1OEYJ

Heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
HMTNWLRVYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 2
publication title Pb1 Domain-Mediated Heterodimerization in Nadph Oxidase and Signaling Complexes of Atypical Protein Kinase C with Par6 and P62
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 105
sequence length 105
chains with identical sequence K, L, M
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1oeyJ00
3TBLD 4F1SA 3L13A 2LASA 1WE7A 3QWZB 5KHOA 4M0WB 1WE6A 4ICVA 1J8CA 2N4FA 3QA8A 1J19A 4FHKA 1WZ3A 1V5OA 2M0XA 4IM2A 2N9XA 2LGXA 3VQIA 2LXAA 3V61A 3R66C 2A4ZA 4K7UA 2BKFA 2KKCA 2KN5A 4MGIE 4AWJA 4IWOA 4I6LB 1Q1OA 2MX2A 1WM2A 2AYOB 2IZVB 1WXAA 2MLBA 4G50A 5E6PA 4HCPB 4K7WA 2KDBA 2DYBA 1R4MI 2JT4B 4GSWA 1V2YA 2RSUA 4IM0A 1S1QB 3SD5A 2MW5A 3OJ3A 4FN2A 4GIVA 3QK0A 3VHTC 4AP4C 3VUYA 2GBMA 5L83A 4GDLA 5G55A 2KWVB 4AUQC 1GNUA 3Q3FA 4B9KA 2L05A 1EUVB 4N9F4 1WH3A 4JL9A 3SHQA 2NBWB 3H7SA 4MELA 2M8SA 1YJ1A 3ML8A 4MEMA 5CHVC 1F9JA 1UZXB 4W9HA 4KDIC 3V62A 3M3JA 1BT0A 3UIPB 4HVBA 3EECA 1HE8A 3V6CB 3CF6E 2KJRA 3KYCD 1WIAA 2EMTA 2MRPA 4BKTA 5TR5A 2LGYA 2KFKB 4W9DA 4GDKA 3PTFC 3AI5A 3NY5A 3QQ8B 1SGHA 4ASWC 3ZIMA 2BYVE 3B1LX 1G6JA 3IG3A 4HPLB 2KDFB 2KZRA 2L0TA 2L76A 1EF5A 2REXA 3PSEB 5C23A 3VH3B 2WWZA 4EOYA 3RYTA 5FR6A 3OAWA 2O6VA 1SIFA 2ZEQA 1V81A 4NJ6A 4K81A 1X1MA 4K1RB 2KK8A 3A9KB 1K8RB 3W1YA 3DVNU 3HK0A 1VD2A 1NDDA 2K8BA 5EDSA 5JH5C 2KTRA 5IA7A 2ZCBA 5LLIA 3UGBB 4DWFA 2K25A 2JUOA 1S3SG 4GMVA 3A4SC 4J6IA 3TJPA 2G4DB 5E6NA 3VAWA 3ZW3A 3V60A 2FUHB 2N7EA 4EZKA 5KHQA 2ZPNA 3KYDD 2KFKA 2O6VD 3DCGA 4DHZB 4LDTB 2ZNVC 3EFUA 4A3OA 4BFRA 1WR1A 2RGFA 3PLUA 2FIFA 4MGYE 2K6QA 2L00B 4TV3A 4XC2A 5AZFA 2IO1B 3KH0A 2WYQA 4W9FA 5C1ZA 2CHZA 2DYMA 1OEYJ 2J0KA 2NVUI 4ANUA 1M94A 4ANVA 3R7RA 3WIMA 3SDLC 2BPSA 2PJHA 2KLCA 2JPHA 2KOXA 4IUMB 3DPDA 4WJQA 3WAMA 5AEKB 4WWNA 4ZYNA 5D6JB 3N30A 3R7QA 2Z0EB 4DXAB 3B0AA 2CS4A 3NOBA 3OJ4B 3VUXA 2GOWA 3APCA 2V3SA 1WGHA 1UGMA 1WX9A 3A1QB 3DBLI 3ZNZB 4FA6A 2MBBB 2IO0B 3PT2B 3PVLA 4JGHB 1WMHA 4KSKC 1YX5B 4IG7B 2JF5A 2BWFA 2KWUB 2I1KA 1E8XA 3ZNHB 4A3PA 3NZUA 4BKSA 1TGZB 2O2VA 2L3ZA 3KUZA 3APFA 4DDID 4EFOA 4TQ1A 2HE7A 2W9NA 2JXXA 5AZGA 1WX7A 2JZZA 4KV2A 5GMVA 1LM8B 4ZRIA 3MHSD 1WY8A 4XZ4A 3AXCA 1RFAA 1TBEA 3O65B 3AULA 2MBQA 3HHMA 2L0FA 4MJSA 2KHWB 2AWTA 2NS5A 1U4AA 5J18A 1WGYA 2KD0A 2DZMA 4IC7B 3R3MA 4MSMB 2CHXA 4KVGB 4BKSD 4MH0E 4W9KA 4FBJB 5JZEB 1E7UA 2J0JA 1XQQA 2K8HA 3A1QA 2A5UA 4GOCA 2DX5B 4MM3A 5D2MB 2GBKA 4URKA 3EC8A 4NQLB 1XT9B 3A4RA 2FCMA 2LXCA 1L7YA 4PS8A 3WAOA 3QJZA 3PRMB 2PE9A 2Z59B 2RR9A 3H1UA 2DZJA 2GBJA 3DVGY 2BYFA 2LRWA 3A33B 2KLGA 3IFWB 2DYOA 4KDLB 2LVOA 5J2RA 4HWIB 3RZWC 2BGFA 1LQBA 1WGRA 2JVCA 4ANXA 2G3QB 4DDGD 2DHZA 5J17A 2KJHB 1ZW7A 1WZ0A 2BYEA 2NBVB 4GN1A 2RD0A 4CYEA 2UYZB 3L10B 2IO2B 4BKGA 3JSVB 3MJWA 3PREA 1KJTA 2IY1B 3NHEB 3APDA 3P2BA 2LWPA 1UELA 2AL3A 3B08A 2KQSA 1L2NA 3LJ3A 2MWSB 2C7MB 3CSFA 3PHXB 3HM6X 4JLCA 2DZKA 2YLMA 2D11A 5E6OA 2N7DA 1RRBA 1YQBA 4I6PA 2R2QA 3L16A 3UINB 2G4SA 1GG3A 2C9WB 2KMCA 4W9LA 2YVCA 1TZ1A 3PHWB 2LI5A 1KOTA 2HD5B 3TMPB 2ZCCA 3U8ZA 4KZCA 1KLVA 1WYWB 2B3AA 2KC1A 3VFKA 4M8MA 2FCNA 4G0NB 1IYFA 4W9JA 3GZNI 3U7DA 4YL8A 1GJZA 1WGGA 1V9JA 4HPMB 1V5TA 3RCZA 3ML9A 1UH6A 4W9GA 2N1WA 3DVNV 2CHWA 4HDOA 3C0RB 3KW5B 2ASQA 2G45B 2LVQA 2LZ6A 4ANWA 2PEAA 3ZTDA 3RZFA 4GXBA 2JRHA 1Y8RC 4HDQA 4IWPA 2XK5B 3ZO5B 2KQ7A 3JYUA 4MDKE 3W1SA 5BO4B 3X0WA 4NAWB 1P1AA 4ZRJA 5JHAA 5HKHA 4II2B 2IO3B 3L17A 1Z2MA 4G11A 3VTWA 1WM3A 3A9KA 2FAZA 4ICUA 4G3XB 3ZRCA 2C7HA 4NPNA 3PRZA 2MP2B 4IW0A 5DPRA 4GU2A 2BF8B 2LJ5A 2OOBB 1ZKHA 2BWES 2KJ6A 2N9EB 3H7PB 3UQBA 4HXDA 1D3ZA 2FIDA 2EKEC 3VDZA 4LJPB 1T0YA 4W9CA 3L08A 4GB9A 1YIWA 2J0MA 4WQOB 3DDCB 3ECIA 5AZHA 2M1MA 3PZDA 2FNJB 2FCSA 4M8NA 4KIKB 3PPAA 2K8CA 3PV1A 5DPSA 4K7SA 1WJNA 4PYZA 3M62B 4RMAA 4MGKE 2XK5A 4B6WA 5DCNA 4EZLA 2NCNA 3VTUA 3VH4B 4OVUA 3H6NA 4TUUA 1OTRB 4MSQB 3VTVA 4LJOB 4BOSC 3AU4A 1RAXA 3ENEA 3ZLZA 4FJVB 2C5LC 4E74A 3W1SC 3KUDB 4W9IA 1GUAB 4WJNA 4F8CB 2V4LA 3KVFB 4EEWA 1P3QU 4LDTD 3S2AA 1J0GA 2OJRA 4NY0A 1QZEA 2M4NA 1WJUA 4WWPA 4BBNC 2R2OA 2NR2A 3BY4B 2KNBA 3QC8B 2KX3A 3DVGX 3CMMB 4WAAA 1RLFA 1YD8U 1LFDA 4NNJB 3K9OB 2UWQA 3NS8A 3QCAA 1YX6B 2KXJA 5CHWA 4FLHA 1FXTB 3PGEA 2L7RA 3QIJA 4BOZB 1E90A 2CR5A 2HTHA 3JVZX 4I6NB 1WXVA 4BBNF 4KIKA 3ZVVA 1UBQA 2WX1A 1GC7A 2ZJDA 2MSED 4TKNA 1V6EA 2ZNVB 2MBEA 2PPHA 4ZRKA 1I42A 2LRUA 4HK2A 4NQKE 2XBBC 4GDKB 4WWOA 3RULA 4WJOA 2D2QA 3EHVA 1I35A 4HCNB 2LGDA 3PLVA 3H9DA 2D10A 1NI2A 2ZVOA 4RM9A 4LCDE 4DHJB 2AEHA 2ZVNA 3QARA 3QHTA 4JQWC 3UQAA 2KDEB 2KDIA 2N9PC 2MBOA 5CTRC 1V49A 2WX0A 5D7GA 2O6VB 1VCBA 3WANA 2I1JA 3DBSA 2D07B 3RUIB 3VUWA 1Z5SB 2GBRA 2RPQA 3K9PB 3TCAA 1TTNA 4AJYB 3N3KB 3OLMD 3IVFA 4AJWA 2C60A 2DAFA 2CU1A 2N1VA 4F7ZA 1UD7A 2KTRB 2KMAA 1EF1A 5LXIB 3IHPC 4CO7A 1C1YB 2Z0DB 1XD3B 4FADA 1GC6A 1JRUA 2GMIC 4PS3A 4IM3A 3V6EB 3WA0A 4DBGA 3JW0X 1P98A 4E3CA 4DHZE 1EO6A 2AL6A 3Q3JA 1PQSA 2K39A 2ZZPB 3QX1A 1WJ4A 4PYUA 2NPTB 4FJYA 3DBRI 1E8YA 3UF8A 2CKHB 2JWZA 3JSVA 1R4NI 1OQYA 3A9JB 3DBHI 3X23A 1Q0WB 2DAJA 4DK5A 4P7IA 4MGZE 3ZNID 3RD2A 1UBIA 3ZUNA 3ALBA 1Q5WB 3TIXA 3CSTA 4JIOU 2BKRB 2NBUA 2D3GA 2Y5BB 3N32A 4W9EA 2KVRA 2LD9A 4II3B 4X57B 1H4RA 3AU5A 2EMSA 2GBNA 2PE6B 3IBEA 4A20A 5LXHA 1E8WA 3ZKJC 1MG8A 5IAAC 1A5RA 1WRDB 4DHJD 4OVVA 5L95C 4HLEA 1WX8A 2KTFA 1AARA 4B95A 4XX5A 3NZSA 1IPGA 4EKUA 1KM7A 1NBFC 1SE9A 2MCNB 3DQVA 2HJ8A 3ZDMC 3U30A 3PS6A 3ZNGC 2DZIA 1WMHB 3UIOB 3GOEA 3VVWB 4PS7A 1WF9A 2NPTA 2WDTB 2DENB 4AOFA 4BVUC 5JHBA 2O2VB 1WI0A 2MQJA 2K6DB 3HIZA 2KFJA 1IP9A 2KO3A 4GGQA 1P0RA 2FCQA 5CX3A 3BINA 3A9JA 4EUTA 1WXSA 4FJZA 2JZ3B 5DPTA 3ONSA 2IBIB 1ISNA 4WJPA 5D94A 4EZJA 2V1YA 1OGWA 3VXWA 1WXMA 5CHFA 3SU8X 5G2NA 3T8MA 1E7VA 4FHJA 5DPWA 1ZGUB 1WGDA 3ZRFA 3T9LA 4TQ0A 2VRRB 4MJSB 4CHKA 3HM3A 2K1FA 3PRPB 4NJ7A 2MBHA 2KC2A 4FULA 3LDZE 4NAWA 4ZDVA 1C3TA 2KWCA 2KANA 1H8CA 1WJ6A 2L8JA 1E5WA 1WFYA 1E8ZA 2J7QB 2KX0A 3D32A 3WAPA 2IYDB 2JRIB 3KUCB 1V80A 2ZPYA 1P9DU 2M17A 3L0WB 3L54A 4HJKA 3M63B 2MA9B 3M95A 2MP2A 3MTNB 3RT3B 4KSLC 3TL5A 4KZ0A 4RM8A 3ZTCA 2JY6A 3DOWA 1WR6E 1OEYA 2LUEA 1CMXB 3ZDTA 3H7PA 1LXDA 3QAQA 4GDLB 4E71A 2IY0B 2LVPA 2C7NB 2QHOA 3WALA 4IWQA 2XEWA 1V86A 3I3TB
chains in the Genus database with same CATH superfamily
