1OEYJ

Heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'HMTNWLRVYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 2
publication title Pb1 Domain-Mediated Heterodimerization in Nadph Oxidase and Signaling Complexes of Atypical Protein Kinase C with Par6 and P62
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 105
sequence length 105
chains with identical sequence K, L, M
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1oeyJ00
3ML9A 3RUIB 1LM8B 2OJRA 3QA8A 4IM3A 1WIAA 1E8ZA 4XC2A 2LZ6A 5D94A 1WXMA 3TL5A 2YLMA 3ONSA 2V3SA 4MELA 2MSED 4BBNF 1TTNA 1OEYA 3PRMB 4W9LA 4A20A 1YX6B 4HXDA 2IBIB 2C9WB 2CHWA 2DYOA 3WANA 4KZCA 2KKCA 4WWPA 3H9DA 4M8MA 4B9KA 5G55A 1FXTB 1WFYA 3QJZA 4W9EA 3RCZA 2MWSB 4A3PA 1RFAA 2CS4A 1UD7A 1WH3A 1V49A 4F7ZA 5BO4B 4BBNC 2IY1B 2PEAA 2ASQA 2IY0B 3MTNB 4W9IA 2LXCA 5CHWA 2UYZB 4EUTA 5C23A 2HD5B 4KZ0A 4W9CA 3R7RA 3LDZE 3RZWC 1RAXA 4DHJD 1OGWA 2D10A 2O2VB 4IG7B 2Y5BB 4II2B 3EFUA 2MQJA 3AI5A 2Z0DB 2A4ZA 2DZKA 3X23A 2IO1B 4W9KA 3ZVVA 1WZ0A 3WAPA 4IWPA 3KUDB 3TIXA 2KQ7A 3PRZA 4TV3A 3AU5A 2MP2B 3PHXB 3L16A 2C7HA 3ML8A 4FJVB 3UIPB 3UQBA 3TMPB 4DDID 2B3AA 1WXSA 3QCAA 4ANUA 5J18A 1GC6A 5CHFA 5E6PA 2MP2A 1YX5B 3AULA 2N1VA 3Q3FA 2KC2A 1WJUA 1SE9A 4ZYNA 4CHKA 2N7DA 5DPRA 1OQYA 2NVUI 4IWOA 4WJNA 4FHKA 3DDCB 3ALBA 3B1LX 3ZIMA 1ZGUB 4ICVA 2V1YA 4W9GA 1V2YA 1I42A 3ZNHB 2L8JA 1AARA 2KWCA 2WX1A 3QIJA 2RR9A 4RMAA 4EZJA 3H6NA 2ZNVB 4W9JA 2G45B 3DVGY 2JT4B 3U7DA 1GNUA 4GB9A 4II3B 1RLFA 2JWZA 3SHQA 2ZCBA 1WGYA 2M8SA 3IHPC 4K7UA 2IO0B 2ZNVC 3V6EB 2FCSA 3D32A 4BFRA 5KHQA 1WX9A 2EMSA 2A5UA 3O65B 4KVGB 4AWJA 4JIOU 3NHEB 4HK2A 3ZKJC 3EHVA 4P7IA 1HE8A 1WX8A 3ZTDA 4EZLA 2UWQA 1A5RA 2DZMA 2KDBA 2K8BA 2XK5B 2ZPYA 3T9LA 4NJ7A 4ASWC 4I6NB 1I35A 2WYQA 4HPLB 2R2OA 1C3TA 4K7WA 4HJKA 4FLHA 1JRUA 2N7EA 4GGQA 2XK5A 4K1RB 1J19A 1WXVA 2BYEA 4GN1A 2K6QA 2MW5A 4WJPA 2RSUA 4W9FA 4G0NB 2KJRA 4K81A 2KHWB 3V6CB 4IM2A 3HK0A 3NZSA 3H7SA 3R3MA 3PRPB 1E5WA 2MCNB 3KW5B 3VXWA 3DBLI 3P2BA 3PV1A 1IPGA 2OOBB 3OJ3A 4FN2A 4PYZA 1V9JA 1WR6E 3L0WB 4DK5A 3M95A 2NBWB 3DCGA 1E8YA 1XQQA 2L0FA 2MX2A 2PPHA 4MGYE 1YQBA 2GBRA 2FCMA 2GBKA 2N9EB 3AXCA 1RRBA 2L05A 1XT9B 4FJZA 4GDKB 4MEMA 1VD2A 4W9DA 4FA6A 2VRRB 2DYMA 2GBNA 2KTFA 4MGIE 1SGHA 4A3OA 3VVWB 4M8NA 1UBQA 3ENEA 2LD9A 2WX0A 2JUOA 4GDKA 2NBUA 2FAZA 3L13A 1V6EA 4MSQB 3PVLA 5LLIA 2BWES 5DPTA 2MBOA 2O6VB 4ZDVA 2KTRB 3H7PB 2EKEC 4K7SA 2NPTB 2KDIA 1WGDA 2DZJA 1P98A 2BGFA 3IVFA 3KUCB 1WJNA 2O6VA 2KTRA 3H7PA 3I3TB 2JPHA 1G6JA 4FJYA 2NPTA 3SD5A 4BKGA 3ZNID 2L0TA 2J7QB 2J0JA 3HM6X 2NR2A 4GDLB 4DDGD 4YL8A 2JXXA 4GXBA 5JH5C 2G4DB 2D07B 4IUMB 3U8ZA 3VFKA 5IAAC 2BPSA 1WE6A 2AL6A 4JQWC 4GDLA 2KJHB 3BINA 4MSMB 2DENB 2KQSA 1C1YB 1NBFC 2KX3A 2LUEA 2K39A 5AZHA 3HHMA 3S2AA 1E7UA 3PREA 2PE6B 4ZRIA 2IO2B 2M4NA 2LXAA 3V62A 3PTFC 2GMIC 3SDLC 1KOTA 1P0RA 5DPSA 3W1SA 3W1SC 4NPNA 4EEWA 3A4RA 5G2NA 3JVZX 4BKSA 2FUHB 4WWOA 4ANVA 3V60A 3WIMA 1H8CA 4PS8A 1E8XA 1EUVB 2DYBA 2LRWA 1LXDA 3APDA 1UELA 4DBGA 4HVBA 2KK8A 4LCDE 1V86A 4IW0A 3KH0A 1IP9A 4HLEA 3UGBB 1BT0A 2XBBC 2D11A 4TQ1A 2FCNA 3ZTCA 3CSFA 1S3SG 1KM7A 1OEYJ 2HTHA 3R7QA 3B0AA 3VTWA 1V5OA 2C7NB 2DX5B 2G3QB 3PT2B 3QC8B 1J8CA 1TZ1A 3A9JB 2BYVE 2NS5A 3JSVB 3L54A 3PS6A 3QX1A 5E6OA 5LXIB 4M0WB 3QARA 5DPWA 4KSKC 3ZNGC 3WAOA 4MGZE 2JZZA 4HCPB 2WWZA 3A9JA 3JSVA 2FNJB 2HE7A 2N9PC 3CMMB 3DBHI 3HIZA 4ANXA 1VCBA 3VUWA 3ZRFA 4GMVA 2CU1A 4WQOB 2CR5A 1P1AA 2KDFB 4CYEA 4LDTB 2K25A 3B08A 3RD2A 2GBJA 2N1WA 3DPDA 2KDEB 2O6VD 2BYFA 2HJ8A 1WE7A 3GOEA 4J6IA 4NQLB 4RM8A 4B95A 4ANWA 4BVUC 3PZDA 2KJ6A 2NCNA 1ISNA 3UINB 3BY4B 2GBMA 2KXJA 2Z59B 1GG3A 2QHOA 3ZRCA 2LRUA 1WX7A 4AJYB 1F9JA 5JHBA 2DAFA 4BOZB 1OTRB 1WZ3A 3L17A 3WA0A 3NOBA 3M62B 3A1QB 2G4SA 3MJWA 1WXAA 4NAWB 3APCA 3OLMD 2KFJA 5D6JB 4HCNB 2MBQA 3NZUA 3RYTA 1E90A 1NI2A 3UIOB 3VTUA 3VUXA 5LXHA 1WJ6A 2MRPA 3A1QA 1R4NI 1TBEA 1TGZB 4NAWA 4PYUA 4WJOA 2JY6A 1WM2A 2IO3B 5E6NA 2M17A 2ZCCA 3VHTC 3GZNI 1X1MA 2ZZPB 2AYOB 3QK0A 1WGHA 2NBVB 3SU8X 4KIKB 3DOWA 5JHAA 1M94A 4E3CA 3KVFB 4BKSD 5AEKB 1L2NA 2KFKB 2PJHA 1UGMA 4IM0A 2D2QA 2ZVOA 1V81A 2CHXA 3KYCD 2FCQA 4HPMB 3N30A 4KIKA 5DCNA 4IWQA 2CHZA 5CHVC 5CX3A 1Q1OA 2M0XA 2KFKA 5AZFA 2KVRA 4MDKE 1Y8RC 3A33B 5KHOA 4DXAB 3MHSD 4F1SA 3DVGX 3ZO5B 4AUQC 4WAAA 5L95C 2LVOA 3H1UA 3L10B 2W9NA 4I6PA 5D2MB 1WM3A 2YVCA 4ICUA 3W1YA 3CF6E 2LASA 4OVVA 3ZUNA 2L00B 1LQBA 2KOXA 4EFOA 2KWVB 5FR6A 2MA9B 3PHWB 3DVNU 3VQIA 1CMXB 4EOYA 4JL9A 3T8MA 3A9KB 2C7MB 3UF8A 4URKA 4KV2A 4TKNA 2R2QA 1Q5WB 2K1FA 4HDOA 2K8HA 3KUZA 4I6LB 1XD3B 2JVCA 2XEWA 1WYWB 3K9OB 1NDDA 2L76A 3A9KA 1WGGA 1KJTA 2L7RA 2LVQA 1MG8A 2N4FA 1WR1A 4HDQA 3CSTA 3VAWA 3KYDD 2LGDA 4GSWA 3PPAA 3PLUA 2DHZA 2PE9A 3TJPA 3WALA 5JZEB 1LFDA 4LDTD 2MBEA 2EMTA 2J0MA 1EF1A 3RT3B 4WJQA 2KD0A 3N3KB 3N32A 3X0WA 2LJ5A 2KANA 2LVPA 3L08A 2K8CA 2KZRA 2M1MA 1L7YA 2Z0EB 2JRHA 3PSEB 3TCAA 3VUYA 1P9DU 3VH3B 3OAWA 2I1KA 2C5LC 1GUAB 4G11A 4LJPB 1GJZA 2KC1A 2KO3A 2LWPA 2N9XA 2RPQA 3PGEA 2KLCA 3M63B 4GOCA 4OVUA 1IYFA 1SIFA 4BOSC 1WY8A 2BKRB 3NS8A 4XZ4A 4W9HA 4NJ6A 2MBHA 2JF5A 3HM3A 2C60A 4ZRJA 4E71A 3AU4A 3VH4B 4GIVA 3OJ4B 1S1QB 3IFWB 3IBEA 3ZDTA 1T0YA 2O2VA 2V4LA 4MGKE 5IA7A 2FIDA 2KLGA 1K8RB 1YD8U 2MLBA 4FBJB 1P3QU 3WAMA 4DHZB 3V61A 3RZFA 4JGHB 3VDZA 1ZKHA 3K9PB 2IYDB 4FULA 3ZW3A 3JW0X 3RULA 1H4RA 3DBSA 4FADA 1WJ4A 2JRIB 3ZNZB 1V5TA 4TQ0A 2MBBB 2I1JA 2LGYA 1E7VA 4N9F4 3U30A 5J2RA 1U4AA 2JZ3B 2KWUB 4WWNA 4B6WA 4RM9A 4TUUA 4IC7B 1D3ZA 4KDIC 5TR5A 1WMHB 2KX0A 4EZKA 4CO7A 4DHZE 2AL3A 2BF8B 5D7GA 4EKUA 2ZEQA 3IG3A 1J0GA 3APFA 2D3GA 4AOFA 3QQ8B 2ZJDA 1WF9A 3EECA 1WMHA 5CTRC 1ZW7A 4F8CB 3R66C 1EO6A 2LI5A 4KDLB 5C1ZA 3QAQA 2FIFA 2LGXA 3QHTA 5EDSA 4FHJA 1UH6A 4X57B 1QZEA 1WGRA 1Z5SB 2AWTA 1GC7A 4DHJB 4G3XB 1KLVA 1EF5A 4MM3A 2KMCA 1PQSA 3EC8A 3Q3JA 4G50A 1V80A 2IZVB 5L83A 2J0KA 2K6DB 3ZDMC 1UBIA 3DBRI 3ECIA 2RGFA 1Z2MA 1WRDB 2ZPNA 3C0RB 4BKTA 3LJ3A 2GOWA 3JYUA 3NY5A 3UQAA 2KN5A 2DAJA 1Q0WB 3ZLZA 3TBLD 3QWZB 4E74A 3A4SC 2KMAA 3DQVA 2L3ZA 1YIWA 4MJSB 4XX5A 4AP4C 2BKFA 2RD0A 4GU2A 4NY0A 4AJWA 4KSLC 4NQKE 2ZVNA 5HKHA 2KNBA 3DVNV 5GMVA 1E8WA 4NNJB 1UZXB 4MJSA 3VTVA 2REXA 1YJ1A 4HWIB 3PLVA 5AZGA 4MH0E 4JLCA 5J17A 3M3JA 2AEHA 2CKHB 4PS7A 4PS3A 2WDTB 4ZRKA 4DWFA 1R4MI 1WI0A 2DZIA 4LJOB 2BWFA
chains in the Genus database with same CATH superfamily
