1OEDB

Structure of acetylcholine receptor pore from electron images
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
250
structure length
127
Chain Sequence
PLFYIVYTIIPCILISILAILVFYLPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVVVLNLHHRSAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
molecule tags Ion channel/receptor
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
total genus 45
structure length 127
sequence length 250
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedB00
4ILAA 2YN6A 2YKSA 4TWFA 2BG9A 4LMLA 5L4HA 4ILCA 3EHZA 5L47A 2XQ4A 3JAEA 4QH4A 2LLYA 4ZZBA 2M6IA 5HEOA 1OEDC 3RI5A 5HEGA 3TLUA 1OEDA 4TWDA 2VL0A 5L4EA 5J0ZA 3UU4A 2M6BA 3RQWA 2KSRA 4IL4A 3UQ7A 2XQAA 4HFBA 3JADA 4HFDA 2XQ6A 5LG3A 3TLVA 2YOEA 4HFEA 4QH5A 4A97A 4NPPA 2LKHA 3LSVA 1OEDB 5IUXA 3RHWA 3RQUA 3EI0A 5HCMA 4LMKA 1OEDE 4IL9A 2BG9B 3TLTA 4TNWA 3UQ4A 3UU6A 4A98A 3UU5A 3JAFA 4IREA 4HFIA 3UU3A 4X5TA 2XQ7A 3P50A 3TLSA 4LMJA 2LM2A 4Z91A 2XQ9A 4F8HA 3TLWA 2XQ3A 2MAWA 3ZKRA 3RIAA 5HEUA 5CFBA 3EAMA 3P4WA 4HFCA 2XQ8A 4HFHA 2LKGA 2BG9C 4Z90A 2BG9E 4TWHA 3UU8A 4COFA 2XQ5A 5HEJA 5HEHA 3RIFA 5HCJA 4ZZCA 4TNVA 4ILBA 4QH1A 3UUBA
chains in the Genus database with same CATH superfamily
4EZHA 4ISSA 4CI1B 3GA8A 3I0QA 4EV6A 1KK7A 1E7PA 1SHZC 1SUMB 2LE8A 2YKSA 4HWIB 4TWFA 4YTMA 3UT5E 3MXZA 4DV6T 5KXJA 5CA0E 4PJLA 2JQHA 2QA7A 2W0GA 1I6ZA 4IHJE 5AQPB 4KHPT 2D0TA 3GWHA 1HF8A 1HR0T 3RPUA 4EAHA 2WAUA 1VOMA 3F2EA 4NUVA 3MA9A 3W15B 5L47A 3ANWA 4KMCA 1EZ3A 1HS7A 4TV8E 4GOUA 4AIUA 3PUWF 2A2FX 4XBFB 2NTXA 4EYUA 3ZJ2A 4YSZA 4ZI7E 5HEOA 2C5JA 1YKHB 3CX6B 3C51A 5FY0A 4LF9T 2FJAA 5HEGA 4NIQA 2CXFA 2MTQA 3NKZA 4P0BA 2X68A 5DABA 3TLUA 3VR8A 4EIWA 5BMVE 4ZI3C 4TWDA 2XAGB 1N32T 5L4EA 4GK5E 4H9SE 5HXEA 2XJ7A 2FJEA 3FZHB 4ZEYA 3HKDE 2WWUA 2IIUA 2LT3A 2W61A 3NRXA 4K0UA 5FL0A 2YU1A 3X1DA 4ADZA 4YTNA 2DL1A 2H7OA 4GYRA 4YFSA 3FXEB 4IDNA 5FXVA 2L9QA 4UV8B 4IGUA 3AE6A 3S4UA 4OYKA 4DR7T 4IL4A 3AEFA 2KXPB 3RF1A 2N1GA 2Y8DA 3V5SA 1WRDA 3CWZB 3FHNA 2NW8A 3JC6D 2KMFA 3LBXA 3SFDA 3L8RA 2IDOB 2V7LA 4L5GA 1D0XA 3SS1A 3UFEA 2CPTA 2A9UA 2CWYA 3OJAA 3ZCJA 2ZM0A 5FXWA 3GN5B 4A97A 4YSXA 5ABGA 4C91A 2LKHA 3LSVA 5C8YE 1JNZA 2E9XA 3BQLA 4TUYE 4YSYA 4LF8T 4DV4T 2KZ7B 3KV5A 2WBLA 2EHOB 3RQUA 5JR9A 3PV0F 5AQGB 1UX5A 4NUUA 1L0VA 1XDOA 4JLEA 2DWGA 2JRKA 3Q5XA 5ETWA 3AE7A 3E08A 2CM0A 4JBWF 4HWFA 5HCMA 2FJDA 2XAJB 1G73A 2UUCT 2PBIA 5AQHB 5AQVB 2E8IA 3RLFF 4PAGA 3M3ZB 4F6RC 4UF0B 4UR9A 1S94A 4UELA 5LG4A 3CQXC 1HX8A 3Q9DA 3ZMTB 2HPLA 2JPFA 1ZHCA 3AE3A 4KHZF 4J2CA 3RKOA 2UXXB 4DVDA 2H7VC 1LVFA 5AFUL 3UU6A 2HHHT 2YDRA 3C98B 2UUAT 1WR0A 1W0BA 2PFVA 3UU5A 2A72A 2CHOA 3JAFA 4IREA 2ZM8A 3PJAJ 2B76A 1XWMA 1H7CA 2EHOC 2FUPA 1VCTA 1VRBA 3EABA 2RA1A 2KT9A 3ONLC 3TLSA 1LRZA 2RPAA 4H63V 4LMJA 3VKHA 4Z91A 4ILUA 2CBIA 4IT4A 3J7Yq 4HKAA 2XQ9A 4F8HA 4LF7T 2VB6A 3RRWA 1UCUA 4DO0A 3C4ZA 3TLWA 2WU5A 4ANJA 3AB3B 5JREA 2VWAA 2MAWA 3R84B 3ZN0B 5LBMA 4DV2T 3CPZA 4PK6A 2IAKA 5JH7E 5ABHA 2KLQA 2DI4A 2VVNA 2L8KA 1MMDA 5KX5E 4JI5T 2F4VT 2C0SA 4JEUB 2D0UA 3PUGA 4TV9E 3SFEA 3VRBA 2BG9C 5LHIB 