1OEDB

Structure of acetylcholine receptor pore from electron images
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
250
structure length
127
Chain Sequence
PLFYIVYTIIPCILISILAILVFYLPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVVVLNLHHRSAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Structure and Gating Mechanism of the Acetylcholine Receptor Pore.
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 45
structure length 127
sequence length 250
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 1oedB00
2VL0A 3TLWA 3RI5A 3TLSA 3EHZA 3EI0A 3TLTA 2MAWA 3UQ4A 1OEDE 2BG9C 4LMKA 2BG9B 3UU8A 3EAMA 3TLUA 5CFBA 4HFBA 2M6BA 5J0ZA 2XQ7A 4X5TA 5HEJA 4COFA 3RIAA 3UU5A 2BG9A 4IREA 3UUBA 5HCMA 2YOEA 3UQ7A 5HCJA 4TNVA 4TNWA 5HEUA 5HEOA 4ILAA 3JAFA 4QH4A 5HEGA 3RIFA 5L47A 2LLYA 4NPPA 4TWDA 2XQ8A 3JAEA 2XQAA 2XQ3A 4ILBA 4HFIA 4Z91A 4F8HA 4Z90A 3UU6A 4TWHA 2YN6A 4ZZBA 3P50A 4A97A 2BG9E 2LKHA 3UU3A 4IL9A 2XQ4A 4A98A 4QH5A 1OEDC 3LSVA 4TWFA 1OEDB 2KSRA 4ILCA 2XQ5A 5L4HA 4ZZCA 3UU4A 4HFDA 4LMJA 3TLVA 3RHWA 5L4EA 3ZKRA 5HEHA 5LG3A 4HFHA 2LM2A 3RQUA 2XQ6A 5IUXA 1OEDA 3RQWA 3JADA 2LKGA 3P4WA 4HFEA 2M6IA 4LMLA 2YKSA 2XQ9A 4IL4A 4QH1A 4HFCA
chains in the Genus database with same CATH superfamily
3RF1A 1QUUA 2JQKA 2V8SV 3TLSA 3EI0A 4X1KE 3T8OA 2NW8A 2PTFA 5C3JA 5JR9A 4AKIA 2XM1A 3GWHA 3JC6C 4U2YA 3DJBA 2B76A 4AKRB 3NZPA 2H88A 2WWVA 2CXFA 4IDNA 1FJGT 3RIUA 4KUMB 3PJAJ 3WI3A 2WSSV 1G8XA 3RLFF 2CCQA 3U78A 3U3IA 1KNZA 2CWYA 5ABFB 4CI2B 3ZEFB 2VKDA 2VB6A 3A5XA 1BR4A 3RKOA 2NR4A 3IEEA 1T98A 2JMHA 1H7CA 4UXNB 2E8IA 4B3MT 1MMAA 2BKNA 4HFHA 2WY2A 4LFAT 4HTEA 2JQ9A 2UXDT 3KBUA 3N9PA 2RA1A 1W09A 3AA1B 4NUUA 3ZJ2A 5FXVA 3ZT5A 3UT5E 4BAYB 4YTPA 3EVYA 2HHHT 4DBQA 2V26A 4DV3T 3L8RA 2CXDA 2LRKA 2AXDS 4QXBB 3N2KE 2WBLA 2V7IA 3PUXF 1YKHB 5DQVA 5FY1A 2C5IT 4C90A 2FJEA 3OTOT 3RIAA 4IDQA 1FEWA 3CMLA 5EK2A 1HTJF 5LHGB 3CIRA 4EOZB 3VKGA 4QHOA 3JAFA 3AXJB 4I43B 3SFDA 5HYAA 2L3LA 5L47A 2LLYA 5LP6E 5AQQB 4G2AA 4U3CA 5HXRA 4HEAA 3AE6A 4X65T 4WZXA 4JI8T 3KFWX 1IAPA 1UGOA 2H3RA 2XAHB 3Q2MA 4DO0A 1E1HB 2VQET 4O4JE 5AQJB 4EB6E 4X66T 2KINB 4ZZCA 1T8BA 3EDUA 2LHNA 4AKHA 1X79A 3NKZA 2LM2A 3N9NA 4HGAA 4LF4T 1XDPA 2QA7A 2KZ7B 5F3JA 4YHHT 2W0GA 3OJAA 3P4PA 1D0YA 5LOVE 1US7B 5L3GB 4DV2T 4UVBB 4DUZT 5JREA 3AE8A 4QH1A 3M65A 2X67A 5LJNA 2YK0A 4Z8XA 4LMKA 1T7SA 3AE4A 2JMKA 2CLYB 1U5PA 2A72A 2WWUA 5JH7E 2L9QA 5JVDE 3IHRA 2Q9QB 1IZNB 4UIGA 4OYKA 4K0KT 2M67A 3O4XE 3ZC0A 2WZIA 2Q9QA 5CA1E 2W2UA 1HS7A 5AQRB 4AQFC 5JDMA 2D0TA 3NRXA 2XQAA 4TWHA 2WQYA 1WFDA 2XSAA 3P50A 2ZM0A 1WYCA 3BQKA 3QNUA 3O9XA 3L39A 2W66A 3AVRA 5LXTE 3I0QA 4GYRA 2KNDA 5EK4A 4IGUA 2FJDA 3RQUA 5IYZE 2IAKA 4KBMB 3KINB 2DLRA 4YY3T 3RYHE 2V7LA 3RPUA 1J5WA 1V9DA 3HI2A 2E9XB 3HL6A 4YSZA 1NAFA 2I0MA 1IBKT 3FBZA 1JNZA 2YDQA 5FXZA 3IF8B 1KNPA 4M1PA 5KXJA 4JI3T 2K5BB 3AEDA 2V6XA 3UU8A 3H3AA 3EABA 3CWZB 5F8PA 4ZS2A 4PFPA 2N2NA 4LF8T 3NRYA 5FY7A 2MTQA 2HN2A 4OK0A 3RRWA 3CQCB 4PJJA 2W4XA 1MNDA 4XAXB 3QB5A 3FZHB 4WBOA 4Q25A 4IDOA 2WMNA 2N1GA 2XAJB 4CN1A 2DWKA 3ONLC 3WAJA 3GN5B 3KDSE 3EUHA 