3ML9A 4FXCA 1C4AA 4IM3A 1E8ZA 2EELA 1QOFA 2WXOA 3KWLA 3TL5A 1TTNA 4A20A 3DBRB 1F2RI 4RGMA 4RGNA 4KZCA 3H9DA 4B9KA 2DWQA 1FXTB 1WFYA 1UWMA 3ABVB 1AW7A 4W9EA 1QILA 4A3PA 1WH3A 4UDUC 1VDVA 2VZKB 1CQVA 2PEAA 3RNEC 2LXCA 2UYZB 5C23A 4KZ0A 3LDZE 4QAYA 4S17A 1RAXA 1L6VA 2D10A 1WWTA 3AI5A 3X23A 2KQ7A 3AE6B 3MJ5A 3AU5A 2UU7A 2C7HA 3L16A 3B2GA 3UIPB 2WDRB 3TMPB 4ANUA 5J18A 1F0ZA 4WAFA 1FCCC 4IOIE 1F2RC 3DDCB 3B1LX 2JQRB 3I5JC 2L8JA 4RMAA 3AEFB 2AQ1B 4W9JA 5HG2A 2G45B 4ITKA 1TS4A 2JT4B 3U7DA 4M02A 5GXGB 5LNK1 2BW2A 2JWZA 4TSSA 1TIFA 1WGYA 4A55A 2IO0B 3V6EB 2FCSA 3D32A 4BFRA 3PZ8A 4BZAA 3EHVA 1IBXA 2XK5B 4K7WA 4C7YA 4FLHA 2N7EA 3BK1A 1V1PA 1F77A 3NVZA 1DOYA 2KJRA 1GB4A 3H7SA 3R3MA 1IPGA 4HPPA 4FN2A 1VRAB 2QDFA 2IPKD 3L0WB 2AX5A 5BYRA 1E8YA 1XLNA 1YQBA 4MEMA 4GDKB 3VRBB 4W9DA 2QMTA 2GBNA 2Z8LA 4A3OA 4M8NA 1UBQA 3ENEA 3FILA 2WXRA 2LD9A 5IO9A 2NBUA 1D5ZC 1D5MC 2MBOA 2EKEC 1RWSA 3AB5A 1JW9D 3IVFA 3TSSA 3H7PA 1G6JA 2NPTA 3EA6A 3ZNID 1PDXA 3ZGZA 3AV8A 5I4DA 1CZPA 2G4DB 2KJHB 3GE8C 4NJCA 4OZAA 3PTFC 2QSDA 1P0RA 4NPNA 3A4RA 4B0MA 3TEZA 4BKSA 2FUHB 4RF1A 1UF0A 2WXIA 2DYBA 4C4VA 3APDA 4DBGA 3P4SB 4JWUC 3KH0A 4YT0B 2L32A 1V5OA 3P4PB 5T8IA 2LGSA 2NS5A 4KKIA 5DPWA 2MJEA 2BBCA 3WAOA 1SBBB 3JSVA 3EGRA 1EWCA 1VCBA 4C00A 3VUWA 3ZRFA 4GMVA 1FXAA 4ZRQA 1XLOA 2QJLA 2ONQA 3P4QB 2GBJA 2O6VD 2I2YA 2BYFA 3RNAC 1ZXIA 3GOEA 1SB3C 3U4EG 4BVUC 3PZDA 3BVZA 3P1MA 1PGAA 2GBMA 1BMLC 1JWBD 5FR3A 1GG3A 1FM0D 3PZ7A 1F9JA 2DAFA 1DGJA 2CU3A 2VZKD 2QIEB 3NZUA 1VJKA 1WJ6A 1JRPA 4NAWA 1R4NI 4PYUA 3AE8B 4YSXB 4AS1A 2ZZPB 4B0EA 1TY0A 3QK0A 4KIKB 1L2NA 2LHEA 5AEKB 4IM0A 1K53A 1P7EA 2PW9A 2WQYB 3KYCD 2FCQA 1IGCA 3BYTB 5H92C 3AN1A 2MH7A 2VH2A 2KFKA 1V1OA 1C4CA 2YVCA 4ICUA 2NMQA 1GB1A 1N61A 3C19A 2KWVB 2RMMA 1HTOA 1OQQA 3UF8A 4URKA 2K1FA 4EE2A 3KUZA 3K9OB 1WYWB 2L76A 1MG8A 2WXMA 3CSTA 1LGRA 3KYDD 2LGDA 3PPAA 3TJPA 1QOAA 2MBEA 2BQQA 2KD0A 3X0WA 2KANA 2LVPA 1L7YA 2KT7A 2Z0EB 2JRHA 3TCAA 3OAWA 4JPSA 2KO3A 1TKEA 4OVUA 1XO3A 3I57A 4BOSC 2E6XA 1TZOA 4XZ4A 3W5VB 2M0AA 3OJ4B 2MHJA 2G9HD 1K8RB 1YD8U 4FBJB 2BS4B 4FULA 3ZW3A 3RULA 1H4RA 2N7JA 2WXNA 2NTSA 1I4QA 1U4AA 2JZ3B 4WWNA 4RM9A 4TUUA 4KDIC 3RPFC 4DHZE 2AL3A 3LB8C 4EKUA 1HA5A 4M01A 1JWSD 2EKIA 1ZW7A 1EO6A 5C1ZA 3QAQA 1AWDA 3QHTA 4FHJA 1V97A 2WXJA 4X57B 1WGRA 1Z5SB 5EE9A 4G3XB 4MM3A 2KMCA 2PIAA 3U52E 3ZDMC 3WCQA 1UBIA 3DBRI 4A9AA 2RGFA 4KGRA 2L83A 4BKTA 3LJ3A 3JYUA 3NY5A 1Q0WB 1XCTL 3A4SC 4MJSB 4AP4C 2RD0A 4GU2A 5BMHA 4LNOA 1UZXB 3OWEB 2REXA 1YJ1A 4JWSC 4S0RA 3PLVA 1ZDVA 4US8A 2AEHA 4J3OD 2WDTB 1DOIA 2DZIA 3N9YC 3RUIB 1MI0A 1E7PB 1WXMA 2M56B 2YLMA 5HI1A 4N6EB 4MELA 3Q8FA 2WXQA 2MSED 4BBNF 4K3BA 4W9LA 1FMAD 2BB6A 2DYOA 1T5XD 4WWPA 1L6UA 3T3OA 4M8MA 4D2KA 1A70A 3Q2AC 1JALA 2MWSB 3BK2A 1WSPA 4F7ZA 5BO4B 4CQNA 2IY1B 1I4GA 2IY0B 4W9IA 1ENFA 4EUTA 3BWUD 3RZWC 4DHJD 2WHIA 4IG7B 1R4MB 1YQ4B 4II2B 2DZKA 3R2IA 3WAPA 4IWPA 1FCLA 4TV3A 2MP2B 3PHXB 4GLSC 4JE3B 1D4BA 4RGOS 3QCAA 1KRHA 1TKGA 5E6PA 3AULA 3Q8CA 4LTUA 4NAMA 1SE9A 2N7DA 1OQYA 2NVUI 4YSZB 1FRRA 1UWXA 3BVGA 2V1YA 4W9GA 3ZNHB 1AARA 2WX1A 4KKJA 1I7HA 2ZNVB 3DVGY 2VH1A 1MHHE 1GNUA 4KX6B 1RLFA 3MC8A 1UGJA 1MFWA 2BVCA 4Q2JA 5KHQA 1WX9A 2EMSA 2A5UA 2H88B 4KVGB 1JCKB 4AWJA 4JIOU 3NHEB 1EWYC 3ZTDA 4EZLA 1A5RA 3T9LA 4NJ7A 4I6NB 4HPLB 2R2OA 2NTTA 2XK5A 1QKZA 3ZJUA 1WXVA 2BYEA 1C78A 2MW5A 4WJPA 4K81A 4YWGG 4RF0A 2M19A 3HK0A 3PRPB 2IGDA 2MCNB 1IUEA 3KW5B 3ZJTA 3VXWA 2OOBB 1V9JA 1WR6E 2DLBA 2FUG1 2JZPA 4LNNA 1UNSA 4MGYE 2GBRA 3AXCA 4WIPA 2L05A 1M4VA 4FA6A 2VRRB 2KTFA 3VVWB 2LJIA 2JUOA 3GP7A 4GDKA 1V6EA 2BWES 1N60A 2O6VB 2KTRB 3AEEB 2DZJA 5G5GA 2L1AA 2BGFA 3KUCB 1FRDA 2JPHA 2V4IB 4FJYA 1HQRD 1K51A 1I4RA 1SSNA 1TY2A 3DBLB 4DDGD 5IN7A 2JXTA 4IUMB 2D07B 5AUKA 3U8ZA 5IAAC 2BPSA 3W5UB 2AL6A 5GMVA 3BINA 1NBFC 3LYYA 5AZHA 3HHMA 1XF5L 2HJ1A 1FIQA 3JVZX 2W55A 4ANVA 3SFEB 4RFBA 1YN4A 4PS8A 1LXDA 3AEBB 1UELA 2D3BA 4R3DA 3UGBB 1OEYJ 2HTHA 2KAJA 3B0AA 4H2AA 3PT2B 1BXTA 2DX5B 3ZQ4A 1J8CA 1TZ1A 3A9JB 2BYVE 4YTMB 5LXIB 3QX1A 1CJEA 4XGAB 2WWZA 2WXGA 2GLSA 2J53A 1ZXHA 2HE7A 3CMMB 3HIZA 3URYA 1SJHD 1KLUD 2CU1A 2R61A 2CR5A 2K25A 1YMHE 3B08A 2INNE 4J6IA 4B95A 2KJ6A 5E6JA 2Z59B 1ACCA 2K22A 1PGBA 1WX7A 5JHBA 1OTRB 1WZ3A 3WA0A 3NOBA 3M62B 3MJWA 4XWWA 3OLMD 2KFJA 2L52A 2WDVB 4HCNB 3VUXA 1E90A 3UIOB 1TBEA 1T0RC 1TGZB 2KN4A 2ZCCA 3FKYA 2FBWB 3AE7B 2AYOB 3DBHB 1WGHA 2NBVB 3SU8X 5D3IB 3TUOA 3KVFB 2PJHA 1V81A 2CHXA 2W82A 1SE2A 4HPMB 3KQ4A 4KIKA 1YQ3B 2CHZA 4M00A 2KVRA 4MDKE 4DXAB 2Y5PA 4F1SA 3ZO5B 4AUQC 1B9RA 4WAAA 5L95C 1TKYA 3L10B 2W9NA 1NYRA 4I6PA 2JYTA 1FO4A 4EFOA 2KOXA 5FR6A 2MA9B 3PHWB 3VQIA 4PK1A 1CMXB 4EOYA 4JL9A 3Q3NC 4I6LB 1XD3B 2LVQA 2KMMA 1WR1A 3GZNB 3VAWA 1FEHA 2W3RA 4LNKA 4ARIA 3WALA 1LFDA 2EMTA 4WJQA 3N32A 4OW0A 4WWMA 2D3CA 3MFGA 4L23A 1P9DU 2I1KA 2C5LC 3KWVA 1FXIA 4LJPB 3ZXRA 2LWPA 2RDHA 3PGEA 3ZYYX 2PTLA 1IYFA 1SIFA 1WY8A 1JMLA 4LNFA 4W9HA 4NJ6A 1C9FA 2MBHA 1I4XA 3HUIA 1ESFA 4E71A 4ARCA 4GIVA 2V4LA 2FIDA 1L4ZB 4JGHB 3VDZA 1FFVA 1N6ZA 3K9PB 2IYDB 2LFIA 1KH0A 2J52A 1XEEA 2MEKA 3JW0X 3DBSA 3ZNZB 1V5TA 4TQ0A 2LGYA 4N9F4 3U30A 2RPVA 3NRZA 4YSYB 5BYQA 3I63C 1WMHB 2KX0A 2BF8B 3IG3A 1J0GA 4AOFA 3QQ8B 2ZJDA 1WF9A 3AE1B 3EECA 1E10A 2LI5A 1AYFA 1T0SC 1PFDA 2FIFA 2LGXA 1B1ZA 4P6VF 1QZEA 2AWTA 4DHJB 4WURA 1VZ8A 1PQSA 3EC8A 2BTEA 1T3QA 5H8YE 1V80A 2LMCA 5L83A 2J0KA 1D5XC 2ZPNA 3C0RB 2KYWA 3UQAA 1FFUA 3W9CB 2DAJA 3QWZB 3SR6A 4E74A 2L3ZA 2AQ3B 4NY0A 4NQKE 3DVNV 2LHDA 2DBYA 4MJSA 3VTVA 2SAKA 5AZGA 4MH0E 5J17A 3IT4B 4PS7A 4DWFA 1R4MI 1WI0A 4OVZA 4LJOB 2WNMA 2BWFA 1UD7A 2B76B 1LM8B 3IT6B 5D94A 5MPOA 3ONSA 3GS2A 4HXDA 3MHZA 2KKCA 2WP9B 3RCZA 2PLPA 1RFAA 2CS4A 4A6QA 1C76A 1V49A 1YJIA 1ZE3D 1SE3A 4MH8A 4ACFA 3B2FA 4N58A 3B9JA 1BUIC 1XLPA 1TS3A 1ZP0B 4N59A 1GAQB 2J42A 2QILA 2Y5BB 3EFUA 2MQJA 2ICIA 1NYQA 2A4ZA 2IO1B 3ZVVA 3KUDB 2OEDA 3PRZA 4RCOA 3KLSX 2X38A 2B3AA 1WXSA 4DDID 1P7FA 2MP2A 2INDC 1YX5B 1WJUA 4CHKA 2PVOD 2LEKA 4WJNA 1WYGA 3ZIMA 4L1BA 4ICVA 1V2YA 2WGSA 2KWCA 4PT5A 3QIJA 1HEZE 3N1XC 1E0ZA 1L0YB 3IAM1 3BZDB 3Q6BA 2DNFA 4II3B 4ZYSA 4HJGE 3SHQA 3IHPC 5EE1A 1T0QC 2ZNVC 3PO0A 4TMAB 3NZ3A 3O65B 1J7BA 2WU5B 4HK2A 3ZKJC 4P7IA 1HE8A 1WX8A 2UWQA 2DZMA 2KDBA 4ASWC 2WYQA 3UI3A 1VR9A 3BVMA 1C3TA 4HJKA 4GGQA 3BIID 2HTME 4XWTA 4K1RB 3DHIC 2K6QA 3SFDB 2YEPF 1RFKA 2KHWB 1XCQL 4IM2A 3NZSA 1E5WA 5TSSA 3DBLI 3P2BA 1EM7A 3OJ3A 4PYZA 3M95A 2NBWB 2L0FA 2IJ0A 2FCMA 2N9EB 1RRBA 4FJZA 1ET9A 4MGIE 1SGHA 2K3UA 3EUB2 2WX0A 1FNWA 4MSQB 3L4PA 4ZDVA 1NEKB 4K7SA 4XE0A 1VZ6A 2G1EA 3RMKC 4ZHPA 3ETRA 1WJNA 2O6VA 2KTRA 1KLGD 4BKGA 1MJDA 2L0TA 4YTNB 4P1CC 3DHGC 3HM6X 2NR2A 4GDLB 4YL8A 4GXBA 2PMVA 4WQMA 2KQSA 2LUEA 2K39A 1GOZA 3E9SA 3S2AA 1J7CA 1E7UA 4ZRIA 1KF6B 2LXAA 2GMIC 1SIJA 1SJED 3SDLC 3AMZA 5DPSA 3W1SA 4EEWA 3W1SC 1FNVA 5G2NA 4DXGA 3V60A 1H8CA 1EUVB 2LRWA 4RGTA 2KVZA 3LXFA 2KK8A 4LCDE 1V86A 4HLEA 2XBBC 4TQ1A 2FCNA 3ZTCA 1MHXA 1KM7A 1S3SG 3R7QA 2G3QB 3QC8B 4US9A 3L54A 3PS6A 2N0SB 4NZLB 4M0WB 4KSKC 3ZNGC 2JZZA 4HCPB 3A9JA 2N9PC 3DBHI 1YOVB 2GRIA 1L5PA 3DWGC 1P1AA 4CYEA 2KQ4X 1TS5A 5IKCM 2N1WA 3RNBC 2HJ8A 3R8BA 2V0GA 4RM8A 1FD6A 2NCNA 3BY4B 2BT6A 3TEWA 4HKZE 3ZRCA 2LRUA 4AJYB 3L17A 4WH4A 2WXFA 2G4SA 2KWDA 1WXAA 3A1QB 3APCA 2MBQA 1NI2A 3VTUA 3NVYA 2D5GA 2ACZB 3W2DA 4WJOA 2JY6A 5E6NA 2M17A 3VHTC 3GZNI 1QLBB 1X1MA 1VLBA 5JHAA 4E3CA 4BKSD 1UGMA 2D2QA 4ZRPA 3N30A 1GPXA 4IWQA 2H89B 1Q10A 5CX3A 5CHVC 5AZFA 2XN9C 2K0PA 3A33B 5KHOA 2LVOA 3H1UA 1JWAD 5D2MB 1WM3A 1QT9A 3CF6E 2LASA 4OVVA 3ZXVA 3ZUNA 2L00B 1NI3A 3DVNU 3A9KB 1YNTE 1Q5WB 4HDOA 2K8HA 2JVCA 3VRAB 1WGGA 1J7AA 3VR9B 1KJTA 4O1NA 3HVZA 1R7SA 4HDQA 1SXTA 3I9V1 2WDQB 4YTPB 2MJDA 1ZUD2 1ROEA 2K9XA 2PE9A 1TYGB 4LDTD 2J0MA 1EF1A 3RT3B 1LO5D 3N3KB 3NS1A 2Y3AA 2K8CA 3PSEB 3VH3B 1AN8A 4MACA 4MT5A 4DQOC 4G11A 4OZCA 1GJZA 2D3AA 2V3PA 2KC1A 4IKGA 3FAHA 1PUTA 1HTQA 2N9XA 2JYEA 3M63B 1DYQA 4L2YA 3NS8A 3DHHC 3HM3A 3AU4A 1S1QB 3IBEA 3J9CA 1T0YA 2O2VA 3R2TA 2MLBA 4DHZB 3H8HA 2ZW1A 1ZKHA 3P4RB 1WGKA 4ZHOA 1WJ4A 2JRIB 5C2TB 1TT5B 2I1JA 3AE9B 1E7VA 5J2RA 2KWUB 4IC7B 5TR5A 2ZW0A 4CO7A 3NUHB 5D7GA 