3QWZB 5KHOA 4M0WB 1HTQA 1T5XD 1J8CA 5GXGB 1FD6A 4FHKA 1V5OA 4IM2A 4ZHOA 3VQIA 3UI3A 3R66C 3J9CA 1AN8A 2WQYB 3R2TA 4XWTA 1MI0A 4I6LB 2RMMA 1Q1OA 1C4CA 1UGJA 2RSUA 1S1QB 3OJ3A 1HEZE 3WCQA 4AP4C 3VUYA 2GBMA 2BTEA 1E0ZA 5G55A 2KWVB 3Q3FA 1BMLC 4LK0M 2BS4B 1PGXA 1YJ1A 4MEMA 1GB4A 1F9JA 1UZXB 4W9HA 2K9XA 4HVBA 1HE8A 1J7CA 4YSYB 1WIAA 1TY0A 1SGHA 2K3UA 3ZIMA 2BYVE 1G6JA 4L2YA 1UNSA 1HZ5A 4EOYA 2JSVX 1RM6C 2ZW0A 3FILA 2ZEQA 1X1MA 2KK8A 3DVNU 1PGAA 5EDSA 1MHXA 1FFVA 2JUOA 3RI7C 3A4SC 4BZAA 3V60A 3MC0B 2CU3A 4LLGM 1I4PA 3ZJTA 4DHZB 4LDTB 3AM9A 3EFUA 2L1AA 2RGFA 3BIID 4ACFA 2FIFA 2L00B 3BVMA 4TV3A 2IO1B 2WYQA 2M19A 2CHZA 3RPFC 2B76B 1JWMD 1FEHA 4WJQA 3DPDA 2N0SB 4WWNA 4ZYNA 2J4XA 3R7QA 1EM7A 3AE7B 3NOBA 1WGKA 2QEJC 2GOWA 3Q69A 3A1QB 2N9KA 2WGSA 2MBBB 2LFIA 5EE3A 4WAFA 2WP9B 3NVVA 1WMHA 2BB5A 2JF5A 1JWSD 1E8XA 3ZNHB 1F0ZA 4BKSA 2L3ZA 4DDID 4EFOA 2W9NA 4A8XC 1L4ZB 1NYRA 4IKGA 5IOIA 4KV2A 5GMVA 4ZRIA 2MBQA 3P4QB 3HHMA 2L0FA 2NS5A 1U4AA 1DOXA 1VZ7A 4KGRA 1KLGD 1PDXA 4D2KA 2K8HA 1XQQA 2DX5B 3PO0A 4NQLB 2KMMA 1XT9B 1D5MC 3EUB2 3WAOA 1YN4A 2PE9A 2RR9A 3H1UA 1GAQB 2DZJA 2GBJA 1P7EA 2LHDA 2LVOA 2IGDA 2BGFA 1LQBA 4HJGE 4C4VB 4XDDA 1TT5B 1WZ0A 4GN1A 2RD0A 2IO2B 3T3OA 3PREA 3GZNB 3SFEB 2I2YA 1ESFA 3AEAB 3PHXB 3HRDD 2SEBD 4NZLB 5E6OA 3L16A 4KKIA 1I4GA 1ZP0B 1GG3A 1L4DB 3AE1B 2LI5A 1KOTA 4OZAA 5IP4D 1JALA 1YQ4B 1FPYA 1IYFA 1GJZA 4HPMB 4LNOA 4PT5A 1T0RC 2N1WA 3DVNV 2ASQA 2G45B 2LVQA 2LZ6A 4OZCA 1Y8RC 4IWPA 1YNTE 2XK5B 1JQ4A 5JXVA 3X0WA 4YSXB 3CIRB 2E3TA 2VH1A 5HKHA 1XF5L 2K22A 3A9KA 1K53A 3ZRCA 2C7HA 4NPNA 3PRZA 4RGTA 3KWLA 1LO5D 2N9EB 3H7PB 4WIPA 3NVYA 3ETRA 4W9CA 3NVZA 2NTSA 3L08A 2WDQB 3PZDA 1ZXHA 2AQ3B 3PPAA 5DPSA 3N20C 4K7SA 5DCNA 3AH7A 1SE2A 4RF0A 4EZLA 3AECB 3H6NA 5EE0A 3VTVA 3FC4A 4LTUA 3DWGC 4FJVB 4E74A 3IT6B 3Q8AA 4W9IA 1V1PA 2L32A 2OJRA 3URYA 2M4NA 1WJUA 3QC8B 4WAAA 1RLFA 1ZXIA 3K9OB 3NS8A 3QCAA 3E9SA 2L7RA 4BOZB 1FO4A 3ZQ4A 3JVZX 1RFKA 1SB3C 2MSED 4C7YA 1I42A 1FNUA 2I38A 2AQ2B 4NQKE 4WWOA 4HCNB 3LYYA 4LNKA 4DHJB 3DBRB 4BAXA 4P6VF 3QHTA 1ZDVA 4JQWC 2KDEB 5D7GA 2N9PC 2WX0A 3WANA 1WSPA 4AJYB 1JCKB 3OLMD 3IVFA 5H8YE 4K3CA 2PTLA 4H2AA 3GP7A 3IHPC 4CO7A 1XD3B 2GMIC 2Q5WD 3P4PB 4OW0A 1C77A 4DHZE 2ZW1A 1MJDA 1JRPA 3DWMA 4NAMA 2NPTB 4YSZB 1QILA 4JIOU 2Y5BB 3MC9A 2WXHA 4X57B 1H4RA 2PE6B 5IN7A 5LXHA 3P1MA 2R61A 4MT5A 1WRDB 1QLBB 4XX5A 2JYEA 5LNK1 2HJ8A 2KDMA 4P1BC 2CJNA 3U30A 1FNVA 5HI1A 1WMHB 3NRZA 2LGIA 3CWIA 3GOEA 3VVWB 2ICIA 1V97A 3HIZA 3A9JA 1VJKA 4A6QA 2JZ3B 2IBIB 3C8YA 3T3NA 1RWSA 5D94A 4HROA 1IBXA 2V1YA 3SU8X 3T8MA 1E7VA 4MACA 3I57A 1XLNA 4TQ0A 2VRRB 3HM3A 2MBHA 4NAWA 1EU3A 4ZYSA 1H8CA 1E5WA 1E8ZA 2KX0A 1KTKA 2ZPYA 1P9DU 3L0WB 4JE3B 3DOWA 1OEYA 1N62A 2GRIA 4R3DA 4XDCA 4IWQA 1DGJA 3GE8C 1IUEA 3L13A 1WE7A 4ZOHC 2WDVB 2HDEA 2QCZA 4ICVA 1J19A 1STEA 2LXAA 2A4ZA 2VH2A 2MHJA 4IWOA 2WU2B 1JMLA 2MX2A 1HZ6A 1QOAA 1OQQA 2IZVB 2MLBA 5E6PA 4HCPB 4Q2JA 4K7WA 2KDBA 2JT4B 1R4MI 4GSWA 2MW5A 1TY2A 4FN2A 4GIVA 3QK0A 4B9KA 4JL9A 4KDIC 3P4RB 3CF6E 3KYCD 4TSSA 2MRPA 1EWCA 2DWQA 2J42A 3QQ8B 3OWEB 1FNWA 2KZRA 2REXA 5C23A 3R2IA 3RN9C 4NJ6A 1V81A 1JW9D 2V3NA 1FMAD 1YJJA 3A9KB 1K8RB 1D6EC 1YJIA 1NDDA 4JX1C 2ZCBA 2BT6A 3TJPA 4J6IA 5E6NA 2N7EA 4LNFA 2KFKA 2O6VD 2ZNVC 1WR1A 4MGYE 2K6QA 4XC2A 4ZRQA 2DYMA 3AE4B 3Q14C 2KVZA 2JU6X 2NVUI 3L4PA 3R7RA 3WIMA 2BPSA 2KLCA 2JPHA 3EA6A 5T8IA 1PFDA 3VRBB 1D5XC 1V1PB 4US9A 4S17A 5EE9A 1SSNA 3OJ4B 3VUXA 1ENFA 4WH4A 2YEPB 2V3SA 1WGHA 4JWSC 1WX9A 4RGMA 3PZ8A 2I1KA 2N9LA 3NZUA 1A70A 4TQ1A 4YXDB 2H88B 1K50A 2BYTA 1LM8B 3MHSD 2G1EA 3AXCA 2KN4A 3O65B 2KHWB 4MH8A 3RNGC 5HHDG 5J18A 2DZMA 3R3MA 2QC8A 3BZDB 4MH0E 1E7UA 4MM3A 2GBKA 5I4DA 1OQRA 1L7YA 4PS8A 2L52A 3EGRA 3QJZA 2WXFA 1SXTA 3DVGY 5AUIA 2BYFA 3A33B 2KLGA 2XNAC 3IFWB 2VZKD 5J2RA 4HWIB 3AE2B 4ANXA 2G3QB 4DDGD 1PUTA 2DHZA 5HG2A 1E6EB 2WXKA 4BKGA 3MJWA 1JWAD 4HRSA 2N7JA 1M4VA 3NHEB 2LWPA 3B08A 3AB5A 2D11A 2N7DA 1RRBA 2ON8A 2R2QA 4C80A 2J53A 2INPE 2C9WB 5BYQA 2YVCA 2HD5B 2ZCCA 1KLVA 3H8HA 1WYWB 1UWMA 2KC1A 3VFKA 4G0NB 5G5GA 2MJDA 5D3DA 3DBLB 1V5TA 3W2DA 2V9HA 3ZJVA 4L1BA 1UH6A 1IBXB 4ANWA 3RZFA 2JRHA 4HDQA 3HVZA 3GS2A 2W82A 3JYUA 4NAWB 2X38A 2X8XX 1K52A 2FAZA 4ZHPA 5DPRA 2BF8B 1HXYD 2LJ5A 4HKZE 2BWES 2K0PA 2V4IB 4ARCA 1SF0A 1D3ZA 3VDZA 3Q8BA 3NG0A 1N60A 1YIWA 4WQOB 5AZHA 4CQNA 4M8NA 4KIKB 3PV1A 1WJNA 1C76A 3BVGA 4B6WA 2NCNA 1YN3A 4OVUA 1KH0A 1VR9A 3FKYA 1OTRB 1RAXA 3W5UB 4B0MA 4WJNA 2HTME 1F2RC 2V4LA 2IDYA 1J0GA 1L0VB 3I9V1 2R2OA 3DVGX 4DXGA 1YD8U 1HTOA 1E90A 4RH6A 4I6NB 2WXOA 1UBQA 4RFBA 2WX1A 1GC7A 4TKNA 3ZYYX 2RPVA 2MBEA 4ZRKA 4WQMA 2LRUA 3AEDB 1I4QA 4WJOA 3EHVA 4DXFA 3H9DA 2D10A 4RM9A 1T0SC 2AEHA 1B1ZA 3DHGC 3QARA 2INDC 1UWXA 2KDIA 1TKGA 1V8CA 4P16A 1VCBA 3DBSA 2D07B 3TCAA 3N1ZC 3N3KB 2INCC 2N1VA 1CJEA 4F7ZA 4KKJA 1EF1A 1LGRA 5LXIB 4FXCA 3VRAB 4IM3A 1DOYA 2G9HD 3JW0X 3U52E 1EO6A 2AL6A 2QILA 3B2FA 2ZZPB 3QX1A 2WDRB 3KQ4A 1XCQL 4PYUA 4REZA 1SEBD 2INNE 3JSVA 1FCCC 3RMKC 1OQYA 3DBHI 4US8A 3RNBC 3Q3OC 1KFYB 1BXTA 2BKRB 2W3SA 2D3GA 2LD9A 3AU5A 2EMSA 2GBNA 2Y5CA 4IDIA 3ZKJC 1MG8A 3AN1A 4XYCA 4DHJD 4B95A 2TSSA 3NZSA 1IPGA 1NBFC 5IKCM 1TS5A 3DQVA 4HKQA 3C19A 2LJIA 4PS7A 1TKEA 1V1OA 2EKIA 2WDTB 2DENB 4BVUC 1WI0A 2JQRB 2KO3A 4GGQA 1P0RA 2FCQA 1C78A 1FM0D 1WXSA 5DPTA 1ISNA 3AE9B 4EZJA 2LHEA 5CHFA 3I5JC 3RNFC 1AWDA 1WGDA 2CJOA 2HJ1A 3PRPB 2K1FA 4KGTA 2KC2A 3FAHA 3LDZE 1YN5A 2KANA 2J7QB 2GB1A 3D32A 3WAPA 2JRIB 3KUCB 2M17A 3M63B 2MA9B 3M95A 1XEEA 1R4MB 1WR6E 3ZDTA 1LXDA 2LVPA 5BMHA 2XEWA 1V86A 3TBLD 2JXTA 1WE6A 3ZXVA 2PLPA 1YOVB 2L83A 2N4FA 3QA8A 2M0XA 3ZGZA 2FBWB 1K51A 2BKFA 2KKCA 1FXAA 1E9MA 2AYOB 1WXAA 2DYBA 3SD5A 3EFCA 3VHTC 3FILB 4GDLA 4A9AA 3W5VB 4AUQC 3KWVA 1GNUA 2L05A 1EUVB 4N9F4 1WH3A 3SHQA 2M8SA 2WXGA 2IGHA 3M3JA 3UIPB 3EECA 2KJRA 1QQRA 4BKTA 3P63A 4YTPB 4W9DA 2BB6A 4OVZA 1ZE3D 3LXFA 3B1LX 3HVDA 3IG3A 4HPLB 4P1CC 4A55A 4AQ7A 2L0TA 2L76A 3PSEB 3ZJUA 2PKOA 1AW7A 2WHIA 3RYTA 2O6VA 4KGSA 4N59A 1MPEA 3W1YA 3HK0A 1HA5A 2KTRA 5IA7A 5LLIA 3VAWA 3ZW3A 3B9JA 1BUIC 4S0RA 5KHQA 3DCGA 4A3OA 4XWWA 2OJWA 5AZFA 4YTMB 3O13A 4W9FA 5C1ZA 1XXGA 1OEYJ 4TMAB 2J0KA 2NMQA 4ANUA 1M94A 3IT4B 5HFYA 3TEYA 3SDLC 2PJHA 1F2RI 1NI3A 3WAMA 3BYYB 5AEKB 5D6JB 4IOIE 3N30A 4RCOA 1FRDA 4KX6B 1GB1A 3APCA 2W3RA 4USAA 1UGMA 4M02A 4FA6A 2PIAA 3SFDB 2IO0B 3MC8A 3PVLA 4JGHB 4IG7B 1QKZA 1TGZB 2O2VA 3APFA 1EU4A 3RNCC 1C9FA 1J7BA 2JXXA 5AZGA 1WX7A 2JZZA 3AMZA 4RGOS 4LNIA 1VLBA 1MG4A 1AYFA 1WY8A 4MJSA 2AWTA 4WURA 3VR8B 1PYWD 1Q10A 1FIQA 1ZPSA 2KD0A 4IC7B 4FBJB 1HQRD 4W9KA 2J0JA 4GOCA 3A1QA 1ROEA 2A5UA 5D2MB 3EC8A 3A4RA 2FCMA 3Q2AC 3LB8C 2LXCA 4M01A 3PRMB 1JROA 2Z59B 1FCLA 2LMCA 2DNFA 1QF6A 2WXJA 3I63C 2DYOA 1KRHA 1TYGB 3P4SB 4WWMA 1GPXA 1DYQA 2NBVB 2UYZB 3L10B 3JSVB 1KJTA 2IY1B 1UELA 2AL3A 2KQSA 1L2NA 3LJ3A 2C7MB 3OG5A 1D5ZC 1ET9A 4JLCA 2DZKA 2YLMA 1YQBA 4YT0B 3UINB 2G4SA 2QIEB 4W9LA 3PHWB 1TZ1A 4C4VA 3BK2A 3U8ZA 4KZCA 2FCNA 4W9JA 4UDUC 3U7DA 1CZPA 1IGCA 1V9JA 3ML9A 4W9GA 2CHWA 4HDOA 3KW5B 3MP9A 1T3QA 1SE3A 2PEAA 3ZTDA 4GXBA 3TEXA 1L0XB 2MJEA 3ZO5B 2KQ4X 2KQ7A 1P1AA 1R7SA 4II2B 3TSSA 1Z2MA 2GI9A 4G11A 3VTWA 4ICUA 1L0YB 4B0EA 1ZKHA 1QOBA 3UQBA 2EKEC 1D4BA 4AS1A 1TS4A 2J0MA 3GB1A 3DDCB 5BYSA 4RNAA 1ACCA 2IJ0A 2M1MA 4YTNB 2K8CA 1I4HA 4PYZA 4MGKE 2XK5A 4JWUC 4C7ZA 3N9YC 4LJOB 4BOSC 3AU4A 2NTTA 2W54A 3ZLZA 2H89B 3W1SC 3KUDB 4GLSC 1TIFA 1P3QU 4LDTD 1MFWA 3S2AA 4BBNC 3PZ7A 3BY4B 3CMMB 1VRAB 3NUHB 4NNJB 1L5PA 1YX6B 2KXJA 5CHWA 4FLHA 1FXTB 3PGEA 3AEEB 3QIJA 4BBNF 2ZJDA 3SR6A 1V6EA 2ZNVB 2PPHA 1SJED 1VDVA 4HK2A 2XBBC 1MHHE 3AE8B 2XN9C 1QOGA 2ZVNA 2GLSA 3N1YC 2DLBA 5CTRC 3DBHB 1V49A 4L23A 4DQOC 2O6VB 2OEDA 4HEA1 3HUIA 3K9PB 1I7HA 1TZOA 2C60A 2DAFA 2CU1A 4EE2A 3BYTB 1UD7A 2KTRB 2KMAA 1C1YB 2Z0DB 4K3BA 1GC6A 1JRUA 2WXLA 4N6EB 3V6EB 4DBGA 1P98A 3Q3JA 1PQSA 1T0QC 1JWBD 1WJ4A 2BS3B 1E8YA 3UF8A 2JWZA 1SJHD 1R4NI 2W55A 3A9JB 3X23A 1Q0WB 4P7IA 3U2SC 4MGZE 3ZNID 3RD2A 3ZUNA 2MH7A 1Q5WB 3ALBA 3TIXA 3TUOA 5C3JB 2NBUA 3N32A 4W9EA 3NZ3A 4II3B 3IBEA 3BK1A 1E8WA 5MPOA 4OVVA 5L95C 4HLEA 2DBYA 1AARA 4EKUA 3RNEC 1KM7A 1SE9A 