4PNIA 3VU7H 4WZXA 5AQUB 2LRKA 1WLXA 3K8PC 2BKOA 4GK0E 3PJAA 4U2YA 3IHRA 4A56A 5HEJA 2E2AA 5AQLB 3BK9A 5HCJA 5AQQB 4ILBA 2CWOA 4H9OC 3UUBA 4LFAT 5HXSA 3ETUA 3SOLA 2V7JA 2YN6A 4DUZT 5CGMA 3HR0A 4ZS3A 1N34T 3E22E 3ZPOA 4EXTA 1MMNA 3ZJ1A 2ZLYA 3I0OA 3RRCA 1UUSA 1IAPA 1MIVA 5HWXA 4CXYA 3CKDA 2LHNA 2I59A 3KV4A 4IDPA 4CXWA 3KV9A 5LXTE 3ZYKA 4DIDB 2V6YB 2XSBA 2ES0A 2BKPA 3EHZA 3PUVF 2MYSA 3QB5A 1UURA 5LJNA 4AI6A 5LMNT 3HL6A 1HCIA 1O3XA 2CBJA 2VKJA 2VKDA 3RIUC 2NW9A 2K48A 3C4XA 2LLYA 5LGTB 4Z8XA 2XAQB 3OVUA 1KFYA 2H88A 4WBNE 3F57A 3GMIA 3F31A 3UUNA 4PJNA 3Q5EA 4AISA 4TZ4C 4X1YE 1KNPA 4QHOA 3OPCA 4DR4T 2WSSV 3NVOA 2JIWA 1YXRA 2LHRA 4O2BE 5F5WA 3C64A 3P4SA 4AKRB 5J0ZA 1M62A 2QYWA 3AE9A 5AQFB 3MJXA 3NZPA 3RYHE 4DR1T 3ANWB 3PUQA 5HXHA 5IYZE 4UVCB 3DTOA 2UUBT 3ZSSA 3P4PA 1AJ3A 3VR9A 5FVLA 5JR9C 2KNDA 4PK5A 4WBOA 4MALA 4DBRA 2BS2A 3B5MA 2W67A 3AEBA 2XQAA 3CQCB 2KINB 3AA6B 5DJQC 1T8BA 3LK42 3N9PA 4I50E 4PJMA 4QWNB 1LVKA 4QX7B 1ZV4X 3KVAA 4KBMB 1KEYA 4O4LE 3U3IA 1W09A 3ZT6A 4KX6A 2ZMAA 4HGAA 2IHR1 5HAXA 2UXDT 4YT0A 2DCFA 1R8IA 1D0YA 1ZEEA 3ZC0A 4P0AA 1G8XA 4CI3B 3FBZA 2XUEA 4EEBA 5J2UE 4LFCT 3ZYLA 1Z8UA 5JDMA 2I6HA 5HXRA 2W62A 4YTPA 4C90A 4BA9A 4DMWA 3OTOT 2BVLA 1XNQT 3P4QA 2KWIB 3AA0B 4H63H 5FMNA 5JDGA 3MZKB 4P09A 4DV5T 2XAFB 4JYAT 1XMQT 1OEDE 4JI4T 3DJBA 3DP7A 4AQGA 2MOZA 3J9X1 5C2TA 4YXDA 3P7IA 2NOXA 3H37A 3N5LA 1QSDA 2AE9A 2BDEA 3A7MA 2VK9A 2Y6XA 1YQ4A 5DQWA 1MNEA 1D1BA 2LRLA 2NR4A 4DR2T 4H9QC 4DR6T 4O4HE 4IE5A 4U33A 2LOPA 3CMLA 4NXMT 3PE0A 4AKLA 2WB5A 2G0UA 4HFIA 3UU3A 4MFRA 3O9XA 3TKLB 2XQ7A 3T1HT 3HKBE 4O4JE 5HXCA 4GKJT 3RC3A 2WMOA 5J2TE 3ZC1A 3PU8A 5L3FB 3ZMVB 1MIYA 2YINA 1SA0E 2HPJA 3D0TA 3KVBA 3L09A 3FZKB 2HN1A 2BBHA 3LBXB 4UF0A 2X9WA 5AQNB 4EGWA 4JV5T 4JI1T 5KDMC 3RIAA 4LF5T 4LFBT 4EEDA 5M4YA 3EAMA 3P4WA 1KNRA 4O4IE 4TX5A 5LNKA 3NWIA 2PTFA 4ZI2C 4B3ST 5AQOB 2NTYA 4BAYB 3QC9A 5EK2A 3AEDA 3Q5WA 2BG9E 2HN2A 3AAAB 2KWHA 1YQ3A 2W63A 4X66T 2WDRA 2X9HA 3BQIA 3KINB 4E7SA 4ISTA 2LSYA 4H9PC 1T7SA 2OLTA 2XQ5A 1FMWA 3CX7B 2CE7A 2X0LB 3K3QC 4COFA 4QXHB 3RIFA 4MLKA 1BR2A 1IBKT 1LKXA 2CXDA 4TNVA 3VKGA 2Q9QD 3MKDA 1NEKA 2BKNA 2L3LA 2X67A 4AKIA 4ILAA 1UK5A 2XAHB 4EYYR 1NWMX 2V8SV 2WCAA 3KBTA 1GQEA 4AKHA 4NXNT 5L4HA 2V7KA 4EB6E 4DUYT 1MIWA 4AKGA 1W9RA 2CLYC 2EHOD 5FYMA 5FKYA 3K1SA 4X20E 2WWVA 3V5UA 1N36T 4ILCA 2XQ4A 3G06A 3AE5A 3JC6C 2V6XA 5H6RB 3WI3A 4YJ2E 5BR8T 4GKKT 4ZI2D 1FEWA 1SE7A 1WCRA 2SPCA 3E0ZA 5FVKA 1NENA 2ZM2A 5AQRB 4ZS2A 2XASB 5FXXA 4ZZBA 3K3OA 4MBQA 1XDPA 3RI5A 5EK4A 2EHOA 2VASA 5CFBA 2AXDS 2WZHA 4B3MT 1HX1B 2X0YA 5LMUT 3VHLA 4ZXLA 3T1YT 5JDFA 5LJMA 2JMHA 2IMLA 2VL0A 1YD8G 2JQKA 2OA5A 3EVYA 3Q2MA 1IJ5A 2K5BB 2WP9A 4HEAA 5TAOA 3RYCE 2E9XC 2YDQA 4KUMB 3ZMZB 4EZ4A 1Y01A 2UXCT 5FXZA 3RQWA 2Z6EA 3IEEA 1U4QA 2V26A 1HG2A 3I9WA 4KP3C 5AQTB 1T98A 2ACXA 4H9NC 5L3CB 3AE2A 5LG3A 3CX8B 2JMKA 1CHUA 4BJMA 2J47A 2LSKA 3TLVA 3ZSTA 4DV1T 1X9BA 3OKQA 2DNXA 1E1HB 4HFEA 4QH5A 2BS4A 2LEHA 3ABVA 4U72A 5LCYA 3U78A 5IUXA 2XPKA 3AVSA 1X79A 3L39A 2V1DB 4CN1A 1B7TA 3RGLA 2V5DA 3I9YA 2J1DG 3K3NA 4PK4A 4X64T 3ESLA 2QGSA 2HH7A 5A1LA 