4OHJA 1XXGA 3N1YC 3TEXA 1PGXA 1WMHA 2N9LA 2HDEA 4F8CB 3R66C 2PKOA 4KDLB 5EDSA 1QOGA 3BYYB 1OQRA 1KLVA 1EF5A 3TEYA 3Q3JA 4G50A 4P1BC 1C77A 1TJEA 3AEDB 3ECIA 2E3TA 2RDBC 1Z2MA 1WRDB 2V9HA 5FK9C 2GOWA 1MG4A 2V3NA 2KN5A 3ZLZA 3TBLD 3DQVA 4XX5A 1I4PA 4KSLC 1D6EC 2KNBA 4NNJB 1C79A 4HWIB 2KDMA 3AEAB 4JLCA 3M3JA 2CKHB 4PS3A 3AE2B 4BAXA 4ZRKA 2INPE 2BS3B 3AH7A 2OJRA 3QA8A 2I38A 1WIAA 4XC2A 2LZ6A 1ZDXA 2V3SA 2SEBD 2N9KA 1KTKA 1OEYA 3PRMB 1YX6B 3P42A 3Q3MC 3Q3OC 2IBIB 2C9WB 2CHWA 1Y56A 3WANA 1FNUA 5G55A 3QJZA 2LGIA 1HZ6A 2ON8A 4USAA 4BBNC 4ZOHC 3O13A 2ASQA 3MTNB 5EE0A 3GB1A 5CHWA 2HD5B 3R7RA 4W9CA 3U7ZA 1OGWA 2O2VB 4HKQA 1DOXA 2Z0DB 1FPYA 4W9KA 1WZ0A 3TIXA 4LLGM 3ML8A 4FJVB 3UQBA 3Q14C 1WXQA 1GC6A 4KGTA 5EE3A 5CHFA 4C80A 4RH6A 2N1VA 3Q3FA 2KC2A 4ZYNA 3RNGC 5DPRA 1PYWD 4IWOA 1EU4A 2WXPA 4FHKA 1XLQA 1IGDA 3ALBA 3RNCC 1ZGUB 2WXHA 4HROA 1I42A 4HEA1 2RR9A 4EZJA 3N20C 3H6NA 1SF0A 4GB9A 4P16A 5BYSA 2ZCBA 1MVKA 2JSVX 2M8SA 4K7UA 1IBXB 1E6EB 4LK0M 1HZ5A 1MPEA 1V1PB 2ZPYA 2K8BA 1I35A 5FKAC 3Q8AA 1V8CA 1JRUA 1QQRA 1T6BX 2BS2B 3Q8EA 2K5PA 1NVID 1J19A 4GN1A 1WRIA 4OZBA 2IDYA 2RSUA 4W9FA 4G0NB 3V6CB 2YEPB 4KGSA 1NENB 3PV1A 2PVGC 1K52A 3AE3B 3OG5A 4DK5A 1UUPA 1STEA 3DCGA 1XQQA 4HRSA 2MX2A 2PPHA 2GBKA 3FILB 4C7ZA 3RN9C 1XT9B 1VD2A 2DYMA 1JWUD 3AM9A 2FAZA 3AECB 3L13A 3PVLA 4XYCA 5LLIA 5DPTA 3AEGB 5C3JB 3ZJVA 3H7PB 2NPTB 2KDIA 1WGDA 1P98A 5IP4D 3I3TB 1ET6A 3SD5A 4C56C 3IAS1 2BB5A 2J7QB 1JROA 1C4PA 2J0JA 1ZOYB 2JXXA 3CIRB 5JH5C 3VFKA 1WE6A 3N1ZC 4JQWC 4GDLA 4MSMB 2DENB 2KX3A 1C1YB 1L4DB 1YN5A 3PREA 2PE6B 2IO2B 2M4NA 5IOIA 3V62A 4A90A 1N62A 1KOTA 4C4VB 4WWOA 2CJNA 3WIMA 1QOBA 4REZA 1E8XA 3RNFC 4HVBA 2TSSA 4IW0A 1IP9A 1BT0A 2D11A 3CSFA 2WXKA 3V3XA 3RI7C 3VTWA 3U2SC 2C7NB 1SEBD 2OHFA 3JSVB 3SEBA 5E6OA 2GB1A 3AE4B 3MC9A 3QARA 4MGZE 2QEJC 2FNJB 2LUMA 1F52A 4M0WA 4ANXA 4WQOB 2IGGA 2KDFB 4LDTB 1N5XA 3RD2A 3DPDA 2KDEB 1YJJA 1WE7A 4NQLB 4ANWA 3CWIA 4RNAA 1QF6A 1ISNA 3UINB 2KXJA 1KFYB 2QHOA 3T3NA 2BYTA 4BOZB 2XNAC 4NAWB 4YXDB 2MJ3A 5D6JB 3RYTA 5LXHA 2Y5CA 1L0XB 2MRPA 3A1QA 1WM2A 2IO3B 3NJTA 3EFCA 5D3DA 1TS2A 3DOWA 1M94A 2GI9A 2KFKB 2KACA 2ZVOA 2RDGA 1ZPSA 5DCNA 1HXYD 3IXSA 1Q1OA 2M0XA 2OJWA 1Y8RC 3MHSD 3DVGX 3Q69A 1YN3A 3W1YA 3V05A 2X8XX 1LQBA 2QC8A 3HVDA 3VR8B 3T8MA 2C7MB 1E9MA 4KV2A 2AQ2B 4TKNA 2R2QA 4K3CA 1RYJA 2XEWA 1R4NB 1NDDA 3A9KA 2L7RA 2N4FA 1N5WA 1N63A 2J4XA 4GSWA 3PLUA 2DHZA 2FE8A 1F1HA 3MC0B 5JZEB 1I4HA 2WS3B 4XDDA 2LJ5A 3L08A 2KZRA 2M1MA 1JWMD 3VUYA 3AE5B 3NVWA 2JX5A 1GUAB 2WLBA 4LNIA 2RPQA 3C8YA 3NG0A 3P63A 2KLCA 5BMGA 4GOCA 1K50A 4IDIA 4AQ7A 2BKRB 1CK1A 2JF5A 2C60A 2W3SA 4ZRJA 3VH4B 1RM6C 3ZDTA 3IFWB 4DXFA 4MGKE 5IA7A 2KLGA 1OFFA 1P3QU 3WAMA 3V61A 3RZFA 2IGHA 5AUIA 2JU6X 3NVVA 4FADA 2MBBB 2W54A 1JQ4A 4B6WA 3HRDD 2INCC 1D3ZA 2JWUA 4EZKA 1SE4A 2QCZA 2ZEQA 5JXVA 3APFA 3FC4A 2D3GA 5CTRC 5BMIA 4MM3B 1L0VB 1UH6A 4JX1C 1GC7A 2Q5WD 3DWMA 2CJOA 5HFYA 2IZVB 5HHDG 2K6DB 5G5HA 3E56A 3GE3C 2KMAA 1YIWA 1EU3A 1VZ7A 2BKFA 4AJWA 5HKHA 2ZVNA 3RFZB 4A8XC 1E8WA 3MP9A 2WXLA 4XDCA 2WU2B 3Q8BA
chains in the Genus database with same CATH topology
3ML9A 3RUIB 1LM8B 2OJRA 3QA8A 4IM3A 1WIAA 1E8ZA 4XC2A 2LZ6A 5D94A 1WXMA 3TL5A 2YLMA 3ONSA 2V3SA 4MELA 2MSED 4BBNF 1TTNA 1OEYA 3PRMB 4W9LA 4A20A 1YX6B 4HXDA 2IBIB 2C9WB 2CHWA 2DYOA 3WANA 4KZCA 2KKCA 4WWPA 3H9DA 4M8MA 4B9KA 5G55A 1FXTB 1WFYA 3QJZA 4W9EA 3RCZA 2MWSB 4A3PA 1RFAA 2CS4A 1UD7A 1WH3A 1V49A 4F7ZA 5BO4B 4BBNC 2IY1B 2PEAA 2ASQA 2IY0B 3MTNB 4W9IA 2LXCA 5CHWA 2UYZB 4EUTA 5C23A 2HD5B 4KZ0A 4W9CA 3R7RA 3LDZE 3RZWC 1RAXA 4DHJD 1OGWA 2D10A 2O2VB 4IG7B 2Y5BB 4II2B 3EFUA 2MQJA 3AI5A 2Z0DB 2A4ZA 2DZKA 3X23A 2IO1B 4W9KA 3ZVVA 1WZ0A 3WAPA 4IWPA 3KUDB 3TIXA 2KQ7A 3PRZA 4TV3A 3AU5A 2MP2B 3PHXB 3L16A 2C7HA 3ML8A 4FJVB 3UIPB 3UQBA 3TMPB 4DDID 2B3AA 1WXSA 3QCAA 4ANUA 5J18A 1GC6A 5CHFA 5E6PA 2MP2A 1YX5B 3AULA 2N1VA 3Q3FA 2KC2A 1WJUA 1SE9A 4ZYNA 4CHKA 2N7DA 5DPRA 1OQYA 2NVUI 4IWOA 4WJNA 4FHKA 3DDCB 3ALBA 3B1LX 3ZIMA 1ZGUB 4ICVA 2V1YA 4W9GA 1V2YA 1I42A 3ZNHB 2L8JA 1AARA 2KWCA 2WX1A 3QIJA 2RR9A 4RMAA 4EZJA 3H6NA 2ZNVB 4W9JA 2G45B 3DVGY 2JT4B 3U7DA 1GNUA 4GB9A 4II3B 1RLFA 2JWZA 3SHQA 2ZCBA 1WGYA 2M8SA 3IHPC 4K7UA 2IO0B 2ZNVC 3V6EB 2FCSA 3D32A 4BFRA 5KHQA 1WX9A 2EMSA 2A5UA 3O65B 4KVGB 4AWJA 4JIOU 3NHEB 4HK2A 3ZKJC 3EHVA 4P7IA 1HE8A 1WX8A 3ZTDA 4EZLA 2UWQA 1A5RA 2DZMA 2KDBA 2K8BA 2XK5B 2ZPYA 3T9LA 4NJ7A 4ASWC 4I6NB 1I35A 2WYQA 4HPLB 2R2OA 1C3TA 4K7WA 4HJKA 4FLHA 1JRUA 2N7EA 4GGQA 2XK5A 4K1RB 1J19A 1WXVA 2BYEA 4GN1A 2K6QA 2MW5A 4WJPA 2RSUA 4W9FA 4G0NB 2KJRA 4K81A 2KHWB 3V6CB 4IM2A 3HK0A 3NZSA 3H7SA 3R3MA 3PRPB 1E5WA 2MCNB 3KW5B 3VXWA 3DBLI 3P2BA 3PV1A 1IPGA 2OOBB 3OJ3A 4FN2A 4PYZA 1V9JA 1WR6E 3L0WB 4DK5A 3M95A 2NBWB 3DCGA 1E8YA 1XQQA 2L0FA 2MX2A 2PPHA 4MGYE 1YQBA 2GBRA 2FCMA 2GBKA 2N9EB 3AXCA 1RRBA 2L05A 1XT9B 4FJZA 4GDKB 4MEMA 1VD2A 4W9DA 4FA6A 2VRRB 2DYMA 2GBNA 2KTFA 4MGIE 1SGHA 4A3OA 3VVWB 4M8NA 1UBQA 3ENEA 2LD9A 2WX0A 2JUOA 4GDKA 2NBUA 2FAZA 3L13A 1V6EA 4MSQB 3PVLA 5LLIA 2BWES 5DPTA 2MBOA 2O6VB 4ZDVA 2KTRB 3H7PB 2EKEC 4K7SA 2NPTB 2KDIA 1WGDA 2DZJA 1P98A 2BGFA 3IVFA 3KUCB 1WJNA 2O6VA 2KTRA 3H7PA 3I3TB 2JPHA 1G6JA 4FJYA 2NPTA 3SD5A 4BKGA 3ZNID 2L0TA 2J7QB 2J0JA 3HM6X 2NR2A 4GDLB 4DDGD 4YL8A 2JXXA 4GXBA 5JH5C 2G4DB 2D07B 4IUMB 3U8ZA 3VFKA 5IAAC 2BPSA 1WE6A 2AL6A 4JQWC 4GDLA 2KJHB 3BINA 4MSMB 2DENB 2KQSA 1C1YB 1NBFC 2KX3A 2LUEA 2K39A 5AZHA 3HHMA 3S2AA 1E7UA 3PREA 2PE6B 4ZRIA 2IO2B 2M4NA 2LXAA 3V62A 3PTFC 2GMIC 3SDLC 1KOTA 1P0RA 5DPSA 3W1SA 3W1SC 4NPNA 4EEWA 3A4RA 5G2NA 3JVZX 4BKSA 2FUHB 4WWOA 4ANVA 3V60A 3WIMA 1H8CA 4PS8A 1E8XA 1EUVB 2DYBA 2LRWA 1LXDA 3APDA 1UELA 4DBGA 4HVBA 2KK8A 4LCDE 1V86A 4IW0A 3KH0A 1IP9A 4HLEA 3UGBB 1BT0A 2XBBC 2D11A 4TQ1A 2FCNA 3ZTCA 3CSFA 1S3SG 1KM7A 1OEYJ 2HTHA 3R7QA 3B0AA 3VTWA 1V5OA 2C7NB 2DX5B 2G3QB 3PT2B 3QC8B 1J8CA 1TZ1A 3A9JB 2BYVE 2NS5A 3JSVB 3L54A 3PS6A 3QX1A 5E6OA 5LXIB 4M0WB 3QARA 5DPWA 4KSKC 3ZNGC 3WAOA 4MGZE 2JZZA 4HCPB 2WWZA 3A9JA 3JSVA 2FNJB 2HE7A 2N9PC 3CMMB 3DBHI 3HIZA 4ANXA 1VCBA 3VUWA 3ZRFA 4GMVA 2CU1A 4WQOB 2CR5A 1P1AA 2KDFB 4CYEA 4LDTB 2K25A 3B08A 3RD2A 2GBJA 2N1WA 3DPDA 2KDEB 2O6VD 2BYFA 2HJ8A 1WE7A 3GOEA 4J6IA 4NQLB 4RM8A 4B95A 4ANWA 4BVUC 3PZDA 2KJ6A 2NCNA 1ISNA 3UINB 3BY4B 2GBMA 2KXJA 2Z59B 1GG3A 2QHOA 3ZRCA 2LRUA 1WX7A 4AJYB 1F9JA 5JHBA 2DAFA 4BOZB 1OTRB 1WZ3A 3L17A 3WA0A 3NOBA 3M62B 3A1QB 2G4SA 3MJWA 1WXAA 4NAWB 3APCA 3OLMD 2KFJA 5D6JB 4HCNB 2MBQA 3NZUA 3RYTA 1E90A 1NI2A 3UIOB 3VTUA 3VUXA 5LXHA 1WJ6A 2MRPA 3A1QA 1R4NI 1TBEA 1TGZB 4NAWA 4PYUA 4WJOA 2JY6A 1WM2A 2IO3B 5E6NA 2M17A 2ZCCA 3VHTC 3GZNI 1X1MA 2ZZPB 2AYOB 3QK0A 1WGHA 2NBVB 3SU8X 4KIKB 3DOWA 5JHAA 1M94A 4E3CA 3KVFB 4BKSD 5AEKB 1L2NA 2KFKB 2PJHA 1UGMA 4IM0A 2D2QA 2ZVOA 1V81A 2CHXA 3KYCD 2FCQA 4HPMB 3N30A 4KIKA 5DCNA 4IWQA 2CHZA 5CHVC 5CX3A 1Q1OA 2M0XA 2KFKA 5AZFA 2KVRA 4MDKE 1Y8RC 3A33B 5KHOA 4DXAB 3MHSD 4F1SA 3DVGX 3ZO5B 4AUQC 4WAAA 5L95C 2LVOA 3H1UA 3L10B 2W9NA 4I6PA 5D2MB 1WM3A 2YVCA 4ICUA 3W1YA 3CF6E 2LASA 4OVVA 3ZUNA 2L00B 1LQBA 2KOXA 4EFOA 2KWVB 5FR6A 2MA9B 3PHWB 3DVNU 3VQIA 1CMXB 4EOYA 4JL9A 3T8MA 3A9KB 2C7MB 3UF8A 4URKA 4KV2A 4TKNA 2R2QA 1Q5WB 2K1FA 4HDOA 2K8HA 3KUZA 4I6LB 1XD3B 