1OEDB

Structure of acetylcholine receptor pore from electron images
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
250
structure length
127
Chain Sequence
b'PLFYIVYTIIPCILISILAILVFYLPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVVVLNLHHRSAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
molecule tags Ion channel/receptor
publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
total genus 45
structure length 127
sequence length 250
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedB00
1OEDB 3RI5A 4X5TA 2YOEA 4HFBA 4TNWA 3RIAA 3ZKRA 3TLTA 4Z91A 3JAEA 2KSRA 5HEGA 2XQ7A 4TWFA 5J0ZA 4ILCA 1OEDE 2XQ8A 3RQUA 3UUBA 3JADA 2LKHA 2XQ5A 2BG9A 4IREA 4A97A 5HEOA 4ILAA 5L47A 5HCMA 5HEUA 4Z90A 3RIFA 5HEHA 3RQWA 2MAWA 2XQAA 2LM2A 3EAMA 4COFA 2XQ6A 2YKSA 5L4HA 4QH5A 4HFHA 4LMKA 4NPPA 3P4WA 3TLWA 3UQ7A 3P50A 4ILBA 4QH4A 2YN6A 2VL0A 2XQ4A 2LKGA 4F8HA 5IUXA 4TWDA 4QH1A 3TLSA 4HFIA 4ZZCA 2LLYA 3TLUA 4TNVA 3UU6A 3UU5A 5HEJA 2M6IA 3TLVA 3UU4A 2BG9C 3UU8A 4ZZBA 3EI0A 5HCJA 2BG9E 5L4EA 4LMJA 3UQ4A 3LSVA 1OEDA 2XQ3A 3UU3A 4TWHA 4HFEA 5CFBA 4HFDA 2XQ9A 3RHWA 4A98A 4IL4A 4HFCA 1OEDC 2BG9B 5LG3A 2M6BA 4LMLA 3JAFA 3EHZA 4IL9A
chains in the Genus database with same CATH superfamily
4X65T 3AAAB 3RYFE 3NBXX 1YKHB 5JVDE 3FHNA 4O2BE 4YSZA 2L9QA 3B13A 4DBRA 4PAGA 3I9YA 1FMWA 4DV1T 1WR0A 1NEKA 5LCYA 4AXPA 4O4IE 3TLTA 1EZ3A 2P9BA 4Z91A 2H7VC 3RIUA 3AA0B 3KINB 4JBWF 4E7SA 1E7PA 2ODUA 2VKJA 2W2UA 1VRBA 2BVMA 3ANWB 3AAIA 3RYHE 5HYAA 5LHHB 4DR3T 1L0VA 2CBJA 4CXYA 5FP3A 2IAKA 4DR2T 3CPZA 2V6XA 3LK3B 4PK6A 4PJJA 2NR4A 5LHGB 4ZI2C 3PUQA 5JDMA 4G2AA 2JJ9A 3CIRA 2X9YA 3OVUA 4JI6T 4XZCA 2XQ5A 2R6GF 5AQLB 3UT5E 3AE5A 4XAXB 5EK3A 3VR9A 2N9DA 5DQWA 4ZS2A 5HEOA 3ZMZB 3L39A 3DJBA 2UUBT 4KHPT 1M62A 4Z90A 5ABHA 3PUWF 3ZSSA 4EIWA 1DU2A 5HEHA 1B7TA 4AKIA 2CEAA 2KMFA 4LF7T 3E22E 3ZJ1A 2OV9A 3MACA 1ZEEA 2H88A 5L3FB 3J7Yq 1UURA 4DV3T 3AEEA 1W0AA 4CZZB 4EZHA 4XBFB 2BKPA 2NOXA 2W63A 3HKBE 3NVOA 4ZOLE 3JC6C 4X1KE 2XSBA 4MHCA 5JR9B 3OKQA 2B76A 2WU5A 5LMUT 2CXDA 2YKSA 3GN5B 3I0QA 2XY8B 5ETWA 3ZT6A 4X64T 4UEMA 1YXRA 5AQSB 2VVSA 4N78D 4F6RC 2V7JA 2KINB 2CA5A 4TN7B 1E1HB 3C4ZA 3PUXF 2XAQB 2M67A 4WYVA 4EOZB 2WS3A 3NZQA 3G06A 4OFZA 2H89A 4JYAT 4LF9T 4LMKA 2JRKA 4AKHA 2FJDA 3U78A 4TZ4C 2WBLA 3C4WA 1YW0A 2LM9A 2PFVA 2XPKA 2XHEB 3PUGA 4PNIA 4TUYE 1UCUA 4EZ4A 5JREA 5H6QB 4LF6T 4AKGA 3BQKA 3LK42 2IUBA 3QK6A 4AKLA 2YN6A 2D2SA 2W66A 3I1AA 2W61A 2W67A 3BK9A 2K5BB 2WM9A 2D5UA 3PURA 4HKAA 3LG7A 4WW0A 5FKYA 1HFAA 5JR9C 1ZKEA 4F8HA 1US7B 4MBQA 2H3RA 1XDPA 4O2AE 2VL8A 5ABGA 4AQFC 4DR4T 1FJGT 2XASB 3AVRA 5AQVB 3EUHA 3R84B 4NXMT 2LHRA 4YJ2E 4GOUA 3TLSA 4H63V 4H9PC 4HN9A 2E9XB 4IE7A 1VCTA 2CPTA 2UXCT 4I4TE 4IDNA 4GK0E 4I0UA 5FXZA 3RF1A 3RH3A 5JDQA 1XNRT 2Q9QB 2YDQA 4KP3C 2PTFA 2K48A 4TV8E 1U4QA 1MIYA 2RPAA 4FI5A 1T8BA 3ZCJA 4CN1A 2BZBA 3AXJB 1X79A 1MNEA 3HR0A 2C5JA 1H7CA 2XUEA 3OJAA 3P8CD 1KF6A 3UU4A 4HEAA 4B6XA 4QX8B 4YY3T 4IE6A 2XAFB 3RC8A 4P1NA 3T1YT 3N9QA 2X0LB 4AISA 2NTXA 2CE7A 1J1JA 3AVSA 5LMNT 4AQGA 1BR1A 2XJ7A 3CQXC 3LSVA 4C91A 5BMVE 4MALA 3LBXA 