2BS2A 2X9WA 4NXMT 2CXLA 4DMVA 2WM9A 3PUSA 5J2UE 2XQ5A 5L3CB 4JI6T 3RRCA 3ONXA 3RHWA 2WP9A 3MXZA 2IDOB 4AKLA 3GN5A 1OXZA 4H9NC 2YEVC 3Q5XA 3MA9A 3T1HT 4U7YA 3PV0F 4J2CA 3V5UA 5A1LA 2XM2A 2LE8A 3P4QA 1MNEA 1MMGA 5LGTB 2CE7A 3I9WA 2VASA 3TLTA 3VRBA 4O4LE 3N2GE 5CGMA 4JI4T 3HKDE 4KP3C 2I6HA 4NIQA 4MBQA 2ACXA 4PJMA 5AQVB 5CB4E 3UQ7A 3RYCE 2H7OA 3F2EA 2JRKA 2CM0A 5ABGA 1KK7A 2H7VC 5HXEA 5BMVE 2ZM6T 2WB5A 4ILBA 4Z90A 2QVAA 4EZHA 4DR4T 3FHNA 3SRZA 4GKKT 4KI0F 3NZQA 4L0RA 3ZPOA 2WMOA 1YKEB 5LG4A 3ZYLA 1MMDA 2LOPA 3RGLA 2KSRA 2D9DA 2BDEA 4G63A 1HF8A 2VKJA 5ABEA 5AQFB 3F57A 1XNQT 3QB5K 5FL1A 1YQ4A 3PUVF 3K8PC 4HFVA 4L5GA 2KXPB 3ONJA 4B3RT 2CRBA 3ZC1A 4I55E 1LKXA 4PAGA 1CUNA 2XZEA 2XY8B 3BQIA 4HKAA 4NUVA 4ZI3C 4B6XA 2K24A 2NW9A 4KX6A 3NVOA 4QWNB 5JDLA 4JI5T 1Y64B 1KF6A 3WAKA 1D1BA 3C4ZA 4PK4A 4JV5T 4ANJA 4IE0A 2W00A 3SOLA 4IREA 3ZYKA 2IHR1 1YXRA 3OBVE 3S4UA 2FBWA 5KDMC 4JEHB 3B5MA 3UULA 4U33A 2XQ8A 5JQGE 3ZLIA 1FMWA 4EYYR 4P1NA 2WDRA 2RP4A 1D1AA 2ODUA 4PNIA 5LA6E 1HNZT 3K3QC 2LEHA 1SUMB 4DV4T 2JJ9A 4ZI7E 3O1IA 5FMNA 3LFMA 4HWCA 1KNRA 2WU2A 2NOXA 2JQHA 2ODVA 5L2LA 3HR0A 5J2TE 3R6NA 4TUYE 5LB7B 4GK0E 2WAUA 3PUQA 3C50A 2VK9A 2OV9A 4A56A 2YDRA 2BZBA 2PJQA 1WCRA 2Y8DA 3ETUA 3CKDA 5KX5E 4P0BA 2J62A 4ISTA 5JR9C 1MMNA 4L9IA 3UUMA 3EHZA 4JUYA 3ZT6A 3MKDA 2BG9B 2L8KA 4MFRA 3AEEA 3OKQA 1N34T 2ZM8A 3AE1A 2KWHA 2BVMA 3SS1A 4HFBA 1CHUA 3RIUC 2XQ7A 5HEJA 2BG9A 5HCMA 1GQEA 2X0HA 3G06A 2ACZA 4DMWA 4UV9B 4ZEYA 1UUSA 3RIFA 4TV9E 1G73A 4NPPA 3ZSSA 2IMLA 4H9QC 3JAEA 3LDQB 3SWHA 1SHZC 2BKPA 5AQNB 4EIWA 2D2SA 4A98A 3LK2B 1M62A 4EV6A 3H37A 1OEDB 5LMNT 1I6ZA 3CK6A 3UTKA 4IDZA 3AE3A 4U31A 5HEHA 3B57A 5LG3A 2PG8A 3KVBA 5IUXA 1OEDA 3K3NA 4IT4A 4I0UA 3ZYMA 4JI1T 1YD8G 3P4WA 3C98B 3AVSA 3AAAB 4PW8A 2XTLA 4EXTA 4YXDA 2FJBA 1S94A 4DVDA 4ZI3D 3VU7H 2GK9A 4DNDA 2NW7A 2VVSA 2YINA 1QLBA 1HR0T 2MBGA 4AI6A 5LGUB 3TLUA 4QXCB 1MIVA 4O8SA 4UEMA 1D0ZA 4YLHA 3PUYF 3QC9A 4DV1T 1IJ5A 5GONE 4DIDB 4YT0A 3AEFA 3TKLB 1Z8UA 4ZS3A 4IE6A 3JC6D 5DABA 4B3ST 3UUXB 4JEUB 4ZOLE 4YJ2E 4U72A 1VCTA 4LFBT 1KFYA 2A3DA 2E5LT 2F4VT 5AQKB 4A97A 2BG9E 1SA0E 4KHPT 4FI5A 4YTNA 3AA7B 2X9YA 5LBMA 4I50E 5L3DB 4DV6T 2HPJA 2NTYA 2X0LB 2V5DA 2XUEA 3VR9A 4DR1T 1R8IA 2EHOA 4X20E 2XPKA 4AKGA 3JADA 4WW0A 2VURA 3LG7A 4MALA 3PUWF 4HFEA 1IBMT 3MACA 5M4YA 1XDOA 2R6GF 4QX7B 2YKSA 2LRLA 3QK6A 3A7MA 3HKEE 3RI5A 4DV5T 4LFCT 2KMFA 1LVKA 1OEDE 5FL0A 2CLYC 2HN1A 2J1DG 3EAMA 3N9LA 1L0VA 2Q9QC 2G0UA 4CI1B 5HWYA 3X1DA 3P8CD 5BR8T 1OWAA 5JTGA 4O2BE 2MOZA 3ZSTA 1WRDA 2YOEA 1D0XA 4N78D 5LBQB 3A8YC 5LMUT 1XWMA 3DP7A 1UX4A 2FUPA 2IUBA 3NWIA 3CQGB 4NXNT 1BR0A 2LSJA 3UUNA 4ZI2C 3AE9A 5ABHA 2X9HA 4O4HE 3AE2A 5IWAT 4AQGA 4EZ4A 4ZZBA 4PFOA 2Y48B 5FKYA 4EGWA 4YSYA 2LJLA 3UU3A 3LBXA 5EK3A 2KWIB 4U74A 4O2AE 2YDSA 3E0ZA 4OYJA 2SPCA 3AAEB 3PUAA 4GK5E 3GA8A 4HWDA 4LF7T 2DWGA 3GMIA 2VVNA 5LYJE 4U2ZA 4EYUA 2LKGA 4LF9T 4WBNE 5JDQA 2IC6A 4LF5T 4LMLA 4YHJA 4IHJE 4AISA 3C4WA 4HE8A 2E9XC 2W67A 2XQ9A 3IBPA 3AAIA 3LK3B 2CHOA 5EZYE 3OVUA 3ZN1B 2A9UA 2E5VA 1BR1A 3M3ZB 3MK7C 4O4IE 5L3BB 4PK5A 2CWOA 3AE7A 5H6QB 3UU5A 5AQMB 2B1EA 