMC A;  4QH5 A;  4B3R T;  2BBH A;  3NZQ A;  2LOS A;  2Q9Q C;  3O4X E;  4KX6 A;  2YDS A;  3LBX B;  4CN6 A;  3UU6 A;  3RIU A;  3C51 A;  1I94 T;  3ONJ A;  3RRC A;  3AXJ A;  1HCI A;  1XNR T;  4AI6 A;  4AIS A;  1OED B;  2A9U A;  4XAX B;  4LF9 T;  2KWI B;  4UV8 B;  2LSJ A;  3CIR A;  4HN9 A;  5HXE A;  2V6Y A;  1D1C A;  2YU1 A;  4V1A v;  1HG2 A;  1MND A;  3ANW A;  2VVN A;  5EZY E;  3RHW A;  4HWF A;  2XM1 A;  3MXZ A;  2FJE A;  4QXB B;  2P9B A;  4WYV A;  3VHL A;  3AA7 B;  4EYU A;  2F4V T;  3VRB A;  4EV6 A;  1BR4 A;  3P4S A;  3ZJ1 A;  2X9W A;  4IRE A;  4PJN A;  2A3D A;  2W0G A;  1WFD A;  2X0L B;  4JV5 T;  4YXD A;  4DV6 T;  5IHY A;  2W00 A;  2PFV A;  3IEE A;  5F3J A;  2YK0 A;  1MMD A;  3RPU A;  3RRW A;  1EZ3 A;  1N36 T;  5LJN A;  4P0A A;  4JUY A;  1WYB A;  4LMK A;  5HEG A;  3OTO T;  4IE5 A;  4HFV A;  1VCT A;  4LF7 T;  3ZYL A;  2BZB A;  4Z90 A;  4HWD A;  3AE4 A;  4ILU A;  3JAD A;  3K8P C;  4TWH A;  4DUY T;  2W66 A;  3OKQ A;  2CXF A;  4WZX A;  2IAK A;  3UUM A;  2YIN A;  2CWO A;  2L3L A;  5F8P A;  4L5G A;  3N9M A;  5LB7 B;  4A98 A;  2ZLY A;  4AIU A;  2WB5 A;  4AXP A;  5LHI B;  4H9R C;  4G2A A;  2IC9 A;  2XJ7 A;  4QXC B;  2XSA A;  3AEA A;  4UV9 B;  4EGW A;  4IL4 A;  3ZEF B;  1OWA A;  1MIW A;  4U7I A;  4DR2 T;  5AQQ B;  1D0Y A;  2KMF A;  3LSV A;  2B76 A;  2BBJ A;  2ES0 A;  3SWH A;  2M6I A;  3MK7 C;  4QKN A;  4PK6 A;  4HFD A;  3TLU A;  3ZMS B;  3DJB A;  5JRC A;  2LKG A;  3A7M A;  4E7Z A;  2A72 A;  2L9Q A;  4KP3 C;  4KI0 F;  5FXV A;  3ABV A;  2WWU A;  1HNW T;  3AE2 A;  3CKD A;  2LHN A;  4GOU A;  5HCJ A;  3PV0 F;  4OYK A;  2WBL A;  3IBP A;  2CCQ A;  2WQY A;  3KVB A;  5LBQ B;  3PE0 A;  1YKH B;  3MZK B;  2E9X C;  4O8S A;  2DCF A;  4PK5 A;  2MBG A;  2ZM2 A;  5CA0 E;  2Y6X A;  2LM9 A;  4TN7 B;  2QGS A;  3AEC A;  1XMO T;  4BJN A;  1J5E T;  5HEJ A;  3N9P A;  3KV4 A;  2JMH A;  4I55 E;  4EEB A;  3FZH B;  2XZE A;  1SHZ C;  2W63 A;  3B5M A;  4CN1 A;  3WAJ A;  2FBW A;  3P4R A;  2WS3 A;  2YU2 A;  3NZP A;  2WZI A;  4UF0 B;  5HEU A;  3LK2 B;  3S4U A;  2WM9 A;  3PUW F;  2DI4 A;  5LMU T;  3GA8 A;  1U4Q A;  5ETW A;  5LGU B;  3FZK B;  2WDQ A;  4AQG A;  4YHJ A;  4ZI3 C;  4IE0 A;  2CA5 A;  3HKC E;  3ESL A;  2D2S A;  4DMW A;  2BS3 A;  2EHO B;  3OBV E;  4MLK A;  1BR2 A;  4LF4 T;  5ADX L;  3RH3 