2JVCA 2XEWA 1WYWB 3K9OB 1NDDA 2L76A 3A9KA 1WGGA 1KJTA 2L7RA 2LVQA 1MG8A 2N4FA 1WR1A 4HDQA 3CSTA 3VAWA 3KYDD 2LGDA 4GSWA 3PPAA 3PLUA 2DHZA 2PE9A 3TJPA 3WALA 5JZEB 1LFDA 4LDTD 2MBEA 2EMTA 2J0MA 1EF1A 3RT3B 4WJQA 2KD0A 3N3KB 3N32A 3X0WA 2LJ5A 2KANA 2LVPA 3L08A 2K8CA 2KZRA 2M1MA 1L7YA 2Z0EB 2JRHA 3PSEB 3TCAA 3VUYA 1P9DU 3VH3B 3OAWA 2I1KA 2C5LC 1GUAB 4G11A 4LJPB 1GJZA 2KC1A 2KO3A 2LWPA 2N9XA 2RPQA 3PGEA 2KLCA 3M63B 4GOCA 4OVUA 1IYFA 1SIFA 4BOSC 1WY8A 2BKRB 3NS8A 4XZ4A 4W9HA 4NJ6A 2MBHA 2JF5A 3HM3A 2C60A 4ZRJA 4E71A 3AU4A 3VH4B 4GIVA 3OJ4B 1S1QB 3IFWB 3IBEA 3ZDTA 1T0YA 2O2VA 2V4LA 4MGKE 5IA7A 2FIDA 2KLGA 1K8RB 1YD8U 2MLBA 4FBJB 1P3QU 3WAMA 4DHZB 3V61A 3RZFA 4JGHB 3VDZA 1ZKHA 3K9PB 2IYDB 4FULA 3ZW3A 3JW0X 3RULA 1H4RA 3DBSA 4FADA 1WJ4A 2JRIB 3ZNZB 1V5TA 4TQ0A 2MBBB 2I1JA 2LGYA 1E7VA 4N9F4 3U30A 5J2RA 1U4AA 2JZ3B 2KWUB 4WWNA 4B6WA 4RM9A 4TUUA 4IC7B 1D3ZA 4KDIC 5TR5A 1WMHB 2KX0A 4EZKA 4CO7A 4DHZE 2AL3A 2BF8B 5D7GA 4EKUA 2ZEQA 3IG3A 1J0GA 3APFA 2D3GA 4AOFA 3QQ8B 2ZJDA 1WF9A 3EECA 1WMHA 5CTRC 1ZW7A 4F8CB 3R66C 1EO6A 2LI5A 4KDLB 5C1ZA 3QAQA 2FIFA 2LGXA 3QHTA 5EDSA 4FHJA 1UH6A 4X57B 1QZEA 1WGRA 1Z5SB 2AWTA 1GC7A 4DHJB 4G3XB 1KLVA 1EF5A 4MM3A 2KMCA 1PQSA 3EC8A 3Q3JA 4G50A 1V80A 2IZVB 5L83A 2J0KA 2K6DB 3ZDMC 1UBIA 3DBRI 3ECIA 2RGFA 1Z2MA 1WRDB 2ZPNA 3C0RB 4BKTA 3LJ3A 2GOWA 3JYUA 3NY5A 3UQAA 2KN5A 2DAJA 1Q0WB 3ZLZA 3TBLD 3QWZB 4E74A 3A4SC 2KMAA 3DQVA 2L3ZA 1YIWA 4MJSB 4XX5A 4AP4C 2BKFA 2RD0A 4GU2A 4NY0A 4AJWA 4KSLC 4NQKE 2ZVNA 5HKHA 2KNBA 3DVNV 5GMVA 1E8WA 4NNJB 1UZXB 4MJSA 3VTVA 2REXA 1YJ1A 4HWIB 3PLVA 5AZGA 4MH0E 4JLCA 5J17A 3M3JA 2AEHA 2CKHB 4PS7A 4PS3A 2WDTB 4ZRKA 4DWFA 1R4MI 1WI0A 2DZIA 4LJOB 2BWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ML9 A;  3RUI B;  1LM8 B;  2OJR A;  3QA8 A;  4IM3 A;  1WIA A;  1E8Z A;  4XC2 A;  2LZ6 A;  5D94 A;  1WXM A;  3TL5 A;  2YLM A;  3ONS A;  2V3S A;  4MEL A;  2MSE D;  4BBN F;  1TTN A;  1OEY A;  3PRM B;  4W9L A;  4A20 A;  1YX6 B;  4HXD A;  2IBI B;  2C9W B;  2CHW A;  2DYO A;  3WAN A;  4KZC A;  2KKC A;  4WWP A;  3H9D A;  4M8M A;  4B9K A;  5G55 A;  1FXT B;  1WFY A;  3QJZ A;  4W9E A;  3RCZ A;  2MWS B;  4A3P A;  1RFA A;  2CS4 A;  1UD7 A;  1WH3 A;  1V49 A;  4F7Z A;  5BO4 B;  4BBN C;  2IY1 B;  2PEA A;  2ASQ A;  2IY0 B;  3MTN B;  4W9I A;  2LXC A;  5CHW A;  2UYZ B;  4EUT A;  5C23 A;  2HD5 B;  4KZ0 A;  4W9C A;  3R7R A;  3LDZ E;  3RZW C;  1RAX A;  4DHJ D;  1OGW A;  2D10 A;  2O2V B;  4IG7 B;  2Y5B B;  4II2 B;  3EFU A;  2MQJ A;  3AI5 A;  2Z0D B;  2A4Z A;  2DZK A;  3X23 A;  2IO1 B;  4W9K A;  3ZVV A;  1WZ0 A;  3WAP A;  4IWP A;  3KUD B;  3TIX A;  2KQ7 A;  3PRZ A;  4TV3 A;  3AU5 A;  2MP2 B;  3PHX B;  3L16 A;  2C7H A;  3ML8 A;  4FJV B;  3UIP B;  3UQB A;  3TMP B;  4DDI D;  2B3A A;  1WXS A;  3QCA A;  4ANU A;  5J18 A;  1GC6 A;  5CHF A;  5E6P A;  2MP2 A;  1YX5 B;  3AUL A;  2N1V A;  3Q3F A;  2KC2 A;  1WJU A;  1SE9 A;  4ZYN A;  4CHK A;  2N7D A;  5DPR A;  1OQY A;  2NVU I;  4IWO A;  4WJN A;  4FHK A;  3DDC B;  3ALB A;  3B1L X;  3ZIM A;  1ZGU B;  4ICV A;  2V1Y A;  4W9G A;  1V2Y A;  1I42 A;  3ZNH B;  2L8J A;  1AAR A;  2KWC A;  2WX1 A;  3QIJ A;  2RR9 A;  4RMA A;  4EZJ A;  3H6N A;  2ZNV B;  4W9J A;  2G45 B;  3DVG Y;  2JT4 B;  3U7D A;  1GNU A;  4GB9 A;  4II3 B;  1RLF A;  2JWZ A;  3SHQ A;  2ZCB A;  1WGY A;  2M8S A;  3IHP C;  4K7U A;  2IO0 B;  2ZNV C;  3V6E B;  2FCS A;  3D32 A;  4BFR A;  5KHQ A;  1WX9 A;  2EMS A;  2A5U A;  3O65 B;  4KVG B;  4AWJ A;  4JIO U;  3NHE B;  4HK2 A;  3ZKJ C;  3EHV A;  4P7I A;  1HE8 A;  1WX8 A;  3ZTD A;  4EZL A;  2UWQ A;  1A5R A;  2DZM A;  2KDB A;  2K8B A;  2XK5 B;  2ZPY A;  3T9L A;  4NJ7 A;  4ASW C;  4I6N B;  1I35 A;  2WYQ A;  4HPL B;  2R2O A;  1C3T A;  4K7W A;  4HJK A;  4FLH A;  1JRU A;  2N7E A;  4GGQ A;  2XK5 A;  4K1R B;  1J19 A;  1WXV A;  2BYE A;  4GN1 A;  2K6Q A;  2MW5 A;  4WJP A;  2RSU A;  4W9F A;  4G0N B;  2KJR A;  4K81 A;  2KHW B;  3V6C B;  4IM2 A;  3HK0 A;  3NZS A;  3H7S A;  3R3M A;  3PRP B;  1E5W A;  2MCN B;  3KW5 B;  3VXW A;  3DBL I;  3P2B A;  3PV1 A;  1IPG A;  2OOB B;  3OJ3 A;  4FN2 A;  4PYZ A;  1V9J A;  1WR6 E;  3L0W B;  4DK5 A;  3M95 A;  2NBW B;  3DCG A;  1E8Y A;  1XQQ A;  2L0F A;  2MX2 A;  2PPH A;  4MGY E;  1YQB A;  2GBR A;  2FCM A;  2GBK A;  2N9E B;  3AXC A;  1RRB A;  2L05 A;  1XT9 B;  4FJZ A;  4GDK B;  4MEM A;  1VD2 A;  4W9D A;  4FA6 A;  2VRR B;  2DYM A;  2GBN A;  2KTF A;  4MGI E;  1SGH A;  4A3O A;  3VVW B;  4M8N A;  1UBQ A;  3ENE A;  2LD9 A;  2WX0 A;  2JUO A;  4GDK A;  2NBU A;  2FAZ A;  3L13 A;  1V6E A;  4MSQ B;  3PVL A;  5LLI A;  2BWE S;  5DPT A;  2MBO A;  2O6V B;  4ZDV A;  2KTR B;  3H7P B;  2EKE C;  4K7S A;  2NPT B;  2KDI A;  1WGD A;  2DZJ A;  1P98 A;  2BGF A;  3IVF A;  3KUC B;  1WJN A;  2O6V A;  2KTR A;  3H7P A;  3I3T B;  2JPH A;  1G6J A;  4FJY A;  2NPT A;  3SD5 A;  4BKG A;  3ZNI D;  2L0T A;  2J7Q B;  2J0J A;  3HM6 X;  2NR2 A;  4GDL B;  4DDG D;  4YL8 A;  2JXX A;  4GXB A;  5JH5 C;  2G4D B;  2D07 B;  4IUM B;  3U8Z A;  3VFK A;  5IAA C;  2BPS A;  1WE6 A;  2AL6 A;  4JQW C;  4GDL A;  2KJH B;  3BIN A;  4MSM B;  2DEN B;  2KQS A;  1C1Y B;  1NBF C;  2KX3 A;  2LUE A;  2K39 A;  5AZH A;  3HHM A;  3S2A A;  1E7U A;  3PRE A;  2PE6 B;  4ZRI A;  2IO2 B;  2M4N A;  2LXA A;  3V62 A;  3PTF C;  2GMI C;  3SDL C;  1KOT A;  1P0R A;  5DPS A;  3W1S A;  3W1S C;  4NPN A;  4EEW A;  3A4R A;  5G2N A;  3JVZ X;  4BKS A;  2FUH B;  4WWO A;  4ANV A;  3V60 A;  3WIM A;  1H8C A;  4PS8 A;  1E8X A;  1EUV B;  2DYB A;  2LRW A;  1LXD A;  3APD A;  1UEL A;  4DBG A;  4HVB A;  2KK8 A;  4LCD E;  1V86 A;  4IW0 A;  3KH0 A;  1IP9 A;  4HLE A;  3UGB B;  1BT0 A;  2XBB C;  2D11 A;  4TQ1 A;  2FCN A;  3ZTC A;  3CSF A;  1S3S G;  1KM7 A;  1OEY J;  2HTH A;  3R7Q A;  3B0A A;  3VTW A;  1V5O A;  2C7N B;  2DX5 B;  2G3Q B;  3PT2 B;  3QC8 B;  1J8C A;  1TZ1 A;  3A9J B;  2BYV E;  2NS5 A;  3JSV B;  3L54 A;  3PS6 A;  3QX1 A;  5E6O A;  5LXI B;  4M0W B;  3QAR A;  5DPW A;  4KSK C;  3ZNG C;  3WAO A;  4MGZ E;  2JZZ A;  4HCP B;  2WWZ A;  3A9J A;  3JSV A;  2FNJ B;  2HE7 A;  2N9P C;  3CMM B;  3DBH I;  3HIZ A;  4ANX A;  1VCB A;  3VUW A;  3ZRF A;  4GMV A;  2CU1 A;  4WQO B;  2CR5 A;  1P1A A;  2KDF B;  4CYE A;  4LDT B;  2K25 A;  3B08 A;  3RD2 A;  2GBJ A;  2N1W A;  3DPD A;  2KDE B;  2O6V D;  2BYF A;  2HJ8 A;  1WE7 A;  3GOE A;  4J6I A;  4NQL B;  4RM8 A;  4B95 A;  4ANW A;  4BVU C;  3PZD A;  2KJ6 A;  2NCN A;  1ISN A;  3UIN B;  3BY4 B;  2GBM A;  2KXJ A;  2Z59 B;  1GG3 A;  2QHO A;  3ZRC A;  2LRU A;  1WX7 A;  4AJY B;  1F9J A;  5JHB A;  2DAF A;  4BOZ B;  1OTR B;  1WZ3 A;  3L17 A;  3WA0 A;  3NOB A;  3M62 B;  3A1Q B;  2G4S A;  3MJW A;  1WXA A;  4NAW B;  3APC A;  3OLM D;  2KFJ A;  5D6J B;  4HCN B;  2MBQ A;  3NZU A;  3RYT A;  1E90 A;  1NI2 A;  3UIO B;  3VTU A;  3VUX A;  5LXH A;  1WJ6 A;  2MRP A;  3A1Q A;  1R4N I;  1TBE A;  1TGZ B;  4NAW A;  4PYU A;  4WJO A;  2JY6 A;  1WM2 A;  2IO3 B;  5E6N A;  2M17 A;  2ZCC A;  3VHT C;  3GZN I;  1X1M A;  2ZZP B;  2AYO B;  3QK0 A;  1WGH A;  2NBV B;  3SU8 X;  4KIK B;  3DOW A;  5JHA A;  1M94 A;  4E3C A;  3KVF B;  4BKS D;  5AEK B;  1L2N A;  2KFK B;  2PJH A;  1UGM A;  4IM0 A;  2D2Q A;  2ZVO A;  1V81 