1J5WA 4EEBA 3CK6A 3EVYA 4YHHT 4YLHA 4B3ST 4MLKA 2LSGA 4JI1T 4HFEA 1D1CA 3VKGA 3N2OA 2NW8A 2Q9QC 2X0HA 3F2EA 3PUYF 2WAUA 2V7IA 1XMQT 3T8OA 2XQ9A 1QLBA 1WCRA 2A9UA 4IDZA 3VU7H 3FB2A 4DMVA 3ETVA 4O8SA 4A98A 3P4PA 4DMWA 2XSAA 3IA3A 2CBIA 5FYMA 2E9XC 5HWYA 1MMDA 3PDYA 4ASKA 1UUSA 4CN6A 2E8IA 4GIWA 1HNZT 5L3DB 2NW9A 3CMLA 3LK2B 2CXFA 4JV5T 2HN2A 2ZM2A 2LRLA 2VKDA 5JH7E 4H9QC 5AQRB 3SRZA 3AEGA 4ZI7E 2XAJB 4ADZA 5LA6E 1AJ3A 4UVCB 2DHRA 2EHOC 3ZLIA 2MPKA 2B1EA 5CB4E 3RIAA 3TKLB 4OK0A 4YTNA 2V6YB 2QYWA 2JQKA 3GWHA 3JAEA 1KK7A 3CVRA 3ZMUB 1CHUA 3SWHA 4JI5T 1NWMX 2UU9T 2C5IT 3GN5A 3N5LA 3N9OA 4DUYT 2XQ7A 2Q9QD 4CXXA 3C64A 4JI0T 2XQ8A 1HNWT 4CXWA 3FZLB 2CWYA 1BR4A 2VWAA 3JADA 1IAPA 2H7OA 3NWIA 5AQMB 3ZMSB 5L3CB 5JRCB 4IREA 4A97A 3CX8B 2N1GA 2XQYA 3BQIA 2YDRA 2PG8A 3PE0A 3RGLA 3KBTA 3SFEA 1MIVA 1ZOYA 2V6YA 2WSSV 2DL1A 3KVAA 4OYJA 1M7KA 2Y8DA 2E2AA 4WNKA 2JMKA 5HEUA 1T72A 2CRBA 1I6ZA 2K24A 3U3IA 3CWZB 3FZMB 3QOFA 4OX9T 2WCAA 1FMVA 2BS2A 4QWNB 4UV9B 3RQWA 4EB6E 4DV5T 2RA1A 1X9BA 4AKRB 5L3EB 1S94A 3GA8A 1MMAA 2UXDT 1KEYA 3KFWX 2XM2A 1LKXA 5LGUB 3EAMA 1BR0A 4LFBT 5HXHA 2V7KA 2WWUA 4FJOA 3QB5K 4WBNE 1N34T 3IF8B 4U31A 2E5LT 5L4HA 4TX5A 4QH5A 2VVNA 4P0AA 4Z8XA 1UX5A 3PJAJ 4B3TT 2K3WA 2YINA 3AEDA 2NW7A 4HFHA 4UVAB 2LEHA 4HWFA 4YHJA 3F57A 2W0GA 3P4WA 4KMCA 5JDLA 4NUUA 3VR8A 4ILBA 1HCIA 4LF5T 4QXHB 3HKEE 1HG5A 2D0TA 4U72A 4BJNA 4V1Av 3FBLA 5A1LA 3O9XA 2W62A 4NIQA 4IT4A 2LKGA 2EHOD 2XTLA 2WDQA 1IBLT 2A2FX 3CX7B 3Q9DA 3ONLC 3LFMA 2YU1A 2XAGB 2V5CA 3P4SA 4TWDA 4U3CA 2ZM6T 4QH1A 2NP9A 1MNDA 3EDUA 3KV9A 2V7MA 4HFIA 3AA6B 3PUVF 5L3GB 3JC6D 2BBJA 4UR9A 4X1YE 3UUMA 3IBPA 3M3ZB 4TNVA 3Q5DA 4OYKA 3UU6A 3UUNA 5C3JA 3AE6A 5F5WA 1VCSA 2E9XD 3D0TA 5LBMA 3Q5XA 2M6IA 4IE0A 3TLVA 3WI3A 4CQIA 4H9RC 5LJMA 5J2TE 3ONXA 2ES0A 2I59A 3C4XA 4LF4T 4KI0F 4DVDA 2BG9C 5AQKB 3RLFF 3FZKB 5FXWA 5M4YA 2CCQA 3N9MA 3QNUA 4HFVA 2QA7A 4QX7B 5EZYE 3ZCIA 5KMGP 2NTYA 2PBIA 4JEHB 2DWGA 1IBKT 4P09A 4X62T 2L3LA 2OA5A 2E9XA 2D0UA 2Z6EA 2AXDS 3C50A 4JEUB 1WR6A 3AAEB 3LDQB 4U74A 5L2LA 2XQ3A 3AE9A 3K3NA 4LFAT 1N33T 3UU3A 3ABVA 2W00A 3DP7A 2YU2A 4ZI3D 5LG4A 4KUMB 4YT0A 2KWIB 2XM1A 4NUVA 3ZMTB 5ABFB 1KNZA 3HA4A 3OYXA 2UXXB 4PJNA 3ANWA 4KX6A 5LOVE 2CHOA 1T7SA 3FXEB 1OEDC 5FMNA 3RYCE 4ILUA 5C2TA 3NKZA 2M6BA 1I94T 4KBMB 3EABA 4YTPA 4DR7T 4WZXA 4JLEA 4ILAA 3C51A 2KLQA 4IL9A 4K0UA 3X1DA 1WYCA 3I9WA 5GONE 4C90A 2LE8A 3ETUA 3ZYMA 3AE3A 4BJMA 3VRBA 4X5TA 1Z0PA 2NWBA 2YOEA 1JNRA 5AQOB 5FY7A 2CXLA 2DCFA 2J4GA 4HFBA 4AIUA 4HWIB 2XAHB 1BR2A 1UX4A 4YSYA 2YEVC 2F4VT 4A56A 4EEDA 1XMOT 2ZLYA 2ZM8A 1OWAA 1R8IA 3HKCE 4IIJE 4PW8A 4U33A 3NRYA 2WMNA 1J5ET 1HS7A 4MFRA 2HPLA 3AE1A 3B5MA 3IEEA 1Y64B 4U2ZA 5J0ZA 3F31A 3RC3A 1OEDE 2A3DA 1G73A 1SE7A 4IDOA 5AQUB 3RQUA 5ABFA 2VQET 1HNXT 5JR9A 3BQLA 2IC6A 1D0ZA 2LKHA 1V9DA 2WDRA 3FXDB 3RX6A 3V5UA 3VRAA 5IWAT 3MK7C 5JDFA 3UULA 2G0UA 4DV4T 1LVKA 4DR6T 1FEWA 5ADXL 2UXBT 4QXBB 2MYSA 3UTKA 4DIDB 2IHR1 2CLYC 2Y48B 5L47A 4KHZF 3E0ZA 5AQPB 2WZHA 3ESLA 5H6RB 3RKGA 2JPFA 3RIFA 3WAKA 4DV6T 3UUXB 4HE8A 4JI2T 5EK2A 5BR8T 5EK4A 4X20E 3GMIA 1D1AA 3O4XE 2WQYA 