A;  4WBN E;  3F2E A;  4J2C A;  3AAI A;  2MAW A;  2NW7 A;  1HG5 A;  2FJD A;  3PJA A;  4EZ4 A;  2UUB T;  4JI6 T;  2BS2 A;  4TWD A;  2CWY A;  2V7K A;  2VKD A;  4A97 A;  4JEH B;  2NP9 A;  2FUP A;  4DV7 T;  1NAF A;  1KK7 A;  5KMG P;  2XQ7 A;  4CXY A;  3O1H A;  3CPZ A;  3P7I A;  2V7L A;  2AE9 A;  2PBI A;  3FZF B;  3PU3 A;  4FI5 A;  5IWA T;  3Q5X A;  1IBK T;  2XAH B;  5FP3 A;  2JMK A;  2BG9 C;  5ABH A;  5AQN B;  3ONL C;  2V1D B;  5FVL A;  3UU5 A;  4EYY R;  4O4J E;  2CRB A;  4DR4 T;  2XAF B;  5LBM A;  1YW0 A;  4UEM A;  1LRZ A;  5FVK A;  4ANJ A;  2C0S A;  4WNK A;  2XAS B;  3EDU A;  3ZN0 B;  4YTM A;  3JC6 D;  2DL1 A;  5AQF B;  1IBM T;  2VL0 A;  3UFG A;  3ZYK A;  2H89 A;  5J1G A;  4AQF C;  3IA3 A;  2LLY A;  3AXJ B;  2V6X A;  1R8I A;  4JLE A;  3PUY F;  4YFS A;  4AKL A;  3RI5 A;  2V6Y B;  4CZZ B;  3K3N A;  2B1E A;  1OED C;  4YY3 T;  3ANW B;  3KIN B;  3KFW X;  3B13 A;  4X65 T;  2DNX A;  5LXT E;  5LJM A;  4OYJ A;  2UUA T;  2IW5 B;  1E2A A;  1KFY A;  2SPC A;  3E0Z A;  5JDF A;  1FIO A;  4JI5 T;  4CI3 B;  1Y01 A;  5LP6 E;  1VOM A;  2MTQ A;  3J9X 1;  4PAG A;  3U78 A;  3HA4 A;  1QUU A;  5L3F B;  4UF0 A;  3ZT5 A;  4PFP A;  3Q5W A;  4UVB B;  4QXH B;  1YQ3 A;  3ZYM A;  4QWN B;  5AQR B;  3AA6 B;  2IC6 A;  1IZN B;  2YOE A;  2CXD A;  3V5U A;  4QX7 B;  4ZXL A;  3UUX B;  3L8R A;  3C98 B;  3ZLI A;  1LKX A;  3T1H T;  3CQC B;  2KLQ A;  3PUZ F;  2I6H A;  4HKA A;  4M1P A;  2BKO A;  3MA9 A;  4IHJ E;  4OHF A;  4HFB A;  3ZCI A;  4H9P C;  2QA7 A;  1FMW A;  4ZI2 C;  5C8Y E;  1ZKE A;  2OLT A;  3O1I A;  3AE5 A;  2J4G A;  4IDN A;  3PUA A;  5FXW A;  4IE7 A;  3Q9D A;  1X9B A;  1LVK A;  4ZI2 D;  2LRL A;  4Z91 A;  4DV2 T;  3NRY A;  4X5T A;  3AEF A;  1JNR A;  3DTO A;  4EB6 E;  4DO0 A;  5JR9 C;  1BR0 A;  3LDQ B;  3PU8 A;  4U74 A;  1US7 B;  3QNU A;  5AQP B;  1IJ5 A;  2LOP A;  4JBW F;  4PK4 A;  5HWY A;  4O4I E;  2XQ9 A;  1D0Z A;  2CXL A;  4IDZ A;  2PTF A;  2RPA A;  3PTR B;  2Q9Q D;  5JRC B;  4JEU B;  3KV9 A;  1HX1 B;  3IF8 B;  1DU2 A;  1MMA A;  2MOZ A;  3UUL A;  3ZST A;  3CML A;  3MJX A;  2UUC T;  2MYS A;  4DV1 T;  3ZT7 A;  1WCR A;  5AQV B;  2GK9 A;  1MIV A;  5LA6 E;  2FJB A;  4DR3 T;  3P8C D;  5HXH A;  3CWZ B;  2V8S V;  3RYI E;  2DHR A;  1IBL T;  5FL1 A;  1UX4 A;  2NWB A;  4OK0 A;  1SUM B;  5LG4 A;  