1LVFA 5JRCA 3FXEB 4TZ4C 2XAFB 4DUYT 5LJMA 3R84B 5AQGB 1VOMA 3H3MA 2AE9A 2IIUA 1IJ6A 4CQIA 2JPFA 5FYMA 3FB2A 2XQ3A 3BK9A 2UUBT 4DR2T 3ZN0B 4X64T 2XAGB 2BS4A 5E0OA 5DJQC 3I0OA 3P4SA 5AQOB 1T72A 2YU1A 3UU4A 3NBXX 4JBWF 2V6YA 4MLKA 4ADZA 1O3XA 2BBJA 3AB3B 2WDQA 3KV6A 2WU5A 4QKNA 3ETVA 3MJXA 4QXHB 1XNRT 5LHHB 4PJNA 4IDPA 1KEYA 4XZCA 5KMGP 4GIWA 3Q9DA 3ABVA 2H89A 3RKGA 4TX5A 5AQTB 4HFCA 3MZKB 3AEBA 3ESLA 4EAHA 4AIUA 4B3TT 4ERRA 2Q9QD 2W61A 4YFSA 3T1YT 2M6BA 3RX6A 5F5WA 3C51A 1YW0A 3UFGA 3UUBA 1HX1B 5HCJA 2UXXB 2DNXA 1WLXA 4BA9A 2V1DB 4CZZB 4IE4A 2IW5B 4ZI2D 4CN4A 4P09A 4A5XA 4F8HA 2VQFT 5HXCA 3CX6B 4HN9A 1N32T 4K0UA 4XBFB 4HWHA 3N9OA 2WS3A 1QSDA 2LM9A 4QH5A 5AQHB 3J7Yq 3AE5A 4V1Av 3RC3A 4H63V 4H9PC 5AQLB 3KVAA 4CI3B 3EDVA 1NEKA 1XMOT 2C5JA 4UF0A 3W15B 5FP3A 1J1JA 3P7IA 2V7JA 3N5LA 4OHFA 1NWMX 2UUAT 2E9XD 2UXNB 2ES0A 4HWIB 2PFVA 2MYSA 5AFUL 3Q5DA 2MAWA 3L3PA 2XSBA 4UVAB 5CFBA 5CJ5A 5HXHA 4GKJT 1UX5A 5AQUB 4COFA 1M7KA 5ADXL 1MIWA 3LJCA 3ZMZB 2K3WA 2DL1A 5AQPB 2MPKA 4ILAA 5CA0E 2C5KT 2JIWA 5TAOA 5ABFA 2P9BA 1E2AA 3FZMB 2VL8A 3VRAA 2XJ7A 5HAXA 5HXSA 1SE7A 3I9YA 2LSYA 5LNKA 2IC9A 5JDGA 4JLEA 1J5ET 3PU8A 2XQ4A 3N9QA 2X9XA 3OPCA 4X1IE 1HFAA 2DCFA 2DI4A 5HWXA 2CBJA 3PDYA 4LMJA 2A2FX 3KBTA 1HNWT 4LF6T 3FZFB 4JYAT 2HPLA 5FXWA 4ISSA 1FIOA 2V5CA 2DHRA 1ZV4X 2ZM2A 4H9SE 3PURA 3P4RA 3ZMSB 2BVLA 1ZKEA 3UFEA 1UCUA 2WCAA 3CVRA 2X51A 5AQIB 2NWBA 2VL0A 3TLWA 5JDFA 2VWAA 4HWFA 1DU2A 1MIYA 3UQ4A 4EEDA 5DQWA 2K48A 2BG9C 3ZCJA 1ZEEA 3HA4A 3N2OA 4IIJE 4X62T 4DR7T 4JI7T 3AXJA 1ZHCA 5FXXA 2QYWA 3KV5A 5HEOA 4E7ZA 5L3FB 5C2TA 2UXCT 3PUZF 3UU6A 4WNKA 2LT3A 2YN6A 2KT9A 2LKHA 2CMRA 3PU3A 4AQFA 2ZMAA 1OEDC 2FJAA 4ZHQE 3PE0A 2I59A 3TLVA 5L4EA 3KV9A 4DR5T 3V5SA 3AA0B 2XQ6A 3RQWA 2X66A 2EHOB 2LSKA 1HNXT 3FXDB 4H9RC 4IE5A 2CEAA 2W62A 2QRXA 1W0AA 2UUCT 4YSXA 3I1AA 1VRBA 3ZMTB 2VKOA 3ZT7A 1WYBA 4UELA 4P0AA 4UV8B 4UVCB 4BJNA 4GOUA 3F31A 4JI2T 1XZYA 4DR3T 1HG2A 3J9X1 2UU9T 2HH7A 3O1HA 4CN6A 3FBLA 4TNWA 5FNVE 4H63H 4YJ3E 3VR8A 3C64A 2UXBT 2LOSA 2CPTA 1FMVA 3FZLB 4TWDA 1NENA 3CPZA 4HFIA 2CBIA 2WDVA 5FVKA 3RC8A 3RYFE 2QGSA 3QUJA 2XAQB 4IL9A 4ZXLA 2EHOC 1JNRA 2J47A 1VCSA 4AXPA 2Z6EA 3QOFA 3LSVA 4FJOA 3LBXB 3Q5WA 2J4GA 1HCIA 5IHYA 1N33T 4PJLA 1W0BA 4DBRA 3AECA 3BQLA 3O1JA 2NP9A 4E7SA 5LCYA 1Z0PA 5LGNB 2E9XA 2D5UA 3KV4A 2E2AA 4H9OC 3PJAA 4IL4A 4DV7T 2YU2A 1YQ3A 2W63A 2JQQA 2LSGA 4TV8E 4KMCA 1I94T 1EZ3A 5L3EB 3RH3A 2XHEB 3HKBE 5J0ZA 3HKCE 2WZHA 3JCFA 2KLQA 4DV0T 3FZKB 3AA6B 4TN7B 4OX9T 2V7MA 3IA3A 5ETWA 5HEGA 5JRCB 5J1GA 1S35A 3ZJ1A 3K1SA 1HX8A 4WYVA 1LRZA 1B7TA 4GYSA 3RYIE 2LSIA 2OA5A 4PK6A 1BR2A 2N9DA 2XASB 2RPAA 2D0UA 3C4XA 4TWFA 2BKOA 3E22E 2PBIA 4C91A 1XMQT 5L4HA 5JDHA 5AQSB 4HFDA 3SFEA 4CXXA 3CX7B 2V6YB 3E08A 2CHNA 4X1YE 2X0YA 1HG5A 4CXWA 3ZMUB 4YTMA 4U7IA 1U4QA 5H6RB 3AEGA 3Q5EA 4JI0T 3VHLA 2LHRA 1WR0A 2BBHA 5LHIB 1IBLT 3D0TA 3ZCIA 3K3OA 2K9AA 1Y01A 2VKHA 1N36T 4CXYA 4AQYT 1UURA 4MHCA 1WR6A 5FY0A 4KHZF 3ZMVB 1AJ3A 4EEBA 4X5TA 1W9RA 4QX8B 1ZP0A 3B13A 4ILUA 3OYZA 3N9MA 3VKHA 2Y6XA 4TNVA 5JDNA 5HEUA 1UK5A 4QH4A 5FVLA 4DR6T 3DTOA 4BJMA 2X68A 2OLTA 3CQXC 4IE7A 4Z91A 1D1CA 2XQYA 4ASKA 2EHOD 4I4TE 2CA5A 3PUGA 2BS3A 4ILCA 5C8YE 3ANWB 2C0SA 3ZKRA 3CX8B 3PTRB 1E7PA 4UR9A 3AEAA 3L09A 2V7KA 3OYXA 3LK42 4OFZA 3ANWA 1X9BA 2M6IA 4UF0B 1ZOYA 2NTXA 4F6RC 5JR9B 2ZLYA