2YDSA 1T98A 3ZYKA 2WP9A 2XQAA 3FBZA 2BS4A 3RYIE 3ZC0A 3QUJA 2KT9A 4M1PA 3UQ7A 2J1DG 4EV6A 3HL6A 4COFA 2WB5A 5LB7B 3T1HT 5JRCA 2XQ6A 3B57A 4YTMA 2JQHA 2CWOA 2KXPB 5CJ5A 2CLYB 2X9WA 3KV5A 4UV8B 4UXNB 3UFEA 3AA1B 3MA9A 3NZPA 4UIGA 5AQFB 5JDGA 4IDQA 3Q5EA 4NPPA 4O4LE 4X66T 1KNRA 3TLWA 2LHNA 3JCFA 3MKDA 3ZEFB 1W09A 2Q9QA 4QKNA 5DQVA 2VKOA 1XDOA 4QH4A 2X9HA 4HWDA 3HKDE 1KFYA 3AEAA 4IDPA 1HF8A 1CUNA 5AQIB 5FVKA 5HXCA 4E7ZA 1VOMA 2VL0A 3KV6A 1HX1B 3RKOA 4ZI2D 3LBXB 5C8YE 2FJEA 2V7LA 3H3MA 1NAFA 1HR0T 2A72A 5FXVA 3RRCA 1ZP0A 3HI2A 5AQQB 5LNKA 4JUYA 3VHLA 5CGMA 4TV9E 2WDVA 2CHNA 4O4HE 1XNQT 2LLYA 2QVAA 3OPCA 4CI2B 4AQYT 4DNDA 5JQGE 2IW5B 2QGSA 2FJBA 5HEJA 2ACXA 4H9SE 4ANJA 2VB6A 2ODVA 4CI3B 3UFGA 1SUMB 2EHOA 2VK9A 4UF0B 2KZ7B 3OYZA 2VQFT 3M65A 5LHIB 3EI0A 1YQ3A 5ABEA 1LRZA 2W4XA 3ZMVB 2WMOA 4DV7T 2BBHA 3QB5A 3K3OA 3RPUA 2L8KA 1D1BA 4IE5A 4LMJA 3UQ4A 1MMGA 3FZFB 3KDSE 3MXZA 3PTRB 1OXZA 3AECA 5CA0E 4LFCT 4PJMA 4I55E 2K9AA 3LJCA 2IMLA 4G63A 2AE9A 3H3AA 2UXNB 3DTOA 2LSKA 2FBWA 3K1SA 4TWHA 4ZS3A 3ZYLA 1YQ4A 4B3RT 4J2CA 4ZXLA 3ZSTA 5LGTB 3V5SA 5JTGA 3AXJA 1WLXA 4IGUA 5LBQB 3RHWA 1HX8A 2WZIA 3PJAA 4PJLA 4BAYB 4IL4A 4GYRA 3PUZF 4I50E 3I0OA 2IC9A 1QUUA 1UGOA 1Z8UA 2BG9B 3A7MA 3AA7B 3K8PC 3MJXA 3OBVE 3ZT5A 5FY0A 2RP4A 2UUAT 4B3MT 2ZM0A 3JAFA 2LSJA 3AB3B 3EHZA 4AQFA 4L0RA 2LOSA 2PJQA 4HWCA 5HXSA 4P0BA 5JDHA 2EHOB 2BKNA 4UF0A 4EXTA 3NRXA 4IE4A 5TAOA 1OEDB 2V26A 3RI5A 4EYUA 5LYJE 1IZNB 5FL1A 4U2YA 3PU8A 2X51A 3SS1A 3CKDA 3PV0F 4OHFA 2KNDA 4TNWA 3ZKRA 3AE8A 5LG3A 4ERRA 1D0XA 3ONJA 2JIWA 2MBGA 2KSRA 5AQNB 4A5XA 4ZHQE 3KBUA 5HEGA 2VASA 2LRKA 5IHYA 1YD8G 3P4RA 3J9X1 5HWXA 4BA9A 1LVFA 1ZV4X 4TWFA 2DLRA 4ILCA 3SOLA 2UUCT 4H9NC 1S35A 3O1HA 4LF8T 3UUBA 4DR5T 2SPCA 1GQEA 3C98B 2YK0A 5E0OA 3N2KE 1FIOA 2J62A 4PFPA 4IHJE 3AE2A 2BG9A 4YSXA 3P4QA 3P7IA 2ZMAA 1HG2A 2BKOA 3VKHA 4U7IA 5DJQC 2E5VA 5CA1E 4K0KT 3CX6B 2XZEA 5HCMA 3RRWA 1KNPA 4DO0A 2ACZA 3Q5WA 3OTOT 1XZYA 2X67A 3ZC1A 3RIUC 4CI1B 3ZJ2A 5J1GA 4AI6A 2MAWA 3ZT7A 3N9LA 2LSIA 3ZPOA 5F8PA 3N9PA 3K3QC 2CMRA 1QSDA 2IIUA 3O1JA 2CM0A 2LM2A 4CN4A 4DV0T 2X68A 4DR1T 3Q2MA 4DUZT 5FXXA 1WFDA 3AEFA 4H9OC 3CQCB 5HXRA 4EAHA 2HHHT 2FJAA 3R6NA 4JI4T 2J47A 1SA0E 3E08A 5IYZE 5KX5E 2BS3A 2BVLA 5AQGB 2DI4A 2JMHA 4HWHA 4PK5A 2V8SV 4Q25A 3L3PA 3FZHB 5FNVE 4H63H 4EGWA 2OLTA 4YFSA 1HTJF 4WBOA 4ZEYA 4UVBB 5AQJB 4HTEA 1JNZA 4DBQA 1SHZC 4QHOA 3N9NA 3A8YC 3P50A 1IJ5A 1MMNA 2WU2A 2X66A 4DV2T 5FL0A 2JQ9A 2D9DA 1XWMA 2XQ4A 2MTQA 3EDVA 2HH7A 5AQHB 5LGNB 2MOZA 1U5PA 3H37A 4JI7T 1WYBA 5L3BB 5IUXA 3CQGB 4NXNT 2VKHA 3AEBA 4PFOA 4O4JE 3L09A 4QXCB 4ZZCA 3N2GE 4X1IE 5KXJA 4JI8T 1IJ6A 3A5XA 4PK4A 4L5GA 2Y6XA 1WRDA 3TLUA 5LJNA 4YJ3E 3UU5A 2HN1A 5AFUL 2HPJA 2KWHA 2LT3A 2C5KT 5LP6E 2IDOB 3IHRA 3O1IA 1YKEB 5AQTB 1G8XA 4ISSA 4UELA 1NENA 1O3XA 2C0SA 2BDEA 2JQQA 3UU8A 1E2AA 4ZZBA 1ZHCA 3L8RA 2QRXA 2WWVA 3PUSA 2DWKA 2FUPA 5J2UE 2GK9A 3S4UA 5HCJA 3WAJA 2BG9E 5FY1A 4JI3T 5L4EA 2LOPA 3KVBA 2DNXA 3PU3A 4GK5E 1N32T 1D0YA 2X0YA 3PUAA 3SFDA 4YXDA 2V1DB 1OEDA 5HXEA 4GKJT 5HAXA 5KDMC 2LSYA 1UK5A 3AE4A 4I43B 5LXTE 4ISTA 4ZI3C 2X9XA 4GKKT 5FVLA 5CFBA 1MIWA 4HGAA 3AE7A 2WY2A 3KV4A 4HFDA 4L9IA 3ZN1B 4EYYR 5JDNA 1IBMT 1N36T 2V5DA 3W15B 4U7YA 1W9RA 3QC9A 4HFCA 1Y01A 2I6HA 4GYSA 5DABA 2VURA 3MZKB 4LMLA 2N2NA 1W0BA 2I0MA 2LJLA 5F3JA 3ZN0B