2LSK A;  3NVO A;  4NPP A;  3FBZ A;  3N2O A;  3ZKR A;  3I9W A;  3N9N A;  1XMQ T;  2ZM6 T;  2JIW A;  2X0H A;  4NXM T;  3RKO A;  3QK6 A;  2N9D A;  4DID B;  1HNZ T;  4JI7 T;  4DUZ T;  3PUS A;  4HGA A;  2Y8D A;  5DJQ C;  2WSS V;  3P4P A;  2IIU A;  2LSI A;  4HTE A;  2WMN A;  1XDP A;  2Y48 B;  3AEE A;  1O3X A;  4HWH A;  3F57 A;  4B3M T;  5FXZ A;  1IAP A;  1T98 A;  1D0X A;  2E2A A;  1W0B A;  5L4H A;  1M62 A;  5HYA A;  3ZCJ A;  1J5W A;  1L0V A;  4HFI A;  5FYM A;  3QC9 A;  3JCF A;  4ZS3 A;  2W2U A;  3ZN1 B;  3UTK A;  4CXX A;  5CGM A;  3OYZ A;  3K3O A;  2EHO C;  2HN2 A;  4A56 A;  1VRB A;  2LT3 A;  4COF A;  2JPF A;  3KVA A;  3N9L A;  3SS1 A;  2JRK A;  5KX5 E;  3C4X A;  1FJG T;  3AE3 A;  2HN1 A;  3RQW A;  3JAE A;  4ILC A;  2BG9 A;  2UXD T;  3C64 A;  2V5D A;  3OYX A;  4QH1 A;  2LSG A;  4UR9 A;  3TKL B;  4DV0 T;  3A8Y C;  5FY0 A;  1ZEE A;  4LF5 T;  4U33 A;  2Q9Q B;  3NKZ A;  2QYW A;  2BS4 A;  5L47 A;  3EI0 A;  2VL8 A;  4P09 A;  5AQJ B;  2KWH A;  4GYS A;  4OFZ A;  2E8I A;  5TAO A;  3M65 A;  1HR0 T;  2DWG A;  4GKK T;  1CHU A;  1Y64 B;  2CHN A;  1XWM A;  4TNV A;  2X9H A;  2IDO B;  3KBU A;  1B7T A;  4Z8X A;  2WDV A;  2J1D G;  3GN5 B;  4LML A;  2X9Y A;  4GK5 E;  4F6R C;  3MAC A;  3RLF F;  4HFC A;  5AQI B;  3UUN A;  1YQ4 A;  4H63 V;  1V9D A;  3RIU C;  4P1N A;  3RGL A;  5J2T E;  1CUN A;  2VKJ A;  2YN6 A;  2JQK A;  1W09 A;  3SFE A;  2JJ9 A;  3AVR A;  2LM2 A;  3GWH A;  1WLX A;  5JDG A;  1J1J A;  1FEW A;  2XQ8 A;  2E9X D;  2ODV A;  2ZMA A;  4UEL A;  5L4E A;  3CX8 B;  3HL6 A;  3SRZ A;  2W67 A;  4HFE A;  2ZM0 A;  3B57 A;  4A5X A;  3N9Q A;  4KHZ F;  2K3W A;  3PUG A;  1I6Z A;  4JI8 T;  1UUS A;  1KF6 A;  3PUQ A;  2ODU A;  3OVU A;  3N5L A;  2G0U A;  5ABF A;  5BMV E;  3ZMZ B;  2VQE T;  4IL9 A;  4JI0 T;  2BG9 E;  4B6X A;  2HPL A;  3F31 A;  3W15 B;  4YJ2 E;  4CQI A;  4ISS A;  3RF1 A;  2CM0 A;  2K24 A;  2WU2 A;  4K0U A;  4IE4 A;  5LNK A;  2BDE A;  5KXJ A;  4YSZ A;  4Q25 A;  4ZI3 D;  5LCY A;  3RC8 A;  3CX7 B;  2CBJ A;  3AE7 A;  2H7O A;  4HFH A;  3LJC A;  2E5V A;  4FJO A;  2CPT A;  5FMN A;  2OV9 A;  1QLB A;  2DLR A;  3VRA A;  4KUM B;  5FY7 A;  3EAM A;  1MIY A;  1NEN A;  1YKE B;  5JR9 A;  4DV3 T;  3FXE B;  3P4Q A;  1WR0 A;  2XUE A;  3P50 A;  1ZHC A;  5JDM A;  3PDY A;  4IE6 A;  1G73 A;  