2FBWA 2VKHA 2CA5A 5AQSB 4ZHQE 1JNRA 4HWDA 4G63A 4HN9A 4QXBB 4ZOLE 3EI0A 3ZCIA 2LOSA 3WAJA 4IDZA 2W66A 3RH3A 1M7KA 3N9NA 5LGNB 1D1CA 2V6YA 2XHEB 3AXJA 4IL9A 5IHYA 2W4XA 5LHGB 4TNWA 2CXLA 3RIUA 3UQ4A 1FIOA 5J1GA 4FJOA 5L3DB 2V5CA 4P1NA 4DR5T 4M1PA 1OWAA 3N2OA 3O1HA 4U7IA 4WNKA 4A98A 4HTEA 3ONXA 3ETVA 5L3GB 4O8SA 4JI7T 1QLBA 1HNWT 5CA1E 3PU3A 5LHHB 3B13A 4L9IA 4O2AE 4JI8T 2A3DA 2CEAA 2XQYA 3CK6A 3N2KE 5LB7B 5JRCB 2N2NA 3CVRA 3O1IA 4IE7A 2X0HA 3H3AA 4IE0A 4G2AA 4U2ZA 2XM2A 3HI2A 4V1Av 3RYFE 1J5ET 2ODUA 1HNZT 5AQKB 2XQ3A 3UTKA 4B3RT 2CHNA 4DV7T 4HWHA 4I55E 5FL1A 4JI6T 1FJGT 2H3RA 2QRXA 1QUUA 2J4GA 2NW7A 2X9XA 3EDUA 4X1IE 5HEUA 1UGOA 2LSGA 2WZIA 3AA1B 3P4RA 5JVDE 3R6NA 4X62T 4B3TT 1BR1A 2XQ8A 1WFDA 4IDQA 1WYCA 2LKGA 3MK7C 2N9DA 4QXCB 2K24A 3HKEE 3KFWX 2YEVC 3EUHA 2WU2A 2GK9A 3M65A 3PUXF 5FNVE 4YY3T 4XZCA 1MNDA 3O1JA 2VL8A 5F8PA 4GYSA 4L0RA 2BZBA 5FY7A 3UU8A 2DHRA 3C4WA 3GN5A 4UVAB 5KMGP 1XMOT 2WDQA 4YJ3E 1Y64B 2ODVA 1HTJF 2Q9QB 4HWCA 3LK2B 5HEHA 5ABFA 5JDQA 4ZZCA 1U5PA 2JQ9A 4X1KE 2WMNA 5GONE 3ZT5A 5JQGE 1N33T 3A8YC 5F3JA 5CB4E 1YKEB 3KBUA 5ABEA 2BG9A 4QX8B 4AQYT 2V7MA 4UIGA 4LMLA 3SWHA 5DQVA 3CQGB 4JUYA 1US7B 3N2GE 2NP9A 2H89A 4IE6A 4KI0F 5JDNA 3QK6A 2IC9A 4JI0T 4OFZA 2B1EA 2VQET 3N9LA 1ZP0A 3AE1A 4PFPA 4FI5A 5AQMB 5LBQB 3UFGA 3MACA 3A5XA 3PDYA 5LP6E 3JAEA 4QH4A 5JR9B 2E5LT 4CQIA 4I0UA 3ONJA 2XM1A 3JCFA 5LOVE 1KNZA 1IBLT 1WYBA 3PUZF 2M6IA 2VQFT 4AQFC 4LF6T 2W00A 3HA4A 5ABFB 2D9DA 5L3EB 1OEDC 3UULA 3ZLIA 2DWKA 3N9OA 3LDQB 4GIWA 5EZYE 3AE4A 4OHFA 1KF6A 2X9YA 4A5XA 2W2UA 3RC8A 4ERRA 3AEEA 5CJ5A 1DU2A 4PJJA 1T72A 3EDVA 3FBLA 4WW0A 3Q5DA 1OEDA 1IBMT 2C5KT 3B57A 5EK3A 3LG7A 4MHCA 3L3PA 5JDLA 2IC6A 2PG8A 2NWBA 3QB5K 3AAIA 3NZQA 5FY1A 1VCSA 4CI2B 5IWAT 1UX4A 2M67A 4YHHT 1HFAA 2XSAA 3LK3B 3SRZA 3UU4A 3KV6A 3NRYA 2M6BA 5C3JA 1MMGA 2LSJA 1I94T 2CCQA 2K3WA 2KSRA 2PJQA 2Q9QC 3PUYF 4OYJA 5AQJB 2XZEA 3RX6A 3ZMSB 3T8OA 2QVAA 2WS3A 4DMVA 3UQ7A 4HFBA 3JADA 4IDOA 4HFDA 2XQ6A 1D0ZA 3C50A 3RKGA 4DV0T 2YOEA 4Q25A 2VURA 2FJBA 4UV9B 1E2AA 4HFVA 5L3BB 4LF4T 1XNRT 4NPPA 2I0MA 5E0OA 1D1AA 1OEDB 2K9AA 4ASKA 3KDSE 1MMAA 2IUBA 3FZFB 4U31A 3RHWA 1WR6A 2E5VA 3AEAA 3QUJA 4YLHA 4AQFA 3UUXB 1HNXT 4DNDA 2RP4A 4I4TE 1ZOYA 3PTRB 2WY2A 4YHJA 5LYJE 4K0KT 4DV3T 4E7ZA 2VKOA 4PFOA 1NAFA 3VRAA 3AE8A 3ZMUB 3ZT7A 5HYAA 2BBJA 2UXNB 3LJCA 3QNUA 2D5UA 4LMKA 2X51A 1BR0A 2C5IT 2JQQA 3I1AA 1FMVA 3UUMA 4AXPA 4ZI3D 3ZEFB 3OBVE 2BG9B 3FZLB 2OV9A 3TLTA 2WM9A 1J1JA 3QOFA 4IE4A 3LFMA 4JEHB 1Z0PA 2CMRA 4OK0A 4DBQA 2Q9QA 4UXNB 2CRBA 2JJ9A 1W0AA 2DLRA 4QKNA 4CZZB 4DR3T 1ZKEA 2D2SA 5AQIB 4XAXB 4OX9T 3OYXA 1IJ6A 2UXBT 4X5TA 5JTGA 4X65T 1S35A 3P50A 2YK0A 3P8CD 4U7YA 3FZMB 2MPKA 2BS3A 2LJLA 2LM2A 4N78D 5HWYA 3ZYMA 4CN4A 4EOZB 4U3CA 2WQYA 5L2LA 3NBXX 3CIRA 4JI2T 3HKCE 3PUSA 4JI3T 3AXJB 4H9RC 2LSIA 3BQKA 2VVSA 3AECA 3N9MA 2R6GF 4UEMA 3WAKA 3ZKRA 3FXDB 2LM9A 2E9XD 3AEGA 4HE8A 5ADXL 2CLYB 2YDSA 3OYZA 4BJNA 3RYIE 2V7IA 4I43B 1V9DA 4HFCA 5LA6E 1XZYA 3ZN1B 3IF8B 3IA3A 4PW8A 1CUNA 2MBGA 1BR4A 1HG5A 4HFHA 1OXZA 2P9BA 5H6QB 2YU2A 2UU9T 3AAEB 3PUAA 4Z90A 2ZM6T 3FB2A 4WYVA 1YW0A 4TN7B 3N9QA 3AVRA 4TWHA 1IZNB 2BVMA 2Y48B 3O4XE 5FP3A 2J62A 4B6XA 5JDHA 3PURA 3AA7B 2ACZA 2X66A 2XY8B 1J5WA 2E9XB 4CXXA 2IW5B 2XTLA 5JRCA 3H3MA 3IBPA 4UVBB 4CN6A 4U74A 4IIJE 5LGUB 2WDVA 4QH1A