chains in the Genus database with same CATH topology
2VL0A 3TLWA 3RI5A 3TLSA 3EHZA 3EI0A 3TLTA 2MAWA 3UQ4A 1OEDE 2BG9C 4LMKA 2BG9B 3UU8A 3EAMA 3TLUA 5CFBA 4HFBA 2M6BA 5J0ZA 2XQ7A 4X5TA 5HEJA 4COFA 3RIAA 3UU5A 2BG9A 4IREA 3UUBA 5HCMA 2YOEA 3UQ7A 5HCJA 4TNVA 4TNWA 5HEUA 5HEOA 4ILAA 3JAFA 4QH4A 5HEGA 3RIFA 5L47A 2LLYA 4NPPA 4TWDA 2XQ8A 3JAEA 2XQAA 2XQ3A 4ILBA 4HFIA 4Z91A 4F8HA 4Z90A 3UU6A 4TWHA 2YN6A 4ZZBA 3P50A 4A97A 2BG9E 2LKHA 3UU3A 4IL9A 2XQ4A 4A98A 4QH5A 1OEDC 3LSVA 4TWFA 1OEDB 2KSRA 4ILCA 2XQ5A 5L4HA 4ZZCA 3UU4A 4HFDA 4LMJA 3TLVA 3RHWA 5L4EA 3ZKRA 5HEHA 5LG3A 4HFHA 2LM2A 3RQUA 2XQ6A 5IUXA 1OEDA 3RQWA 3JADA 2LKGA 3P4WA 4HFEA 2M6IA 4LMLA 2YKSA 2XQ9A 4IL4A 4QH1A 4HFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL0 A;  3TLW A;  3RI5 A;  3TLS A;  3EHZ A;  3EI0 A;  3TLT A;  2MAW A;  3UQ4 A;  1OED E;  2BG9 C;  4LMK A;  2BG9 B;  3UU8 A;  3EAM A;  3TLU A;  5CFB A;  4HFB A;  2M6B A;  5J0Z A;  2XQ7 A;  4X5T A;  5HEJ A;  4COF A;  3RIA A;  3UU5 A;  2BG9 A;  4IRE A;  3UUB A;  5HCM A;  2YOE A;  3UQ7 A;  5HCJ A;  4TNV A;  4TNW A;  5HEU A;  5HEO A;  4ILA A;  3JAF A;  4QH4 A;  5HEG A;  3RIF A;  5L47 A;  2LLY A;  4NPP A;  4TWD A;  2XQ8 A;  3JAE A;  2XQA A;  2XQ3 A;  4ILB A;  4HFI A;  4Z91 A;  4F8H A;  4Z90 A;  3UU6 A;  4TWH A;  2YN6 A;  4ZZB A;  3P50 A;  4A97 A;  2BG9 E;  2LKH A;  3UU3 A;  4IL9 A;  2XQ4 A;  4A98 A;  4QH5 A;  1OED C;  3LSV A;  4TWF A;  1OED B;  2KSR A;  4ILC A;  2XQ5 A;  5L4H A;  4ZZC A;  3UU4 A;  4HFD A;  4LMJ A;  3TLV A;  3RHW A;  5L4E A;  3ZKR A;  5HEH A;  5LG3 A;  4HFH A;  2LM2 A;  3RQU A;  2XQ6 A;  5IUX A;  1OED A;  3RQW A;  3JAD A;  2LKG A;  3P4W A;  4HFE A;  2M6I A;  4LML A;  2YKS A;  2XQ9 A;  4IL4 A;  4QH1 A;  4HFC A; 
#chains in the Genus database with same CATH topology
 3RF1 A;  1QUU A;  2JQK A;  2V8S V;  3TLS A;  3EI0 A;  4X1K E;  3T8O A;  2NW8 A;  2PTF A;  5C3J A;  5JR9 A;  4AKI A;  2XM1 A;  3GWH A;  3JC6 C;  4U2Y A;  3DJB A;  2B76 A;  4AKR B;  3NZP A;  2H88 A;  2WWV A;  2CXF A;  4IDN A;  1FJG T;  3RIU A;  4KUM B;  3PJA J;  3WI3 A;  2WSS V;  1G8X A;  3RLF F;  2CCQ A;  3U78 A;  3U3I A;  1KNZ A;  2CWY A;  5ABF B;  4CI2 B;  3ZEF B;  2VKD A;  2VB6 A;  3A5X A;  1BR4 A;  3RKO A;  2NR4 A;  3IEE A;  1T98 A;  2JMH A;  1H7C A;  4UXN B;  2E8I A;  4B3M T;  1MMA A;  2BKN A;  4HFH A;  2WY2 A;  4LFA T;  4HTE A;  2JQ9 A;  2UXD T;  3KBU A;  3N9P A;  2RA1 A;  1W09 A;  3AA1 B;  4NUU A;  3ZJ2 A;  5FXV A;  3ZT5 A;  3UT5 E;  4BAY B;  4YTP A;  3EVY A;  2HHH T;  4DBQ A;  2V26 A;  4DV3 T;  3L8R A;  2CXD A;  2LRK A;  2AXD S;  4QXB B;  3N2K E;  2WBL A;  2V7I A;  3PUX F;  1YKH B;  5DQV A;  5FY1 A;  2C5I T;  4C90 A;  2FJE A;  3OTO T;  3RIA A;  4IDQ A;  1FEW A;  3CML A;  5EK2 A;  1HTJ F;  5LHG B;  3CIR A;  4EOZ B;  3VKG A;  4QHO A;  3JAF A;  3AXJ B;  4I43 B;  3SFD A;  5HYA A;  2L3L A;  5L47 A;  