2Q9Q A;  4AKG A;  3RIF A;  1BR1 A;  5FXX A;  3HKB E;  3EDV A;  5JRE A;  3AAE B;  5HCM A;  2R6G F;  2UU9 T;  2CE7 A;  3VR8 A;  4PJM A;  5JH7 E;  4IT4 A;  3Q5D A;  4ZZB A;  3RKG A;  4ZS2 A;  3PUR A;  4DVD A;  3ZSS A;  5EK3 A;  3UU8 A;  2AXD S;  3GN5 A;  2VQF T;  2M6B A;  3HR0 A;  2N1G A;  5AQM B;  4CN4 A;  4LMJ A;  3CVR A;  1KNR A;  2YDR A;  4X1Y E;  2ACZ A;  2XM2 A;  5LHG B;  4HWC A;  4U72 A;  4U31 A;  3E22 E;  2V5C A;  2E9X B;  3AE6 A;  3OJA A;  3QB5 A;  2LE8 A;  4IDO A;  3RIA A;  3PUV F;  2XQA A;  1N32 T;  1Z0P A;  5JDH A;  2V7J A;  2KSR A;  4UIG A;  4IDQ A;  2WU5 A;  5AQH B;  3NWI A;  3K3Q C;  2IML A;  1WR6 A;  4LFC T;  4UVC B;  2H7V C;  3O1J A;  5EK4 A;  3E08 A;  2UXX B;  1D1B A;  4P0B A;  5JTG A;  5LMN T;  2XQ3 A;  2IHR 1;  3UUB A;  5HEH A;  3ONX A;  4YJ3 E;  2CHO A;  4DV4 T;  2LJL A;  5E0O A;  3I9Y A;  4MAL A;  3T1Y T;  2X0Y A;  2X67 A;  3UT5 E;  3BQL A;  3AE1 A;  3HI2 A;  2IUB A;  5H6Q B;  4MFR A;  4H9S E;  3RC3 A;  3U3I A;  3A5X A;  4YTP A;  4PJL A;  4UVA B;  4DND A;  1GQE A;  4XBF B;  2XPK A;  3H37 A;  2L8K A;  5J2U E;  5HEO A;  1UUR A;  4LF6 T;  3FZM B;  4NXN T;  3O9X A;  5HXC A;  3FBL A;  3T8O A;  2HH7 A;  2KXP B;  5LOV E;  2UXB T;  1S35 A;  5FKY A;  2UXC T;  3H3M A;  3SOL A;  5AFU L;  4TZ4 C;  3RQU A;  3CQX C;  5CJ5 A;  2X68 A;  3ZPO A;  4LF8 T;  2JQQ A;  5JVD E;  4JI4 T;  2LSY A;  2QVA A;  4JI1 T;  4ADZ A;  2C5K T;  2BG9 B;  2VWA A;  4ZOL E;  4YHH T;  4E7S A;  2VKO A;  1SE7 A;  2VAS A;  5ABE A;  4YLH A;  4IDP A;  2WDR A;  3VKG A;  2OA5 A;  3QOF A;  4ASK A;  2I59 A;  1M7K A;  5IYZ E;  5L3E B;  4I50 E;  5JDL A;  3H3A A;  3OPC A;  3UU4 A;  3UQ7 A;  2K48 A;  3M3Z B;  5HXR A;  2LHR A;  4QX8 B;  1NWM X;  3AAA B;  4ZHQ E;  4CI2 B;  3ETV A;  2WAU A;  3L39 A;  2E9X A;  1KNZ A;  4X66 T;  5A1L A;  5CA1 E;  5AQG B;  3NBX X;  3FXD B;  2H88 A;  4HEA A;  3DP7 A;  2XY8 B;  3Q2M A;  2A2F X;  4DBR A;  3N2G E;  4AKI A;  2CMR A;  5L3G B;  2WY2 A;  4H9Q C;  4U7Y A;  3VU7 H;  2LEH A;  2C5I T;  2NW8 A;  4F8H A;  5AQU B;  3VKH A;  4ILB A;  2BKN A;  1LVF A;  4YTN A;  4U3C A;  5AQO B;  3ZMU B;  5CFB A;  4AKH A;  5F5W A;  3AEB A;  5AQS B;  2CLY B;  3RX6 A;  2VK9 A;  5HXS A;  3ETU A;  5JDQ A;  1XNQ T;  1YXR A;  3TLV A;  4EXT A;  1HS7 A;  3GMI A;  4QH4 A;  5ABF B;  4HWI