A;  2CHX A;  3KYC D;  2FCQ A;  4HPM B;  3N30 A;  4KIK A;  5DCN A;  4IWQ A;  2CHZ A;  5CHV C;  5CX3 A;  1Q1O A;  2M0X A;  2KFK A;  5AZF A;  2KVR A;  4MDK E;  1Y8R C;  3A33 B;  5KHO A;  4DXA B;  3MHS D;  4F1S A;  3DVG X;  3ZO5 B;  4AUQ C;  4WAA A;  5L95 C;  2LVO A;  3H1U A;  3L10 B;  2W9N A;  4I6P A;  5D2M B;  1WM3 A;  2YVC A;  4ICU A;  3W1Y A;  3CF6 E;  2LAS A;  4OVV A;  3ZUN A;  2L00 B;  1LQB A;  2KOX A;  4EFO A;  2KWV B;  5FR6 A;  2MA9 B;  3PHW B;  3DVN U;  3VQI A;  1CMX B;  4EOY A;  4JL9 A;  3T8M A;  3A9K B;  2C7M B;  3UF8 A;  4URK A;  4KV2 A;  4TKN A;  2R2Q A;  1Q5W B;  2K1F A;  4HDO A;  2K8H A;  3KUZ A;  4I6L B;  1XD3 B;  2JVC A;  2XEW A;  1WYW B;  3K9O B;  1NDD A;  2L76 A;  3A9K A;  1WGG A;  1KJT A;  2L7R A;  2LVQ A;  1MG8 A;  2N4F A;  1WR1 A;  4HDQ A;  3CST A;  3VAW A;  3KYD D;  2LGD A;  4GSW A;  3PPA A;  3PLU A;  2DHZ A;  2PE9 A;  3TJP A;  3WAL A;  5JZE B;  1LFD A;  4LDT D;  2MBE A;  2EMT A;  2J0M A;  1EF1 A;  3RT3 B;  4WJQ A;  2KD0 A;  3N3K B;  3N32 A;  3X0W A;  2LJ5 A;  2KAN A;  2LVP A;  3L08 A;  2K8C A;  2KZR A;  2M1M A;  1L7Y A;  2Z0E B;  2JRH A;  3PSE B;  3TCA A;  3VUY A;  1P9D U;  3VH3 B;  3OAW A;  2I1K A;  2C5L C;  1GUA B;  4G11 A;  4LJP B;  1GJZ A;  2KC1 A;  2KO3 A;  2LWP A;  2N9X A;  2RPQ A;  3PGE A;  2KLC A;  3M63 B;  4GOC A;  4OVU A;  1IYF A;  1SIF A;  4BOS C;  1WY8 A;  2BKR B;  3NS8 A;  4XZ4 A;  4W9H A;  4NJ6 A;  2MBH A;  2JF5 A;  3HM3 A;  2C60 A;  4ZRJ A;  4E71 A;  3AU4 A;  3VH4 B;  4GIV A;  3OJ4 B;  1S1Q B;  3IFW B;  3IBE A;  3ZDT A;  1T0Y A;  2O2V A;  2V4L A;  4MGK E;  5IA7 A;  2FID A;  2KLG A;  1K8R B;  1YD8 U;  2MLB A;  4FBJ B;  1P3Q U;  3WAM A;  4DHZ B;  3V61 A;  3RZF A;  4JGH B;  3VDZ A;  1ZKH A;  3K9P B;  2IYD B;  4FUL A;  3ZW3 A;  3JW0 X;  3RUL A;  1H4R A;  3DBS A;  4FAD A;  1WJ4 A;  2JRI B;  3ZNZ B;  1V5T A;  4TQ0 A;  2MBB B;  2I1J A;  2LGY A;  1E7V A;  4N9F 4;  3U30 A;  5J2R A;  1U4A A;  2JZ3 B;  2KWU B;  4WWN A;  4B6W A;  4RM9 A;  4TUU A;  4IC7 B;  1D3Z A;  4KDI C;  5TR5 A;  1WMH B;  2KX0 A;  4EZK A;  4CO7 A;  4DHZ E;  2AL3 A;  2BF8 B;  5D7G A;  4EKU A;  2ZEQ A;  3IG3 A;  1J0G A;  3APF A;  2D3G A;  4AOF A;  3QQ8 B;  2ZJD A;  1WF9 A;  3EEC A;  1WMH A;  5CTR C;  1ZW7 A;  4F8C B;  3R66 C;  1EO6 A;  2LI5 A;  4KDL B;  5C1Z A;  3QAQ A;  2FIF A;  2LGX A;  3QHT A;  5EDS A;  4FHJ A;  1UH6 A;  4X57 B;  1QZE A;  1WGR A;  1Z5S B;  2AWT A;  1GC7 A;  4DHJ B;  4G3X B;  1KLV A;  1EF5 A;  4MM3 A;  2KMC A;  1PQS A;  3EC8 A;  3Q3J A;  4G50 A;  1V80 A;  2IZV B;  5L83 A;  2J0K A;  2K6D B;  3ZDM C;  1UBI A;  3DBR I;  3ECI A;  2RGF A;  1Z2M A;  1WRD B;  2ZPN A;  3C0R B;  4BKT A;  3LJ3 A;  2GOW A;  3JYU A;  3NY5 A;  3UQA A;  2KN5 A;  2DAJ A;  1Q0W B;  3ZLZ A;  3TBL D;  3QWZ B;  4E74 A;  3A4S C;  2KMA A;  3DQV A;  2L3Z A;  1YIW A;  4MJS B;  4XX5 A;  4AP4 C;  2BKF A;  2RD0 A;  4GU2 A;  4NY0 A;  4AJW A;  4KSL C;  4NQK E;  2ZVN A;  5HKH A;  2KNB A;  3DVN V;  5GMV A;  1E8W A;  4NNJ B;  1UZX B;  4MJS A;  3VTV A;  2REX A;  1YJ1 A;  4HWI B;  3PLV A;  5AZG A;  4MH0 E;  4JLC A;  5J17 A;  3M3J A;  2AEH A;  2CKH B;  4PS7 A;  4PS3 A;  2WDT B;  4ZRK A;  4DWF A;  1R4M I;  1WI0 A;  2DZI A;  4LJO B;  2BWF A; 
#chains in the Genus database with same CATH topology
 3ML9 A;  4FXC A;  1C4A A;  4IM3 A;  1E8Z A;  2EEL A;  1QOF A;  2WXO A;  3KWL A;  3TL5 A;  1TTN A;  4A20 A;  3DBR B;  1F2R I;  4RGM A;  4RGN A;  4KZC A;  3H9D A;  4B9K A;  2DWQ A;  1FXT B;  1WFY A;  1UWM A;  3ABV B;  1AW7 A;  4W9E A;  1QIL A;  4A3P A;  1WH3 A;  4UDU C;  1VDV A;  2VZK B;  1CQV A;  2PEA A;  3RNE C;  2LXC A;  2UYZ B;  5C23 A;  4KZ0 A;  3LDZ E;  4QAY A;  4S17 A;  1RAX A;  1L6V A;  2D10 A;  1WWT A;  3AI5 A;  3X23 A;  2KQ7 A;  3AE6 B;  3MJ5 A;  3AU5 A;  2UU7 A;  2C7H A;  3L16 A;  3B2G A;  3UIP B;  2WDR B;  3TMP B;  4ANU A;  5J18 A;  1F0Z A;  4WAF A;  1FCC C;  4IOI E;  1F2R C;  3DDC B;  3B1L X;  2JQR B;  3I5J C;  2L8J A;  4RMA A;  3AEF B;  2AQ1 B;  4W9J A;  5HG2 A;  2G45 B;  4ITK A;  1TS4 A;  2JT4 B;  3U7D A;  4M02 A;  5GXG B;  5LNK 1;  2BW2 A;  2JWZ A;  4TSS A;  1TIF A;  1WGY A;  4A55 A;  2IO0 B;  3V6E B;  2FCS A;  3D32 A;  4BFR A;  3PZ8 A;  4BZA A;  3EHV A;  1IBX A;  2XK5 B;  4K7W A;  4C7Y A;  4FLH A;  2N7E A;  3BK1 A;  1V1P A;  1F77 A;  3NVZ A;  1DOY A;  2KJR A;  1GB4 A;  3H7S A;  3R3M A;  1IPG A;  4HPP A;  4FN2 A;  1VRA B;  2QDF A;  2IPK D;  3L0W B;  2AX5 A;  5BYR A;  1E8Y A;  1XLN A;  1YQB A;  4MEM A;  4GDK B;  3VRB B;  4W9D A;  2QMT A;  2GBN A;  2Z8L A;  4A3O A;  4M8N A;  1UBQ A;  3ENE A;  3FIL A;  2WXR A;  2LD9 A;  5IO9 A;  2NBU A;  1D5Z C;  1D5M C;  2MBO A;  2EKE C;  1RWS A;  3AB5 A;  1JW9 D;  3IVF A;  3TSS A;  3H7P A;  1G6J A;  2NPT A;  3EA6 A;  3ZNI D;  1PDX A;  3ZGZ A;  3AV8 A;  5I4D A;  1CZP A;  2G4D B;  2KJH B;  3GE8 C;  4NJC A;  4OZA A;  3PTF C;  2QSD A;  1P0R A;  4NPN A;  3A4R A;  4B0M A;  3TEZ A;  4BKS A;  2FUH B;  4RF1 A;  1UF0 A;  2WXI A;  2DYB A;  4C4V A;  3APD A;  4DBG A;  3P4S B;  4JWU C;  3KH0 A;  4YT0 B;  2L32 A;  1V5O A;  3P4P B;  5T8I A;  2LGS A;  2NS5 A;  4KKI A;  5DPW A;  2MJE A;  2BBC A;  3WAO A;  1SBB B;  3JSV A;  3EGR A;  1EWC A;  1VCB A;  4C00 A;  3VUW A;  3ZRF A;  4GMV A;  1FXA A;  4ZRQ A;  1XLO A;  2QJL A;  2ONQ A;  3P4Q B;  2GBJ A;  2O6V D;  2I2Y A;  2BYF A;  3RNA C;  1ZXI A;  3GOE A;  1SB3 C;  3U4E G;  4BVU C;  3PZD A;  3BVZ A;  3P1M A;  1PGA A;  2GBM A;  1BML C;  1JWB D;  5FR3 A;  1GG3 A;  1FM0 D;  3PZ7 A;  1F9J A;  2DAF A;  1DGJ A;  2CU3 A;  2VZK D;  2QIE B;  3NZU A;  1VJK A;  1WJ6 A;  1JRP A;  4NAW A;  1R4N I;  4PYU A;  3AE8 B;  4YSX B;  4AS1 A;  2ZZP B;  4B0E A;  1TY0 A;  3QK0 A;  4KIK B;  1L2N A;  2LHE A;  5AEK B;  4IM0 A;  1K53 A;  1P7E A;  2PW9 A;  2WQY B;  3KYC D;  2FCQ A;  1IGC A;  3BYT B;  5H92 C;  3AN1 A;  2MH7 A;  2VH2 A;  2KFK A;  1V1O A;  1C4C A;  2YVC A;  4ICU A;  2NMQ A;  1GB1 A;  1N61 A;  3C19 A;  2KWV B;  2RMM A;  1HTO A;  1OQQ A;  3UF8 A;  4URK A;  2K1F A;  4EE2 A;  3KUZ A;  3K9O B;  1WYW B;  2L76 A;  1MG8 A;  2WXM A;  3CST A;  1LGR A;  3KYD D;  2LGD A;  3PPA A;  3TJP A;  1QOA A;  2MBE A;  2BQQ A;  2KD0 A;  3X0W A;  2KAN A;  2LVP A;  1L7Y A;  2KT7 A;  2Z0E B;  2JRH A;  3TCA A;  3OAW A;  4JPS A;  2KO3 A;  1TKE A;  4OVU A;  1XO3 A;  3I57 A;  4BOS C;  2E6X A;  1TZO A;  4XZ4 A;  3W5V B;  2M0A A;  3OJ4 B;  2MHJ A;  2G9H D;  1K8R B;  1YD8 U;  4FBJ B;  2BS4 B;  4FUL A;  3ZW3 A;  3RUL A;  1H4R A;  2N7J A;  2WXN A;  2NTS A;  1I4Q A;  1U4A A;  2JZ3 B;  4WWN A;  4RM9 A;  4TUU A;  4KDI C;  3RPF C;  4DHZ E;  2AL3 A;  3LB8 C;  4EKU A;  1HA5 A;  4M01 A;  1JWS D;  2EKI A;  1ZW7 A;  1EO6 A;  5C1Z A;  3QAQ A;  1AWD A;  3QHT A;  4FHJ A;  1V97 A;  2WXJ A;  4X57 B;  1WGR A;  1Z5S B;  5EE9 A;  4G3X B;  4MM3 A;  2KMC A;  2PIA A;  3U52 E;  3ZDM C;  3WCQ A;  1UBI A;  3DBR I;  4A9A A;  2RGF A;  4KGR A;  2L83 A;  4BKT A;  3LJ3 A;  3JYU A;  3NY5 A;  1Q0W B;  1XCT L;  3A4S C;  4MJS B;  4AP4 C;  2RD0 A;  4GU2 A;  5BMH A;  4LNO A;  1UZX B;  3OWE B;  2REX A;  1YJ1 A;  4JWS C;  4S0R A;  3PLV A;  1ZDV A;  4US8 A;  2AEH A;  4J3O D;  2WDT B;  1DOI A;  2DZI A;  3N9Y C;  3RUI B;  1MI0 A;  1E7P B;  