2LLY A;  5LP6 E;  5AQQ B;  4G2A A;  4U3C A;  5HXR A;  4HEA A;  3AE6 A;  4X65 T;  4WZX A;  4JI8 T;  3KFW X;  1IAP A;  1UGO A;  2H3R A;  2XAH B;  3Q2M A;  4DO0 A;  1E1H B;  2VQE T;  4O4J E;  5AQJ B;  4EB6 E;  4X66 T;  2KIN B;  4ZZC A;  1T8B A;  3EDU A;  2LHN A;  4AKH A;  1X79 A;  3NKZ A;  2LM2 A;  3N9N A;  4HGA A;  4LF4 T;  1XDP A;  2QA7 A;  2KZ7 B;  5F3J A;  4YHH T;  2W0G A;  3OJA A;  3P4P A;  1D0Y A;  5LOV E;  1US7 B;  5L3G B;  4DV2 T;  4UVB B;  4DUZ T;  5JRE A;  3AE8 A;  4QH1 A;  3M65 A;  2X67 A;  5LJN A;  2YK0 A;  4Z8X A;  4LMK A;  1T7S A;  3AE4 A;  2JMK A;  2CLY B;  1U5P A;  2A72 A;  2WWU A;  5JH7 E;  2L9Q A;  5JVD E;  3IHR A;  2Q9Q B;  1IZN B;  4UIG A;  4OYK A;  4K0K T;  2M67 A;  3O4X E;  3ZC0 A;  2WZI A;  2Q9Q A;  5CA1 E;  2W2U A;  1HS7 A;  5AQR B;  4AQF C;  5JDM A;  2D0T A;  3NRX A;  2XQA A;  4TWH A;  2WQY A;  1WFD A;  2XSA A;  3P50 A;  2ZM0 A;  1WYC A;  3BQK A;  3QNU A;  3O9X A;  3L39 A;  2W66 A;  3AVR A;  5LXT E;  3I0Q A;  4GYR A;  2KND A;  5EK4 A;  4IGU A;  2FJD A;  3RQU A;  5IYZ E;  2IAK A;  4KBM B;  3KIN B;  2DLR A;  4YY3 T;  3RYH E;  2V7L A;  3RPU A;  1J5W A;  1V9D A;  3HI2 A;  2E9X B;  3HL6 A;  4YSZ A;  1NAF A;  2I0M A;  1IBK T;  3FBZ A;  1JNZ A;  2YDQ A;  5FXZ A;  3IF8 B;  1KNP A;  4M1P A;  5KXJ A;  4JI3 T;  2K5B B;  3AED A;  2V6X A;  3UU8 A;  3H3A A;  3EAB A;  3CWZ B;  5F8P A;  4ZS2 A;  4PFP A;  2N2N A;  4LF8 T;  3NRY A;  5FY7 A;  2MTQ A;  2HN2 A;  4OK0 A;  3RRW A;  3CQC B;  4PJJ A;  2W4X A;  1MND A;  4XAX B;  3QB5 A;  3FZH B;  4WBO A;  4Q25 A;  4IDO A;  2WMN A;  2N1G A;  2XAJ B;  4CN1 A;  2DWK A;  3ONL C;  3WAJ A;  3GN5 B;  3KDS E;  3EUH A;  2BS2 A;  2X9W A;  4NXM T;  2CXL A;  4DMV A;  2WM9 A;  3PUS A;  5J2U E;  2XQ5 A;  5L3C B;  4JI6 T;  3RRC A;  3ONX A;  3RHW A;  2WP9 A;  3MXZ A;  2IDO B;  4AKL A;  3GN5 A;  1OXZ A;  4H9N C;  2YEV C;  3Q5X A;  3MA9 A;  3T1H T;  4U7Y A;  3PV0 F;  4J2C A;  3V5U A;  5A1L A;  2XM2 A;  2LE8 A;  3P4Q A;  1MNE A;  1MMG A;  5LGT B;  2CE7 A;  3I9W A;  2VAS A;  3TLT A;  3VRB A;  4O4L E;  3N2G E;  5CGM A;  4JI4 T;  3HKD E;  4KP3 C;  2I6H A;  4NIQ A;  4MBQ A;  2ACX A;  4PJM A;  5AQV B;  5CB4 E;  3UQ7 A;  3RYC E;  2H7O A;  3F2E A;  2JRK A;  2CM0 A;  5ABG A;  1KK7 A;  2H7V C;  5HXE A;  5BMV E;  2ZM6 T;  2WB5 A;  4ILB A;  4Z90 A;  2QVA A;  4EZH A;  4DR4 T;  3FHN A;  3SRZ A;  4GKK T;  4KI0 F;  3NZQ A;  4L0R A;  3ZPO A;  2WMO A;  1YKE B;  5LG4 A;  3ZYL A;  1MMD A;  2LOP A;  3RGL A;  2KSR A;  2D9D A;  2BDE A;  4G63 A;  1HF8 A;  2VKJ A;  5ABE A;  5AQF B;  3F57 A;  1XNQ T;  3QB5 K;  5FL1 A;  1YQ4 A;  3PUV F;  3K8P C;  4HFV A;  4L5G A;  2KXP B;  3ONJ A;  4B3R T;  2CRB A;  3ZC1 A;  4I55 E;  1LKX A;  4PAG A;  1CUN A;  2XZE A;  2XY8 B;  3BQI A;  4HKA A;  4NUV A;  4ZI3 C;  4B6X A;  2K24 A;  2NW9 A;  4KX6 A;  3NVO A;  4QWN B;  5JDL A;  4JI5 T;  1Y64 B;  1KF6 A;  3WAK A;  1D1B A;  3C4Z A;  4PK4 A;  4JV5 T;  4ANJ A;  4IE0 A;  2W00 A;  3SOL A;  4IRE A;  3ZYK A;  2IHR 1;  1YXR A;  3OBV E;  3S4U A;  2FBW A;  5KDM C;  4JEH B;  3B5M A;  3UUL A;  4U33 A;  2XQ8 A;  5JQG E;  3ZLI