chains in the Genus database with same CATH topology
4ILAA 2YN6A 2YKSA 4TWFA 2BG9A 4LMLA 5L4HA 4ILCA 3EHZA 5L47A 2XQ4A 3JAEA 4QH4A 2LLYA 4ZZBA 2M6IA 5HEOA 1OEDC 3RI5A 5HEGA 3TLUA 1OEDA 4TWDA 2VL0A 5L4EA 5J0ZA 3UU4A 2M6BA 3RQWA 2KSRA 4IL4A 3UQ7A 2XQAA 4HFBA 3JADA 4HFDA 2XQ6A 5LG3A 3TLVA 2YOEA 4HFEA 4QH5A 4A97A 4NPPA 2LKHA 3LSVA 1OEDB 5IUXA 3RHWA 3RQUA 3EI0A 5HCMA 4LMKA 1OEDE 4IL9A 2BG9B 3TLTA 4TNWA 3UQ4A 3UU6A 4A98A 3UU5A 3JAFA 4IREA 4HFIA 3UU3A 4X5TA 2XQ7A 3P50A 3TLSA 4LMJA 2LM2A 4Z91A 2XQ9A 4F8HA 3TLWA 2XQ3A 2MAWA 3ZKRA 3RIAA 5HEUA 5CFBA 3EAMA 3P4WA 4HFCA 2XQ8A 4HFHA 2LKGA 2BG9C 4Z90A 2BG9E 4TWHA 3UU8A 4COFA 2XQ5A 5HEJA 5HEHA 3RIFA 5HCJA 4ZZCA 4TNVA 4ILBA 4QH1A 3UUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILA A;  2YN6 A;  2YKS A;  4TWF A;  2BG9 A;  4LML A;  5L4H A;  4ILC A;  3EHZ A;  5L47 A;  2XQ4 A;  3JAE A;  4QH4 A;  2LLY A;  4ZZB A;  2M6I A;  5HEO A;  1OED C;  3RI5 A;  5HEG A;  3TLU A;  1OED A;  4TWD A;  2VL0 A;  5L4E A;  5J0Z A;  3UU4 A;  2M6B A;  3RQW A;  2KSR A;  4IL4 A;  3UQ7 A;  2XQA A;  4HFB A;  3JAD A;  4HFD A;  2XQ6 A;  5LG3 A;  3TLV A;  2YOE A;  4HFE A;  4QH5 A;  4A97 A;  4NPP A;  2LKH A;  3LSV A;  1OED B;  5IUX A;  3RHW A;  3RQU A;  3EI0 A;  5HCM A;  4LMK A;  1OED E;  4IL9 A;  2BG9 B;  3TLT A;  4TNW A;  3UQ4 A;  3UU6 A;  4A98 A;  3UU5 A;  3JAF A;  4IRE A;  4HFI A;  3UU3 A;  4X5T A;  2XQ7 A;  3P50 A;  3TLS A;  4LMJ A;  2LM2 A;  4Z91 A;  2XQ9 A;  4F8H A;  3TLW A;  2XQ3 A;  2MAW A;  3ZKR A;  3RIA A;  5HEU A;  5CFB A;  3EAM A;  3P4W A;  4HFC A;  2XQ8 A;  4HFH A;  2LKG A;  2BG9 C;  4Z90 A;  2BG9 E;  4TWH A;  3UU8 A;  4COF A;  2XQ5 A;  5HEJ A;  5HEH A;  3RIF A;  5HCJ A;  4ZZC A;  4TNV A;  4ILB A;  4QH1 A;  3UUB A; 
#chains in the Genus database with same CATH topology
 4EZH A;  4ISS A;  4CI1 B;  3GA8 A;  3I0Q A;  4EV6 A;  1KK7 A;  1E7P A;  1SHZ C;  1SUM B;  2LE8 A;  2YKS A;  4HWI B;  4TWF A;  4YTM A;  3UT5 E;  3MXZ A;  4DV6 T;  5KXJ A;  5CA0 E;  4PJL A;  2JQH A;  2QA7 A;  2W0G A;  1I6Z A;  4IHJ E;  5AQP B;  4KHP T;  2D0T A;  3GWH A;  1HF8 A;  1HR0 T;  3RPU A;  4EAH A;  2WAU A;  1VOM A;  3F2E A;  4NUV A;  3MA9 A;  3W15 B;  5L47 A;  3ANW A;  4KMC A;  1EZ3 A;  1HS7 A;  4TV8 E;  4GOU A;  4AIU A;  3PUW F;  2A2F X;  4XBF B;  2NTX A;  4EYU A;  3ZJ2 A;  4YSZ A;  4ZI7 E;  5HEO A;  2C5J A;  1YKH B;  3CX6 B;  3C51 A;  5FY0 A;  4LF9 T;  2FJA A;  5HEG A;  4NIQ A;  2CXF A;  2MTQ A;  3NKZ A;  4P0B A;  2X68 A;  5DAB A;  3TLU A;  3VR8 A;  4EIW A;  5BMV E;  4ZI3 C;  4TWD A;  2XAG B;  1N32 T;  5L4E A;  4GK5 E;  4H9S E;  5HXE A;  2XJ7 A;  2FJE A;  3FZH B;  4ZEY A;  3HKD E;  2WWU A;  2IIU A;  2LT3 A;  2W61 A;  3NRX A;  4K0U A;  5FL0 A;  2YU1 A;  3X1D A;  4ADZ A;  4YTN A;  2DL1 A;  2H7O A;  4GYR A;  4YFS A;  3FXE B;  4IDN A;  5FXV A;  2L9Q A;  4UV8 B;  4IGU A;  3AE6 A;  3S4U A;  4OYK A;  4DR7 T;  