chains in the Genus database with same CATH topology
1OEDB 3RI5A 4X5TA 2YOEA 4HFBA 4TNWA 3RIAA 3ZKRA 3TLTA 4Z91A 3JAEA 2KSRA 5HEGA 2XQ7A 4TWFA 5J0ZA 4ILCA 1OEDE 2XQ8A 3RQUA 3UUBA 3JADA 2LKHA 2XQ5A 2BG9A 4IREA 4A97A 5HEOA 4ILAA 5L47A 5HCMA 5HEUA 4Z90A 3RIFA 5HEHA 3RQWA 2MAWA 2XQAA 2LM2A 3EAMA 4COFA 2XQ6A 2YKSA 5L4HA 4QH5A 4HFHA 4LMKA 4NPPA 3P4WA 3TLWA 3UQ7A 3P50A 4ILBA 4QH4A 2YN6A 2VL0A 2XQ4A 2LKGA 4F8HA 5IUXA 4TWDA 4QH1A 3TLSA 4HFIA 4ZZCA 2LLYA 3TLUA 4TNVA 3UU6A 3UU5A 5HEJA 2M6IA 3TLVA 3UU4A 2BG9C 3UU8A 4ZZBA 3EI0A 5HCJA 2BG9E 5L4EA 4LMJA 3UQ4A 3LSVA 1OEDA 2XQ3A 3UU3A 4TWHA 4HFEA 5CFBA 4HFDA 2XQ9A 3RHWA 4A98A 4IL4A 4HFCA 1OEDC 2BG9B 5LG3A 2M6BA 4LMLA 3JAFA 3EHZA 4IL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OED B;  3RI5 A;  4X5T A;  2YOE A;  4HFB A;  4TNW A;  3RIA A;  3ZKR A;  3TLT A;  4Z91 A;  3JAE A;  2KSR A;  5HEG A;  2XQ7 A;  4TWF A;  5J0Z A;  4ILC A;  1OED E;  2XQ8 A;  3RQU A;  3UUB A;  3JAD A;  2LKH A;  2XQ5 A;  2BG9 A;  4IRE A;  4A97 A;  5HEO A;  4ILA A;  5L47 A;  5HCM A;  5HEU A;  4Z90 A;  3RIF A;  5HEH A;  3RQW A;  2MAW A;  2XQA A;  2LM2 A;  3EAM A;  4COF A;  2XQ6 A;  2YKS A;  5L4H A;  4QH5 A;  4HFH A;  4LMK A;  4NPP A;  3P4W A;  3TLW A;  3UQ7 A;  3P50 A;  4ILB A;  4QH4 A;  2YN6 A;  2VL0 A;  2XQ4 A;  2LKG A;  4F8H A;  5IUX A;  4TWD A;  4QH1 A;  3TLS A;  4HFI A;  4ZZC A;  2LLY A;  3TLU A;  4TNV A;  3UU6 A;  3UU5 A;  5HEJ A;  2M6I A;  3TLV A;  3UU4 A;  2BG9 C;  3UU8 A;  4ZZB A;  3EI0 A;  5HCJ A;  2BG9 E;  5L4E A;  4LMJ A;  3UQ4 A;  3LSV A;  1OED A;  2XQ3 A;  3UU3 A;  4TWH A;  4HFE A;  5CFB A;  4HFD A;  2XQ9 A;  3RHW A;  4A98 A;  4IL4 A;  4HFC A;  1OED C;  2BG9 B;  5LG3 A;  2M6B A;  4LML A;  3JAF A;  3EHZ A;  4IL9 A; 
#chains in the Genus database with same CATH topology
 4X65 T;  3AAA B;  3RYF E;  3NBX X;  1YKH B;  5JVD E;  3FHN A;  4O2B E;  4YSZ A;  2L9Q A;  3B13 A;  4DBR A;  4PAG A;  3I9Y A;  1FMW A;  4DV1 T;  1WR0 A;  1NEK A;  5LCY A;  4AXP A;  4O4I E;  3TLT A;  1EZ3 A;  2P9B A;  4Z91 A;  2H7V C;  3RIU A;  3AA0 B;  3KIN B;  4JBW F;  4E7S A;  1E7P A;  2ODU A;  2VKJ A;  2W2U A;  1VRB A;  2BVM A;  3ANW B;  3AAI A;  3RYH E;  5HYA A;  5LHH B;  4DR3 T;  1L0V A;  2CBJ A;  4CXY A;  5FP3 A;  2IAK A;  4DR2 T;  3CPZ A;  2V6X A;  3LK3 B;  4PK6 A;  4PJJ A;  2NR4 A;  5LHG B;  4ZI2 C;  3PUQ A;  5JDM A;  4G2A A;  2JJ9 A;  3CIR A;  2X9Y A;  3OVU A;  4JI6 T;  4XZC A;  2XQ5 A;  2R6G F;  5AQL B;  3UT5 E;  3AE5 A;  4XAX B;  5EK3 A;  3VR9 A;  2N9D A;  5DQW A;  4ZS2 A;  5HEO A;  3ZMZ B;  3L39 A;  3DJB A;  2UUB T;  4KHP T;  1M62 A;  4Z90 A;  5ABH A;  3PUW F;  3ZSS A;  4EIW A;  1DU2 A;  5HEH A;  1B7T A;  4AKI A;  2CEA A;  2KMF A;  4LF7 T;  3E22 E;  3ZJ1 A;  2OV9 A;  3MAC A;  1ZEE A;  2H88 A;  5L3F B;  3J7Y q;  1UUR A;  4DV3 T;  3AEE A;  1W0A A;  4CZZ B;  4EZH A;  4XBF B;  2BKP A;  2NOX A;  2W63 A;  