A;  1FMW A;  4EYY R;  4P1N A;  2WDR A;  2RP4 A;  1D1A A;  2ODU A;  4PNI A;  5LA6 E;  1HNZ T;  3K3Q C;  2LEH A;  1SUM B;  4DV4 T;  2JJ9 A;  4ZI7 E;  3O1I A;  5FMN A;  3LFM A;  4HWC A;  1KNR A;  2WU2 A;  2NOX A;  2JQH A;  2ODV A;  5L2L A;  3HR0 A;  5J2T E;  3R6N A;  4TUY E;  5LB7 B;  4GK0 E;  2WAU A;  3PUQ A;  3C50 A;  2VK9 A;  2OV9 A;  4A56 A;  2YDR A;  2BZB A;  2PJQ A;  1WCR A;  2Y8D A;  3ETU A;  3CKD A;  5KX5 E;  4P0B A;  2J62 A;  4IST A;  5JR9 C;  1MMN A;  4L9I A;  3UUM A;  3EHZ A;  4JUY A;  3ZT6 A;  3MKD A;  2BG9 B;  2L8K A;  4MFR A;  3AEE A;  3OKQ A;  1N34 T;  2ZM8 A;  3AE1 A;  2KWH A;  2BVM A;  3SS1 A;  4HFB A;  1CHU A;  3RIU C;  2XQ7 A;  5HEJ A;  2BG9 A;  5HCM A;  1GQE A;  2X0H A;  3G06 A;  2ACZ A;  4DMW A;  4UV9 B;  4ZEY A;  1UUS A;  3RIF A;  4TV9 E;  1G73 A;  4NPP A;  3ZSS A;  2IML A;  4H9Q C;  3JAE A;  3LDQ B;  3SWH A;  1SHZ C;  2BKP A;  5AQN B;  4EIW A;  2D2S A;  4A98 A;  3LK2 B;  1M62 A;  4EV6 A;  3H37 A;  1OED B;  5LMN T;  1I6Z A;  3CK6 A;  3UTK A;  4IDZ A;  3AE3 A;  4U31 A;  5HEH A;  3B57 A;  5LG3 A;  2PG8 A;  3KVB A;  5IUX A;  1OED A;  3K3N A;  4IT4 A;  4I0U A;  3ZYM A;  4JI1 T;  1YD8 G;  3P4W A;  3C98 B;  3AVS A;  3AAA B;  4PW8 A;  2XTL A;  4EXT A;  4YXD A;  2FJB A;  1S94 A;  4DVD A;  4ZI3 D;  3VU7 H;  2GK9 A;  4DND A;  2NW7 A;  2VVS A;  2YIN A;  1QLB A;  1HR0 T;  2MBG A;  4AI6 A;  5LGU B;  3TLU A;  4QXC B;  1MIV A;  4O8S A;  4UEM A;  1D0Z A;  4YLH A;  3PUY F;  3QC9 A;  4DV1 T;  1IJ5 A;  5GON E;  4DID B;  4YT0 A;  3AEF A;  3TKL B;  1Z8U A;  4ZS3 A;  4IE6 A;  3JC6 D;  5DAB A;  4B3S T;  3UUX B;  4JEU B;  4ZOL E;  4YJ2 E;  4U72 A;  1VCT A;  4LFB T;  1KFY A;  2A3D A;  2E5L T;  2F4V T;  5AQK B;  4A97 A;  2BG9 E;  1SA0 E;  4KHP T;  4FI5 A;  4YTN A;  3AA7 B;  2X9Y A;  5LBM A;  4I50 E;  5L3D B;  4DV6 T;  2HPJ A;  2NTY A;  2X0L B;  2V5D A;  2XUE A;  3VR9 A;  4DR1 T;  1R8I A;  2EHO A;  4X20 E;  2XPK A;  4AKG A;  3JAD A;  4WW0 A;  2VUR A;  3LG7 A;  4MAL A;  3PUW F;  4HFE A;  1IBM T;  3MAC A;  5M4Y A;  1XDO A;  2R6G F;  4QX7 B;  2YKS A;  2LRL A;  3QK6 A;  3A7M A;  3HKE E;  3RI5 A;  4DV5 T;  4LFC T;  2KMF A;  1LVK A;  1OED E;  5FL0 A;  2CLY C;  2HN1 A;  2J1D G;  3EAM A;  3N9L A;  1L0V A;  2Q9Q C;  2G0U A;  4CI1 B;  5HWY A;  3X1D A;  3P8C D;  5BR8 T;  1OWA A;  5JTG A;  4O2B E;  2MOZ A;  3ZST A;  1WRD A;  2YOE A;  1D0X A;  4N78 D;  5LBQ B;  3A8Y C;  5LMU T;  1XWM A;  3DP7 A;  1UX4 A;  2FUP A;  2IUB A;  3NWI A;  3CQG B;  4NXN T;  1BR0 A;  2LSJ A;  3UUN A;  4ZI2 C;  3AE9 A;  5ABH A;  2X9H A;  4O4H E;  3AE2 A;  5IWA T;  4AQG A;  4EZ4 A;  4ZZB A;  4PFO A;  2Y48 B;  5FKY A;  4EGW A;  4YSY A;  2LJL A;  3UU3 A;  3LBX A;  5EK3 A;  2KWI B;  4U74 A;  4O2A E;  2YDS A;  3E0Z A;  4OYJ A;  2SPC A;  3AAE B;  3PUA A;  4GK5 E;  3GA8 A;  4HWD A;  4LF7 T;  2DWG A;  3GMI A;  2VVN A;  5LYJ E;  4U2Z A;  4EYU A;  2LKG A;  4LF9 T;  4WBN E;  5JDQ A;  2IC6 A;  4LF5 T;  4LML A;  4YHJ A;  4IHJ E;  4AIS A;  3C4W A;  4HE8 A;  2E9X C;  2W67 A;  2XQ9 A;  3IBP A;  3AAI A;  3LK3 B;  2CHO A;  5EZY E;  3OVU A;  3ZN1 B;  2A9U A;  2E5V