4IL4 A;  3AEF A;  2KXP B;  3RF1 A;  2N1G A;  2Y8D A;  3V5S A;  1WRD A;  3CWZ B;  3FHN A;  2NW8 A;  3JC6 D;  2KMF A;  3LBX A;  3SFD A;  3L8R A;  2IDO B;  2V7L A;  4L5G A;  1D0X A;  3SS1 A;  3UFE A;  2CPT A;  2A9U A;  2CWY A;  3OJA A;  3ZCJ A;  2ZM0 A;  5FXW A;  3GN5 B;  4A97 A;  4YSX A;  5ABG A;  4C91 A;  2LKH A;  3LSV A;  5C8Y E;  1JNZ A;  2E9X A;  3BQL A;  4TUY E;  4YSY A;  4LF8 T;  4DV4 T;  2KZ7 B;  3KV5 A;  2WBL A;  2EHO B;  3RQU A;  5JR9 A;  3PV0 F;  5AQG B;  1UX5 A;  4NUU A;  1L0V A;  1XDO A;  4JLE A;  2DWG A;  2JRK A;  3Q5X A;  5ETW A;  3AE7 A;  3E08 A;  2CM0 A;  4JBW F;  4HWF A;  5HCM A;  2FJD A;  2XAJ B;  1G73 A;  2UUC T;  2PBI A;  5AQH B;  5AQV B;  2E8I A;  3RLF F;  4PAG A;  3M3Z B;  4F6R C;  4UF0 B;  4UR9 A;  1S94 A;  4UEL A;  5LG4 A;  3CQX C;  1HX8 A;  3Q9D A;  3ZMT B;  2HPL A;  2JPF A;  1ZHC A;  3AE3 A;  4KHZ F;  4J2C A;  3RKO A;  2UXX B;  4DVD A;  2H7V C;  1LVF A;  5AFU L;  3UU6 A;  2HHH T;  2YDR A;  3C98 B;  2UUA T;  1WR0 A;  1W0B A;  2PFV A;  3UU5 A;  2A72 A;  2CHO A;  3JAF A;  4IRE A;  2ZM8 A;  3PJA J;  2B76 A;  1XWM A;  1H7C A;  2EHO C;  2FUP A;  1VCT A;  1VRB A;  3EAB A;  2RA1 A;  2KT9 A;  3ONL C;  3TLS A;  1LRZ A;  2RPA A;  4H63 V;  4LMJ A;  3VKH A;  4Z91 A;  4ILU A;  2CBI A;  4IT4 A;  3J7Y q;  4HKA A;  2XQ9 A;  4F8H A;  4LF7 T;  2VB6 A;  3RRW A;  1UCU A;  4DO0 A;  3C4Z A;  3TLW A;  2WU5 A;  4ANJ A;  3AB3 B;  5JRE A;  2VWA A;  2MAW A;  3R84 B;  3ZN0 B;  5LBM A;  4DV2 T;  3CPZ A;  4PK6 A;  2IAK A;  5JH7 E;  5ABH A;  2KLQ A;  2DI4 A;  2VVN A;  2L8K A;  1MMD A;  5KX5 E;  4JI5 T;  2F4V T;  2C0S A;  4JEU B;  2D0U A;  3PUG A;  4TV9 E;  3SFE A;  3VRB A;  2BG9 C;  5LHI B;  4PNI A;  3VU7 H;  4WZX A;  5AQU B;  2LRK A;  1WLX A;  3K8P C;  2BKO A;  4GK0 E;  3PJA A;  4U2Y A;  3IHR A;  4A56 A;  5HEJ A;  2E2A A;  5AQL B;  3BK9 A;  5HCJ A;  5AQQ B;  4ILB A;  2CWO A;  4H9O C;  3UUB A;  4LFA T;  5HXS A;  3ETU A;  3SOL A;  2V7J A;  2YN6 A;  4DUZ T;  5CGM A;  3HR0 A;  4ZS3 A;  1N34 T;  3E22 E;  3ZPO A;  4EXT A;  1MMN A;  3ZJ1 A;  2ZLY A;  3I0O A;  3RRC A;  1UUS A;  1IAP A;  1MIV A;  5HWX A;  4CXY A;  3CKD A;  2LHN A;  2I59 A;  3KV4 A;  4IDP A;  4CXW A;  3KV9 A;  5LXT E;  3ZYK A;  4DID B;  2V6Y B;  2XSB A;  2ES0 A;  2BKP A;  3EHZ A;  3PUV F;  2MYS A;  3QB5 A;  1UUR A;  5LJN A;  4AI6 A;  5LMN T;  3HL6 A;  1HCI A;  1O3X A;  2CBJ A;  2VKJ A;  2VKD A;  3RIU C;  2NW9 A;  2K48 A;  3C4X A;  2LLY A;  5LGT B;  4Z8X A;  2XAQ B;  3OVU A;  1KFY A;  2H88 A;  4WBN E;  3F57 A;  3GMI A;  3F31 A;  3UUN A;  4PJN A;  3Q5E A;  4AIS A;  4TZ4 C;  4X1Y E;  1KNP A;  4QHO A;  3OPC A;  4DR4 T;  2WSS V;  3NVO A;  2JIW A;  1YXR A;  2LHR A;  4O2B E;  5F5W A;  3C64 A;  3P4S A;  4AKR B;  5J0Z A;  1M62 A;  2QYW A;  3AE9 A;  5AQF B;  3MJX A;  3NZP A;  3RYH E;  4DR1 T;  3ANW B;  3PUQ A;  5HXH A;  5IYZ E;  4UVC B;  3DTO A;  2UUB T;  3ZSS A;  3P4P A;  1AJ3 A;  3VR9 A;  5FVL A;  5JR9 C;  2KND A;  4PK5 A;  4WBO A;  4MAL A;  4DBR A;  2BS2 A;  3B5M A;  2W67 A;  3AEB A;  2XQA A;  3CQC B;  2KIN B;  3AA6 B;  5DJQ C;  1T8B A;  3LK4 2;  3N9P