1IGDA 1YMHE 1C4PA 3ZDMC 3U7ZA 2MEKA 3PS6A 2D5GA 3UIOB 2NPTA 4XGAB 5JHBA 1CK1A 2D3BA 2O2VB 2MQJA 2K6DB 1KLUD 5CX3A 4HPPA 1N63A 3ONSA 4WJPA 3RFZB 1OGWA 3VXWA 1WXMA 1XCTL 1XO3A 1L6UA 5DPWA 1WYGA 3E56A 2PVGC 3ZRFA 2WXQA 4MJSB 4NJ7A 3Q3MC 2WXMA 3AV8A 3NJTA 2VZKB 2D3AA 1WJ6A 2L8JA 1WFYA 4C56C 4RGNA 3L54A 4HJKA 3TL5A 2MP2A 5BMGA 4KZ0A 3ZTCA 2JY6A 1CMXB 2PVOD 3QAQA 2ONQA 2IY0B 2C7NB 2QHOA 4F1SA 2LASA 3U4EG 2BS2B 1WZ3A 2N9XA 2LGXA 3V61A 2JX5A 2KACA 4K7UA 2KN5A 4MGIE 4AWJA 3Q8FA 1WM2A 2RDHA 2IGGA 4G50A 1V2YA 4IM0A 1N6ZA 2JWUA 1NYQA 5L83A 3AEFB 2BBCA 3NVWA 2NBWB 3AE6B 3H7SA 1DOIA 4MELA 3ML8A 1SE4A 5CHVC 4ARIA 3V62A 1BT0A 3SEBA 2LUMA 3V6CB 2EMTA 2EELA 1YQ3B 2SAKA 5TR5A 2LGYA 2KFKB 2J52A 4GDKA 3MFGA 3PTFC 3AI5A 3NY5A 1I4XA 4ASWC 1JWUD 3IAM1 2KDFB 2D3CA 1EF5A 3VH3B 2WWZA 5FR6A 3OAWA 1SIFA 5IO9A 4K81A 2OHFA 1OFFA 4K1RB 2BW2A 3Q6BA 1VD2A 2K8BA 3RNAC 2WNMA 2JZPA 5JH5C 1XLPA 3UGBB 2Z8LA 4DWFA 2K25A 4GMVA 1S3SG 2Y3AA 2MJ3A 5EE1A 2M56B 2G4DB 4A90A 2FUHB 1XLOA 3B2GA 1WRIA 4EZKA 2ZPNA 3KYDD 1TKYA 4BFRA 3PLUA 4QAYA 3KH0A 2PMVA 3BVZA 3P42A 4ANVA 2JYTA 2KOXA 4IUMB 1T6BX 1Y56A 2WLBA 2Z0EB 4NJCA 4DXAB 3B0AA 2CS4A 1ZOYB 5TSSA 4MM3B 2V0GA 2V3PA 3DBLI 3ZNZB 3PT2B 1UF0A 3KLSX 1N5WA 2RDBC 4KSKC 1YX5B 3GE3C 3W9CB 2BWFA 2KWUB 1KF6B 4A3PA 3KUZA 2FUG1 2HE7A 1RYJA 4XZ4A 2E6XA 1RFAA 1TBEA 3AULA 1WGYA 4MSMB 4BKSD 2CHXA 4KVGB 4RF1A 5JZEB 4URKA 2IPKD 3ABVB 3TEWA 3AEBB 1PGBA 2LRWA 4KDLB 3RZWC 2JVCA 1WGRA 2KYWA 3N1XC 4M0WA 5J17A 2KJHB 1ZW7A 2BYEA 4M00A 4CYEA 1CQVA 3V3XA 3APDA 3P2BA 3MJ5A 2MWSB 3NS1A 3CSFA 3HM6X 4I6PA 2BQQA 2KMCA 1ZUD2 1VZ6A 3TMPB 3VR9B 1NEKB 2B3AA 4M8MA 3GZNI 4YL8A 2PW9A 1WGGA 5BYRA 3RCZA 1E10A 3C0RB 1QT9A 3MHZA 1N5XA 5BMIA 4MDKE 3W1SA 5BO4B 3BWUD 4ZRJA 2WU5B 5JHAA 2IO3B 3L17A 3R8BA 1FFUA 1WM3A 4G3XB 4N58A 2MP2B 1F52A 4IW0A 4GU2A 2OOBB 2KJ6A 3Q3NC 4HXDA 4XE0A 2FIDA 4LJPB 1T0YA 4GB9A 2WS3B 2WXRA 3ECIA 2KAJA 2KT7A 2FNJB 1WXQA 2FCSA 2K5PA 3AE5B 1UUPA 3M62B 4RMAA 3VTUA 3VH4B 4TUUA 4MSQB 1FXIA 3ENEA 2C5LC 5H92C 2FE8A 4F8CB 1GUAB 4J3OD 3KVFB 4EEWA 1QOFA 1J7AA 1C79A 4NY0A 1QZEA 4WWPA 2NR2A 2ACZB 2KNBA 2KX3A 1LFDA 2UWQA 5E6JA 3IXSA 5G5HA 5C2TB 4JPSA 2CR5A 2HTHA 2AQ1B 1WXVA 4KIKA 3ZVVA 4C00A 1I4RA 4PK1A 3Q8CA 2RDGA 2QJLA 4OZBA 5FR3A 3RULA 4GDKB 1I35A 2D2QA 1B9RA 2LGDA 3PLVA 2ZVOA 1NI2A 4LCDE 5D3IB 3Q8EA 3UQAA 1TS3A 1TS2A 1R4NB 5FK9C 5FKAC 5AUKA 2MBOA 4OHJA 2I1JA 1EWYC 3RUIB 3VUWA 2AX5A 1Z5SB 2GBRA 2RPQA 1TTNA 4AJWA 1FRRA 1MVKA 4FADA 1C4AA 4PS3A 4ZRPA 4ITKA 3WA0A 4E3CA 3ZXRA 2YEPF 2K39A 1F77A 4FJYA 3DBRI 2M0AA 1E7PB 2CKHB 1ET6A 1XLQA 2LGSA 2LEKA 2UU7A 2DAJA 4DK5A 1UBIA 1ZDXA 3CSTA 2KVRA 3AEGB 4A20A 4YWGG 5IAAC 3DHIC 1A5RA 1GOZA 1WX8A 2KTFA 3IAS1 2QDFA 2MCNB 3ZNGC 1SIJA 2DZIA 1P7FA 1WF9A 4AOFA 1NVID 2KWDA 2QSDA 2KFJA 1IP9A 1TJEA 3BINA 4EUTA 4FJZA 1F1HA 5G2NA 1N61A 2WXIA 4FHJA 1ZGUB 2WXPA 1NENB 3T9LA 4CHKA 3AE3B 3DHHC 2BVCA 4FULA 2QMTA 1C3TA 2KWCA 1VZ8A 4O1NA 2IYDB 1V80A 4ZDVA 3RT3B 3MTNB 2WXNA 4KSLC 4RM8A 1SBBB 2LUEA 3V05A 1WWTA 3TEZA 1L6VA 3H7PA 4GDLB 4LNNA 4E71A 3WALA 2Y5PA 3I3TB
chains in the Genus database with same CATH topology
3TBLD 4F1SA 3L13A 2LASA 1WE7A 3QWZB 5KHOA 4M0WB 1WE6A 4ICVA 1J8CA 2N4FA 3QA8A 1J19A 4FHKA 1WZ3A 1V5OA 2M0XA 4IM2A 2N9XA 2LGXA 3VQIA 2LXAA 3V61A 3R66C 2A4ZA 4K7UA 2BKFA 2KKCA 2KN5A 4MGIE 4AWJA 4IWOA 4I6LB 1Q1OA 2MX2A 1WM2A 2AYOB 2IZVB 1WXAA 2MLBA 4G50A 5E6PA 4HCPB 4K7WA 2KDBA 2DYBA 1R4MI 2JT4B 4GSWA 1V2YA 2RSUA 4IM0A 1S1QB 3SD5A 2MW5A 3OJ3A 4FN2A 4GIVA 3QK0A 3VHTC 4AP4C 3VUYA 2GBMA 5L83A 4GDLA 5G55A 2KWVB 4AUQC 1GNUA 3Q3FA 4B9KA 2L05A 1EUVB 4N9F4 1WH3A 4JL9A 3SHQA 2NBWB 3H7SA 4MELA 2M8SA 1YJ1A 3ML8A 4MEMA 5CHVC 1F9JA 1UZXB 4W9HA 4KDIC 3V62A 3M3JA 1BT0A 3UIPB 4HVBA 3EECA 1HE8A 3V6CB 3CF6E 2KJRA 3KYCD 1WIAA 2EMTA 2MRPA 4BKTA 5TR5A 2LGYA 2KFKB 4W9DA 4GDKA 3PTFC 3AI5A 3NY5A 3QQ8B 1SGHA 4ASWC 3ZIMA 2BYVE 3B1LX 1G6JA 3IG3A 4HPLB 2KDFB 2KZRA 2L0TA 2L76A 1EF5A 2REXA 3PSEB 5C23A 3VH3B 2WWZA 4EOYA 3RYTA 5FR6A 3OAWA 2O6VA 1SIFA 2ZEQA 1V81A 4NJ6A 4K81A 1X1MA 4K1RB 2KK8A 3A9KB 1K8RB 3W1YA 3DVNU 3HK0A 1VD2A 1NDDA 2K8BA 5EDSA 5JH5C 2KTRA 5IA7A 2ZCBA 5LLIA 3UGBB 4DWFA 2K25A 2JUOA 1S3SG 4GMVA 3A4SC 4J6IA 3TJPA 2G4DB 5E6NA 3VAWA 3ZW3A 3V60A 2FUHB 2N7EA 4EZKA 5KHQA 2ZPNA 3KYDD 2KFKA 2O6VD 3DCGA 4DHZB 4LDTB 2ZNVC 3EFUA 4A3OA 4BFRA 1WR1A 2RGFA 3PLUA 2FIFA 4MGYE 2K6QA 2L00B 4TV3A 4XC2A 5AZFA 2IO1B 3KH0A 2WYQA 4W9FA 5C1ZA 2CHZA 2DYMA 1OEYJ 2J0KA 2NVUI 4ANUA 1M94A 4ANVA 3R7RA 3WIMA 3SDLC 2BPSA 2PJHA 2KLCA 2JPHA 2KOXA 4IUMB 3DPDA 4WJQA 3WAMA 5AEKB 4WWNA 4ZYNA 5D6JB 3N30A 3R7QA 2Z0EB 4DXAB 3B0AA 2CS4A 3NOBA 3OJ4B 3VUXA 2GOWA 3APCA 2V3SA 1WGHA 1UGMA 1WX9A 3A1QB 3DBLI 3ZNZB 4FA6A 2MBBB 2IO0B 3PT2B 3PVLA 4JGHB 1WMHA 4KSKC 1YX5B 4IG7B 2JF5A 2BWFA 2KWUB 2I1KA 1E8XA 3ZNHB 4A3PA 3NZUA 4BKSA 1TGZB 2O2VA 2L3ZA 3KUZA 3APFA 4DDID 4EFOA 4TQ1A 2HE7A 2W9NA 2JXXA 5AZGA 1WX7A 2JZZA 4KV2A 5GMVA 1LM8B 4ZRIA 3MHSD 1WY8A 4XZ4A 3AXCA 1RFAA 1TBEA 3O65B 3AULA 2MBQA 3HHMA 2L0FA 4MJSA 2KHWB 2AWTA 2NS5A 1U4AA 5J18A 1WGYA 2KD0A 2DZMA 4IC7B 3R3MA 4MSMB 2CHXA 4KVGB 4BKSD 4MH0E 4W9KA 4FBJB 5JZEB 1E7UA 2J0JA 1XQQA 2K8HA 3A1QA 2A5UA 4GOCA 2DX5B 4MM3A 5D2MB 2GBKA 4URKA 3EC8A 4NQLB 1XT9B 3A4RA 2FCMA 2LXCA 1L7YA 4PS8A 3WAOA 3QJZA 3PRMB 2PE9A 2Z59B 2RR9A 3H1UA 2DZJA 2GBJA 3DVGY 2BYFA 2LRWA 3A33B 2KLGA 3IFWB 2DYOA 4KDLB 2LVOA 5J2RA 4HWIB 3RZWC 2BGFA 1LQBA 1WGRA 2JVCA 4ANXA 2G3QB 4DDGD 2DHZA 5J17A 2KJHB 1ZW7A 1WZ0A 2BYEA 2NBVB 4GN1A 2RD0A 4CYEA 2UYZB 3L10B 2IO2B 4BKGA 3JSVB 3MJWA 3PREA 1KJTA 2IY1B 3NHEB 3APDA 3P2BA 2LWPA 1UELA 2AL3A 3B08A 2KQSA 1L2NA 3LJ3A 2MWSB 2C7MB 3CSFA 3PHXB 3HM6X 4JLCA 2DZKA 2YLMA 2D11A 5E6OA 2N7DA 1RRBA 1YQBA 4I6PA 2R2QA 3L16A 3UINB 2G4SA 1GG3A 2C9WB 2KMCA 4W9LA 2YVCA 1TZ1A 3PHWB 2LI5A 1KOTA 2HD5B 3TMPB 2ZCCA 3U8ZA 4KZCA 1KLVA 1WYWB 2B3AA 2KC1A 3VFKA 4M8MA 2FCNA 4G0NB 1IYFA 4W9JA 3GZNI 3U7DA 4YL8A 1GJZA 1WGGA 1V9JA 4HPMB 1V5TA 3RCZA 3ML9A 1UH6A 4W9GA 2N1WA 3DVNV 2CHWA 4HDOA 3C0RB 3KW5B 2ASQA 2G45B 2LVQA 2LZ6A 4ANWA 2PEAA 3ZTDA 3RZFA 4GXBA 2JRHA 1Y8RC 4HDQA 4IWPA 2XK5B 3ZO5B 2KQ7A 3JYUA 4MDKE 3W1SA 5BO4B 3X0WA 4NAWB 1P1AA 4ZRJA 5JHAA 5HKHA 4II2B 2IO3B 3L17A 1Z2MA 4G11A 3VTWA 1WM3A 3A9KA 2FAZA 4ICUA 4G3XB 3ZRCA 2C7HA 4NPNA 3PRZA 2MP2B 4IW0A 5DPRA 4GU2A 2BF8B 2LJ5A 2OOBB 1ZKHA 2BWES 2KJ6A 2N9EB 3H7PB 3UQBA 4HXDA 1D3ZA 2FIDA 2EKEC 3VDZA 4LJPB 1T0YA 4W9CA 3L08A 4GB9A 1YIWA 2J0MA 4WQOB 3DDCB 3ECIA 5AZHA 2M1MA 3PZDA 2FNJB 2FCSA 4M8NA 4KIKB 3PPAA 2K8CA 3PV1A 5DPSA 4K7SA 1WJNA 4PYZA 3M62B 4RMAA 4MGKE 2XK5A 4B6WA 5DCNA 4EZLA 2NCNA 3VTUA 3VH4B 4OVUA 3H6NA 4TUUA 1OTRB 4MSQB 3VTVA 4LJOB 4BOSC 3AU4A 1RAXA 3ENEA 3ZLZA 4FJVB 2C5LC 4E74A 3W1SC 3KUDB 4W9IA 1GUAB 4WJNA 4F8CB 2V4LA 3KVFB 4EEWA 1P3QU 4LDTD 3S2AA 1J0GA 2OJRA 4NY0A 1QZEA 2M4NA 1WJUA 4WWPA 4BBNC 2R2OA 2NR2A 3BY4B 2KNBA 3QC8B 2KX3A 3DVGX 3CMMB 4WAAA 1RLFA 1YD8U 1LFDA 4NNJB 3K9OB 2UWQA 3NS8A 3QCAA 1YX6B 2KXJA 5CHWA 4FLHA 1FXTB 3PGEA 2L7RA 3QIJA 4BOZB 1E90A 2CR5A 2HTHA 3JVZX 4I6NB 1WXVA 4BBNF 4KIKA 3ZVVA 1UBQA 2WX1A 1GC7A 2ZJDA 2MSED 4TKNA 1V6EA 2ZNVB 2MBEA 2PPHA 4ZRKA 1I42A 2LRUA 4HK2A 4NQKE 2XBBC 4GDKB 4WWOA 3RULA 4WJOA 2D2QA 3EHVA 1I35A 4HCNB 2LGDA 3PLVA 3H9DA 2D10A 1NI2A 