1OEYJ

Heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'HMTNWLRVYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 2
molecule tags Immune system
source organism Homo sapiens
publication title Pb1 Domain-Mediated Heterodimerization in Nadph Oxidase and Signaling Complexes of Atypical Protein Kinase C with Par6 and P62
pubmed doi rcsb
total genus 26
structure length 105
sequence length 105
chains with identical sequence K, L, M
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1oeyJ00
2FAZA 4M8NA 1MG8A 2JT4B 3EC8A 3Q3JA 1E8YA 4NQKE 1WMHA 4HPMB 2O6VD 3N32A 3PTFC 2IZVB 4EOYA 1L7YA 4RM9A 1WE7A 4TKNA 1WGRA 4EZLA 1V5OA 4HK2A 1H8CA 4GN1A 2UYZB 4WJQA 2DENB 2HD5B 5AZGA 4ZDVA 4FADA 5G2NA 1IPGA 1LQBA 1ZGUB 5AEKB 2AEHA 3KYCD 2LGXA 2KWCA 2GBMA 1WR6E 1C1YB 3MTNB 4I6NB 1WZ0A 3GZNI 2M17A 3V60A 3UGBB 5J18A 2G45B 4MDKE 4IG7B 1ZW7A 4G11A 1WFYA 5LXIB 2KFKA 5D2MB 4IC7B 3JYUA 2HTHA 2G3QB 4FHKA 4BBNC 1P98A 2D11A 4DHZE 2LJ5A 1WJNA 3M62B 2C7HA 1V2YA 4FJVB 2ZPYA 3RCZA 2DAFA 5LLIA 1WJUA 1RRBA 1WMHB 1XQQA 1K8RB 4KV2A 3Q3FA 1E8ZA 3PVLA 3QAQA 4MH0E 4PYZA 1TTNA 3K9PB 3X0WA 1P9DU 5CHVC 2V1YA 1WY8A 4II3B 2KHWB 4W9KA 3AULA 2N4FA 4W9GA 4ASWC 4FJYA 3ZRCA 2C7NB 2A5UA 2D3GA 1V9JA 2CU1A 4GDLA 3UF8A 4LCDE 4WWNA 3TCAA 2KFKB 2EMTA 4BOSC 2NS5A 2NBWB 3ECIA 4PS7A 4KSLC 4ANXA 3MHSD 3APFA 2YVCA 5GMVA 1UELA 2KLGA 3LDZE 4E3CA 2ZZPB 2KK8A 1SGHA 2K1FA 2XBBC 2M0XA 3H7PB 2PE6B 1WYWB 2KD0A 4HPLB 5CHWA 3ENEA 1NBFC 2O6VA 2FCQA 2LRWA 3R7RA 5JHBA 1RLFA 2LXAA 4FHJA 3W1YA 1LM8B 2C9WB 2IBIB 3VH4B 3IG3A 3KVFB 3M63B 2WWZA 2GBRA 3VUYA 4MJSA 4TUUA 4GOCA 2RPQA 2WX1A 3D32A 4I6PA 4CHKA 3VXWA 4DBGA 1UH6A 1OGWA 2W9NA 2LRUA 3L0WB 2JZ3B 2BWFA 2V4LA 1L2NA 3ML8A 5KHQA 1E8XA 4AWJA 2N1WA 2LGYA 4DK5A 1VD2A 5AZHA 3VFKA 3DBLI 1LFDA 5JHAA 2MWSB 1WM2A 2DYMA 3RZFA 1WX9A 4IW0A 1YX5B 3L16A 4CO7A 3SHQA 2ZNVC 3A4RA 3JW0X 2K6DB 2PPHA 3EECA 4M8MA 1OEYJ 3ZO5B 2KQSA 2XK5B 2D07B 2DX5B 1KLVA 1V86A 3ZDMC 3MJWA 1XT9B 1WXMA 4HXDA 4RMAA 3VDZA 3VQIA 1P1AA 3A9KA 4GMVA 4K1RB 4K7SA 1WX8A 3TMPB 3OJ3A 3PGEA 2DAJA 1E5WA 1E7VA 2L05A 2BWES 2GOWA 4WAAA 2KTRA 2K25A 4LDTB 3ZNID 2REXA 1V6EA 4DDGD 3KH0A 3QHTA 4TV3A 2O6VB 4LDTD 2G4DB 1J19A 3SDLC 3I3TB 2KTFA 2NBUA 3EFUA 3U30A 2BYEA 4BFRA 1TBEA 1R4NI 3QJZA 2MA9B 2K8BA 4HCNB 2JY6A 1WI0A 2M4NA 2Z0EB 3ONSA 4TQ0A 2BKRB 5J17A 4GB9A 1EO6A 4IM3A 1YD8U 3ML9A 4CYEA 2MLBA 1GJZA 1TGZB 4K81A 4B6WA 4X57B 2L00B 1WXVA 4MSMB 3BY4B 4IUMB 4G3XB 4KIKB 4BKSA 1ZKHA 3QARA 3AXCA 4FBJB 4HVBA 4EZKA 1E90A 5DPRA 4II2B 1P0RA 2I1KA 2J0MA 2KOXA 4JLCA 3TBLD 3U8ZA 3VAWA 2KWVB 4F1SA 2LXCA 4AP4C 1WXAA 2KQ7A 3R3MA 1WIAA 2PEAA 2Y5BB 3PHWB 3ZTCA 2Z59B 1WGGA 4NPNA 1G6JA 2N9XA 3CF6E 3JSVA 3KUDB 4W9FA 4W9IA 1KOTA 4GDKB 1WGDA 3WAPA 2L7RA 4FLHA 3LJ3A 2HE7A 4K7UA 1VCBA 1YX6B 4W9CA 2BGFA 2K39A 2MP2B 3L54A 4MM3A 4F7ZA 3NZUA 2KX3A 3QK0A 4E74A 4HCPB 5D6JB 2N7EA 3DPDA 1WJ6A 3O65B 4KDIC 1GNUA 5EDSA 3TIXA 5E6OA 4BBNF 4JQWC 2WYQA 2NCNA 4GSWA 2GBNA 1NI2A 3CMMB 3ALBA 2RD0A 4WJOA 3H6NA 3TL5A 2JRHA 3VTVA 3GOEA 2N9EB 4BKGA 3PS6A 2M1MA 3C0RB 2MQJA 3PHXB 2KN5A 2CHZA 4ICUA 2MP2A 3CSFA 4GIVA 4F8CB 4AJWA 5DCNA 3UQBA 4LJPB 3PRZA 1V49A 4KZ0A 2KFJA 4G0NB 5JZEB 4BOZB 2VRRB 3PT2B 2FCMA 2BPSA 5C23A 3DQVA 1ISNA 4GGQA 3IFWB 3PRMB 4NNJB 2LVPA 1U4AA 3N3KB 3L08A 4AJYB 5E6PA 5L95C 4GDKA 3H1UA 2N7DA 1YQBA 1M94A 4IM2A 1BT0A 4NAWA 4N9F4 3KW5B 2NVUI 4B9KA 3RUIB 4W9LA 2LD9A 3PSEB 1IP9A 2JPHA 1EUVB 2KO3A 3T9LA 2RSUA 1J0GA 2CHXA 3DDCB 2K6QA 2KXJA 2NPTB 2CHWA 2KDEB 4NJ6A 3RD2A 4DDID 1UZXB 1I35A 2JXXA 3PLVA 4ZRJA 2FIDA 3W1SA 4HWIB 3KYDD 3V6CB 4OVUA 2JVCA 3ZVVA 3WA0A 3M95A 5DPWA 1UGMA 3DVNV 3KUZA 2LASA 2PE9A 3IHPC 3RYTA 4HLEA 3APDA 1KM7A 3UIPB 5AZFA 4IM0A 3TJPA 2L0TA 3W1SC 2J7QB 3K9OB 1SIFA 2LUEA 2MBHA 3H9DA 2NPTA 4FA6A 4W9EA 4ZYNA 2JWZA 