1WXM A;  2M56 B;  2YLM A;  5HI1 A;  4N6E B;  4MEL A;  3Q8F A;  2WXQ A;  2MSE D;  4BBN F;  4K3B A;  4W9L A;  1FMA D;  2BB6 A;  2DYO A;  1T5X D;  4WWP A;  1L6U A;  3T3O A;  4M8M A;  4D2K A;  1A70 A;  3Q2A C;  1JAL A;  2MWS B;  3BK2 A;  1WSP A;  4F7Z A;  5BO4 B;  4CQN A;  2IY1 B;  1I4G A;  2IY0 B;  4W9I A;  1ENF A;  4EUT A;  3BWU D;  3RZW C;  4DHJ D;  2WHI A;  4IG7 B;  1R4M B;  1YQ4 B;  4II2 B;  2DZK A;  3R2I A;  3WAP A;  4IWP A;  1FCL A;  4TV3 A;  2MP2 B;  3PHX B;  4GLS C;  4JE3 B;  1D4B A;  4RGO S;  3QCA A;  1KRH A;  1TKG A;  5E6P A;  3AUL A;  3Q8C A;  4LTU A;  4NAM A;  1SE9 A;  2N7D A;  1OQY A;  2NVU I;  4YSZ B;  1FRR A;  1UWX A;  3BVG A;  2V1Y A;  4W9G A;  3ZNH B;  1AAR A;  2WX1 A;  4KKJ A;  1I7H A;  2ZNV B;  3DVG Y;  2VH1 A;  1MHH E;  1GNU A;  4KX6 B;  1RLF A;  3MC8 A;  1UGJ A;  1MFW A;  2BVC A;  4Q2J A;  5KHQ A;  1WX9 A;  2EMS A;  2A5U A;  2H88 B;  4KVG B;  1JCK B;  4AWJ A;  4JIO U;  3NHE B;  1EWY C;  3ZTD A;  4EZL A;  1A5R A;  3T9L A;  4NJ7 A;  4I6N B;  4HPL B;  2R2O A;  2NTT A;  2XK5 A;  1QKZ A;  3ZJU A;  1WXV A;  2BYE A;  1C78 A;  2MW5 A;  4WJP A;  4K81 A;  4YWG G;  4RF0 A;  2M19 A;  3HK0 A;  3PRP B;  2IGD A;  2MCN B;  1IUE A;  3KW5 B;  3ZJT A;  3VXW A;  2OOB B;  1V9J A;  1WR6 E;  2DLB A;  2FUG 1;  2JZP A;  4LNN A;  1UNS A;  4MGY E;  2GBR A;  3AXC A;  4WIP A;  2L05 A;  1M4V A;  4FA6 A;  2VRR B;  2KTF A;  3VVW B;  2LJI A;  2JUO A;  3GP7 A;  4GDK A;  1V6E A;  2BWE S;  1N60 A;  2O6V B;  2KTR B;  3AEE B;  2DZJ A;  5G5G A;  2L1A A;  2BGF A;  3KUC B;  1FRD A;  2JPH A;  2V4I B;  4FJY A;  1HQR D;  1K51 A;  1I4R A;  1SSN A;  1TY2 A;  3DBL B;  4DDG D;  5IN7 A;  2JXT A;  4IUM B;  2D07 B;  5AUK A;  3U8Z A;  5IAA C;  2BPS A;  3W5U B;  2AL6 A;  5GMV A;  3BIN A;  1NBF C;  3LYY A;  5AZH A;  3HHM A;  1XF5 L;  2HJ1 A;  1FIQ A;  3JVZ X;  2W55 A;  4ANV A;  3SFE B;  4RFB A;  1YN4 A;  4PS8 A;  1LXD A;  3AEB B;  1UEL A;  2D3B A;  4R3D A;  3UGB B;  1OEY J;  2HTH A;  2KAJ A;  3B0A A;  4H2A A;  3PT2 B;  1BXT A;  2DX5 B;  3ZQ4 A;  1J8C A;  1TZ1 A;  3A9J B;  2BYV E;  4YTM B;  5LXI B;  3QX1 A;  1CJE A;  4XGA B;  2WWZ A;  2WXG A;  2GLS A;  2J53 A;  1ZXH A;  2HE7 A;  3CMM B;  3HIZ A;  3URY A;  1SJH D;  1KLU D;  2CU1 A;  2R61 A;  2CR5 A;  2K25 A;  1YMH E;  3B08 A;  2INN E;  4J6I A;  4B95 A;  2KJ6 A;  5E6J A;  2Z59 B;  1ACC A;  2K22 A;  1PGB A;  1WX7 A;  5JHB A;  1OTR B;  1WZ3 A;  3WA0 A;  3NOB A;  3M62 B;  3MJW A;  4XWW A;  3OLM D;  2KFJ A;  2L52 A;  2WDV B;  4HCN B;  3VUX A;  1E90 A;  3UIO B;  1TBE A;  1T0R C;  1TGZ B;  2KN4 A;  2ZCC A;  3FKY A;  2FBW B;  3AE7 B;  2AYO B;  3DBH B;  1WGH A;  2NBV B;  3SU8 X;  5D3I B;  3TUO A;  3KVF B;  2PJH A;  1V81 A;  2CHX A;  2W82 A;  1SE2 A;  4HPM B;  3KQ4 A;  4KIK A;  1YQ3 B;  2CHZ A;  4M00 A;  2KVR A;  4MDK E;  4DXA B;  2Y5P A;  4F1S A;  3ZO5 B;  4AUQ C;  1B9R A;  4WAA A;  5L95 C;  1TKY A;  3L10 B;  2W9N A;  1NYR A;  4I6P A;  2JYT A;  1FO4 A;  4EFO A;  2KOX A;  5FR6 A;  2MA9 B;  3PHW B;  3VQI A;  4PK1 A;  1CMX B;  4EOY A;  4JL9 A;  3Q3N C;  4I6L B;  1XD3 B;  2LVQ A;  2KMM A;  1WR1 A;  3GZN B;  3VAW A;  1FEH A;  2W3R A;  4LNK A;  4ARI A;  3WAL A;  1LFD A;  2EMT A;  4WJQ A;  3N32 A;  4OW0 A;  4WWM A;  2D3C A;  3MFG A;  4L23 A;  1P9D U;  2I1K A;  2C5L C;  3KWV A;  1FXI A;  4LJP B;  3ZXR A;  2LWP A;  2RDH A;  3PGE A;  3ZYY X;  2PTL A;  1IYF A;  1SIF A;  1WY8 A;  1JML A;  4LNF A;  4W9H A;  4NJ6 A;  1C9F A;  2MBH A;  1I4X A;  3HUI A;  1ESF A;  4E71 A;  4ARC A;  4GIV A;  2V4L A;  2FID A;  1L4Z B;  4JGH B;  3VDZ A;  1FFV A;  1N6Z A;  3K9P B;  2IYD B;  2LFI A;  1KH0 A;  2J52 A;  1XEE A;  2MEK A;  3JW0 X;  3DBS A;  3ZNZ B;  1V5T A;  4TQ0 A;  2LGY A;  4N9F 4;  3U30 A;  2RPV A;  3NRZ A;  4YSY B;  5BYQ A;  3I63 C;  1WMH B;  2KX0 A;  2BF8 B;  3IG3 A;  1J0G A;  4AOF A;  3QQ8 B;  2ZJD A;  1WF9 A;  3AE1 B;  3EEC A;  1E10 A;  2LI5 A;  1AYF A;  1T0S C;  1PFD A;  2FIF A;  2LGX A;  1B1Z A;  4P6V F;  1QZE A;  2AWT A;  4DHJ B;  4WUR A;  1VZ8 A;  1PQS A;  3EC8 A;  2BTE A;  1T3Q A;  5H8Y E;  1V80 A;  2LMC A;  5L83 A;  2J0K A;  1D5X C;  2ZPN A;  3C0R B;  2KYW A;  3UQA A;  1FFU A;  3W9C B;  2DAJ A;  3QWZ B;  3SR6 A;  4E74 A;  2L3Z A;  2AQ3 B;  4NY0 A;  4NQK E;  3DVN V;  2LHD A;  2DBY A;  4MJS A;  3VTV A;  2SAK A;  5AZG A;  4MH0 E;  5J17 A;  3IT4 B;  4PS7 A;  4DWF A;  1R4M I;  1WI0 A;  4OVZ A;  4LJO B;  2WNM A;  2BWF A;  1UD7 A;  2B76 B;  1LM8 B;  3IT6 B;  5D94 A;  5MPO A;  3ONS A;  3GS2 A;  4HXD A;  3MHZ A;  2KKC A;  2WP9 B;  3RCZ A;  2PLP A;  1RFA A;  2CS4 A;  4A6Q A;  1C76 A;  1V49 A;  1YJI A;  1ZE3 D;  1SE3 A;  4MH8 A;  4ACF A;  3B2F A;  4N58 A;  3B9J A;  1BUI C;  1XLP A;  1TS3 A;  1ZP0 B;  4N59 A;  1GAQ B;  2J42 A;  2QIL A;  2Y5B B;  3EFU A;  2MQJ A;  2ICI A;  1NYQ A;  2A4Z A;  2IO1 B;  3ZVV A;  3KUD B;  2OED A;  3PRZ A;  4RCO A;  3KLS X;  2X38 A;  2B3A A;  1WXS A;  4DDI D;  1P7F A;  2MP2 A;  2IND C;  1YX5 B;  1WJU A;  4CHK A;  2PVO D;  2LEK A;  4WJN A;  1WYG A;  3ZIM A;  4L1B A;  4ICV A;  1V2Y A;  2WGS A;  2KWC A;  4PT5 A;  3QIJ A;  1HEZ E;  3N1X C;  1E0Z A;  1L0Y B;  3IAM 1;  3BZD B;  3Q6B A;  2DNF A;  4II3 B;  4ZYS A;  4HJG E;  3SHQ A;  3IHP C;  5EE1 A;  1T0Q C;  2ZNV C;  3PO0 A;  4TMA B;  3NZ3 A;  3O65 B;  1J7B A;  2WU5 B;  4HK2 A;  3ZKJ C;  4P7I A;  1HE8 A;  1WX8 A;  2UWQ A;  2DZM A;  2KDB A;  4ASW C;  2WYQ A;  3UI3 A;  1VR9 A;  3BVM A;  1C3T A;  4HJK A;  4GGQ A;  3BII D;  2HTM E;  4XWT A;  4K1R B;  3DHI C;  2K6Q A;  3SFD B;  2YEP F;  1RFK A;  2KHW B;  1XCQ L;  4IM2 A;  3NZS A;  1E5W A;  5TSS A;  3DBL I;  3P2B A;  1EM7 A;  3OJ3 A;  4PYZ A;  3M95 A;  2NBW B;  2L0F A;  2IJ0 A;  2FCM A;  2N9E B;  1RRB A;  4FJZ A;  1ET9 A;  4MGI E;  1SGH A;  2K3U A;  3EUB 2;  2WX0 A;  1FNW A;  4MSQ B;  3L4P A;  4ZDV A;  1NEK B;  4K7S A;  4XE0 A;  1VZ6 A;  2G1E A;  3RMK C;  4ZHP A;  3ETR A;  1WJN A;  2O6V A;  2KTR A;  1KLG D;  4BKG A;  1MJD A;  2L0T A;  4YTN B;  4P1C C;  3DHG C;  3HM6 X;  2NR2 A;  4GDL B;  4YL8 A;  4GXB A;  2PMV A;  4WQM A;  2KQS A;  2LUE A;  2K39 A;  1GOZ A;  3E9S A;  3S2A A;  1J7C A;  1E7U A;  4ZRI A;  1KF6 B;  2LXA A;  2GMI C;  1SIJ A;  1SJE D;  3SDL C;  3AMZ A;  5DPS A;  3W1S A;  4EEW A;  3W1S C;  1FNV A;  5G2N A;  4DXG A;  3V60 A;  1H8C A;  1EUV B;  2LRW A;  4RGT A;  2KVZ A;  3LXF A;  2KK8 A;  4LCD E;  1V86 A;  4HLE A;  2XBB C;  4TQ1 A;  2FCN A;  3ZTC A;  1MHX A;  1KM7 A;  1S3S G;  3R7Q A;  2G3Q B;  3QC8 B;  4US9 A;  3L54 A;  3PS6 A;  2N0S B;  4NZL B;  4M0W B;  4KSK C;  3ZNG C;  2JZZ A;  4HCP B;  3A9J A;  2N9P C;  3DBH I;  1YOV B;  2GRI A;  1L5P A;  3DWG C;  1P1A A;  4CYE A;  2KQ4 X;  1TS5 A;  5IKC M;  2N1W A;  3RNB C;  2HJ8 A;  3R8B A;  2V0G A;  4RM8 A;  1FD6 A;  2NCN A;  3BY4 B;  2BT6 A;  3TEW A;  4HKZ E;  3ZRC A;  2LRU A;  4AJY B;  3L17 A;  4WH4 A;  2WXF A;  2G4S A;  2KWD A;  1WXA A;  3A1Q B;  3APC A;  2MBQ A;  1NI2 A;  3VTU A;  3NVY A;  2D5G A;  2ACZ B;  3W2D A;  4WJO A;  2JY6 A;  5E6N A;  2M17 A;  3VHT C;  3GZN I;  1QLB B;  1X1M A;  1VLB A;  5JHA A;  4E3C A;  4BKS D;  1UGM A;  2D2Q A;  4ZRP A;  3N30 A;  1GPX A;  4IWQ A;  2H89 B;  1Q10 A;  5CX3 A;  5CHV C;  5AZF A;  