2ZVOA 4RM9A 4LCDE 4DHJB 2AEHA 2ZVNA 3QARA 3QHTA 4JQWC 3UQAA 2KDEB 2KDIA 2N9PC 2MBOA 5CTRC 1V49A 2WX0A 5D7GA 2O6VB 1VCBA 3WANA 2I1JA 3DBSA 2D07B 3RUIB 3VUWA 1Z5SB 2GBRA 2RPQA 3K9PB 3TCAA 1TTNA 4AJYB 3N3KB 3OLMD 3IVFA 4AJWA 2C60A 2DAFA 2CU1A 2N1VA 4F7ZA 1UD7A 2KTRB 2KMAA 1EF1A 5LXIB 3IHPC 4CO7A 1C1YB 2Z0DB 1XD3B 4FADA 1GC6A 1JRUA 2GMIC 4PS3A 4IM3A 3V6EB 3WA0A 4DBGA 3JW0X 1P98A 4E3CA 4DHZE 1EO6A 2AL6A 3Q3JA 1PQSA 2K39A 2ZZPB 3QX1A 1WJ4A 4PYUA 2NPTB 4FJYA 3DBRI 1E8YA 3UF8A 2CKHB 2JWZA 3JSVA 1R4NI 1OQYA 3A9JB 3DBHI 3X23A 1Q0WB 2DAJA 4DK5A 4P7IA 4MGZE 3ZNID 3RD2A 1UBIA 3ZUNA 3ALBA 1Q5WB 3TIXA 3CSTA 4JIOU 2BKRB 2NBUA 2D3GA 2Y5BB 3N32A 4W9EA 2KVRA 2LD9A 4II3B 4X57B 1H4RA 3AU5A 2EMSA 2GBNA 2PE6B 3IBEA 4A20A 5LXHA 1E8WA 3ZKJC 1MG8A 5IAAC 1A5RA 1WRDB 4DHJD 4OVVA 5L95C 4HLEA 1WX8A 2KTFA 1AARA 4B95A 4XX5A 3NZSA 1IPGA 4EKUA 1KM7A 1NBFC 1SE9A 2MCNB 3DQVA 2HJ8A 3ZDMC 3U30A 3PS6A 3ZNGC 2DZIA 1WMHB 3UIOB 3GOEA 3VVWB 4PS7A 1WF9A 2NPTA 2WDTB 2DENB 4AOFA 4BVUC 5JHBA 2O2VB 1WI0A 2MQJA 2K6DB 3HIZA 2KFJA 1IP9A 2KO3A 4GGQA 1P0RA 2FCQA 5CX3A 3BINA 3A9JA 4EUTA 1WXSA 4FJZA 2JZ3B 5DPTA 3ONSA 2IBIB 1ISNA 4WJPA 5D94A 4EZJA 2V1YA 1OGWA 3VXWA 1WXMA 5CHFA 3SU8X 5G2NA 3T8MA 1E7VA 4FHJA 5DPWA 1ZGUB 1WGDA 3ZRFA 3T9LA 4TQ0A 2VRRB 4MJSB 4CHKA 3HM3A 2K1FA 3PRPB 4NJ7A 2MBHA 2KC2A 4FULA 3LDZE 4NAWA 4ZDVA 1C3TA 2KWCA 2KANA 1H8CA 1WJ6A 2L8JA 1E5WA 1WFYA 1E8ZA 2J7QB 2KX0A 3D32A 3WAPA 2IYDB 2JRIB 3KUCB 1V80A 2ZPYA 1P9DU 2M17A 3L0WB 3L54A 4HJKA 3M63B 2MA9B 3M95A 2MP2A 3MTNB 3RT3B 4KSLC 3TL5A 4KZ0A 4RM8A 3ZTCA 2JY6A 3DOWA 1WR6E 1OEYA 2LUEA 1CMXB 3ZDTA 3H7PA 1LXDA 3QAQA 4GDLB 4E71A 2IY0B 2LVPA 2C7NB 2QHOA 3WALA 4IWQA 2XEWA 1V86A 3I3TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TBL D;  4F1S A;  3L13 A;  2LAS A;  1WE7 A;  3QWZ B;  5KHO A;  4M0W B;  1WE6 A;  4ICV A;  1J8C A;  2N4F A;  3QA8 A;  1J19 A;  4FHK A;  1WZ3 A;  1V5O A;  2M0X A;  4IM2 A;  2N9X A;  2LGX A;  3VQI A;  2LXA A;  3V61 A;  3R66 C;  2A4Z A;  4K7U A;  2BKF A;  2KKC A;  2KN5 A;  4MGI E;  4AWJ A;  4IWO A;  4I6L B;  1Q1O A;  2MX2 A;  1WM2 A;  2AYO B;  2IZV B;  1WXA A;  2MLB A;  4G50 A;  5E6P A;  4HCP B;  4K7W A;  2KDB A;  2DYB A;  1R4M I;  2JT4 B;  4GSW A;  1V2Y A;  2RSU A;  4IM0 A;  1S1Q B;  3SD5 A;  2MW5 A;  3OJ3 A;  4FN2 A;  4GIV A;  3QK0 A;  3VHT C;  4AP4 C;  3VUY A;  2GBM A;  5L83 A;  4GDL A;  5G55 A;  2KWV B;  4AUQ C;  1GNU A;  3Q3F A;  4B9K A;  2L05 A;  1EUV B;  4N9F 4;  1WH3 A;  4JL9 A;  3SHQ A;  2NBW B;  3H7S A;  4MEL A;  2M8S A;  1YJ1 A;  3ML8 A;  4MEM A;  5CHV C;  1F9J A;  1UZX B;  4W9H A;  4KDI C;  3V62 A;  3M3J A;  1BT0 A;  3UIP B;  4HVB A;  3EEC A;  1HE8 A;  3V6C B;  3CF6 E;  2KJR A;  3KYC D;  1WIA A;  2EMT A;  2MRP A;  4BKT A;  5TR5 A;  2LGY A;  2KFK B;  4W9D A;  4GDK A;  3PTF C;  3AI5 A;  3NY5 A;  3QQ8 B;  1SGH A;  4ASW C;  3ZIM A;  2BYV E;  3B1L X;  1G6J A;  3IG3 A;  4HPL B;  2KDF B;  2KZR A;  2L0T A;  2L76 A;  1EF5 A;  2REX A;  3PSE B;  5C23 A;  3VH3 B;  2WWZ A;  4EOY A;  3RYT A;  5FR6 A;  3OAW A;  2O6V A;  1SIF A;  2ZEQ A;  1V81 A;  4NJ6 A;  4K81 A;  1X1M A;  4K1R B;  2KK8 A;  3A9K B;  1K8R B;  3W1Y A;  3DVN U;  3HK0 A;  1VD2 A;  1NDD A;  2K8B A;  5EDS A;  5JH5 C;  2KTR A;  5IA7 A;  2ZCB A;  5LLI A;  3UGB B;  4DWF A;  2K25 A;  2JUO A;  1S3S G;  4GMV A;  3A4S C;  4J6I A;  3TJP A;  2G4D B;  5E6N A;  3VAW A;  3ZW3 A;  3V60 A;  2FUH B;  2N7E A;  4EZK A;  5KHQ A;  2ZPN A;  3KYD D;  2KFK A;  2O6V D;  3DCG A;  4DHZ B;  4LDT B;  2ZNV C;  3EFU A;  4A3O A;  4BFR A;  1WR1 A;  2RGF A;  3PLU A;  2FIF A;  4MGY E;  2K6Q A;  2L00 B;  4TV3 A;  4XC2 A;  5AZF A;  2IO1 B;  3KH0 A;  2WYQ A;  4W9F A;  5C1Z A;  2CHZ A;  2DYM A;  1OEY J;  2J0K A;  2NVU I;  4ANU A;  1M94 A;  4ANV A;  3R7R A;  3WIM A;  3SDL C;  2BPS A;  2PJH A;  2KLC A;  2JPH A;  2KOX A;  4IUM B;  3DPD A;  4WJQ A;  3WAM A;  5AEK B;  4WWN A;  4ZYN A;  5D6J B;  3N30 A;  3R7Q A;  2Z0E B;  4DXA B;  3B0A A;  2CS4 A;  3NOB A;  3OJ4 B;  3VUX A;  2GOW A;  3APC A;  2V3S A;  1WGH A;  1UGM A;  1WX9 A;  3A1Q B;  3DBL I;  3ZNZ B;  4FA6 A;  2MBB B;  2IO0 B;  3PT2 B;  3PVL A;  4JGH B;  1WMH A;  4KSK C;  1YX5 B;  4IG7 B;  2JF5 A;  2BWF A;  2KWU B;  2I1K A;  1E8X A;  3ZNH B;  4A3P A;  3NZU A;  4BKS A;  1TGZ B;  2O2V A;  2L3Z A;  3KUZ A;  3APF A;  4DDI D;  4EFO A;  4TQ1 A;  2HE7 A;  2W9N A;  2JXX A;  5AZG A;  1WX7 A;  2JZZ A;  4KV2 A;  5GMV A;  1LM8 B;  4ZRI A;  3MHS D;  1WY8 A;  4XZ4 A;  3AXC A;  1RFA A;  1TBE A;  3O65 B;  3AUL A;  2MBQ A;  3HHM A;  2L0F A;  4MJS A;  2KHW B;  2AWT A;  2NS5 A;  1U4A A;  5J18 A;  1WGY A;  2KD0 A;  2DZM A;  4IC7 B;  3R3M A;  4MSM B;  2CHX A;  4KVG B;  4BKS D;  4MH0 E;  4W9K A;  4FBJ B;  5JZE B;  1E7U A;  2J0J A;  1XQQ A;  2K8H A;  3A1Q A;  2A5U A;  4GOC A;  2DX5 B;  4MM3 A;  5D2M B;  2GBK A;  4URK A;  3EC8 A;  4NQL B;  1XT9 B;  3A4R A;  2FCM A;  2LXC A;  1L7Y A;  4PS8 A;  3WAO A;  3QJZ A;  3PRM B;  2PE9 A;  2Z59 B;  2RR9 A;  3H1U A;  2DZJ A;  2GBJ A;  3DVG Y;  2BYF A;  2LRW A;  3A33 B;  2KLG A;  3IFW B;  2DYO A;  4KDL B;  2LVO A;  5J2R A;  4HWI B;  3RZW C;  2BGF A;  1LQB A;  1WGR A;  2JVC A;  4ANX A;  2G3Q B;  4DDG D;  2DHZ A;  5J17 A;  2KJH B;  1ZW7 A;  1WZ0 A;  2BYE A;  2NBV B;  4GN1 A;  2RD0 A;  4CYE A;  2UYZ B;  3L10 B;  2IO2 B;  4BKG A;  3JSV B;  3MJW A;  3PRE A;  1KJT A;  2IY1 B;  3NHE B;  3APD A;  3P2B A;  2LWP A;  1UEL A;  2AL3 A;  3B08 A;  2KQS A;  1L2N A;  3LJ3 A;  2MWS B;  2C7M B;  3CSF A;  3PHX B;  3HM6 X;  4JLC A;  2DZK A;  2YLM A;  2D11 A;  5E6O A;  2N7D A;  1RRB A;  1YQB A;  4I6P A;  2R2Q A;  3L16 A;  3UIN B;  2G4S A;  1GG3 A;  2C9W B;  2KMC A;  4W9L A;  2YVC A;  1TZ1 A;  3PHW B;  2LI5 A;  1KOT A;  2HD5 B;  3TMP B;  2ZCC A;  3U8Z A;  4KZC A;  1KLV A;  1WYW B;  2B3A A;  2KC1 A;  3VFK A;  4M8M A;  2FCN A;  4G0N B;  1IYF A;  4W9J A;  3GZN I;  3U7D A;  4YL8 A;  1GJZ A;  1WGG A;  1V9J A;  4HPM B;  1V5T A;  3RCZ A;  3ML9 A;  1UH6 A;  4W9G A;  2N1W A;  3DVN V;  2CHW A;  4HDO A;  3C0R B;  3KW5 B;  2ASQ A;  2G45 B;  2LVQ A;  2LZ6 A;  4ANW A;  2PEA A;  3ZTD A;  3RZF A;  4GXB A;  2JRH A;  1Y8R C;  4HDQ A;  4IWP A;  2XK5 B;  3ZO5 B;  2KQ7 A;  3JYU A;  4MDK E;  3W1S A;  5BO4 B;  3X0W A;  4NAW B;  1P1A A;  4ZRJ A;  5JHA A;  5HKH A;  4II2 B;  2IO3 B;  3L17 A;  1Z2M A;  4G11 A;  3VTW A;  1WM3 A;  3A9K A;  2FAZ A;  4ICU A;  4G3X B;  3ZRC A;  2C7H A;  4NPN A;  3PRZ A;  2MP2 B;  4IW0 A;  5DPR A;  4GU2 A;  2BF8 B;  2LJ5 A;  2OOB B;  1ZKH A;  2BWE S;  2KJ6 A;  2N9E B;  3H7P B;  3UQB A;  4HXD A;  1D3Z A;  2FID A;  2EKE C;  3VDZ A;  4LJP B;  1T0Y A;  4W9C A;  3L08 A;  4GB9 A;  1YIW A;  2J0M A;  4WQO B;  3DDC B;  3ECI A;  5AZH A;  2M1M A;  3PZD A;  2FNJ B;  2FCS A;  4M8N A;  4KIK B;  3PPA A;  2K8C A;  3PV1 A;  5DPS A;  4K7S A;  1WJN A;  4PYZ A;  3M62 B;  4RMA A;  4MGK E;  2XK5 A;  4B6W A;  5DCN A;  4EZL A;  2NCN A;  3VTU A;  3VH4 B;  4OVU A;  3H6N A;  4TUU A;  1OTR B;  4MSQ B;  3VTV A;  4LJO B;  4BOS C;  3AU4 A;  1RAX A;  3ENE A;  3ZLZ A;  4FJV B;  2C5L C;  4E74 A;  3W1S C;  3KUD B;  4W9I A;  1GUA B;  4WJN A;  4F8C B;  2V4L A;  3KVF B;  4EEW A;  1P3Q U;  4LDT D;  3S2A A;  1J0G A;  2OJR