2KJHB 2O2VB 1GC6A 3B1LX 4WWOA 2KVRA 3B0AA 4KDLB 1Z5SB 4IWPA 2KLCA 2CS4A 4AUQC 3QA8A 2RR9A 1AARA 3HM6X 5CHFA 4WQOB 3KUCB 5TR5A 4PYUA 2LGDA 1OQYA 3T8MA 2DYBA 4MGYE 3ZKJC 4B95A 3QQ8B 3A9KB 3PV1A 1RAXA 2WX0A 3N30A 2AL3A 2MBOA 3V62A 3RZWC 5IA7A 5HKHA 3NHEB 2I1JA 2NBVB 4G50A 2MBQA 4ANWA 4A3OA 3NS8A 1R4MI 3M3JA 1NDDA 5J2RA 1D3ZA 3S2AA 5DPSA 4P7IA 4KIKA 5DPTA 4A20A 5BO4B 5C1ZA 2IY1B 4NAWB 4XZ4A 3ZRFA 3PPAA 2GBJA 4MGIE 4DWFA 3DVGX 4EKUA 2KMCA 2OJRA 3JSVB 4MEMA 4ICVA 1C3TA 1WH3A 2BKFA 3B08A 3RULA 3OLMD 2QHOA 4MGKE 2FUHB 2MW5A 2DZIA 2M8SA 4YL8A 1A5RA 1Q1OA 2KANA 3QX1A 4IWQA 1OEYA 5D94A 4J6IA 1CMXB 5G55A 3RT3B 1J8CA 3H7SA 1T0YA 3ZNZB 2CKHB 2FCSA 3VTWA 4FN2A 3ZTDA 1E8WA 1WZ3A 1KJTA 5KHOA 3IVFA 2R2OA 4KSKC 4ANVA 4ZRIA 4I6LB 2AWTA 1WJ4A 1UD7A 4WJPA 5D7GA 2ZVOA 2KWUB 4JGHB 1WXSA 3NOBA 2LWPA 1UBIA 2R2QA 3WALA 5E6NA 2MBBB 3ZUNA 2BYFA 5CX3A 2FNJB 2JRIB 1SE9A 2YLMA 2GMIC 4EEWA 1WGHA 4URKA 2L3ZA 3VUWA 3ZNHB 2KDBA 3VH3B 3WIMA 3U7DA 1V5TA 3NY5A 4EZJA 3DBHI 1GC7A 1WE6A 1HE8A 2IYDB 3ZLZA 4HDQA 3HK0A 4OVVA 1QZEA 1UBQA 1WGYA 3VHTC 2IO3B 4MGZE 4A3PA 1E7UA 5IAAC 2MBEA 2KDIA 2L76A 2JZZA 3A1QB 3EHVA 4LJOB 2LI5A 2KMAA 1IYFA 2GBKA 2D10A 2MSED 1WR1A 3P2BA 2JF5A 4M0WB 2EKEC 2DZMA 3ZDTA 2UWQA 4AOFA 1H4RA 1RFAA 1F9JA 3L10B 2KC1A 1EF5A 3WANA 2KJRA 1GG3A 3HM3A 3VTUA 4HJKA 5CTRC 2L0FA 3WAOA 3X23A 1GUAB 3R7QA 2B3AA 3DVNU 3PZDA 2ZEQA 2DZKA 2ASQA 3APCA 2MX2A 2L8JA 1WX7A 1TZ1A 4TQ1A 1Y8RC 2BYVE 2WDTB 3HIZA 3SU8X 4E71A 1I42A 3L13A 4KZCA 3A9JB 4DXAB 4JIOU 2K8HA 2D2QA 1JRUA 2DHZA 3DCGA 4KVGB 3DVGY 4FULA 1WM3A 3V61A 1S1QB 5L83A 4XC2A 2ZNVB 1XD3B 4W9JA 3A1QA 2KC2A 1X1MA 2KX0A 4DHZB 2ZVNA 1EF1A 4XX5A 2O2VA 3UIOB 2J0JA 3DBSA 4W9DA 3AU5A 3A9JA 2KJ6A 3DBRI 3PRPB 4GXBA 4ANUA 1YJ1A 3AU4A 4ZRKA 2FCNA 2AYOB 3OJ4B 2AL6A 2K8CA 4BVUC 4EUTA 1FXTB 4GDLB 3UQAA 1YIWA 3CSTA 2LVOA 2LZ6A 2NR2A 3H7PA 3QWZB 4NY0A 4MELA 1PQSA 