3HKB E;  3NVO A;  4ZOL E;  3JC6 C;  4X1K E;  2XSB A;  4MHC A;  5JR9 B;  3OKQ A;  2B76 A;  2WU5 A;  5LMU T;  2CXD A;  2YKS A;  3GN5 B;  3I0Q A;  2XY8 B;  5ETW A;  3ZT6 A;  4X64 T;  4UEM A;  1YXR A;  5AQS B;  2VVS A;  4N78 D;  4F6R C;  2V7J A;  2KIN B;  2CA5 A;  4TN7 B;  1E1H B;  3C4Z A;  3PUX F;  2XAQ B;  2M67 A;  4WYV A;  4EOZ B;  2WS3 A;  3NZQ A;  3G06 A;  4OFZ A;  2H89 A;  4JYA T;  4LF9 T;  4LMK A;  2JRK A;  4AKH A;  2FJD A;  3U78 A;  4TZ4 C;  2WBL A;  3C4W A;  1YW0 A;  2LM9 A;  2PFV A;  2XPK A;  2XHE B;  3PUG A;  4PNI A;  4TUY E;  1UCU A;  4EZ4 A;  5JRE A;  5H6Q B;  4LF6 T;  4AKG A;  3BQK A;  3LK4 2;  2IUB A;  3QK6 A;  4AKL A;  2YN6 A;  2D2S A;  2W66 A;  3I1A A;  2W61 A;  2W67 A;  3BK9 A;  2K5B B;  2WM9 A;  2D5U A;  3PUR A;  4HKA A;  3LG7 A;  4WW0 A;  5FKY A;  1HFA A;  5JR9 C;  1ZKE A;  4F8H A;  1US7 B;  4MBQ A;  2H3R A;  1XDP A;  4O2A E;  2VL8 A;  5ABG A;  4AQF C;  4DR4 T;  1FJG T;  2XAS B;  3AVR A;  5AQV B;  3EUH A;  3R84 B;  4NXM T;  2LHR A;  4YJ2 E;  4GOU A;  3TLS A;  4H63 V;  4H9P C;  4HN9 A;  2E9X B;  4IE7 A;  1VCT A;  2CPT A;  2UXC T;  4I4T E;  4IDN A;  4GK0 E;  4I0U A;  5FXZ A;  3RF1 A;  3RH3 A;  5JDQ A;  1XNR T;  2Q9Q B;  2YDQ A;  4KP3 C;  2PTF A;  2K48 A;  4TV8 E;  1U4Q A;  1MIY A;  2RPA A;  4FI5 A;  1T8B A;  3ZCJ A;  4CN1 A;  2BZB A;  3AXJ B;  1X79 A;  1MNE A;  3HR0 A;  2C5J A;  1H7C A;  2XUE A;  3OJA A;  3P8C D;  1KF6 A;  3UU4 A;  4HEA A;  4B6X A;  4QX8 B;  4YY3 T;  4IE6 A;  2XAF B;  3RC8 A;  4P1N A;  3T1Y T;  3N9Q A;  2X0L B;  4AIS A;  2NTX A;  2CE7 A;  1J1J A;  3AVS A;  5LMN T;  4AQG A;  1BR1 A;  2XJ7 A;  3CQX C;  3LSV A;  4C91 A;  5BMV E;  4MAL A;  3LBX A;  1J5W A;  4EEB A;  3CK6 A;  3EVY A;  4YHH T;  4YLH A;  4B3S T;  4MLK A;  2LSG A;  4JI1 T;  4HFE A;  1D1C A;  3VKG A;  3N2O A;  2NW8 A;  2Q9Q C;  2X0H A;  3F2E A;  3PUY F;  2WAU A;  2V7I A;  1XMQ T;  3T8O A;  2XQ9 A;  1QLB A;  1WCR A;  2A9U A;  4IDZ A;  3VU7 H;  3FB2 A;  4DMV A;  3ETV A;  4O8S A;  4A98 A;  3P4P A;  4DMW A;  2XSA A;  3IA3 A;  2CBI A;  5FYM A;  2E9X C;  5HWY A;  1MMD A;  3PDY A;  4ASK A;  1UUS A;  4CN6 A;  2E8I A;  4GIW A;  1HNZ T;  5L3D B;  2NW9 A;  3CML A;  3LK2 B;  2CXF A;  4JV5 T;  2HN2 A;  2ZM2 A;  2LRL A;  2VKD A;  5JH7 E;  4H9Q C;  5AQR B;  3SRZ A;  3AEG A;  4ZI7 E;  2XAJ B;  4ADZ A;  5LA6 E;  1AJ3 A;  4UVC B;  2DHR A;  2EHO C;  3ZLI A;  2MPK A;  2B1E A;  5CB4 E;  3RIA A;  3TKL B;  4OK0 A;  4YTN A;  2V6Y B;  2QYW A;  2JQK A;  3GWH A;  3JAE A;  1KK7 A;  3CVR A;  3ZMU B;  1CHU A;  3SWH A;  4JI5 T;  1NWM X;  2UU9 T;  2C5I T;  3GN5 A;  3N5L A;  3N9O A;  4DUY T;  2XQ7 A;  2Q9Q D;  4CXX A;  3C64 A;  4JI0 T;  2XQ8 A;  1HNW T;  4CXW A;  3FZL B;  2CWY A;  1BR4 A;  2VWA A;  3JAD A;  1IAP A;  2H7O A;  3NWI A;  5AQM B;  3ZMS B;  5L3C B;  5JRC B;  4IRE A;  4A97 A;  3CX8 B;  2N1G A;  2XQY A;  3BQI A;  2YDR A;  2PG8 A;  3PE0 A;  3RGL A;  3KBT A;  3SFE A;  1MIV A;  1ZOY A;  2V6Y A;  2WSS V;  2DL1 A;  3KVA A;  4OYJ A;  1M7K A;  2Y8D A;  2E2A A;  4WNK A;  2JMK A;  5HEU A;  1T72 A;  2CRB A;  1I6Z A;  2K24 A;  3U3I A;  3CWZ B;  3FZM B;  3QOF A;  4OX9 T;  2WCA A;  1FMV A;  2BS2 A;  4QWN B;  4UV9 B;  3RQW A;  4EB6 E;  4DV5 T;  2RA1 A;  1X9B A;  4AKR B;  5L3E B;  1S94 A;  3GA8 A;  1MMA A;  2UXD T;  1KEY A;  3KFW X;  2XM2 A;  1LKX A;  5LGU B;  3EAM A;  1BR0 A;  4LFB T;  5HXH A;  2V7K A;  2WWU A;  4FJO A;  3QB5 K;  4WBN E;  1N34 T;  3IF8 B;  4U31 A;  2E5L T;  5L4H A;  4TX5 A;  4QH5 A;  2VVN A;  4P0A A;  4Z8X A;  1UX5 A;  3PJA J;  4B3T T;  2K3W A;  2YIN A;  3AED A;  2NW7 A;  4HFH A;  4UVA B;  2LEH A;  4HWF A;  4YHJ A;  3F57 A;  2W0G A;  3P4W A;  4KMC A;  5JDL A;  4NUU A;  3VR8 A;  4ILB A;  1HCI A;  4LF5 T;  4QXH B;  3HKE E;  1HG5 A;  2D0T A;  4U72 A;  4BJN A;  4V1A v;  3FBL A;  5A1L A;  3O9X A;  2W62 A;  4NIQ A;  4IT4 A;  2LKG A;  2EHO D;  2XTL A;  2WDQ A;  1IBL T;  2A2F X;  3CX7 B;  3Q9D A;  3ONL C;  3LFM A;  2YU1 A;  2XAG B;  2V5C A;  3P4S A;  4TWD A;  4U3C A;  2ZM6 T;  4QH1 A;  2NP9 A;  1MND A;  3EDU A;  3KV9 A;  2V7M A;  4HFI A;  3AA6 B;  3PUV F;  5L3G B;  3JC6 D;  2BBJ A;  4UR9 A;  4X1Y E;  3UUM A;  3IBP A;  3M3Z B;  4TNV A;  3Q5D A;  4OYK A;  3UU6 A;  3UUN A;  5C3J A;  3AE6 A;  5F5W A;  1VCS A;  2E9X D;  3D0T A;  5LBM A;  3Q5X A;  2M6I A;  4IE0 A;  3TLV A;  3WI3 A;  4CQI A;  4H9R C;  5LJM A;  5J2T E;  3ONX A;  2ES0 A;  2I59 A;  3C4X A;  4LF4 T;  4KI0 F;  4DVD A;  2BG9 C;  5AQK B;  3RLF F;  3FZK B;  5FXW A;  5M4Y A;  2CCQ A;  3N9M A;  3QNU A;  4HFV A;  2QA7 A;  4QX7 B;  5EZY E;  3ZCI A;  5KMG P;  2NTY A;  2PBI A;  4JEH B;  2DWG A;  1IBK T;  4P09 A;  4X62 T;  2L3L A;  2OA5 A;  2E9X A;  2D0U A;  2Z6E A;  2AXD S;  3C50 A;  4JEU B;  1WR6 A;  3AAE B;  3LDQ B;  4U74 A;  5L2L A;  2XQ3 A;  3AE9 A;  3K3N A;  4LFA T;  1N33 T;  3UU3 A;  3ABV A;  2W00 A;  3DP7 A;  2YU2 A;  4ZI3 D;  5LG4 A;  4KUM B;  4YT0 A;  2KWI B;  2XM1 A;  4NUV A;  3ZMT B;  5ABF B;  1KNZ A;  3HA4 A;  3OYX A;  2UXX B;  4PJN A;  3ANW A;  4KX6 A;  5LOV E;  2CHO A;  1T7S A;  3FXE B;  1OED C;  5FMN A;  3RYC E;  4ILU A;  5C2T A;  3NKZ A;  2M6B A;  1I94 T;  4KBM B;  3EAB A;  4YTP A;  4DR7 T;  4WZX A;  4JLE A;  4ILA A;  3C51 A;  2KLQ A;  4IL9 A;  4K0U A;  3X1D A;  1WYC A;  3I9W A;  5GON E;  4C90 A;  2LE8 A;  3ETU A;  3ZYM A;  3AE3 A;  4BJM A;  3VRB A;  4X5T A;  1Z0P A;  2NWB A;  2YOE A;  1JNR A;  5AQO B;  5FY7 A;  2CXL A;  2DCF A;  2J4G A;  4HFB A;  4AIU A;  4HWI B;  2XAH B;  1BR2 A;  1UX4 A;  4YSY A;  2YEV C;  2F4V T;  4A56 A;  4EED A;  1XMO T;  2ZLY A;  2ZM8 A;  1OWA A;  1R8I A;  3HKC E;  4IIJ E;  4PW8 A;  4U33 A;  3NRY A;  2WMN A;  1J5E T;  1HS7 A;  4MFR A;  2HPL A;  3AE1 A;  3B5M A;  3IEE A;  1Y64 B;  4U2Z A;  5J0Z A;  3F31 A;  3RC3 A;  1OED E;  2A3D A;  1G73 A;  1SE7 A;  4IDO A;  5AQU B;  3RQU A;  5ABF A;  2VQE T;  1HNX T;  5JR9 A;  3BQL A;  2IC6 A;  1D0Z A;  2LKH A;  1V9D A;  2WDR A;  3FXD B;  3RX6 A;  3V5U A;  3VRA A;  5IWA T;  3MK7 C;  5JDF A;  3UUL A;  2G0U A;  4DV4 T;  1LVK A;  4DR6 T;  1FEW A;  5ADX L;  2UXB T;  4QXB B;  2MYS A;  3UTK A;  4DID B;  2IHR 1;  2CLY C;  2Y48 B;  5L47 A;  4KHZ F;  3E0Z A;  5AQP B;  2WZH A;  3ESL A;  5H6R B;  3RKG A;  2JPF A;  