A;  4NY0 A;  1QZE A;  2M4N A;  1WJU A;  4WWP A;  4BBN C;  2R2O A;  2NR2 A;  3BY4 B;  2KNB A;  3QC8 B;  2KX3 A;  3DVG X;  3CMM B;  4WAA A;  1RLF A;  1YD8 U;  1LFD A;  4NNJ B;  3K9O B;  2UWQ A;  3NS8 A;  3QCA A;  1YX6 B;  2KXJ A;  5CHW A;  4FLH A;  1FXT B;  3PGE A;  2L7R A;  3QIJ A;  4BOZ B;  1E90 A;  2CR5 A;  2HTH A;  3JVZ X;  4I6N B;  1WXV A;  4BBN F;  4KIK A;  3ZVV A;  1UBQ A;  2WX1 A;  1GC7 A;  2ZJD A;  2MSE D;  4TKN A;  1V6E A;  2ZNV B;  2MBE A;  2PPH A;  4ZRK A;  1I42 A;  2LRU A;  4HK2 A;  4NQK E;  2XBB C;  4GDK B;  4WWO A;  3RUL A;  4WJO A;  2D2Q A;  3EHV A;  1I35 A;  4HCN B;  2LGD A;  3PLV A;  3H9D A;  2D10 A;  1NI2 A;  2ZVO A;  4RM9 A;  4LCD E;  4DHJ B;  2AEH A;  2ZVN A;  3QAR A;  3QHT A;  4JQW C;  3UQA A;  2KDE B;  2KDI A;  2N9P C;  2MBO A;  5CTR C;  1V49 A;  2WX0 A;  5D7G A;  2O6V B;  1VCB A;  3WAN A;  2I1J A;  3DBS A;  2D07 B;  3RUI B;  3VUW A;  1Z5S B;  2GBR A;  2RPQ A;  3K9P B;  3TCA A;  1TTN A;  4AJY B;  3N3K B;  3OLM D;  3IVF A;  4AJW A;  2C60 A;  2DAF A;  2CU1 A;  2N1V A;  4F7Z A;  1UD7 A;  2KTR B;  2KMA A;  1EF1 A;  5LXI B;  3IHP C;  4CO7 A;  1C1Y B;  2Z0D B;  1XD3 B;  4FAD A;  1GC6 A;  1JRU A;  2GMI C;  4PS3 A;  4IM3 A;  3V6E B;  3WA0 A;  4DBG A;  3JW0 X;  1P98 A;  4E3C A;  4DHZ E;  1EO6 A;  2AL6 A;  3Q3J A;  1PQS A;  2K39 A;  2ZZP B;  3QX1 A;  1WJ4 A;  4PYU A;  2NPT B;  4FJY A;  3DBR I;  1E8Y A;  3UF8 A;  2CKH B;  2JWZ A;  3JSV A;  1R4N I;  1OQY A;  3A9J B;  3DBH I;  3X23 A;  1Q0W B;  2DAJ A;  4DK5 A;  4P7I A;  4MGZ E;  3ZNI D;  3RD2 A;  1UBI A;  3ZUN A;  3ALB A;  1Q5W B;  3TIX A;  3CST A;  4JIO U;  2BKR B;  2NBU A;  2D3G A;  2Y5B B;  3N32 A;  4W9E A;  2KVR A;  2LD9 A;  4II3 B;  4X57 B;  1H4R A;  3AU5 A;  2EMS A;  2GBN A;  2PE6 B;  3IBE A;  4A20 A;  5LXH A;  1E8W A;  3ZKJ C;  1MG8 A;  5IAA C;  1A5R A;  1WRD B;  4DHJ D;  4OVV A;  5L95 C;  4HLE A;  1WX8 A;  2KTF A;  1AAR A;  4B95 A;  4XX5 A;  3NZS A;  1IPG A;  4EKU A;  1KM7 A;  1NBF C;  1SE9 A;  2MCN B;  3DQV A;  2HJ8 A;  3ZDM C;  3U30 A;  3PS6 A;  3ZNG C;  2DZI A;  1WMH B;  3UIO B;  3GOE A;  3VVW B;  4PS7 A;  1WF9 A;  2NPT A;  2WDT B;  2DEN B;  4AOF A;  4BVU C;  5JHB A;  2O2V B;  1WI0 A;  2MQJ A;  2K6D B;  3HIZ A;  2KFJ A;  1IP9 A;  2KO3 A;  4GGQ A;  1P0R A;  2FCQ A;  5CX3 A;  3BIN A;  3A9J A;  4EUT A;  1WXS A;  4FJZ A;  2JZ3 B;  5DPT A;  3ONS A;  2IBI B;  1ISN A;  4WJP A;  5D94 A;  4EZJ A;  2V1Y A;  1OGW A;  3VXW A;  1WXM A;  5CHF A;  3SU8 X;  5G2N A;  3T8M A;  1E7V A;  4FHJ A;  5DPW A;  1ZGU B;  1WGD A;  3ZRF A;  3T9L A;  4TQ0 A;  2VRR B;  4MJS B;  4CHK A;  3HM3 A;  2K1F A;  3PRP B;  4NJ7 A;  2MBH A;  2KC2 A;  4FUL A;  3LDZ E;  4NAW A;  4ZDV A;  1C3T A;  2KWC A;  2KAN A;  1H8C A;  1WJ6 A;  2L8J A;  1E5W A;  1WFY A;  1E8Z A;  2J7Q B;  2KX0 A;  3D32 A;  3WAP A;  2IYD B;  2JRI B;  3KUC B;  1V80 A;  2ZPY A;  1P9D U;  2M17 A;  3L0W B;  3L54 A;  4HJK A;  3M63 B;  2MA9 B;  3M95 A;  2MP2 A;  3MTN B;  3RT3 B;  4KSL C;  3TL5 A;  4KZ0 A;  4RM8 A;  3ZTC A;  2JY6 A;  3DOW A;  1WR6 E;  1OEY A;  2LUE A;  1CMX B;  3ZDT A;  3H7P A;  1LXD A;  3QAQ A;  4GDL B;  4E71 A;  2IY0 B;  2LVP A;  2C7N B;  2QHO A;  3WAL A;  4IWQ A;  2XEW A;  1V86 A;  3I3T B; 
#chains in the Genus database with same CATH topology
 3QWZ B;  5KHO A;  4M0W B;  1HTQ A;  1T5X D;  1J8C A;  5GXG B;  1FD6 A;  4FHK A;  1V5O A;  4IM2 A;  4ZHO A;  3VQI A;  3UI3 A;  3R66 C;  3J9C A;  1AN8 A;  2WQY B;  3R2T A;  4XWT A;  1MI0 A;  4I6L B;  2RMM A;  1Q1O A;  1C4C A;  1UGJ A;  2RSU A;  1S1Q B;  3OJ3 A;  1HEZ E;  3WCQ A;  4AP4 C;  3VUY A;  2GBM A;  2BTE A;  1E0Z A;  5G55 A;  2KWV B;  3Q3F A;  1BML C;  4LK0 M;  2BS4 B;  1PGX A;  1YJ1 A;  4MEM A;  1GB4 A;  1F9J A;  1UZX B;  4W9H A;  2K9X A;  4HVB A;  1HE8 A;  1J7C A;  4YSY B;  1WIA A;  1TY0 A;  1SGH A;  2K3U A;  3ZIM A;  2BYV E;  1G6J A;  4L2Y A;  1UNS A;  1HZ5 A;  4EOY A;  2JSV X;  1RM6 C;  2ZW0 A;  3FIL A;  2ZEQ A;  1X1M A;  2KK8 A;  3DVN U;  1PGA A;  5EDS A;  1MHX A;  1FFV A;  2JUO A;  3RI7 C;  3A4S C;  4BZA A;  3V60 A;  3MC0 B;  2CU3 A;  4LLG M;  1I4P A;  3ZJT A;  4DHZ B;  4LDT B;  3AM9 A;  3EFU A;  2L1A A;  2RGF A;  3BII D;  4ACF A;  2FIF A;  2L00 B;  3BVM A;  4TV3 A;  2IO1 B;  2WYQ A;  2M19 A;  2CHZ A;  3RPF C;  2B76 B;  1JWM D;  1FEH A;  4WJQ A;  3DPD A;  2N0S B;  4WWN A;  4ZYN A;  2J4X A;  3R7Q A;  1EM7 A;  3AE7 B;  3NOB A;  1WGK A;  2QEJ C;  2GOW A;  3Q69 A;  3A1Q B;  2N9K A;  2WGS A;  2MBB B;  2LFI A;  5EE3 A;  4WAF A;  2WP9 B;  3NVV A;  1WMH A;  2BB5 A;  2JF5 A;  1JWS D;  1E8X A;  3ZNH B;  1F0Z A;  4BKS A;  2L3Z A;  4DDI D;  4EFO A;  2W9N A;  4A8X C;  1L4Z B;  1NYR A;  4IKG A;  5IOI A;  4KV2 A;  5GMV A;  4ZRI A;  2MBQ A;  3P4Q B;  3HHM A;  2L0F A;  2NS5 A;  1U4A A;  1DOX A;  1VZ7 A;  4KGR A;  1KLG D;  1PDX A;  4D2K A;  2K8H A;  1XQQ A;  2DX5 B;  3PO0 A;  4NQL B;  2KMM A;  1XT9 B;  1D5M C;  3EUB 2;  3WAO A;  1YN4 A;  2PE9 A;  2RR9 A;  3H1U A;  1GAQ B;  2DZJ A;  2GBJ A;  1P7E A;  2LHD A;  2LVO A;  2IGD A;  2BGF A;  1LQB A;  4HJG E;  4C4V B;  4XDD A;  1TT5 B;  1WZ0 A;  4GN1 A;  2RD0 A;  2IO2 B;  3T3O A;  3PRE A;  3GZN B;  3SFE B;  2I2Y A;  1ESF A;  3AEA B;  3PHX B;  3HRD D;  2SEB D;  4NZL B;  5E6O A;  3L16 A;  4KKI A;  1I4G A;  1ZP0 B;  1GG3 A;  1L4D B;  3AE1 B;  2LI5 A;  1KOT A;  4OZA A;  5IP4 D;  1JAL A;  1YQ4 B;  1FPY A;  1IYF A;  1GJZ A;  4HPM B;  4LNO A;  4PT5 A;  1T0R C;  2N1W A;  3DVN V;  2ASQ A;  2G45 B;  2LVQ A;  2LZ6 A;  4OZC A;  1Y8R C;  4IWP A;  1YNT E;  2XK5 B;  1JQ4 A;  5JXV A;  3X0W A;  4YSX B;  3CIR B;  2E3T A;  2VH1 A;  5HKH A;  1XF5 L;  2K22 A;  3A9K A;  1K53 A;  3ZRC A;  2C7H A;  4NPN A;  3PRZ A;  4RGT A;  3KWL A;  1LO5 D;  2N9E B;  3H7P B;  4WIP A;  3NVY A;  3ETR A;  4W9C A;  3NVZ A;  2NTS A;  3L08 A;  2WDQ B;  3PZD A;  1ZXH A;  2AQ3 B;  3PPA A;  5DPS A;  3N20 C;  4K7S A;  5DCN A;  3AH7 A;  1SE2 A;  4RF0 A;  4EZL A;  3AEC B;  3H6N A;  5EE0 A;  3VTV A;  3FC4 A;  4LTU A;  3DWG C;  4FJV B;  4E74 A;  3IT6 B;  3Q8A A;  4W9I A;  1V1P A;  2L32 A;  2OJR A;  3URY A;  2M4N A;  1WJU A;  3QC8 B;  4WAA A;  1RLF A;  1ZXI A;  3K9O B;  3NS8 A;  3QCA A;  3E9S A;  2L7R A;  4BOZ B;  1FO4 A;  3ZQ4 A;  3JVZ X;  1RFK A;  1SB3 C;  2MSE D;  4C7Y A;  1I42 A;  1FNU A;  2I38 A;  2AQ2 B;  4NQK E;  4WWO A;  4HCN B;  3LYY A;  4LNK A;  4DHJ B;  3DBR B;  4BAX A;  4P6V F;  3QHT A;  1ZDV A;  4JQW C;  2KDE B;  5D7G A;  2N9P C;  2WX0 A;  3WAN A;  1WSP A;  4AJY B;  1JCK B;  3OLM D;  3IVF A;  5H8Y E;  4K3C A;  2PTL A;  4H2A A;  3GP7 A;  3IHP C;  4CO7 A;  1XD3 B;  2GMI C;  2Q5W D;  3P4P B;  4OW0 A;  1C77 A;  4DHZ E;  2ZW1 A;  1MJD A;  1JRP A;  3DWM A;  4NAM A;  2NPT B;  4YSZ B;  1QIL A;  4JIO U;  2Y5B B;  3MC9 A;  2WXH A;  4X57 B;  1H4R A;  2PE6 B;  5IN7 A;  5LXH A;  3P1M A;  2R61 A;  4MT5 A;  1WRD B;  1QLB B;  4XX5 A;  2JYE A;  5LNK 1;  2HJ8 A;  2KDM A;  4P1B C;  2CJN A;  3U30 A;  1FNV A;  5HI1 A;  1WMH B;  3NRZ A;  2LGI A;  3CWI A;  3GOE A;  3VVW B;  2ICI A;  1V97 A;  3HIZ A;  3A9J A;  1VJK A;  4A6Q A;  2JZ3 B;  2IBI B;  3C8Y A;  3T3N A;  1RWS A;  5D94 A;  4HRO A;  1IBX A;  2V1Y A;  3SU8 X;  3T8M A;  1E7V A;  4MAC A;  3I57 A;  