2FIFA 4HDOA 2XEWA 2J0KA 2JUOA 1WRDB 2KKCA 3UINB 3PREA 2RGFA 4GU2A 4W9HA 2BF8B 1LXDA 3IBEA 2MCNB 2CR5A 4MJSB 1Q5WB 1V81A 3OAWA 2ZCBA 1P3QU 4JL9A 2KDFB 5FR6A 5JH5C 1WF9A 3AI5A 4K7WA 3SD5A 2PJHA 4NQLB 5LXHA 3L17A 1S3SG 4DHJD 2OOBB 2IO0B 2N1VA 2ZCCA 1V80A 3A33B 2IO2B 2KZRA 3DOWA 3R66C 4PS3A 2KTRB 3VUXA 3QIJA 3ZW3A 2A4ZA 4IWOA 4FJZA 3BINA 4WWPA 2MRPA 4BKSD 1Q0WB 4RM8A 3A4SC 2G4SA 3VVWB 2V3SA 2C7MB 1OTRB 2IO1B 3HHMA 3WAMA 3ZNGC 2XK5A 3NZSA 1Z2MA 4WJNA 2Z0DB 2C5LC 2EMSA 2N9PC 3ZIMA 3JVZX 4BKTA 2KNBA 4EFOA 4NJ7A 2DYOA 3V6EB 2IY0B 2LVQA 2DZJA 2ZJDA 3QCAA 2HJ8A 4MSQB 2C60A 2ZPNA 4DHJB 3PLUA 3QC8B 4PS8A
chains in the Genus database with same CATH superfamily
1F52A 2WXGA 4NQKE 4HPMB 3UI3A 1VRAB 4EOYA 2WXQA 1TS2A 1JROA 4GN1A 4WJQA 2DENB 2OEDA 5G2NA 1LQBA 1ZGUB 3KYCD 1WWTA 3MTNB 4I6NB 4XDDA 3RNBC 4OHJA 3BVZA 4L2YA 5J18A 1L4DB 2G45B 1ZW7A 4OZBA 1WFYA 5D2MB 1R4MB 3P4QB 3U4EG 2RDHA 2G3QB 2JXTA 2D11A 4DHZE 2X38A 3M62B 2BQQA 1WJUA 2V9HA 3Q3FA 4MM3B 4ZRPA 3K9PB 4B0MA 2V1YA 3LB8C 3URYA 4W9KA 3R2IA 2PW9A 1SEBD 1TS5A 1N5WA 4LCDE 4WWNA 3TCAA 2KFKB 2NS5A 2NBWB 1MVKA 3ECIA 1QOGA 1FCCC 1I4PA 2YVCA 2ZZPB 2KK8A 3H7PB 1ENFA 2PE6B 4HPLB 3WCQA 2J53A 2O6VA 2FCQA 2LRWA 5JHBA 3NG0A 5H92C 1J7BA 3VH4B 3KVFB 2GBRA 3D32A 3AE2B 2H89B 4CHKA 4DBGA 2W9NA 4TMAB 2BWFA 2V4LA 4LNFA 1ZOYB 3Q69A 4CO7A 4M8MA 3EECA 4YSZB 1CK1A 2LJIA 3MJWA 3VDZA 1P1AA 1YJIA 1STEA 4K7SA 2QCZA 2BB5A 2BWES 4LDTB 1JQ4A 3ZNID 3HVZA 3KH0A 2KWDA 2O6VB 3GP7A 1JALA 1J19A 3OWEB 1N6ZA 2BYEA 1TBEA 1R4NI 1WI0A 4YTPB 2M4NA 5J17A 2LEKA 3ZYYX 2M56B 4CYEA 2L00B 4MSMB 1UWMA 4BKSA 3QARA 3AXCA 2Z8LA 3Q8BA 2I1KA 2KOXA 4JLCA 4A90A 4AP4C 1WXAA 3KWVA 2J4XA 3R3MA 1R7SA 5MPOA 4NPNA 2N9XA 2IGHA 4GDKB 3WAPA 2QC8A 1VCBA 2K39A 3L54A 4MM3A 2K5PA 4HCPB 1PDXA 1WJ6A 5C3JB 5EDSA 1Q10A 1ZDXA 4BBNF 1FIQA 2WLBA 3CMMB 2RD0A 4WJOA 1MG4A 3VTVA 1TIFA 3ZJVA 1SE3A 