3RIF A;  3WAK A;  4DV6 T;  3UUX B;  4HE8 A;  4JI2 T;  5EK2 A;  5BR8 T;  5EK4 A;  4X20 E;  3GMI A;  1D1A A;  3O4X E;  2WQY A;  2YDS A;  1T98 A;  3ZYK A;  2WP9 A;  2XQA A;  3FBZ A;  2BS4 A;  3RYI E;  3ZC0 A;  3QUJ A;  2KT9 A;  4M1P A;  3UQ7 A;  2J1D G;  4EV6 A;  3HL6 A;  4COF A;  2WB5 A;  5LB7 B;  3T1H T;  5JRC A;  2XQ6 A;  3B57 A;  4YTM A;  2JQH A;  2CWO A;  2KXP B;  5CJ5 A;  2CLY B;  2X9W A;  3KV5 A;  4UV8 B;  4UXN B;  3UFE A;  3AA1 B;  3MA9 A;  3NZP A;  4UIG A;  5AQF B;  5JDG A;  4IDQ A;  3Q5E A;  4NPP A;  4O4L E;  4X66 T;  1KNR A;  3TLW A;  2LHN A;  3JCF A;  3MKD A;  3ZEF B;  1W09 A;  2Q9Q A;  4QKN A;  5DQV A;  2VKO A;  1XDO A;  4QH4 A;  2X9H A;  4HWD A;  3HKD E;  1KFY A;  3AEA A;  4IDP A;  1HF8 A;  1CUN A;  5AQI B;  5FVK A;  5HXC A;  4E7Z A;  1VOM A;  2VL0 A;  3KV6 A;  1HX1 B;  3RKO A;  4ZI2 D;  3LBX B;  5C8Y E;  2FJE A;  2V7L A;  3H3M A;  1NAF A;  1HR0 T;  2A72 A;  5FXV A;  3RRC A;  1ZP0 A;  3HI2 A;  5AQQ B;  5LNK A;  4JUY A;  3VHL A;  5CGM A;  4TV9 E;  2WDV A;  2CHN A;  4O4H E;  1XNQ T;  2LLY A;  2QVA A;  3OPC A;  4CI2 B;  4AQY T;  4DND A;  5JQG E;  2IW5 B;  2QGS A;  2FJB A;  5HEJ A;  2ACX A;  4H9S E;  4ANJ A;  2VB6 A;  2ODV A;  4CI3 B;  3UFG A;  1SUM B;  2EHO A;  2VK9 A;  4UF0 B;  2KZ7 B;  3OYZ A;  2VQF T;  3M65 A;  5LHI B;  3EI0 A;  1YQ3 A;  5ABE A;  1LRZ A;  2W4X A;  3ZMV B;  2WMO A;  4DV7 T;  2BBH A;  3QB5 A;  3K3O A;  3RPU A;  2L8K A;  1D1B A;  4IE5 A;  4LMJ A;  3UQ4 A;  1MMG A;  3FZF B;  3KDS E;  3MXZ A;  3PTR B;  1OXZ A;  3AEC A;  5CA0 E;  4LFC T;  4PJM A;  4I55 E;  2K9A A;  3LJC A;  2IML A;  4G63 A;  2AE9 A;  3H3A A;  2UXN B;  3DTO A;  2LSK A;  2FBW A;  3K1S A;  4TWH A;  4ZS3 A;  3ZYL A;  1YQ4 A;  4B3R T;  4J2C A;  4ZXL A;  3ZST A;  5LGT B;  3V5S A;  5JTG A;  3AXJ A;  1WLX A;  4IGU A;  5LBQ B;  3RHW A;  1HX8 A;  2WZI A;  3PJA A;  4PJL A;  4BAY B;  4IL4 A;  4GYR A;  3PUZ F;  4I50 E;  3I0O A;  2IC9 A;  1QUU A;  1UGO A;  1Z8U A;  2BG9 B;  3A7M A;  3AA7 B;  3K8P C;  3MJX A;  3OBV E;  3ZT5 A;  5FY0 A;  2RP4 A;  2UUA T;  4B3M T;  2ZM0 A;  3JAF A;  2LSJ A;  3AB3 B;  3EHZ A;  4AQF A;  4L0R A;  2LOS A;  2PJQ A;  4HWC A;  5HXS A;  4P0B A;  5JDH A;  2EHO B;  2BKN A;  4UF0 A;  4EXT A;  3NRX A;  4IE4 A;  5TAO A;  1OED B;  2V26 A;  3RI5 A;  4EYU A;  5LYJ E;  1IZN B;  5FL1 A;  4U2Y A;  3PU8 A;  2X51 A;  3SS1 A;  3CKD A;  3PV0 F;  4OHF A;  2KND A;  4TNW A;  3ZKR A;  3AE8 A;  5LG3 A;  4ERR A;  1D0X A;  3ONJ A;  2JIW A;  2MBG A;  2KSR A;  5AQN B;  4A5X A;  4ZHQ E;  3KBU A;  5HEG A;  2VAS A;  2LRK A;  5IHY A;  1YD8 G;  3P4R A;  3J9X 1;  5HWX A;  4BA9 A;  1LVF A;  1ZV4 X;  4TWF A;  2DLR A;  4ILC A;  3SOL A;  2UUC T;  4H9N C;  1S35 A;  3O1H A;  4LF8 T;  3UUB A;  4DR5 T;  2SPC A;  1GQE A;  3C98 B;  2YK0 A;  5E0O A;  3N2K E;  1FIO A;  2J62 A;  4PFP A;  4IHJ E;  3AE2 A;  2BG9 A;  4YSX A;  3P4Q A;  3P7I A;  2ZMA A;  1HG2 A;  2BKO A;  3VKH A;  4U7I A;  5DJQ C;  2E5V A;  5CA1 E;  4K0K T;  3CX6 B;  2XZE A;  5HCM A;  3RRW A;  1KNP A;  4DO0 A;  2ACZ A;  3Q5W A;  3OTO T;  1XZY A;  2X67 A;  3ZC1 A;  3RIU C;  