1XLN A;  4TQ0 A;  2VRR B;  3HM3 A;  2MBH A;  4NAW A;  1EU3 A;  4ZYS A;  1H8C A;  1E5W A;  1E8Z A;  2KX0 A;  1KTK A;  2ZPY A;  1P9D U;  3L0W B;  4JE3 B;  3DOW A;  1OEY A;  1N62 A;  2GRI A;  4R3D A;  4XDC A;  4IWQ A;  1DGJ A;  3GE8 C;  1IUE A;  3L13 A;  1WE7 A;  4ZOH C;  2WDV B;  2HDE A;  2QCZ A;  4ICV A;  1J19 A;  1STE A;  2LXA A;  2A4Z A;  2VH2 A;  2MHJ A;  4IWO A;  2WU2 B;  1JML A;  2MX2 A;  1HZ6 A;  1QOA A;  1OQQ A;  2IZV B;  2MLB A;  5E6P A;  4HCP B;  4Q2J A;  4K7W A;  2KDB A;  2JT4 B;  1R4M I;  4GSW A;  2MW5 A;  1TY2 A;  4FN2 A;  4GIV A;  3QK0 A;  4B9K A;  4JL9 A;  4KDI C;  3P4R B;  3CF6 E;  3KYC D;  4TSS A;  2MRP A;  1EWC A;  2DWQ A;  2J42 A;  3QQ8 B;  3OWE B;  1FNW A;  2KZR A;  2REX A;  5C23 A;  3R2I A;  3RN9 C;  4NJ6 A;  1V81 A;  1JW9 D;  2V3N A;  1FMA D;  1YJJ A;  3A9K B;  1K8R B;  1D6E C;  1YJI A;  1NDD A;  4JX1 C;  2ZCB A;  2BT6 A;  3TJP A;  4J6I A;  5E6N A;  2N7E A;  4LNF A;  2KFK A;  2O6V D;  2ZNV C;  1WR1 A;  4MGY E;  2K6Q A;  4XC2 A;  4ZRQ A;  2DYM A;  3AE4 B;  3Q14 C;  2KVZ A;  2JU6 X;  2NVU I;  3L4P A;  3R7R A;  3WIM A;  2BPS A;  2KLC A;  2JPH A;  3EA6 A;  5T8I A;  1PFD A;  3VRB B;  1D5X C;  1V1P B;  4US9 A;  4S17 A;  5EE9 A;  1SSN A;  3OJ4 B;  3VUX A;  1ENF A;  4WH4 A;  2YEP B;  2V3S A;  1WGH A;  4JWS C;  1WX9 A;  4RGM A;  3PZ8 A;  2I1K A;  2N9L A;  3NZU A;  1A70 A;  4TQ1 A;  4YXD B;  2H88 B;  1K50 A;  2BYT A;  1LM8 B;  3MHS D;  2G1E A;  3AXC A;  2KN4 A;  3O65 B;  2KHW B;  4MH8 A;  3RNG C;  5HHD G;  5J18 A;  2DZM A;  3R3M A;  2QC8 A;  3BZD B;  4MH0 E;  1E7U A;  4MM3 A;  2GBK A;  5I4D A;  1OQR A;  1L7Y A;  4PS8 A;  2L52 A;  3EGR A;  3QJZ A;  2WXF A;  1SXT A;  3DVG Y;  5AUI A;  2BYF A;  3A33 B;  2KLG A;  2XNA C;  3IFW B;  2VZK D;  5J2R A;  4HWI B;  3AE2 B;  4ANX A;  2G3Q B;  4DDG D;  1PUT A;  2DHZ A;  5HG2 A;  1E6E B;  2WXK A;  4BKG A;  3MJW A;  1JWA D;  4HRS A;  2N7J A;  1M4V A;  3NHE B;  2LWP A;  3B08 A;  3AB5 A;  2D11 A;  2N7D A;  1RRB A;  2ON8 A;  2R2Q A;  4C80 A;  2J53 A;  2INP E;  2C9W B;  5BYQ A;  2YVC A;  2HD5 B;  2ZCC A;  1KLV A;  3H8H A;  1WYW B;  1UWM A;  2KC1 A;  3VFK A;  4G0N B;  5G5G A;  2MJD A;  5D3D A;  3DBL B;  1V5T A;  3W2D A;  2V9H A;  3ZJV A;  4L1B A;  1UH6 A;  1IBX B;  4ANW A;  3RZF A;  2JRH A;  4HDQ A;  3HVZ A;  3GS2 A;  2W82 A;  3JYU A;  4NAW B;  2X38 A;  2X8X X;  1K52 A;  2FAZ A;  4ZHP A;  5DPR A;  2BF8 B;  1HXY D;  2LJ5 A;  4HKZ E;  2BWE S;  2K0P A;  2V4I B;  4ARC A;  1SF0 A;  1D3Z A;  3VDZ A;  3Q8B A;  3NG0 A;  1N60 A;  1YIW A;  4WQO B;  5AZH A;  4CQN A;  4M8N A;  4KIK B;  3PV1 A;  1WJN A;  1C76 A;  3BVG A;  4B6W A;  2NCN A;  1YN3 A;  4OVU A;  1KH0 A;  1VR9 A;  3FKY A;  1OTR B;  1RAX A;  3W5U B;  4B0M A;  4WJN A;  2HTM E;  1F2R C;  2V4L A;  2IDY A;  1J0G A;  1L0V B;  3I9V 1;  2R2O A;  3DVG X;  4DXG A;  1YD8 U;  1HTO A;  1E90 A;  4RH6 A;  4I6N B;  2WXO A;  1UBQ A;  4RFB A;  2WX1 A;  1GC7 A;  4TKN A;  3ZYY X;  2RPV A;  2MBE A;  4ZRK A;  4WQM A;  2LRU A;  3AED B;  1I4Q A;  4WJO A;  3EHV A;  4DXF A;  3H9D A;  2D10 A;  4RM9 A;  1T0S C;  2AEH A;  1B1Z A;  3DHG C;  3QAR A;  2IND C;  1UWX A;  2KDI A;  1TKG A;  1V8C A;  4P16 A;  1VCB A;  3DBS A;  2D07 B;  3TCA A;  3N1Z C;  3N3K B;  2INC C;  2N1V A;  1CJE A;  4F7Z A;  4KKJ A;  1EF1 A;  1LGR A;  5LXI B;  4FXC A;  3VRA B;  4IM3 A;  1DOY A;  2G9H D;  3JW0 X;  3U52 E;  1EO6 A;  2AL6 A;  2QIL A;  3B2F A;  2ZZP B;  3QX1 A;  2WDR B;  3KQ4 A;  1XCQ L;  4PYU A;  4REZ A;  1SEB D;  2INN E;  3JSV A;  1FCC C;  3RMK C;  1OQY A;  3DBH I;  4US8 A;  3RNB C;  3Q3O C;  1KFY B;  1BXT A;  2BKR B;  2W3S A;  2D3G A;  2LD9 A;  3AU5 A;  2EMS A;  2GBN A;  2Y5C A;  4IDI A;  3ZKJ C;  1MG8 A;  3AN1 A;  4XYC A;  4DHJ D;  4B95 A;  2TSS A;  3NZS A;  1IPG A;  1NBF C;  5IKC M;  1TS5 A;  3DQV A;  4HKQ A;  3C19 A;  2LJI A;  4PS7 A;  1TKE A;  1V1O A;  2EKI A;  2WDT B;  2DEN B;  4BVU C;  1WI0 A;  2JQR B;  2KO3 A;  4GGQ A;  1P0R A;  2FCQ A;  1C78 A;  1FM0 D;  1WXS A;  5DPT A;  1ISN A;  3AE9 B;  4EZJ A;  2LHE A;  5CHF A;  3I5J C;  3RNF C;  1AWD A;  1WGD A;  2CJO A;  2HJ1 A;  3PRP B;  2K1F A;  4KGT A;  2KC2 A;  3FAH A;  3LDZ E;  1YN5 A;  2KAN A;  2J7Q B;  2GB1 A;  3D32 A;  3WAP A;  2JRI B;  3KUC B;  2M17 A;  3M63 B;  2MA9 B;  3M95 A;  1XEE A;  1R4M B;  1WR6 E;  3ZDT A;  1LXD A;  2LVP A;  5BMH A;  2XEW A;  1V86 A;  3TBL D;  2JXT A;  1WE6 A;  3ZXV A;  2PLP A;  1YOV B;  2L83 A;  2N4F A;  3QA8 A;  2M0X A;  3ZGZ A;  2FBW B;  1K51 A;  2BKF A;  2KKC A;  1FXA A;  1E9M A;  2AYO B;  1WXA A;  2DYB A;  3SD5 A;  3EFC A;  3VHT C;  3FIL B;  4GDL A;  4A9A A;  3W5V B;  4AUQ C;  3KWV A;  1GNU A;  2L05 A;  1EUV B;  4N9F 4;  1WH3 A;  3SHQ A;  2M8S A;  2WXG A;  2IGH A;  3M3J A;  3UIP B;  3EEC A;  2KJR A;  1QQR A;  4BKT A;  3P63 A;  4YTP B;  4W9D A;  2BB6 A;  4OVZ A;  1ZE3 D;  3LXF A;  3B1L X;  3HVD A;  3IG3 A;  4HPL B;  4P1C C;  4A55 A;  4AQ7 A;  2L0T A;  2L76 A;  3PSE B;  3ZJU A;  2PKO A;  1AW7 A;  2WHI A;  3RYT A;  2O6V A;  4KGS A;  4N59 A;  1MPE A;  3W1Y A;  3HK0 A;  1HA5 A;  2KTR A;  5IA7 A;  5LLI A;  3VAW A;  3ZW3 A;  3B9J A;  1BUI C;  4S0R A;  5KHQ A;  3DCG A;  4A3O A;  4XWW A;  2OJW A;  5AZF A;  4YTM B;  3O13 A;  4W9F A;  5C1Z A;  1XXG A;  1OEY J;  4TMA B;  2J0K A;  2NMQ A;  4ANU A;  1M94 A;  3IT4 B;  5HFY A;  3TEY A;  3SDL C;  2PJH A;  1F2R I;  1NI3 A;  3WAM A;  3BYY B;  5AEK B;  5D6J B;  4IOI E;  3N30 A;  4RCO A;  1FRD A;  4KX6 B;  1GB1 A;  3APC A;  2W3R A;  4USA A;  1UGM A;  4M02 A;  4FA6 A;  2PIA A;  3SFD B;  2IO0 B;  3MC8 A;  3PVL A;  4JGH B;  4IG7 B;  1QKZ A;  1TGZ B;  2O2V A;  3APF A;  1EU4 A;  3RNC C;  1C9F A;  1J7B A;  2JXX A;  5AZG A;  1WX7 A;  2JZZ A;  3AMZ A;  4RGO S;  4LNI A;  1VLB A;  1MG4 A;  1AYF A;  1WY8 A;  4MJS A;  2AWT A;  4WUR A;  3VR8 B;  1PYW D;  1Q10 A;  1FIQ A;  1ZPS A;  2KD0 A;  4IC7 B;  4FBJ B;  1HQR D;  4W9K A;  2J0J A;  4GOC A;  3A1Q A;  1ROE A;  2A5U A;  5D2M B;  3EC8 A;  3A4R A;  2FCM A;  3Q2A C;  3LB8 C;  2LXC A;  4M01 A;  3PRM B;  1JRO A;  2Z59 B;  1FCL A;  2LMC A;  2DNF A;  1QF6 A;  2WXJ A;  3I63 C;  2DYO A;  1KRH A;  1TYG B;  3P4S B;  4WWM A;  1GPX A;  1DYQ A;  2NBV B;  2UYZ B;  3L10 B;  3JSV B;  1KJT A;  2IY1 B;  1UEL A;  2AL3 A;  2KQS A;  1L2N A;  3LJ3 A;  2C7M B;  3OG5 A;  1D5Z C;  1ET9 A;  4JLC A;  2DZK A;  2YLM A;  1YQB A;  4YT0 B;  3UIN B;  2G4S A;  2QIE B;  4W9L A;  3PHW B;  1TZ1 A;  4C4V A;  3BK2 A;  3U8Z A;  4KZC A;  2FCN A;  4W9J A;  4UDU C;  3U7D A;  1CZP A;  1IGC A;  1V9J A;  3ML9 A;  4W9G A;  2CHW A;  4HDO A;  3KW5 B;  3MP9 A;  1T3Q A;  1SE3 A;  2PEA A;  3ZTD A;  4GXB A;  3TEX A;  1L0X B;  2MJE A;  3ZO5 B;  2KQ4 X;  2KQ7 A;  1P1A A;  1R7S A;  4II2 B;  3TSS A;  1Z2M A;  2GI9 A;  4G11 A;  3VTW A;  4ICU A;  1L0Y B;  4B0E A;  1ZKH A;  1QOB A;  3UQB A;  2EKE C;  1D4B A;  4AS1 A;  1TS4 A;  2J0M A;  3GB1 A;  3DDC B;  5BYS A;  4RNA A;  1ACC A;  2IJ0 A;  2M1M A;  4YTN B;  2K8C A;  1I4H A;  4PYZ A;  4MGK E;  2XK5 A;  4JWU C;  4C7Z A;  3N9Y C;  4LJO B;  4BOS C;  3AU4 A;  2NTT A;  2W54 A;  3ZLZ A;  2H89 B;  3W1S C;  3KUD B;  4GLS C;  1TIF A;  1P3Q U;  4LDT D;  1MFW A;  3S2A A;  4BBN C;  3PZ7 A;  3BY4 B;  