3C0RB 2MQJA 3PHXB 1T0QC 2MP2A 3UQBA 3PRZA 4M00A 4KGSA 4XYCA 1QKZA 4BOZB 2BPSA 5FKAC 3N9YC 2K22A 2CJOA 5E6PA 3GS2A 5L95C 4GDKA 1YQBA 4N9F4 2I2YA 4B9KA 3P4PB 3PSEB 1IP9A 2J42A 2GI9A 1RWSA 2CHXA 3DDCB 3I63C 2NPTB 4NJ6A 2CU3A 3GE8C 1PGAA 4HWIB 3V6CB 3WA0A 3V05A 3M95A 4ZOHC 1UGMA 2PE9A 3UIPB 5AZFA 1SIFA 2MJEA 1K53A 1IGDA 5I4DA 2G9HD 2O2VB 4A55A 3B1LX 4XGAB 4RF0A 2CS4A 1KTKA 4WQOB 3KUCB 4WIPA 3A9KB 3KLSX 2AL3A 2XN9C 3RZWC 5HKHA 3NHEB 1AWDA 3M3JA 1D3ZA 3Q3MC 5DPSA 1YN3A 5DPTA 5BO4B 5C1ZA 2IY1B 4NAWB 1HTOA 4DWFA 4LNNA 4ICVA 3B08A 4XWWA 1J7AA 2FUHB 2MW5A 2M8SA 2QEJC 3B2FA 1PYWD 1WSPA 4J6IA 2K3UA 3RT3B 1T0YA 5BYRA 5FK9C 3VTWA 2D3BA 1E8WA 1NI3A 2GLSA 1FCLA 1FD6A 2PLPA 2AWTA 2BVCA 5D7GA 1WXSA 2MBBB 1FNUA 1YN4A 4EEWA 2JX5A 3VUWA 2KDBA 2DWQA 3N1YC 4C7ZA 3NRZA 1FMAD 3WIMA 3NY5A 3N20C 3DBHI 1F77A 3IT6B 2IGGA 1QZEA 3VRBB 2AQ2B 2L76A 2JZZA 3EHVA 1IYFA 1WR1A 4P6VF 4S17A 2DZMA 3ZDTA 4AOFA 1L0YB 3L10B 1EF5A 2KJRA 1ZXHA 5CTRC 1T0RC 3PZDA 3Q8AA 2D5GA 2DZKA 2WDVB 1ET9A 3HIZA 5D3IB 3AEAB 2WXRA 3A9JB 2K8HA 1RM6C 1XLNA 4KVGB 4K3BA 4W9JA 1HTQA 4WWMA 1C9FA 2KC2A 2KX0A 2J0JA 3DBSA 4QAYA 1ZE3D 1T5XD 4ZRKA 2AYOB 1KFYB 1NYQA 5TSSA 4EUTA 2LZ6A 3NVYA 1VZ7A 2W55A 1N62A 3GZNB 4M02A 1WRDB 3AE6B 1KLGD 2SAKA 2KKCA 1LO5D 3P63A 2RGFA 4MACA 4W9HA 3IBEA 2CR5A 1P3QU 2KDFB 3SD5A 2QDFA 1S3SG 2IO0B 1A70A 2W3SA 3AV8A 3DOWA 2IO2B 2KZRA 2W3RA 3R66C 3ZW3A 4IWOA 4FJZA 2MRPA 4RGNA 2G4SA 3AEFB 3DBHB 2IO1B 3WAMA 2XK5A 3NZSA 1Z2MA 5H8YE 2Z0DB 2MJ3A 2WU2B 4EFOA 3T3NA 4NJ7A 4S0RA 4MSQB 3QC8B 2N9KA 4PS8A 3Q3JA 1WMHA 5AUIA 2O6VD 3PTFC 1ROEA 4RM9A 1WE7A 3IAM1 4LLGM 2KN4A 1TKEA 5AZGA 2OJWA 2AEHA 2Q5WD 1WR6E 1C1YB 4JE3B 3RNCC 1WZ0A 3GZNI 2M17A 3V60A 2BS2B 3UGBB 1UWXA 3DWMA 4IG7B 5LXIB 1GAQB 2W54A 2WXKA 3JYUA 1JW9D 4FHKA 2VZKD 1P98A 3BZDB 2DLBA 4FJVB 2ZW1A 1SJHD 1QQRA 5LLIA 2AQ3B 1RRBA 1WMHB 1XQQA 3PVLA 4XDCA 3QAQA 1TTNA 