A;  4I50 E;  4PJM A;  4QWN B;  1LVK A;  4QX7 B;  1ZV4 X;  3KVA A;  4KBM B;  1KEY A;  4O4L E;  3U3I A;  1W09 A;  3ZT6 A;  4KX6 A;  2ZMA A;  4HGA A;  2IHR 1;  5HAX A;  2UXD T;  4YT0 A;  2DCF A;  1R8I A;  1D0Y A;  1ZEE A;  3ZC0 A;  4P0A A;  1G8X A;  4CI3 B;  3FBZ A;  2XUE A;  4EEB A;  5J2U E;  4LFC T;  3ZYL A;  1Z8U A;  5JDM A;  2I6H A;  5HXR A;  2W62 A;  4YTP A;  4C90 A;  4BA9 A;  4DMW A;  3OTO T;  2BVL A;  1XNQ T;  3P4Q A;  2KWI B;  3AA0 B;  4H63 H;  5FMN A;  5JDG A;  3MZK B;  4P09 A;  4DV5 T;  2XAF B;  4JYA T;  1XMQ T;  1OED E;  4JI4 T;  3DJB A;  3DP7 A;  4AQG A;  2MOZ A;  3J9X 1;  5C2T A;  4YXD A;  3P7I A;  2NOX A;  3H37 A;  3N5L A;  1QSD A;  2AE9 A;  2BDE A;  3A7M A;  2VK9 A;  2Y6X A;  1YQ4 A;  5DQW A;  1MNE A;  1D1B A;  2LRL A;  2NR4 A;  4DR2 T;  4H9Q C;  4DR6 T;  4O4H E;  4IE5 A;  4U33 A;  2LOP A;  3CML A;  4NXM T;  3PE0 A;  4AKL A;  2WB5 A;  2G0U A;  4HFI A;  3UU3 A;  4MFR A;  3O9X A;  3TKL B;  2XQ7 A;  3T1H T;  3HKB E;  4O4J E;  5HXC A;  4GKJ T;  3RC3 A;  2WMO A;  5J2T E;  3ZC1 A;  3PU8 A;  5L3F B;  3ZMV B;  1MIY A;  2YIN A;  1SA0 E;  2HPJ A;  3D0T A;  3KVB A;  3L09 A;  3FZK B;  2HN1 A;  2BBH A;  3LBX B;  4UF0 A;  2X9W A;  5AQN B;  4EGW A;  4JV5 T;  4JI1 T;  5KDM C;  3RIA A;  4LF5 T;  4LFB T;  4EED A;  5M4Y A;  3EAM A;  3P4W A;  1KNR A;  4O4I E;  4TX5 A;  5LNK A;  3NWI A;  2PTF A;  4ZI2 C;  4B3S T;  5AQO B;  2NTY A;  4BAY B;  3QC9 A;  5EK2 A;  3AED A;  3Q5W A;  2BG9 E;  2HN2 A;  3AAA B;  2KWH A;  1YQ3 A;  2W63 A;  4X66 T;  2WDR A;  2X9H A;  3BQI A;  3KIN B;  4E7S A;  4IST A;  2LSY A;  4H9P C;  1T7S A;  2OLT A;  2XQ5 A;  1FMW A;  3CX7 B;  2CE7 A;  2X0L B;  3K3Q C;  4COF A;  4QXH B;  3RIF A;  4MLK A;  1BR2 A;  1IBK T;  1LKX A;  2CXD A;  4TNV A;  3VKG A;  2Q9Q D;  3MKD A;  1NEK A;  2BKN A;  2L3L A;  2X67 A;  4AKI A;  4ILA A;  1UK5 A;  2XAH B;  4EYY R;  1NWM X;  2V8S V;  2WCA A;  3KBT A;  1GQE A;  4AKH A;  4NXN T;  5L4H A;  2V7K A;  4EB6 E;  4DUY T;  1MIW A;  4AKG A;  1W9R A;  2CLY C;  2EHO D;  5FYM A;  5FKY A;  3K1S A;  4X20 E;  2WWV A;  3V5U A;  1N36 T;  4ILC A;  2XQ4 A;  3G06 A;  3AE5 A;  3JC6 C;  2V6X A;  5H6R B;  3WI3 A;  4YJ2 E;  5BR8 T;  4GKK T;  4ZI2 D;  1FEW A;  1SE7 A;  1WCR A;  2SPC A;  3E0Z A;  5FVK A;  1NEN A;  2ZM2 A;  5AQR B;  4ZS2 A;  2XAS B;  5FXX A;  4ZZB A;  3K3O A;  4MBQ A;  1XDP A;  3RI5 A;  5EK4 A;  2EHO A;  2VAS A;  5CFB A;  2AXD S;  2WZH A;  4B3M T;  1HX1 B;  2X0Y A;  5LMU T;  3VHL A;  4ZXL A;  3T1Y T;  5JDF A;  5LJM A;  2JMH A;  2IML A;  2VL0 A;  1YD8 G;  2JQK A;  2OA5 A;  3EVY A;  3Q2M A;  1IJ5 A;  2K5B B;  2WP9 A;  4HEA A;  5TAO A;  3RYC E;  2E9X C;  2YDQ A;  4KUM B;  3ZMZ B;  4EZ4 A;  1Y01 A;  2UXC T;  5FXZ A;  3RQW A;  2Z6E A;  3IEE A;  1U4Q A;  2V26 A;  1HG2 A;  3I9W A;  4KP3 C;  5AQT B;  1T98 A;  2ACX A;  4H9N C;  5L3C B;  3AE2 A;  5LG3 A;  3CX8 B;  2JMK A;  1CHU A;  4BJM A;  2J47 A;  2LSK A;  3TLV A;  3ZST A;  4DV1 T;  1X9B A;  3OKQ A;  2DNX A;  1E1H B;  4HFE A;  4QH5 A;  2BS4 A;  2LEH A;  3ABV A;  4U72 A;  5LCY A;  3U78 A;  5IUX A;  2XPK A;  3AVS A;  1X79 A;  