3CMM B;  1VRA B;  3NUH B;  4NNJ B;  1L5P A;  1YX6 B;  2KXJ A;  5CHW A;  4FLH A;  1FXT B;  3PGE A;  3AEE B;  3QIJ A;  4BBN F;  2ZJD A;  3SR6 A;  1V6E A;  2ZNV B;  2PPH A;  1SJE D;  1VDV A;  4HK2 A;  2XBB C;  1MHH E;  3AE8 B;  2XN9 C;  1QOG A;  2ZVN A;  2GLS A;  3N1Y C;  2DLB A;  5CTR C;  3DBH B;  1V49 A;  4L23 A;  4DQO C;  2O6V B;  2OED A;  4HEA 1;  3HUI A;  3K9P B;  1I7H A;  1TZO A;  2C60 A;  2DAF A;  2CU1 A;  4EE2 A;  3BYT B;  1UD7 A;  2KTR B;  2KMA A;  1C1Y B;  2Z0D B;  4K3B A;  1GC6 A;  1JRU A;  2WXL A;  4N6E B;  3V6E B;  4DBG A;  1P98 A;  3Q3J A;  1PQS A;  1T0Q C;  1JWB D;  1WJ4 A;  2BS3 B;  1E8Y A;  3UF8 A;  2JWZ A;  1SJH D;  1R4N I;  2W55 A;  3A9J B;  3X23 A;  1Q0W B;  4P7I A;  3U2S C;  4MGZ E;  3ZNI D;  3RD2 A;  3ZUN A;  2MH7 A;  1Q5W B;  3ALB A;  3TIX A;  3TUO A;  5C3J B;  2NBU A;  3N32 A;  4W9E A;  3NZ3 A;  4II3 B;  3IBE A;  3BK1 A;  1E8W A;  5MPO A;  4OVV A;  5L95 C;  4HLE A;  2DBY A;  1AAR A;  4EKU A;  3RNE C;  1KM7 A;  1SE9 A;  1IGD A;  1YMH E;  1C4P A;  3ZDM C;  3U7Z A;  2MEK A;  3PS6 A;  2D5G A;  3UIO B;  2NPT A;  4XGA B;  5JHB A;  1CK1 A;  2D3B A;  2O2V B;  2MQJ A;  2K6D B;  1KLU D;  5CX3 A;  4HPP A;  1N63 A;  3ONS A;  4WJP A;  3RFZ B;  1OGW A;  3VXW A;  1WXM A;  1XCT L;  1XO3 A;  1L6U A;  5DPW A;  1WYG A;  3E56 A;  2PVG C;  3ZRF A;  2WXQ A;  4MJS B;  4NJ7 A;  3Q3M C;  2WXM A;  3AV8 A;  3NJT A;  2VZK B;  2D3A A;  1WJ6 A;  2L8J A;  1WFY A;  4C56 C;  4RGN A;  3L54 A;  4HJK A;  3TL5 A;  2MP2 A;  5BMG A;  4KZ0 A;  3ZTC A;  2JY6 A;  1CMX B;  2PVO D;  3QAQ A;  2ONQ A;  2IY0 B;  2C7N B;  2QHO A;  4F1S A;  2LAS A;  3U4E G;  2BS2 B;  1WZ3 A;  2N9X A;  2LGX A;  3V61 A;  2JX5 A;  2KAC A;  4K7U A;  2KN5 A;  4MGI E;  4AWJ A;  3Q8F A;  1WM2 A;  2RDH A;  2IGG A;  4G50 A;  1V2Y A;  4IM0 A;  1N6Z A;  2JWU A;  1NYQ A;  5L83 A;  3AEF B;  2BBC A;  3NVW A;  2NBW B;  3AE6 B;  3H7S A;  1DOI A;  4MEL A;  3ML8 A;  1SE4 A;  5CHV C;  4ARI A;  3V62 A;  1BT0 A;  3SEB A;  2LUM A;  3V6C B;  2EMT A;  2EEL A;  1YQ3 B;  2SAK A;  5TR5 A;  2LGY A;  2KFK B;  2J52 A;  4GDK A;  3MFG A;  3PTF C;  3AI5 A;  3NY5 A;  1I4X A;  4ASW C;  1JWU D;  3IAM 1;  2KDF B;  2D3C A;  1EF5 A;  3VH3 B;  2WWZ A;  5FR6 A;  3OAW A;  1SIF A;  5IO9 A;  4K81 A;  2OHF A;  1OFF A;  4K1R B;  2BW2 A;  3Q6B A;  1VD2 A;  2K8B A;  3RNA C;  2WNM A;  2JZP A;  5JH5 C;  1XLP A;  3UGB B;  2Z8L A;  4DWF A;  2K25 A;  4GMV A;  1S3S G;  2Y3A A;  2MJ3 A;  5EE1 A;  2M56 B;  2G4D B;  4A90 A;  2FUH B;  1XLO A;  3B2G A;  1WRI A;  4EZK A;  2ZPN A;  3KYD D;  1TKY A;  4BFR A;  3PLU A;  4QAY A;  3KH0 A;  2PMV A;  3BVZ A;  3P42 A;  4ANV A;  2JYT A;  2KOX A;  4IUM B;  1T6B X;  1Y56 A;  2WLB A;  2Z0E B;  4NJC A;  4DXA B;  3B0A A;  2CS4 A;  1ZOY B;  5TSS A;  4MM3 B;  2V0G A;  2V3P A;  3DBL I;  3ZNZ B;  3PT2 B;  1UF0 A;  3KLS X;  1N5W A;  2RDB C;  4KSK C;  1YX5 B;  3GE3 C;  3W9C B;  2BWF A;  2KWU B;  1KF6 B;  4A3P A;  3KUZ A;  2FUG 1;  2HE7 A;  1RYJ A;  4XZ4 A;  2E6X A;  1RFA A;  1TBE A;  3AUL A;  1WGY A;  4MSM B;  4BKS D;  2CHX A;  4KVG B;  4RF1 A;  5JZE B;  4URK A;  2IPK D;  3ABV B;  3TEW A;  3AEB B;  1PGB A;  2LRW A;  4KDL B;  3RZW C;  2JVC A;  1WGR A;  2KYW A;  3N1X C;  4M0W A;  5J17 A;  2KJH B;  1ZW7 A;  2BYE A;  4M00 A;  4CYE A;  1CQV A;  3V3X A;  3APD A;  3P2B A;  3MJ5 A;  2MWS B;  3NS1 A;  3CSF A;  3HM6 X;  4I6P A;  2BQQ A;  2KMC A;  1ZUD 2;  1VZ6 A;  3TMP B;  3VR9 B;  1NEK B;  2B3A A;  4M8M A;  3GZN I;  4YL8 A;  2PW9 A;  1WGG A;  5BYR A;  3RCZ A;  1E10 A;  3C0R B;  1QT9 A;  3MHZ A;  1N5X A;  5BMI A;  4MDK E;  3W1S A;  5BO4 B;  3BWU D;  4ZRJ A;  2WU5 B;  5JHA A;  2IO3 B;  3L17 A;  3R8B A;  1FFU A;  1WM3 A;  4G3X B;  4N58 A;  2MP2 B;  1F52 A;  4IW0 A;  4GU2 A;  2OOB B;  2KJ6 A;  3Q3N C;  4HXD A;  4XE0 A;  2FID A;  4LJP B;  1T0Y A;  4GB9 A;  2WS3 B;  2WXR A;  3ECI A;  2KAJ A;  2KT7 A;  2FNJ B;  1WXQ A;  2FCS A;  2K5P A;  3AE5 B;  1UUP A;  3M62 B;  4RMA A;  3VTU A;  3VH4 B;  4TUU A;  4MSQ B;  1FXI A;  3ENE A;  2C5L C;  5H92 C;  2FE8 A;  4F8C B;  1GUA B;  4J3O D;  3KVF B;  4EEW A;  1QOF A;  1J7A A;  1C79 A;  4NY0 A;  1QZE A;  4WWP A;  2NR2 A;  2ACZ B;  2KNB A;  2KX3 A;  1LFD A;  2UWQ A;  5E6J A;  3IXS A;  5G5H A;  5C2T B;  4JPS A;  2CR5 A;  2HTH A;  2AQ1 B;  1WXV A;  4KIK A;  3ZVV A;  4C00 A;  1I4R A;  4PK1 A;  3Q8C A;  2RDG A;  2QJL A;  4OZB A;  5FR3 A;  3RUL A;  4GDK B;  1I35 A;  2D2Q A;  1B9R A;  2LGD A;  3PLV A;  2ZVO A;  1NI2 A;  4LCD E;  5D3I B;  3Q8E A;  3UQA A;  1TS3 A;  1TS2 A;  1R4N B;  5FK9 C;  5FKA C;  5AUK A;  2MBO A;  4OHJ A;  2I1J A;  1EWY C;  3RUI B;  3VUW A;  2AX5 A;  1Z5S B;  2GBR A;  2RPQ A;  1TTN A;  4AJW A;  1FRR A;  1MVK A;  4FAD A;  1C4A A;  4PS3 A;  4ZRP A;  4ITK A;  3WA0 A;  4E3C A;  3ZXR A;  2YEP F;  2K39 A;  1F77 A;  4FJY A;  3DBR I;  2M0A A;  1E7P B;  2CKH B;  1ET6 A;  1XLQ A;  2LGS A;  2LEK A;  2UU7 A;  2DAJ A;  4DK5 A;  1UBI A;  1ZDX A;  3CST A;  2KVR A;  3AEG B;  4A20 A;  4YWG G;  5IAA C;  3DHI C;  1A5R A;  1GOZ A;  1WX8 A;  2KTF A;  3IAS 1;  2QDF A;  2MCN B;  3ZNG C;  1SIJ A;  2DZI A;  1P7F A;  1WF9 A;  4AOF A;  1NVI D;  2KWD A;  2QSD A;  2KFJ A;  1IP9 A;  1TJE A;  3BIN A;  4EUT A;  4FJZ A;  1F1H A;  5G2N A;  1N61 A;  2WXI A;  4FHJ A;  1ZGU B;  2WXP A;  1NEN B;  3T9L A;  4CHK A;  3AE3 B;  3DHH C;  2BVC A;  4FUL A;  2QMT A;  1C3T A;  2KWC A;  1VZ8 A;  4O1N A;  2IYD B;  1V80 A;  4ZDV A;  3RT3 B;  3MTN B;  2WXN A;  4KSL C;  4RM8 A;  1SBB B;  2LUE A;  3V05 A;  1WWT A;  3TEZ A;  1L6V A;  3H7P A;  4GDL B;  4LNN A;  4E71 A;  3WAL A;  2Y5P A;  3I3T B; 
#chains in the Genus database with same CATH homology
 3TBL D;  4F1S A;  3L13 A;  2LAS A;  1WE7 A;  3QWZ B;  5KHO A;  4M0W B;  1WE6 A;  4ICV A;  1J8C A;  2N4F A;  3QA8 A;  1J19 A;  4FHK A;  1WZ3 A;  1V5O A;  2M0X A;  4IM2 A;  2N9X A;  2LGX A;  3VQI A;  2LXA A;  3V61 A;  3R66 C;  2A4Z A;  4K7U A;  2BKF A;  2KKC A;  2KN5 A;  4MGI E;  4AWJ A;  4IWO A;  4I6L B;  1Q1O A;  2MX2 A;  1WM2 A;  2AYO B;  2IZV B;  1WXA A;  2MLB A;  4G50 A;  5E6P A;  4HCP B;  4K7W A;  2KDB A;  2DYB A;  1R4M I;  2JT4 B;  4GSW A;  1V2Y A;  2RSU A;  4IM0 A;  1S1Q B;  3SD5 A;  2MW5 A;  3OJ3 A;  4FN2 A;  4GIV A;  3QK0 A;  3VHT C;  4AP4 C;  3VUY A;  2GBM A;  5L83 A;  4GDL A;  5G55 A;  2KWV B;  4AUQ C;  1GNU A;  3Q3F A;  4B9K A;  2L05 A;  1EUV B;  4N9F 4;  1WH3 A;  4JL9 A;  3SHQ A;  2NBW B;  3H7S A;  4MEL A;  2M8S A;  1YJ1 A;  3ML8 A;  4MEM A;  5CHV C;  1F9J A;  1UZX B;  4W9H A;  4KDI C;  3V62 A;  3M3J A;  1BT0 A;  3UIP B;  4HVB A;  3EEC A;  1HE8 A;  3V6C B;  3CF6 E;  2KJR A;  3KYC D;  1WIA A;  2EMT A;  2MRP A;  4BKT A;  5TR5 A;  2LGY A;  2KFK B;  4W9D A;  4GDK A;  3PTF C;  3AI5 A;  3NY5 A;  3QQ8 B;  1SGH A;  4ASW C;  3ZIM A;  2BYV E;  3B1L X;  1G6J A;  3IG3 A;  4HPL B;  2KDF B;  2KZR A;  2L0T A;  2L76 A;  1EF5 A;  2REX A;  3PSE B;  5C23 A;  3VH3 B;  2WWZ A;  4EOY A;  3RYT A;  5FR6 A;  3OAW A;  2O6V A;  1SIF A;  2ZEQ A;  1V81 A;  4NJ6 A;  4K81 A;  1X1M A;  4K1R B;  2KK8 A;  3A9K B;  1K8R B;  3W1Y A;  3DVN U;  3HK0 A;  1VD2 A;  1NDD A;  2K8B A;  5EDS A;  5JH5 C;  2KTR A;  5IA7 A;  2ZCB A;  5LLI A;  3UGB B;  4DWF