1DYQA 1P9DU 1TY0A 2E6XA 1WY8A 2WS3B 4II3B 2JWUA 2KHWB 3AULA 2N4FA 4W9GA 4FJYA 2A5UA 2D3GA 4WURA 3DBLB 4BOSC 1ZDVA 2ONQA 3FILB 1VZ6A 1XF5L 3MHSD 1SB3C 4NAMA 1UELA 2KLGA 2MHJA 3VRAB 3RFZB 2M19A 5BYQA 2KYWA 2K1FA 1OFFA 1WYWB 4AQ7A 5BMIA 3ENEA 1C77A 1ESFA 2LXAA 1LM8B 2JSVX 3M63B 4BZAA 3VUYA 4MJSA 4GOCA 1I4QA 1OQRA 1FNWA 3L0WB 3ML8A 2LGYA 2K9XA 1VD2A 2FE8A 1WM2A 2DYMA 2MWSB 3RZFA 1KLUD 1YX5B 2ZNVC 3A4RA 3JW0X 2K6DB 2PKOA 2VZKB 2D07B 2AQ1B 3VQIA 2WXFA 4HXDA 3TMPB 3PGEA 3ZGZA 1E7VA 1PFDA 2GOWA 4WAAA 2KTRA 3TUOA 3AEEB 4DDGD 2REXA 4TV3A 4DXGA 1WYGA 3SDLC 2KTFA 3U30A 3QJZA 2MA9B 4HCNB 3TEYA 3RI7C 3ONSA 4TQ0A 4GB9A 1D5XC 4IM3A 1UNSA 1C4PA 1GJZA 4LNKA 4IUMB 3BYYB 4KIKB 2VH1A 4FBJB 3PZ7A 5T8IA 3VAWA 3PHWB 2TSSA 1WGGA 3JSVA 2R61A 1WGDA 4FLHA 2RDBC 2HE7A 2RDGA 1JCKB 2MP2B 3QK0A 2N7EA 3O65B 3FC4A 2WYQA 4GSWA 3H6NA 4RF1A 2JRHA 3GOEA 2N9EB 4YTNB 4BKGA 2M1MA 4WAFA 2KN5A 4F8CB 4CQNA 2KFJA 1HEZE 2KQ4X 3PT2B 4DQOC 3FAHA 3DHHC 5C23A 1ZUD2 2XNAC 4GGQA 3IFWB 2LVPA 1U4AA 3J9CA 3N3KB 1FPYA 2IPKD 2YEPF 4AJYB 4PT5A 1JMLA 2N7JA 3H1UA 4GLSC 2N7DA 4C7YA 4IM2A 4NAWA 1BT0A 1BXTA 4ACFA 2JPHA 4L23A 4IOIE 3T9LA 1J0GA 2K6QA 2KXJA 2CHWA 1UZXB 4A6QA 1V8CA 2EKIA 2JXXA 4ZRJA 1MFWA 4C00A 4C80A 3I5JC 4J3OD 3DVNV 3KUZA 2LASA 3APDA 2J7QB 2GB1A 2MBHA 4W9EA 1GC6A 1TS4A 2KLCA 1E0ZA 5CHFA 2N0SB 5TR5A 3T8MA 1QF6A 3QQ8B 1VZ8A 3V62A 2MBOA 5IA7A 1NENB 2JYEA 4YSYB 3C19A 4A3OA 1R4MI 1EM7A 3AE5B 3S2AA 4A20A 2UU7A 4XZ4A 3SFDB 4M01A 2KMCA 2OJRA 3JSVB 3Q8FA 3RULA 2QHOA 4EE2A 1IUEA 4YL8A 1MHHE 1K52A 1J8CA 3ZNZB 3R8BA 3ZTDA 1WZ3A 1K51A 1KJTA 2LGSA 5KHOA 4ANVA 2WXPA 3RNAC 1EU4A 1WJ4A 1IBXB 4WJPA 1PUTA 3NOBA 2LWPA 2R2QA 3ZUNA 5CX3A 1SE9A 1WGHA 4URKA 3RNEC 1KH0A 4JX1C 3U7DA 1T3QA 1V5TA 4EZJA 1WE6A 1HE8A 2IYDB 3ZLZA 2FUG1 5EE9A 3B2GA 3MC0B 4MGZE 4A3PA 3W9CB 1C4AA 3DWGC 2L32A 3CWIA 4RH6A 3AE9B 3A1QB 1YOVB 4LJOB 3NVVA 4RFBA 