B;  3I1A A;  1ZP0 A;  4MBQ A;  4PNI A;  4YSX A;  2XQ6 A;  5LHH B;  3CX6 B;  3N2K E;  2VUR A;  5DQV A;  4H63 H;  5AQL B;  2H3R A;  5AQT B;  3R6N A;  3AA1 B;  3C50 A;  2W62 A;  2K5B B;  4EOZ B;  2N2N A;  4G63 A;  3VR9 A;  5DAB A;  3RYF E;  1G8X A;  3UFE A;  4X62 T;  3Q5E A;  3CK6 A;  4B3S T;  2NR4 A;  4AQY T;  4I43 B;  3AA0 B;  2PJQ A;  4K0K T;  5HAX A;  2X51 A;  2EHO D;  5EK2 A;  5JR9 B;  2D0T A;  2HHH T;  1W0A A;  2XQ4 A;  4ERR A;  2XAJ B;  4H9N C;  2XHE B;  1HFA A;  4KHP T;  3KBT A;  1KEY A;  4GIW A;  5LGT B;  4JI2 T;  2V7I A;  2YKS A;  2VVS A;  4L9I A;  2NW9 A;  3LFM A;  1WYC A;  3V5S A;  2W61 A;  1MMN A;  1W9R A;  3RYH E;  5L3B B;  1T8B A;  2JQH A;  3QUJ A;  4NUU A;  3LBX A;  4I4T E;  4AQF A;  1AJ3 A;  2K9A A;  1UGO A;  3I0Q A;  2MPK A;  2XAG B;  3ZJ2 A;  4NUV A;  2Z6E A;  4TV9 E;  1OED A;  4YT0 A;  3J7Y q;  4TUY E;  3X1D A;  4JI3 T;  2YEV C;  1N33 T;  3ZC0 A;  4O4H E;  4GK0 E;  4LFA T;  1FMV A;  4PJJ A;  1N34 T;  5DQW A;  3BK9 A;  4C90 A;  3LG7 A;  2PG8 A;  1H7C A;  3C4Z A;  1QSD A;  3N9O A;  4U2Y A;  2HPJ A;  4GYR A;  1U5P A;  2KND A;  4PFO A;  4X1I E;  3I0O A;  4DMV A;  2KT9 A;  3C4W A;  4C91 A;  3NRX A;  2XQ5 A;  4O2A E; 
#chains in the Genus database with same CATH homology
 5LG3 A;  4TWD A;  4TWH A;  2XQ4 A;  4A97 A;  4TNV A;  2XQ7 A;  2YKS A;  4F8H A;  1OED B;  3RQU A;  4LML A;  4ILB A;  5IUX A;  3TLT A;  3RIA A;  5CFB A;  2XQ9 A;  4HFH A;  5L4H A;  4HFC A;  2XQA A;  4A98 A;  2KSR A;  2BG9 C;  2BG9 B;  2YOE A;  5HEJ A;  3EAM A;  4ILA A;  3RHW A;  4HFI A;  3UU5 A;  4IL4 A;  2YN6 A;  3TLV A;  4QH4 A;  3P50 A;  2LM2 A;  2LKH A;  5HEU A;  2XQ6 A;  4TNW A;  3RIF A;  4TWF A;  2XQ3 A;  5J0Z A;  1OED A;  3UU4 A;  4COF A;  4IRE A;  3UUB A;  2XQ8 A;  4HFB A;  5HEH A;  3LSV A;  5L4E A;  5HCM A;  2VL0 A;  3UQ7 A;  2M6I A;  3TLS A;  4HFE A;  3TLW A;  4HFD A;  3RQW A;  3TLU A;  3UQ4 A;  2LLY A;  3JAE A;  4ILC A;  2BG9 A;  4ZZB A;  2LKG A;  4QH1 A;  3UU3 A;  1OED E;  4QH5 A;  4NPP A;  3RI5 A;  3UU8 A;  3ZKR A;  3JAF A;  4Z91 A;  5HCJ A;  2M6B A;  4ZZC A;  1OED C;  5L47 A;  3P4W A;  4LMK A;  2MAW A;  4LMJ A;  4X5T A;  5HEG A;  3EI0 A;  4IL9 A;  2BG9 E;  3EHZ A;  3UU6 A;  5HEO A;  4Z90 A;  2XQ5 A;  3JAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...