2XN9 C;  2K0P A;  3A33 B;  5KHO A;  2LVO A;  3H1U A;  1JWA D;  5D2M B;  1WM3 A;  1QT9 A;  3CF6 E;  2LAS A;  4OVV A;  3ZXV A;  3ZUN A;  2L00 B;  1NI3 A;  3DVN U;  3A9K B;  1YNT E;  1Q5W B;  4HDO A;  2K8H A;  2JVC A;  3VRA B;  1WGG A;  1J7A A;  3VR9 B;  1KJT A;  4O1N A;  3HVZ A;  1R7S A;  4HDQ A;  1SXT A;  3I9V 1;  2WDQ B;  4YTP B;  2MJD A;  1ZUD 2;  1ROE A;  2K9X A;  2PE9 A;  1TYG B;  4LDT D;  2J0M A;  1EF1 A;  3RT3 B;  1LO5 D;  3N3K B;  3NS1 A;  2Y3A A;  2K8C A;  3PSE B;  3VH3 B;  1AN8 A;  4MAC A;  4MT5 A;  4DQO C;  4G11 A;  4OZC A;  1GJZ A;  2D3A A;  2V3P A;  2KC1 A;  4IKG A;  3FAH A;  1PUT A;  1HTQ A;  2N9X A;  2JYE A;  3M63 B;  1DYQ A;  4L2Y A;  3NS8 A;  3DHH C;  3HM3 A;  3AU4 A;  1S1Q B;  3IBE A;  3J9C A;  1T0Y A;  2O2V A;  3R2T A;  2MLB A;  4DHZ B;  3H8H A;  2ZW1 A;  1ZKH A;  3P4R B;  1WGK A;  4ZHO A;  1WJ4 A;  2JRI B;  5C2T B;  1TT5 B;  2I1J A;  3AE9 B;  1E7V A;  5J2R A;  2KWU B;  4IC7 B;  5TR5 A;  2ZW0 A;  4CO7 A;  3NUH B;  5D7G A;  4OHJ A;  1XXG A;  3N1Y C;  3TEX A;  1PGX A;  1WMH A;  2N9L A;  2HDE A;  4F8C B;  3R66 C;  2PKO A;  4KDL B;  5EDS A;  1QOG A;  3BYY B;  1OQR A;  1KLV A;  1EF5 A;  3TEY A;  3Q3J A;  4G50 A;  4P1B C;  1C77 A;  1TJE A;  3AED B;  3ECI A;  2E3T A;  2RDB C;  1Z2M A;  1WRD B;  2V9H A;  5FK9 C;  2GOW A;  1MG4 A;  2V3N A;  2KN5 A;  3ZLZ A;  3TBL D;  3DQV A;  4XX5 A;  1I4P A;  4KSL C;  1D6E C;  2KNB A;  4NNJ B;  1C79 A;  4HWI B;  2KDM A;  3AEA B;  4JLC A;  3M3J A;  2CKH B;  4PS3 A;  3AE2 B;  4BAX A;  4ZRK A;  2INP E;  2BS3 B;  3AH7 A;  2OJR A;  3QA8 A;  2I38 A;  1WIA A;  4XC2 A;  2LZ6 A;  1ZDX A;  2V3S A;  2SEB D;  2N9K A;  1KTK A;  1OEY A;  3PRM B;  1YX6 B;  3P42 A;  3Q3M C;  3Q3O C;  2IBI B;  2C9W B;  2CHW A;  1Y56 A;  3WAN A;  1FNU A;  5G55 A;  3QJZ A;  2LGI A;  1HZ6 A;  2ON8 A;  4USA A;  4BBN C;  4ZOH C;  3O13 A;  2ASQ A;  3MTN B;  5EE0 A;  3GB1 A;  5CHW A;  2HD5 B;  3R7R A;  4W9C A;  3U7Z A;  1OGW A;  2O2V B;  4HKQ A;  1DOX A;  2Z0D B;  1FPY A;  4W9K A;  1WZ0 A;  3TIX A;  4LLG M;  3ML8 A;  4FJV B;  3UQB A;  3Q14 C;  1WXQ A;  1GC6 A;  4KGT A;  5EE3 A;  5CHF A;  4C80 A;  4RH6 A;  2N1V A;  3Q3F A;  2KC2 A;  4ZYN A;  3RNG C;  5DPR A;  1PYW D;  4IWO A;  1EU4 A;  2WXP A;  4FHK A;  1XLQ A;  1IGD A;  3ALB A;  3RNC C;  1ZGU B;  2WXH A;  4HRO A;  1I42 A;  4HEA 1;  2RR9 A;  4EZJ A;  3N20 C;  3H6N A;  1SF0 A;  4GB9 A;  4P16 A;  5BYS A;  2ZCB A;  1MVK A;  2JSV X;  2M8S A;  4K7U A;  1IBX B;  1E6E B;  4LK0 M;  1HZ5 A;  1MPE A;  1V1P B;  2ZPY A;  2K8B A;  1I35 A;  5FKA C;  3Q8A A;  1V8C A;  1JRU A;  1QQR A;  1T6B X;  2BS2 B;  3Q8E A;  2K5P A;  1NVI D;  1J19 A;  4GN1 A;  1WRI A;  4OZB A;  2IDY A;  2RSU A;  4W9F A;  4G0N B;  3V6C B;  2YEP B;  4KGS A;  1NEN B;  3PV1 A;  2PVG C;  1K52 A;  3AE3 B;  3OG5 A;  4DK5 A;  1UUP A;  1STE A;  3DCG A;  1XQQ A;  4HRS A;  2MX2 A;  2PPH A;  2GBK A;  3FIL B;  4C7Z A;  3RN9 C;  1XT9 B;  1VD2 A;  2DYM A;  1JWU D;  3AM9 A;  2FAZ A;  3AEC B;  3L13 A;  3PVL A;  4XYC A;  5LLI A;  5DPT A;  3AEG B;  5C3J B;  3ZJV A;  3H7P B;  2NPT B;  2KDI A;  1WGD A;  1P98 A;  5IP4 D;  3I3T B;  1ET6 A;  3SD5 A;  4C56 C;  3IAS 1;  2BB5 A;  2J7Q B;  1JRO A;  1C4P A;  2J0J A;  1ZOY B;  2JXX A;  3CIR B;  5JH5 C;  3VFK A;  1WE6 A;  3N1Z C;  4JQW C;  4GDL A;  4MSM B;  2DEN B;  2KX3 A;  1C1Y B;  1L4D B;  1YN5 A;  3PRE A;  2PE6 B;  2IO2 B;  2M4N A;  5IOI A;  3V62 A;  4A90 A;  1N62 A;  1KOT A;  4C4V B;  4WWO A;  2CJN A;  3WIM A;  1QOB A;  4REZ A;  1E8X A;  3RNF C;  4HVB A;  2TSS A;  4IW0 A;  1IP9 A;  1BT0 A;  2D11 A;  3CSF A;  2WXK A;  3V3X A;  3RI7 C;  3VTW A;  3U2S C;  2C7N B;  1SEB D;  2OHF A;  3JSV B;  3SEB A;  5E6O A;  2GB1 A;  3AE4 B;  3MC9 A;  3QAR A;  4MGZ E;  2QEJ C;  2FNJ B;  2LUM A;  1F52 A;  4M0W A;  4ANX A;  4WQO B;  2IGG A;  2KDF B;  4LDT B;  1N5X A;  3RD2 A;  3DPD A;  2KDE B;  1YJJ A;  1WE7 A;  4NQL B;  4ANW A;  3CWI A;  4RNA A;  1QF6 A;  1ISN A;  3UIN B;  2KXJ A;  1KFY B;  2QHO A;  3T3N A;  2BYT A;  4BOZ B;  2XNA C;  4NAW B;  4YXD B;  2MJ3 A;  5D6J B;  3RYT A;  5LXH A;  2Y5C A;  1L0X B;  2MRP A;  3A1Q A;  1WM2 A;  2IO3 B;  3NJT A;  3EFC A;  5D3D A;  1TS2 A;  3DOW A;  1M94 A;  2GI9 A;  2KFK B;  2KAC A;  2ZVO A;  2RDG A;  1ZPS A;  5DCN A;  1HXY D;  3IXS A;  1Q1O A;  2M0X A;  2OJW A;  1Y8R C;  3MHS D;  3DVG X;  3Q69 A;  1YN3 A;  3W1Y A;  3V05 A;  2X8X X;  1LQB A;  2QC8 A;  3HVD A;  3VR8 B;  3T8M A;  2C7M B;  1E9M A;  4KV2 A;  2AQ2 B;  4TKN A;  2R2Q A;  4K3C A;  1RYJ A;  2XEW A;  1R4N B;  1NDD A;  3A9K A;  2L7R A;  2N4F A;  1N5W A;  1N63 A;  2J4X A;  4GSW A;  3PLU A;  2DHZ A;  2FE8 A;  1F1H A;  3MC0 B;  5JZE B;  1I4H A;  2WS3 B;  4XDD A;  2LJ5 A;  3L08 A;  2KZR A;  2M1M A;  1JWM D;  3VUY A;  3AE5 B;  3NVW A;  2JX5 A;  1GUA B;  2WLB A;  4LNI A;  2RPQ A;  3C8Y A;  3NG0 A;  3P63 A;  2KLC A;  5BMG A;  4GOC A;  1K50 A;  4IDI A;  4AQ7 A;  2BKR B;  1CK1 A;  2JF5 A;  2C60 A;  2W3S A;  4ZRJ A;  3VH4 B;  1RM6 C;  3ZDT A;  3IFW B;  4DXF A;  4MGK E;  5IA7 A;  2KLG A;  1OFF A;  1P3Q U;  3WAM A;  3V61 A;  3RZF A;  2IGH A;  5AUI A;  2JU6 X;  3NVV A;  4FAD A;  2MBB B;  2W54 A;  1JQ4 A;  4B6W A;  3HRD D;  2INC C;  1D3Z A;  2JWU A;  4EZK A;  1SE4 A;  2QCZ A;  2ZEQ A;  5JXV A;  3APF A;  3FC4 A;  2D3G A;  5CTR C;  5BMI A;  4MM3 B;  1L0V B;  1UH6 A;  4JX1 C;  1GC7 A;  2Q5W D;  3DWM A;  2CJO A;  5HFY A;  2IZV B;  5HHD G;  2K6D B;  5G5H A;  3E56 A;  3GE3 C;  2KMA A;  1YIW A;  1EU3 A;  1VZ7 A;  2BKF A;  4AJW A;  5HKH A;  2ZVN A;  3RFZ B;  4A8X C;  1E8W A;  3MP9 A;  2WXL A;  4XDC A;  2WU2 B;  3Q8B A; 
#chains in the Genus database with same CATH homology
 3ML9 A;  3RUI B;  1LM8 B;  2OJR A;  3QA8 A;  4IM3 A;  1WIA A;  1E8Z A;  4XC2 A;  2LZ6 A;  5D94 A;  1WXM A;  3TL5 A;  2YLM A;  3ONS A;  2V3S A;  4MEL A;  2MSE D;  4BBN F;  1TTN A;  1OEY A;  3PRM B;  4W9L A;  4A20 A;  1YX6 B;  4HXD A;  2IBI B;  2C9W B;  2CHW A;  2DYO A;  3WAN A;  4KZC A;  2KKC A;  4WWP A;  3H9D A;  4M8M A;  4B9K A;  5G55 A;  1FXT B;  1WFY A;  3QJZ A;  4W9E A;  3RCZ A;  2MWS B;  4A3P A;  1RFA A;  2CS4 A;  1UD7 A;  1WH3 A;  1V49 A;  4F7Z A;  5BO4 B;  4BBN C;  2IY1 B;  2PEA A;  2ASQ A;  2IY0 B;  3MTN B;  4W9I A;  2LXC A;  5CHW A;  2UYZ B;  4EUT A;  5C23 A;  2HD5 B;  4KZ0 A;  4W9C A;  3R7R A;  3LDZ E;  3RZW C;  1RAX A;  4DHJ D;  1OGW A;  2D10 A;  2O2V B;  4IG7 B;  2Y5B B;  4II2 B;  3EFU A;  2MQJ A;  3AI5 A;  2Z0D B;  2A4Z A;  2DZK A;  3X23 A;  2IO1 B;  4W9K A;  3ZVV A;  1WZ0 A;  3WAP A;  4IWP A;  3KUD B;  3TIX A;  2KQ7 A;  3PRZ A;  4TV3 A;  3AU5 A;  2MP2 B;  3PHX B;  3L16 A;  2C7H A;  3ML8 A;  4FJV B;  3UIP B;  3UQB A;  3TMP B;  4DDI D;  2B3A A;  1WXS A;  3QCA A;  4ANU A;  5J18 A;  1GC6 A;  5CHF A;  5E6P A;  2MP2 A;  1YX5 B;  3AUL A;  2N1V A;  3Q3F A;  2KC2 A;  1WJU A;  1SE9 A;  4ZYN A;  4CHK A;  2N7D A;  5DPR A;  1OQY A;  2NVU I;  4IWO A;  4WJN A;  4FHK A;  3DDC B;  3ALB A;  3B1L X;  3ZIM A;  1ZGU B;  4ICV A;  2V1Y A;  4W9G A;  1V2Y A;  1I42 A;  3ZNH B;  2L8J A;  1AAR A;  2KWC A;  2WX1 A;  3QIJ A;  2RR9 A;  4RMA A;  4EZJ A;  3H6N A;  2ZNV B;  4W9J A;  2G45 B;  3DVG Y;  2JT4 B;  3U7D A;  1GNU A;  4GB9 A;  4II3 