3L39 A;  2V1D B;  4CN1 A;  1B7T A;  3RGL A;  2V5D A;  3I9Y A;  2J1D G;  3K3N A;  4PK4 A;  4X64 T;  3ESL A;  2QGS A;  2HH7 A;  5A1L A;  2FBW A;  2VKH A;  2CA5 A;  5AQS B;  4ZHQ E;  1JNR A;  4HWD A;  4G63 A;  4HN9 A;  4QXB B;  4ZOL E;  3EI0 A;  3ZCI A;  2LOS A;  3WAJ A;  4IDZ A;  2W66 A;  3RH3 A;  1M7K A;  3N9N A;  5LGN B;  1D1C A;  2V6Y A;  2XHE B;  3AXJ A;  4IL9 A;  5IHY A;  2W4X A;  5LHG B;  4TNW A;  2CXL A;  3RIU A;  3UQ4 A;  1FIO A;  5J1G A;  4FJO A;  5L3D B;  2V5C A;  4P1N A;  4DR5 T;  4M1P A;  1OWA A;  3N2O A;  3O1H A;  4U7I A;  4WNK A;  4A98 A;  4HTE A;  3ONX A;  3ETV A;  5L3G B;  4O8S A;  4JI7 T;  1QLB A;  1HNW T;  5CA1 E;  3PU3 A;  5LHH B;  3B13 A;  4L9I A;  4O2A E;  4JI8 T;  2A3D A;  2CEA A;  2XQY A;  3CK6 A;  3N2K E;  5LB7 B;  5JRC B;  2N2N A;  3CVR A;  3O1I A;  4IE7 A;  2X0H A;  3H3A A;  4IE0 A;  4G2A A;  4U2Z A;  2XM2 A;  3HI2 A;  4V1A v;  3RYF E;  1J5E T;  2ODU A;  1HNZ T;  5AQK B;  2XQ3 A;  3UTK A;  4B3R T;  2CHN A;  4DV7 T;  4HWH A;  4I55 E;  5FL1 A;  4JI6 T;  1FJG T;  2H3R A;  2QRX A;  1QUU A;  2J4G A;  2NW7 A;  2X9X A;  3EDU A;  4X1I E;  5HEU A;  1UGO A;  2LSG A;  2WZI A;  3AA1 B;  3P4R A;  5JVD E;  3R6N A;  4X62 T;  4B3T T;  1BR1 A;  2XQ8 A;  1WFD A;  4IDQ A;  1WYC A;  2LKG A;  3MK7 C;  2N9D A;  4QXC B;  2K24 A;  3HKE E;  3KFW X;  2YEV C;  3EUH A;  2WU2 A;  2GK9 A;  3M65 A;  3PUX F;  5FNV E;  4YY3 T;  4XZC A;  1MND A;  3O1J A;  2VL8 A;  5F8P A;  4GYS A;  4L0R A;  2BZB A;  5FY7 A;  3UU8 A;  2DHR A;  3C4W A;  3GN5 A;  4UVA B;  5KMG P;  1XMO T;  2WDQ A;  4YJ3 E;  1Y64 B;  2ODV A;  1HTJ F;  2Q9Q B;  4HWC A;  3LK2 B;  5HEH A;  5ABF A;  5JDQ A;  4ZZC A;  1U5P A;  2JQ9 A;  4X1K E;  2WMN A;  5GON E;  3ZT5 A;  5JQG E;  1N33 T;  3A8Y C;  5F3J A;  5CB4 E;  1YKE B;  3KBU A;  5ABE A;  2BG9 A;  4QX8 B;  4AQY T;  2V7M A;  4UIG A;  4LML A;  3SWH A;  5DQV A;  3CQG B;  4JUY A;  1US7 B;  3N2G E;  2NP9 A;  2H89 A;  4IE6 A;  4KI0 F;  5JDN A;  3QK6 A;  2IC9 A;  4JI0 T;  4OFZ A;  2B1E A;  2VQE T;  3N9L A;  1ZP0 A;  3AE1 A;  4PFP A;  4FI5 A;  5AQM B;  5LBQ B;  3UFG A;  3MAC A;  3A5X A;  3PDY A;  5LP6 E;  3JAE A;  4QH4 A;  5JR9 B;  2E5L T;  4CQI A;  4I0U A;  3ONJ A;  2XM1 A;  3JCF A;  5LOV E;  1KNZ A;  1IBL T;  1WYB A;  3PUZ F;  2M6I A;  2VQF T;  4AQF C;  4LF6 T;  2W00 A;  3HA4 A;  5ABF B;  2D9D A;  5L3E B;  1OED C;  3UUL A;  3ZLI A;  2DWK A;  3N9O A;  3LDQ B;  4GIW A;  5EZY E;  3AE4 A;  4OHF A;  1KF6 A;  2X9Y A;  4A5X A;  2W2U A;  3RC8 A;  4ERR A;  3AEE A;  5CJ5 A;  1DU2 A;  4PJJ A;  1T72 A;  3EDV A;  3FBL A;  4WW0 A;  3Q5D A;  1OED A;  1IBM T;  2C5K T;  3B57 A;  5EK3 A;  3LG7 A;  4MHC A;  3L3P A;  5JDL A;  2IC6 A;  2PG8 A;  2NWB A;  3QB5 K;  3AAI A;  3NZQ A;  5FY1 A;  1VCS A;  4CI2 B;  5IWA T;  1UX4 A;  2M67 A;  4YHH T;  1HFA A;  2XSA A;  3LK3 B;  3SRZ A;  3UU4 A;  3KV6 A;  3NRY A;  2M6B A;  5C3J A;  1MMG A;  2LSJ A;  1I94 T;  2CCQ A;  2K3W A;  2KSR A;  2PJQ A;  2Q9Q C;  3PUY F;  4OYJ A;  5AQJ B;  2XZE A;  3RX6 A;  3ZMS B;  3T8O A;  2QVA A;  2WS3 A;  4DMV A;  3UQ7 A;  4HFB A;  3JAD A;  4IDO A;  4HFD