A;  2K25 A;  2JUO A;  1S3S G;  4GMV A;  3A4S C;  4J6I A;  3TJP A;  2G4D B;  5E6N A;  3VAW A;  3ZW3 A;  3V60 A;  2FUH B;  2N7E A;  4EZK A;  5KHQ A;  2ZPN A;  3KYD D;  2KFK A;  2O6V D;  3DCG A;  4DHZ B;  4LDT B;  2ZNV C;  3EFU A;  4A3O A;  4BFR A;  1WR1 A;  2RGF A;  3PLU A;  2FIF A;  4MGY E;  2K6Q A;  2L00 B;  4TV3 A;  4XC2 A;  5AZF A;  2IO1 B;  3KH0 A;  2WYQ A;  4W9F A;  5C1Z A;  2CHZ A;  2DYM A;  1OEY J;  2J0K A;  2NVU I;  4ANU A;  1M94 A;  4ANV A;  3R7R A;  3WIM A;  3SDL C;  2BPS A;  2PJH A;  2KLC A;  2JPH A;  2KOX A;  4IUM B;  3DPD A;  4WJQ A;  3WAM A;  5AEK B;  4WWN A;  4ZYN A;  5D6J B;  3N30 A;  3R7Q A;  2Z0E B;  4DXA B;  3B0A A;  2CS4 A;  3NOB A;  3OJ4 B;  3VUX A;  2GOW A;  3APC A;  2V3S A;  1WGH A;  1UGM A;  1WX9 A;  3A1Q B;  3DBL I;  3ZNZ B;  4FA6 A;  2MBB B;  2IO0 B;  3PT2 B;  3PVL A;  4JGH B;  1WMH A;  4KSK C;  1YX5 B;  4IG7 B;  2JF5 A;  2BWF A;  2KWU B;  2I1K A;  1E8X A;  3ZNH B;  4A3P A;  3NZU A;  4BKS A;  1TGZ B;  2O2V A;  2L3Z A;  3KUZ A;  3APF A;  4DDI D;  4EFO A;  4TQ1 A;  2HE7 A;  2W9N A;  2JXX A;  5AZG A;  1WX7 A;  2JZZ A;  4KV2 A;  5GMV A;  1LM8 B;  4ZRI A;  3MHS D;  1WY8 A;  4XZ4 A;  3AXC A;  1RFA A;  1TBE A;  3O65 B;  3AUL A;  2MBQ A;  3HHM A;  2L0F A;  4MJS A;  2KHW B;  2AWT A;  2NS5 A;  1U4A A;  5J18 A;  1WGY A;  2KD0 A;  2DZM A;  4IC7 B;  3R3M A;  4MSM B;  2CHX A;  4KVG B;  4BKS D;  4MH0 E;  4W9K A;  4FBJ B;  5JZE B;  1E7U A;  2J0J A;  1XQQ A;  2K8H A;  3A1Q A;  2A5U A;  4GOC A;  2DX5 B;  4MM3 A;  5D2M B;  2GBK A;  4URK A;  3EC8 A;  4NQL B;  1XT9 B;  3A4R A;  2FCM A;  2LXC A;  1L7Y A;  4PS8 A;  3WAO A;  3QJZ A;  3PRM B;  2PE9 A;  2Z59 B;  2RR9 A;  3H1U A;  2DZJ A;  2GBJ A;  3DVG Y;  2BYF A;  2LRW A;  3A33 B;  2KLG A;  3IFW B;  2DYO A;  4KDL B;  2LVO A;  5J2R A;  4HWI B;  3RZW C;  2BGF A;  1LQB A;  1WGR A;  2JVC A;  4ANX A;  2G3Q B;  4DDG D;  2DHZ A;  5J17 A;  2KJH B;  1ZW7 A;  1WZ0 A;  2BYE A;  2NBV B;  4GN1 A;  2RD0 A;  4CYE A;  2UYZ B;  3L10 B;  2IO2 B;  4BKG A;  3JSV B;  3MJW A;  3PRE A;  1KJT A;  2IY1 B;  3NHE B;  3APD A;  3P2B A;  2LWP A;  1UEL A;  2AL3 A;  3B08 A;  2KQS A;  1L2N A;  3LJ3 A;  2MWS B;  2C7M B;  3CSF A;  3PHX B;  3HM6 X;  4JLC A;  2DZK A;  2YLM A;  2D11 A;  5E6O A;  2N7D A;  1RRB A;  1YQB A;  4I6P A;  2R2Q A;  3L16 A;  3UIN B;  2G4S A;  1GG3 A;  2C9W B;  2KMC A;  4W9L A;  2YVC A;  1TZ1 A;  3PHW B;  2LI5 A;  1KOT A;  2HD5 B;  3TMP B;  2ZCC A;  3U8Z A;  4KZC A;  1KLV A;  1WYW B;  2B3A A;  2KC1 A;  3VFK A;  4M8M A;  2FCN A;  4G0N B;  1IYF A;  4W9J A;  3GZN I;  3U7D A;  4YL8 A;  1GJZ A;  1WGG A;  1V9J A;  4HPM B;  1V5T A;  3RCZ A;  3ML9 A;  1UH6 A;  4W9G A;  2N1W A;  3DVN V;  2CHW A;  4HDO A;  3C0R B;  3KW5 B;  2ASQ A;  2G45 B;  2LVQ A;  2LZ6 A;  4ANW A;  2PEA A;  3ZTD A;  3RZF A;  4GXB A;  2JRH A;  1Y8R C;  4HDQ A;  4IWP A;  2XK5 B;  3ZO5 B;  2KQ7 A;  3JYU A;  4MDK E;  3W1S A;  5BO4 B;  3X0W A;  4NAW B;  1P1A A;  4ZRJ A;  5JHA A;  5HKH A;  4II2 B;  2IO3 B;  3L17 A;  1Z2M A;  4G11 A;  3VTW A;  1WM3 A;  3A9K A;  2FAZ A;  4ICU A;  4G3X B;  3ZRC A;  2C7H A;  4NPN A;  3PRZ A;  2MP2 B;  4IW0 A;  5DPR A;  4GU2 A;  2BF8 B;  2LJ5 A;  2OOB B;  1ZKH A;  2BWE S;  2KJ6 A;  2N9E B;  3H7P B;  3UQB A;  4HXD A;  1D3Z A;  2FID A;  2EKE C;  3VDZ A;  4LJP B;  1T0Y A;  4W9C A;  3L08 A;  4GB9 A;  1YIW A;  2J0M A;  4WQO B;  3DDC B;  3ECI A;  5AZH A;  2M1M A;  3PZD A;  2FNJ B;  2FCS A;  4M8N A;  4KIK B;  3PPA A;  2K8C A;  3PV1 A;  5DPS A;  4K7S A;  1WJN A;  4PYZ A;  3M62 B;  4RMA A;  4MGK E;  2XK5 A;  4B6W A;  5DCN A;  4EZL A;  2NCN A;  3VTU A;  3VH4 B;  4OVU A;  3H6N A;  4TUU A;  1OTR B;  4MSQ B;  3VTV A;  4LJO B;  4BOS C;  3AU4 A;  1RAX A;  3ENE A;  3ZLZ A;  4FJV B;  2C5L C;  4E74 A;  3W1S C;  3KUD B;  4W9I A;  1GUA B;  4WJN A;  4F8C B;  2V4L A;  3KVF B;  4EEW A;  1P3Q U;  4LDT D;  3S2A A;  1J0G A;  2OJR A;  4NY0 A;  1QZE A;  2M4N A;  1WJU A;  4WWP A;  4BBN C;  2R2O A;  2NR2 A;  3BY4 B;  2KNB A;  3QC8 B;  2KX3 A;  3DVG X;  3CMM B;  4WAA A;  1RLF A;  1YD8 U;  1LFD A;  4NNJ B;  3K9O B;  2UWQ A;  3NS8 A;  3QCA A;  1YX6 B;  2KXJ A;  5CHW A;  4FLH A;  1FXT B;  3PGE A;  2L7R A;  3QIJ A;  4BOZ B;  1E90 A;  2CR5 A;  2HTH A;  3JVZ X;  4I6N B;  1WXV A;  4BBN F;  4KIK A;  3ZVV A;  1UBQ A;  2WX1 A;  1GC7 A;  2ZJD A;  2MSE D;  4TKN A;  1V6E A;  2ZNV B;  2MBE A;  2PPH A;  4ZRK A;  1I42 A;  2LRU A;  4HK2 A;  4NQK E;  2XBB C;  4GDK B;  4WWO A;  3RUL A;  4WJO A;  2D2Q A;  3EHV A;  1I35 A;  4HCN B;  2LGD A;  3PLV A;  3H9D A;  2D10 A;  1NI2 A;  2ZVO A;  4RM9 A;  4LCD E;  4DHJ B;  2AEH A;  2ZVN A;  3QAR A;  3QHT A;  4JQW C;  3UQA A;  2KDE B;  2KDI A;  2N9P C;  2MBO A;  5CTR C;  1V49 A;  2WX0 A;  5D7G A;  2O6V B;  1VCB A;  3WAN A;  2I1J A;  3DBS A;  2D07 B;  3RUI B;  3VUW A;  1Z5S B;  2GBR A;  2RPQ A;  3K9P B;  3TCA A;  1TTN A;  4AJY B;  3N3K B;  3OLM D;  3IVF A;  4AJW A;  2C60 A;  2DAF A;  2CU1 A;  2N1V A;  4F7Z A;  1UD7 A;  2KTR B;  2KMA A;  1EF1 A;  5LXI B;  3IHP C;  4CO7 A;  1C1Y B;  2Z0D B;  1XD3 B;  4FAD A;  1GC6 A;  1JRU A;  2GMI C;  4PS3 A;  4IM3 A;  3V6E B;  3WA0 A;  4DBG A;  3JW0 X;  1P98 A;  4E3C A;  4DHZ E;  1EO6 A;  2AL6 A;  3Q3J A;  1PQS A;  2K39 A;  2ZZP B;  3QX1 A;  1WJ4 A;  4PYU A;  2NPT B;  4FJY A;  3DBR I;  1E8Y A;  3UF8 A;  2CKH B;  2JWZ A;  3JSV A;  1R4N I;  1OQY A;  3A9J B;  3DBH I;  3X23 A;  1Q0W B;  2DAJ A;  4DK5 A;  4P7I A;  4MGZ E;  3ZNI D;  3RD2 A;  1UBI A;  3ZUN A;  3ALB A;  1Q5W B;  3TIX A;  3CST A;  4JIO U;  2BKR B;  2NBU A;  2D3G A;  2Y5B B;  3N32 A;  4W9E A;  2KVR A;  2LD9 A;  4II3 B;  4X57 B;  1H4R A;  3AU5 A;  2EMS A;  2GBN A;  2PE6 B;  3IBE A;  4A20 A;  5LXH A;  1E8W A;  3ZKJ C;  1MG8 A;  5IAA C;  1A5R A;  1WRD B;  4DHJ D;  4OVV A;  5L95 C;  4HLE A;  1WX8 A;  2KTF A;  1AAR A;  4B95 A;  4XX5 A;  3NZS A;  1IPG A;  4EKU A;  1KM7 A;  1NBF C;  1SE9 A;  2MCN B;  3DQV A;  2HJ8 A;  3ZDM C;  3U30 A;  3PS6 A;  3ZNG C;  2DZI A;  1WMH B;  3UIO B;  3GOE A;  3VVW B;  4PS7 A;  1WF9 A;  2NPT A;  2WDT B;  2DEN B;  4AOF A;  4BVU C;  5JHB A;  2O2V B;  1WI0 A;  2MQJ A;  2K6D B;  3HIZ A;  2KFJ A;  1IP9 A;  2KO3 A;  4GGQ A;  1P0R A;  2FCQ A;  5CX3 A;  3BIN A;  3A9J A;  4EUT A;  1WXS A;  4FJZ A;  2JZ3 B;  5DPT A;  3ONS A;  2IBI B;  1ISN A;  4WJP A;  5D94 A;  4EZJ A;  2V1Y A;  1OGW A;  3VXW A;  1WXM A;  5CHF A;  3SU8 X;  5G2N A;  3T8M A;  1E7V A;  4FHJ A;  5DPW A;  1ZGU B;  1WGD A;  3ZRF A;  3T9L A;  4TQ0 A;  2VRR B;  4MJS B;  4CHK A;  3HM3 A;  2K1F A;  3PRP B;  4NJ7 A;  2MBH A;  2KC2 A;  4FUL A;  3LDZ E;  4NAW A;  4ZDV A;  1C3T A;  2KWC A;  2KAN A;  1H8C A;  1WJ6 A;  2L8J A;  1E5W A;  1WFY A;  1E8Z A;  2J7Q B;  2KX0 A;  3D32 A;  3WAP A;  2IYD B;  2JRI B;  3KUC B;  1V80 A;  2ZPY A;  1P9D U;  2M17 A;  3L0W B;  3L54 A;  4HJK A;  3M63 B;  2MA9 B;  3M95 A;  2MP2 A;  3MTN B;  3RT3 B;  4KSL C;  3TL5 A;  4KZ0 A;  4RM8 A;  3ZTC A;  2JY6 A;  3DOW A;  1WR6 E;  1OEY A;  2LUE A;  1CMX B;  3ZDT A;  3H7P A;  1LXD A;  3QAQ A;  4GDL B;  4E71 A;  2IY0 B;  2LVP A;  2C7N B;  2QHO A;  3WAL A;  4IWQ A;  2XEW A;  1V86 A;  3I3T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...