B;  1RLF A;  2JWZ A;  3SHQ A;  2ZCB A;  1WGY A;  2M8S A;  3IHP C;  4K7U A;  2IO0 B;  2ZNV C;  3V6E B;  2FCS A;  3D32 A;  4BFR A;  5KHQ A;  1WX9 A;  2EMS A;  2A5U A;  3O65 B;  4KVG B;  4AWJ A;  4JIO U;  3NHE B;  4HK2 A;  3ZKJ C;  3EHV A;  4P7I A;  1HE8 A;  1WX8 A;  3ZTD A;  4EZL A;  2UWQ A;  1A5R A;  2DZM A;  2KDB A;  2K8B A;  2XK5 B;  2ZPY A;  3T9L A;  4NJ7 A;  4ASW C;  4I6N B;  1I35 A;  2WYQ A;  4HPL B;  2R2O A;  1C3T A;  4K7W A;  4HJK A;  4FLH A;  1JRU A;  2N7E A;  4GGQ A;  2XK5 A;  4K1R B;  1J19 A;  1WXV A;  2BYE A;  4GN1 A;  2K6Q A;  2MW5 A;  4WJP A;  2RSU A;  4W9F A;  4G0N B;  2KJR A;  4K81 A;  2KHW B;  3V6C B;  4IM2 A;  3HK0 A;  3NZS A;  3H7S A;  3R3M A;  3PRP B;  1E5W A;  2MCN B;  3KW5 B;  3VXW A;  3DBL I;  3P2B A;  3PV1 A;  1IPG A;  2OOB B;  3OJ3 A;  4FN2 A;  4PYZ A;  1V9J A;  1WR6 E;  3L0W B;  4DK5 A;  3M95 A;  2NBW B;  3DCG A;  1E8Y A;  1XQQ A;  2L0F A;  2MX2 A;  2PPH A;  4MGY E;  1YQB A;  2GBR A;  2FCM A;  2GBK A;  2N9E B;  3AXC A;  1RRB A;  2L05 A;  1XT9 B;  4FJZ A;  4GDK B;  4MEM A;  1VD2 A;  4W9D A;  4FA6 A;  2VRR B;  2DYM A;  2GBN A;  2KTF A;  4MGI E;  1SGH A;  4A3O A;  3VVW B;  4M8N A;  1UBQ A;  3ENE A;  2LD9 A;  2WX0 A;  2JUO A;  4GDK A;  2NBU A;  2FAZ A;  3L13 A;  1V6E A;  4MSQ B;  3PVL A;  5LLI A;  2BWE S;  5DPT A;  2MBO A;  2O6V B;  4ZDV A;  2KTR B;  3H7P B;  2EKE C;  4K7S A;  2NPT B;  2KDI A;  1WGD A;  2DZJ A;  1P98 A;  2BGF A;  3IVF A;  3KUC B;  1WJN A;  2O6V A;  2KTR A;  3H7P A;  3I3T B;  2JPH A;  1G6J A;  4FJY A;  2NPT A;  3SD5 A;  4BKG A;  3ZNI D;  2L0T A;  2J7Q B;  2J0J A;  3HM6 X;  2NR2 A;  4GDL B;  4DDG D;  4YL8 A;  2JXX A;  4GXB A;  5JH5 C;  2G4D B;  2D07 B;  4IUM B;  3U8Z A;  3VFK A;  5IAA C;  2BPS A;  1WE6 A;  2AL6 A;  4JQW C;  4GDL A;  2KJH B;  3BIN A;  4MSM B;  2DEN B;  2KQS A;  1C1Y B;  1NBF C;  2KX3 A;  2LUE A;  2K39 A;  5AZH A;  3HHM A;  3S2A A;  1E7U A;  3PRE A;  2PE6 B;  4ZRI A;  2IO2 B;  2M4N A;  2LXA A;  3V62 A;  3PTF C;  2GMI C;  3SDL C;  1KOT A;  1P0R A;  5DPS A;  3W1S A;  3W1S C;  4NPN A;  4EEW A;  3A4R A;  5G2N A;  3JVZ X;  4BKS A;  2FUH B;  4WWO A;  4ANV A;  3V60 A;  3WIM A;  1H8C A;  4PS8 A;  1E8X A;  1EUV B;  2DYB A;  2LRW A;  1LXD A;  3APD A;  1UEL A;  4DBG A;  4HVB A;  2KK8 A;  4LCD E;  1V86 A;  4IW0 A;  3KH0 A;  1IP9 A;  4HLE A;  3UGB B;  1BT0 A;  2XBB C;  2D11 A;  4TQ1 A;  2FCN A;  3ZTC A;  3CSF A;  1S3S G;  1KM7 A;  1OEY J;  2HTH A;  3R7Q A;  3B0A A;  3VTW A;  1V5O A;  2C7N B;  2DX5 B;  2G3Q B;  3PT2 B;  3QC8 B;  1J8C A;  1TZ1 A;  3A9J B;  2BYV E;  2NS5 A;  3JSV B;  3L54 A;  3PS6 A;  3QX1 A;  5E6O A;  5LXI B;  4M0W B;  3QAR A;  5DPW A;  4KSK C;  3ZNG C;  3WAO A;  4MGZ E;  2JZZ A;  4HCP B;  2WWZ A;  3A9J A;  3JSV A;  2FNJ B;  2HE7 A;  2N9P C;  3CMM B;  3DBH I;  3HIZ A;  4ANX A;  1VCB A;  3VUW A;  3ZRF A;  4GMV A;  2CU1 A;  4WQO B;  2CR5 A;  1P1A A;  2KDF B;  4CYE A;  4LDT B;  2K25 A;  3B08 A;  3RD2 A;  2GBJ A;  2N1W A;  3DPD A;  2KDE B;  2O6V D;  2BYF A;  2HJ8 A;  1WE7 A;  3GOE A;  4J6I A;  4NQL B;  4RM8 A;  4B95 A;  4ANW A;  4BVU C;  3PZD A;  2KJ6 A;  2NCN A;  1ISN A;  3UIN B;  3BY4 B;  2GBM A;  2KXJ A;  2Z59 B;  1GG3 A;  2QHO A;  3ZRC A;  2LRU A;  1WX7 A;  4AJY B;  1F9J A;  5JHB A;  2DAF A;  4BOZ B;  1OTR B;  1WZ3 A;  3L17 A;  3WA0 A;  3NOB A;  3M62 B;  3A1Q B;  2G4S A;  3MJW A;  1WXA A;  4NAW B;  3APC A;  3OLM D;  2KFJ A;  5D6J B;  4HCN B;  2MBQ A;  3NZU A;  3RYT A;  1E90 A;  1NI2 A;  3UIO B;  3VTU A;  3VUX A;  5LXH A;  1WJ6 A;  2MRP A;  3A1Q A;  1R4N I;  1TBE A;  1TGZ B;  4NAW A;  4PYU A;  4WJO A;  2JY6 A;  1WM2 A;  2IO3 B;  5E6N A;  2M17 A;  2ZCC A;  3VHT C;  3GZN I;  1X1M A;  2ZZP B;  2AYO B;  3QK0 A;  1WGH A;  2NBV B;  3SU8 X;  4KIK B;  3DOW A;  5JHA A;  1M94 A;  4E3C A;  3KVF B;  4BKS D;  5AEK B;  1L2N A;  2KFK B;  2PJH A;  1UGM A;  4IM0 A;  2D2Q A;  2ZVO A;  1V81 A;  2CHX A;  3KYC D;  2FCQ A;  4HPM B;  3N30 A;  4KIK A;  5DCN A;  4IWQ A;  2CHZ A;  5CHV C;  5CX3 A;  1Q1O A;  2M0X A;  2KFK A;  5AZF A;  2KVR A;  4MDK E;  1Y8R C;  3A33 B;  5KHO A;  4DXA B;  3MHS D;  4F1S A;  3DVG X;  3ZO5 B;  4AUQ C;  4WAA A;  5L95 C;  2LVO A;  3H1U A;  3L10 B;  2W9N A;  4I6P A;  5D2M B;  1WM3 A;  2YVC A;  4ICU A;  3W1Y A;  3CF6 E;  2LAS A;  4OVV A;  3ZUN A;  2L00 B;  1LQB A;  2KOX A;  4EFO A;  2KWV B;  5FR6 A;  2MA9 B;  3PHW B;  3DVN U;  3VQI A;  1CMX B;  4EOY A;  4JL9 A;  3T8M A;  3A9K B;  2C7M B;  3UF8 A;  4URK A;  4KV2 A;  4TKN A;  2R2Q A;  1Q5W B;  2K1F A;  4HDO A;  2K8H A;  3KUZ A;  4I6L B;  1XD3 B;  2JVC A;  2XEW A;  1WYW B;  3K9O B;  1NDD A;  2L76 A;  3A9K A;  1WGG A;  1KJT A;  2L7R A;  2LVQ A;  1MG8 A;  2N4F A;  1WR1 A;  4HDQ A;  3CST A;  3VAW A;  3KYD D;  2LGD A;  4GSW A;  3PPA A;  3PLU A;  2DHZ A;  2PE9 A;  3TJP A;  3WAL A;  5JZE B;  1LFD A;  4LDT D;  2MBE A;  2EMT A;  2J0M A;  1EF1 A;  3RT3 B;  4WJQ A;  2KD0 A;  3N3K B;  3N32 A;  3X0W A;  2LJ5 A;  2KAN A;  2LVP A;  3L08 A;  2K8C A;  2KZR A;  2M1M A;  1L7Y A;  2Z0E B;  2JRH A;  3PSE B;  3TCA A;  3VUY A;  1P9D U;  3VH3 B;  3OAW A;  2I1K A;  2C5L C;  1GUA B;  4G11 A;  4LJP B;  1GJZ A;  2KC1 A;  2KO3 A;  2LWP A;  2N9X A;  2RPQ A;  3PGE A;  2KLC A;  3M63 B;  4GOC A;  4OVU A;  1IYF A;  1SIF A;  4BOS C;  1WY8 A;  2BKR B;  3NS8 A;  4XZ4 A;  4W9H A;  4NJ6 A;  2MBH A;  2JF5 A;  3HM3 A;  2C60 A;  4ZRJ A;  4E71 A;  3AU4 A;  3VH4 B;  4GIV A;  3OJ4 B;  1S1Q B;  3IFW B;  3IBE A;  3ZDT A;  1T0Y A;  2O2V A;  2V4L A;  4MGK E;  5IA7 A;  2FID A;  2KLG A;  1K8R B;  1YD8 U;  2MLB A;  4FBJ B;  1P3Q U;  3WAM A;  4DHZ B;  3V61 A;  3RZF A;  4JGH B;  3VDZ A;  1ZKH A;  3K9P B;  2IYD B;  4FUL A;  3ZW3 A;  3JW0 X;  3RUL A;  1H4R A;  3DBS A;  4FAD A;  1WJ4 A;  2JRI B;  3ZNZ B;  1V5T A;  4TQ0 A;  2MBB B;  2I1J A;  2LGY A;  1E7V A;  4N9F 4;  3U30 A;  5J2R A;  1U4A A;  2JZ3 B;  2KWU B;  4WWN A;  4B6W A;  4RM9 A;  4TUU A;  4IC7 B;  1D3Z A;  4KDI C;  5TR5 A;  1WMH B;  2KX0 A;  4EZK A;  4CO7 A;  4DHZ E;  2AL3 A;  2BF8 B;  5D7G A;  4EKU A;  2ZEQ A;  3IG3 A;  1J0G A;  3APF A;  2D3G A;  4AOF A;  3QQ8 B;  2ZJD A;  1WF9 A;  3EEC A;  1WMH A;  5CTR C;  1ZW7 A;  4F8C B;  3R66 C;  1EO6 A;  2LI5 A;  4KDL B;  5C1Z A;  3QAQ A;  2FIF A;  2LGX A;  3QHT A;  5EDS A;  4FHJ A;  1UH6 A;  4X57 B;  1QZE A;  1WGR A;  1Z5S B;  2AWT A;  1GC7 A;  4DHJ B;  4G3X B;  1KLV A;  1EF5 A;  4MM3 A;  2KMC A;  1PQS A;  3EC8 A;  3Q3J A;  4G50 A;  1V80 A;  2IZV B;  5L83 A;  2J0K A;  2K6D B;  3ZDM C;  1UBI A;  3DBR I;  3ECI A;  2RGF A;  1Z2M A;  1WRD B;  2ZPN A;  3C0R B;  4BKT A;  3LJ3 A;  2GOW A;  3JYU A;  3NY5 A;  3UQA A;  2KN5 A;  2DAJ A;  1Q0W B;  3ZLZ A;  3TBL D;  3QWZ B;  4E74 A;  3A4S C;  2KMA A;  3DQV A;  2L3Z A;  1YIW A;  4MJS B;  4XX5 A;  4AP4 C;  2BKF A;  2RD0 A;  4GU2 A;  4NY0 A;  4AJW A;  4KSL C;  4NQK E;  2ZVN A;  5HKH A;  2KNB A;  3DVN V;  5GMV A;  1E8W A;  4NNJ B;  1UZX B;  4MJS A;  3VTV A;  2REX A;  1YJ1 A;  4HWI B;  3PLV A;  5AZG A;  4MH0 E;  4JLC A;  5J17 A;  3M3J A;  2AEH A;  2CKH B;  4PS7 A;  4PS3 A;  2WDT B;  4ZRK A;  4DWF A;  1R4M I;  1WI0 A;  2DZI A;  4LJO B;  2BWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...