A;  1BR1 A;  3M3Z B;  3MK7 C;  4O4I E;  5L3B B;  4PK5 A;  2CWO A;  3AE7 A;  5H6Q B;  3UU5 A;  5AQM B;  2B1E A;  1LVF A;  5JRC A;  3FXE B;  4TZ4 C;  2XAF B;  4DUY T;  5LJM A;  3R84 B;  5AQG B;  1VOM A;  3H3M A;  2AE9 A;  2IIU A;  1IJ6 A;  4CQI A;  2JPF A;  5FYM A;  3FB2 A;  2XQ3 A;  3BK9 A;  2UUB T;  4DR2 T;  3ZN0 B;  4X64 T;  2XAG B;  2BS4 A;  5E0O A;  5DJQ C;  3I0O A;  3P4S A;  5AQO B;  1T72 A;  2YU1 A;  3UU4 A;  3NBX X;  4JBW F;  2V6Y A;  4MLK A;  4ADZ A;  1O3X A;  2BBJ A;  3AB3 B;  2WDQ A;  3KV6 A;  2WU5 A;  4QKN A;  3ETV A;  3MJX A;  4QXH B;  1XNR T;  5LHH B;  4PJN A;  4IDP A;  1KEY A;  4XZC A;  5KMG P;  4GIW A;  3Q9D A;  3ABV A;  2H89 A;  3RKG A;  4TX5 A;  5AQT B;  4HFC A;  3MZK B;  3AEB A;  3ESL A;  4EAH A;  4AIU A;  4B3T T;  4ERR A;  2Q9Q D;  2W61 A;  4YFS A;  3T1Y T;  2M6B A;  3RX6 A;  5F5W A;  3C51 A;  1YW0 A;  3UFG A;  3UUB A;  1HX1 B;  5HCJ A;  2UXX B;  2DNX A;  1WLX A;  4BA9 A;  2V1D B;  4CZZ B;  4IE4 A;  2IW5 B;  4ZI2 D;  4CN4 A;  4P09 A;  4A5X A;  4F8H A;  2VQF T;  5HXC A;  3CX6 B;  4HN9 A;  1N32 T;  4K0U A;  4XBF B;  4HWH A;  3N9O A;  2WS3 A;  1QSD A;  2LM9 A;  4QH5 A;  5AQH B;  3J7Y q;  3AE5 A;  4V1A v;  3RC3 A;  4H63 V;  4H9P C;  5AQL B;  3KVA A;  4CI3 B;  3EDV A;  1NEK A;  1XMO T;  2C5J A;  4UF0 A;  3W15 B;  5FP3 A;  1J1J A;  3P7I A;  2V7J A;  3N5L A;  4OHF A;  1NWM X;  2UUA T;  2E9X D;  2UXN B;  2ES0 A;  4HWI B;  2PFV A;  2MYS A;  5AFU L;  3Q5D A;  2MAW A;  3L3P A;  2XSB A;  4UVA B;  5CFB A;  5CJ5 A;  5HXH A;  4GKJ T;  1UX5 A;  5AQU B;  4COF A;  1M7K A;  5ADX L;  1MIW A;  3LJC A;  3ZMZ B;  2K3W A;  2DL1 A;  5AQP B;  2MPK A;  4ILA A;  5CA0 E;  2C5K T;  2JIW A;  5TAO A;  5ABF A;  2P9B A;  1E2A A;  3FZM B;  2VL8 A;  3VRA A;  2XJ7 A;  5HAX A;  5HXS A;  1SE7 A;  3I9Y A;  2LSY A;  5LNK A;  2IC9 A;  5JDG A;  4JLE A;  1J5E T;  3PU8 A;  2XQ4 A;  3N9Q A;  2X9X A;  3OPC A;  4X1I E;  1HFA A;  2DCF A;  2DI4 A;  5HWX A;  2CBJ A;  3PDY A;  4LMJ A;  2A2F X;  3KBT A;  1HNW T;  4LF6 T;  3FZF B;  4JYA T;  2HPL A;  5FXW A;  4ISS A;  1FIO A;  2V5C A;  2DHR A;  1ZV4 X;  2ZM2 A;  4H9S E;  3PUR A;  3P4R A;  3ZMS B;  2BVL A;  1ZKE A;  3UFE A;  1UCU A;  2WCA A;  3CVR A;  2X51 A;  5AQI B;  2NWB A;  2VL0 A;  3TLW A;  5JDF A;  2VWA A;  4HWF A;  1DU2 A;  1MIY A;  3UQ4 A;  4EED A;  5DQW A;  2K48 A;  2BG9 C;  3ZCJ A;  1ZEE A;  3HA4 A;  3N2O A;  4IIJ E;  4X62 T;  4DR7 T;  4JI7 T;  3AXJ A;  1ZHC A;  5FXX A;  2QYW A;  3KV5 A;  5HEO A;  4E7Z A;  5L3F B;  5C2T A;  2UXC T;  3PUZ F;  3UU6 A;  4WNK A;  2LT3 A;  2YN6 A;  2KT9 A;  2LKH A;  2CMR A;  3PU3 A;  4AQF A;  2ZMA A;  1OED C;  2FJA A;  4ZHQ E;  3PE0 A;  2I59 A;  3TLV A;  5L4E A;  3KV9 A;  4DR5 T;  3V5S A;  3AA0 B;  2XQ6 A;  3RQW A;  2X66 A;  2EHO B;  2LSK A;  1HNX T;  3FXD B;  4H9R C;  4IE5 A;  2CEA A;  2W62 A;  2QRX A;  1W0A A;  2UUC T;  4YSX A;  3I1A A;  1VRB A;  3ZMT B;  2VKO A;  3ZT7 A;  1WYB A;  4UEL A;  4P0A A;  4UV8 B;  4UVC B;  4BJN A;  4GOU A;  3F31 A;  4JI2 T;  1XZY A;  4DR3 T;  1HG2 A;  3J9X 1;  2UU9 T;  2HH7 A;  3O1H A;  4CN6 A;  3FBL A;  4TNW A;  