4CI1 B;  3ZJ2 A;  5J1G A;  4AI6 A;  2MAW A;  3ZT7 A;  3N9L A;  2LSI A;  3ZPO A;  5F8P A;  3N9P A;  3K3Q C;  2CMR A;  1QSD A;  2IIU A;  3O1J A;  2CM0 A;  2LM2 A;  4CN4 A;  4DV0 T;  2X68 A;  4DR1 T;  3Q2M A;  4DUZ T;  5FXX A;  1WFD A;  3AEF A;  4H9O C;  3CQC B;  5HXR A;  4EAH A;  2HHH T;  2FJA A;  3R6N A;  4JI4 T;  2J47 A;  1SA0 E;  3E08 A;  5IYZ E;  5KX5 E;  2BS3 A;  2BVL A;  5AQG B;  2DI4 A;  2JMH A;  4HWH A;  4PK5 A;  2V8S V;  4Q25 A;  3L3P A;  3FZH B;  5FNV E;  4H63 H;  4EGW A;  2OLT A;  4YFS A;  1HTJ F;  4WBO A;  4ZEY A;  4UVB B;  5AQJ B;  4HTE A;  1JNZ A;  4DBQ A;  1SHZ C;  4QHO A;  3N9N A;  3A8Y C;  3P50 A;  1IJ5 A;  1MMN A;  2WU2 A;  2X66 A;  4DV2 T;  5FL0 A;  2JQ9 A;  2D9D A;  1XWM A;  2XQ4 A;  2MTQ A;  3EDV A;  2HH7 A;  5AQH B;  5LGN B;  2MOZ A;  1U5P A;  3H37 A;  4JI7 T;  1WYB A;  5L3B B;  5IUX A;  3CQG B;  4NXN T;  2VKH A;  3AEB A;  4PFO A;  4O4J E;  3L09 A;  4QXC B;  4ZZC A;  3N2G E;  4X1I E;  5KXJ A;  4JI8 T;  1IJ6 A;  3A5X A;  4PK4 A;  4L5G A;  2Y6X A;  1WRD A;  3TLU A;  5LJN A;  4YJ3 E;  3UU5 A;  2HN1 A;  5AFU L;  2HPJ A;  2KWH A;  2LT3 A;  2C5K T;  5LP6 E;  2IDO B;  3IHR A;  3O1I A;  1YKE B;  5AQT B;  1G8X A;  4ISS A;  4UEL A;  1NEN A;  1O3X A;  2C0S A;  2BDE A;  2JQQ A;  3UU8 A;  1E2A A;  4ZZB A;  1ZHC A;  3L8R A;  2QRX A;  2WWV A;  3PUS A;  2DWK A;  2FUP A;  5J2U E;  2GK9 A;  3S4U A;  5HCJ A;  3WAJ A;  2BG9 E;  5FY1 A;  4JI3 T;  5L4E A;  2LOP A;  3KVB A;  2DNX A;  3PU3 A;  4GK5 E;  1N32 T;  1D0Y A;  2X0Y A;  3PUA A;  3SFD A;  4YXD A;  2V1D B;  1OED A;  5HXE A;  4GKJ T;  5HAX A;  5KDM C;  2LSY A;  1UK5 A;  3AE4 A;  4I43 B;  5LXT E;  4IST A;  4ZI3 C;  2X9X A;  4GKK T;  5FVL A;  5CFB A;  1MIW A;  4HGA A;  3AE7 A;  2WY2 A;  3KV4 A;  4HFD A;  4L9I A;  3ZN1 B;  4EYY R;  5JDN A;  1IBM T;  1N36 T;  2V5D A;  3W15 B;  4U7Y A;  1W9R A;  3QC9 A;  4HFC A;  1Y01 A;  2I6H A;  4GYS A;  5DAB A;  2VUR A;  3MZK B;  4LML A;  2N2N A;  1W0B A;  2I0M A;  2LJL A;  5F3J A;  3ZN0 B; 
#chains in the Genus database with same CATH homology
 1OED B;  3RI5 A;  4X5T A;  2YOE A;  4HFB A;  4TNW A;  3RIA A;  3ZKR A;  3TLT A;  4Z91 A;  3JAE A;  2KSR A;  5HEG A;  2XQ7 A;  4TWF A;  5J0Z A;  4ILC A;  1OED E;  2XQ8 A;  3RQU A;  3UUB A;  3JAD A;  2LKH A;  2XQ5 A;  2BG9 A;  4IRE A;  4A97 A;  5HEO A;  4ILA A;  5L47 A;  5HCM A;  5HEU A;  4Z90 A;  3RIF A;  5HEH A;  3RQW A;  2MAW A;  2XQA A;  2LM2 A;  3EAM A;  4COF A;  2XQ6 A;  2YKS A;  5L4H A;  4QH5 A;  4HFH A;  4LMK A;  4NPP A;  3P4W A;  3TLW A;  3UQ7 A;  3P50 A;  4ILB A;  4QH4 A;  2YN6 A;  2VL0 A;  2XQ4 A;  2LKG A;  4F8H A;  5IUX A;  4TWD A;  4QH1 A;  3TLS A;  4HFI A;  4ZZC A;  2LLY A;  3TLU A;  4TNV A;  3UU6 A;  3UU5 A;  5HEJ A;  2M6I A;  3TLV A;  3UU4 A;  2BG9 C;  3UU8 A;  4ZZB A;  3EI0 A;  5HCJ A;  2BG9 E;  5L4E A;  4LMJ A;  3UQ4 A;  3LSV A;  1OED A;  2XQ3 A;  3UU3 A;  4TWH A;  4HFE A;  5CFB A;  4HFD A;  2XQ9 A;  3RHW A;  4A98 A;  4IL4 A;  4HFC A;  1OED C;  2BG9 B;  5LG3 A;  2M6B A;  4LML A;  3JAF A;  3EHZ A;  4IL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...