A;  2XQ6 A;  1D0Z A;  3C50 A;  3RKG A;  4DV0 T;  2YOE A;  4Q25 A;  2VUR A;  2FJB A;  4UV9 B;  1E2A A;  4HFV A;  5L3B B;  4LF4 T;  1XNR T;  4NPP A;  2I0M A;  5E0O A;  1D1A A;  1OED B;  2K9A A;  4ASK A;  3KDS E;  1MMA A;  2IUB A;  3FZF B;  4U31 A;  3RHW A;  1WR6 A;  2E5V A;  3AEA A;  3QUJ A;  4YLH A;  4AQF A;  3UUX B;  1HNX T;  4DND A;  2RP4 A;  4I4T E;  1ZOY A;  3PTR B;  2WY2 A;  4YHJ A;  5LYJ E;  4K0K T;  4DV3 T;  4E7Z A;  2VKO A;  4PFO A;  1NAF A;  3VRA A;  3AE8 A;  3ZMU B;  3ZT7 A;  5HYA A;  2BBJ A;  2UXN B;  3LJC A;  3QNU A;  2D5U A;  4LMK A;  2X51 A;  1BR0 A;  2C5I T;  2JQQ A;  3I1A A;  1FMV A;  3UUM A;  4AXP A;  4ZI3 D;  3ZEF B;  3OBV E;  2BG9 B;  3FZL B;  2OV9 A;  3TLT A;  2WM9 A;  1J1J A;  3QOF A;  4IE4 A;  3LFM A;  4JEH B;  1Z0P A;  2CMR A;  4OK0 A;  4DBQ A;  2Q9Q A;  4UXN B;  2CRB A;  2JJ9 A;  1W0A A;  2DLR A;  4QKN A;  4CZZ B;  4DR3 T;  1ZKE A;  2D2S A;  5AQI B;  4XAX B;  4OX9 T;  3OYX A;  1IJ6 A;  2UXB T;  4X5T A;  5JTG A;  4X65 T;  1S35 A;  3P50 A;  2YK0 A;  3P8C D;  4U7Y A;  3FZM B;  2MPK A;  2BS3 A;  2LJL A;  2LM2 A;  4N78 D;  5HWY A;  3ZYM A;  4CN4 A;  4EOZ B;  4U3C A;  2WQY A;  5L2L A;  3NBX X;  3CIR A;  4JI2 T;  3HKC E;  3PUS A;  4JI3 T;  3AXJ B;  4H9R C;  2LSI A;  3BQK A;  2VVS A;  3AEC A;  3N9M A;  2R6G F;  4UEM A;  3WAK A;  3ZKR A;  3FXD B;  2LM9 A;  2E9X D;  3AEG A;  4HE8 A;  5ADX L;  2CLY B;  2YDS A;  3OYZ A;  4BJN A;  3RYI E;  2V7I A;  4I43 B;  1V9D A;  4HFC A;  5LA6 E;  1XZY A;  3ZN1 B;  3IF8 B;  3IA3 A;  4PW8 A;  1CUN A;  2MBG A;  1BR4 A;  1HG5 A;  4HFH A;  1OXZ A;  2P9B A;  5H6Q B;  2YU2 A;  2UU9 T;  3AAE B;  3PUA A;  4Z90 A;  2ZM6 T;  3FB2 A;  4WYV A;  1YW0 A;  4TN7 B;  3N9Q A;  3AVR A;  4TWH A;  1IZN B;  2BVM A;  2Y48 B;  3O4X E;  5FP3 A;  2J62 A;  4B6X A;  5JDH A;  3PUR A;  3AA7 B;  2ACZ A;  2X66 A;  2XY8 B;  1J5W A;  2E9X B;  4CXX A;  2IW5 B;  2XTL A;  5JRC A;  3H3M A;  3IBP A;  4UVB B;  4CN6 A;  4U74 A;  4IIJ E;  5LGU B;  2WDV A;  4QH1 A; 
#chains in the Genus database with same CATH homology
 4ILA A;  2YN6 A;  2YKS A;  4TWF A;  2BG9 A;  4LML A;  5L4H A;  4ILC A;  3EHZ A;  5L47 A;  2XQ4 A;  3JAE A;  4QH4 A;  2LLY A;  4ZZB A;  2M6I A;  5HEO A;  1OED C;  3RI5 A;  5HEG A;  3TLU A;  1OED A;  4TWD A;  2VL0 A;  5L4E A;  5J0Z A;  3UU4 A;  2M6B A;  3RQW A;  2KSR A;  4IL4 A;  3UQ7 A;  2XQA A;  4HFB A;  3JAD A;  4HFD A;  2XQ6 A;  5LG3 A;  3TLV A;  2YOE A;  4HFE A;  4QH5 A;  4A97 A;  4NPP A;  2LKH A;  3LSV A;  1OED B;  5IUX A;  3RHW A;  3RQU A;  3EI0 A;  5HCM A;  4LMK A;  1OED E;  4IL9 A;  2BG9 B;  3TLT A;  4TNW A;  3UQ4 A;  3UU6 A;  4A98 A;  3UU5 A;  3JAF A;  4IRE A;  4HFI A;  3UU3 A;  4X5T A;  2XQ7 A;  3P50 A;  3TLS A;  4LMJ A;  2LM2 A;  4Z91 A;  2XQ9 A;  4F8H A;  3TLW A;  2XQ3 A;  2MAW A;  3ZKR A;  3RIA A;  5HEU A;  5CFB A;  3EAM A;  3P4W A;  4HFC A;  2XQ8 A;  4HFH A;  2LKG A;  2BG9 C;  4Z90 A;  2BG9 E;  4TWH A;  3UU8 A;  4COF A;  2XQ5 A;  5HEJ A;  5HEH A;  3RIF A;  5HCJ A;  4ZZC A;  4TNV A;  4ILB A;  4QH1 A;  3UUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...