5FNV E;  4H63 H;  4YJ3 E;  3VR8 A;  3C64 A;  2UXB T;  2LOS A;  2CPT A;  1FMV A;  3FZL B;  4TWD A;  1NEN A;  3CPZ A;  4HFI A;  2CBI A;  2WDV A;  5FVK A;  3RC8 A;  3RYF E;  2QGS A;  3QUJ A;  2XAQ B;  4IL9 A;  4ZXL A;  2EHO C;  1JNR A;  2J47 A;  1VCS A;  4AXP A;  2Z6E A;  3QOF A;  3LSV A;  4FJO A;  3LBX B;  3Q5W A;  2J4G A;  1HCI A;  5IHY A;  1N33 T;  4PJL A;  1W0B A;  4DBR A;  3AEC A;  3BQL A;  3O1J A;  2NP9 A;  4E7S A;  5LCY A;  1Z0P A;  5LGN B;  2E9X A;  2D5U A;  3KV4 A;  2E2A A;  4H9O C;  3PJA A;  4IL4 A;  4DV7 T;  2YU2 A;  1YQ3 A;  2W63 A;  2JQQ A;  2LSG A;  4TV8 E;  4KMC A;  1I94 T;  1EZ3 A;  5L3E B;  3RH3 A;  2XHE B;  3HKB E;  5J0Z A;  3HKC E;  2WZH A;  3JCF A;  2KLQ A;  4DV0 T;  3FZK B;  3AA6 B;  4TN7 B;  4OX9 T;  2V7M A;  3IA3 A;  5ETW A;  5HEG A;  5JRC B;  5J1G A;  1S35 A;  3ZJ1 A;  3K1S A;  1HX8 A;  4WYV A;  1LRZ A;  1B7T A;  4GYS A;  3RYI E;  2LSI A;  2OA5 A;  4PK6 A;  1BR2 A;  2N9D A;  2XAS B;  2RPA A;  2D0U A;  3C4X A;  4TWF A;  2BKO A;  3E22 E;  2PBI A;  4C91 A;  1XMQ T;  5L4H A;  5JDH A;  5AQS B;  4HFD A;  3SFE A;  4CXX A;  3CX7 B;  2V6Y B;  3E08 A;  2CHN A;  4X1Y E;  2X0Y A;  1HG5 A;  4CXW A;  3ZMU B;  4YTM A;  4U7I A;  1U4Q A;  5H6R B;  3AEG A;  3Q5E A;  4JI0 T;  3VHL A;  2LHR A;  1WR0 A;  2BBH A;  5LHI B;  1IBL T;  3D0T A;  3ZCI A;  3K3O A;  2K9A A;  1Y01 A;  2VKH A;  1N36 T;  4CXY A;  4AQY T;  1UUR A;  4MHC A;  1WR6 A;  5FY0 A;  4KHZ F;  3ZMV B;  1AJ3 A;  4EEB A;  4X5T A;  1W9R A;  4QX8 B;  1ZP0 A;  3B13 A;  4ILU A;  3OYZ A;  3N9M A;  3VKH A;  2Y6X A;  4TNV A;  5JDN A;  5HEU A;  1UK5 A;  4QH4 A;  5FVL A;  4DR6 T;  3DTO A;  4BJM A;  2X68 A;  2OLT A;  3CQX C;  4IE7 A;  4Z91 A;  1D1C A;  2XQY A;  4ASK A;  2EHO D;  4I4T E;  2CA5 A;  3PUG A;  2BS3 A;  4ILC A;  5C8Y E;  3ANW B;  2C0S A;  3ZKR A;  3CX8 B;  3PTR B;  1E7P A;  4UR9 A;  3AEA A;  3L09 A;  2V7K A;  3OYX A;  3LK4 2;  4OFZ A;  3ANW A;  1X9B A;  2M6I A;  4UF0 B;  1ZOY A;  2NTX A;  4F6R C;  5JR9 B;  2ZLY A; 
#chains in the Genus database with same CATH homology
 2VL0 A;  3TLW A;  3RI5 A;  3TLS A;  3EHZ A;  3EI0 A;  3TLT A;  2MAW A;  3UQ4 A;  1OED E;  2BG9 C;  4LMK A;  2BG9 B;  3UU8 A;  3EAM A;  3TLU A;  5CFB A;  4HFB A;  2M6B A;  5J0Z A;  2XQ7 A;  4X5T A;  5HEJ A;  4COF A;  3RIA A;  3UU5 A;  2BG9 A;  4IRE A;  3UUB A;  5HCM A;  2YOE A;  3UQ7 A;  5HCJ A;  4TNV A;  4TNW A;  5HEU A;  5HEO A;  4ILA A;  3JAF A;  4QH4 A;  5HEG A;  3RIF A;  5L47 A;  2LLY A;  4NPP A;  4TWD A;  2XQ8 A;  3JAE A;  2XQA A;  2XQ3 A;  4ILB A;  4HFI A;  4Z91 A;  4F8H A;  4Z90 A;  3UU6 A;  4TWH A;  2YN6 A;  4ZZB A;  3P50 A;  4A97 A;  2BG9 E;  2LKH A;  3UU3 A;  4IL9 A;  2XQ4 A;  4A98 A;  4QH5 A;  1OED C;  3LSV A;  4TWF A;  1OED B;  2KSR A;  4ILC A;  2XQ5 A;  5L4H A;  4ZZC A;  3UU4 A;  4HFD A;  4LMJ A;  3TLV A;  3RHW A;  5L4E A;  3ZKR A;  5HEH A;  5LG3 A;  4HFH A;  2LM2 A;  3RQU A;  2XQ6 A;  5IUX A;  1OED A;  3RQW A;  3JAD A;  2LKG A;  3P4W A;  4HFE A;  2M6I A;  4LML A;  2YKS A;  2XQ9 A;  4IL4 A;  4QH1 A;  4HFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...