2D10A 2MSED 1YQ4B 4M0WB 1XLOA 2EKEC 1F9JA 2LMCA 1GG3A 1GUAB 2B3AA 2ASQA 3APCA 5IO9A 1GB1A 4TQ1A 3SU8X 2WDTB 4E71A 2BYTA 4KZCA 4JIOU 3SR6A 2MEKA 3DCGA 2DHZA 4N59A 4YXDB 1WM3A 3V61A 1S1QB 4XC2A 1XD3B 1X1MA 4DHZB 3UIOB 3P1MA 2L52A 2D3AA 3AEDB 1EWYC 3DBRI 3PRPB 4GXBA 4ANUA 4UDUC 4OW0A 4K3CA 2K8CA 4GDLB 3UQAA 1YIWA 2NR2A 3H7PA 3QWZB 2PMVA 3NS1A 4HDOA 2XEWA 1F2RC 3TEWA 1F0ZA 3PREA 4GU2A 1LXDA 2B76B 2QJLA 4ZRQA 1N61A 2WXNA 2H88B 4NQLB 4DHJD 1SSNA 2N1VA 2ZCCA 4RNAA 1V80A 3ZJUA 1LGRA 3Q3OC 3BINA 4WWPA 1MHXA 3A4SC 2V3SA 1SE4A 1SJED 5JXVA 3T3OA 2ZJDA 2HJ8A 3PLUA 3IXSA 1MG8A 2JT4B 3EC8A 3VR8B 1E8YA 1L0XB 2J52A 2IZVB 3U52E 1WGRA 1V5OA 2NTTA 2RPVA 4HK2A 4ZDVA 1YQ3B 3AEBB 3ZXRA 1C76A 4XE0A 3SEBA 5HFYA 1XCTL 1MJDA 1XCQL 5C2TB 1L6VA 3NVWA 1GB4A 5LNK1 4MDKE 3E9SA 2KFKA 3P42A 2PIAA 4IC7B 2INPE 4BBNC 2LJ5A 1WJNA 2C7HA 3MC8A 1K8RB 3EFCA 3HRDD 4MH0E 3MP9A 5G5HA 4ASWC 3ZRCA 2C7NB 2Y5PA 1V9JA 2CU1A 4GDLA 4ARCA 4PS7A 4KSLC 3APFA 1L5PA 1PGXA 5GMVA 2INCC 4RGTA 4E3CA 3LXFA 1SGHA 2M0XA 2KD0A 2DNFA 1L0VB 1V1PB 1NBFC 3LYYA 3R7RA 1AW7A 1RLFA 4FHJA 3W1YA 4HROA 1AN8A 3U2SC 2IBIB 1K50A 3IG3A 4YSXB 2WWZA 1EWCA 4TUUA 1VDVA 2RPQA 4I6PA 3NVZA 1OGWA 4KKIA 2JZ3B 3HUIA 1L2NA 1JWMD 1E8XA 2N1WA 5AZHA 2JU6X 3DBLI 1LFDA 5JHAA 1IGCA 3AE8B 2ON8A 2PPHA 1YNTE 1OEYJ 1KLVA 2DX5B 4US9A 4RMAA 1XLPA 1WXMA 3EGRA 1HXYD 5BMHA 4GMVA 4K1RB 1WX8A 1C4CA 3OJ3A 1E5WA 2L05A 2K25A 1QILA 5IOIA 1V6EA 3BVGA 3QHTA 1V1PA 3RNGC 4LDTD 2G4DB 3P4RB 2IJ0A 4BFRA 2HJ1A 4D2KA 2JY6A 1E9MA 1EO6A 1YD8U 3ML9A 1PGBA 1UF0A 4B6WA 3C8YA 4X57B 3OG5A 2L1AA 1E7PB 3ZQ4A 3DHIC 4HVBA 1E90A 5DPRA 4II2B 1P0RA 3TBLD 2G1EA 2KWVB 4F1SA 2LXCA 2WXMA 1WIAA 2PEAA 2Y5BB 2Z59B 1FFVA 4ZHPA 1G6JA 3CF6E 4W9FA 4W9IA 3MC9A 2L7RA 2EELA 1ZXIA 3GB1A 2BGFA 2KMMA 2W82A 2KX3A 4E74A 5D6JB 4JQWC 1NI2A 3TL5A 2WHIA 2NMQA 3PS6A 4OVZA 1YJJA 2CHZA 2QIEB 4BAXA 4GIVA 4HEA1 2Y5CA 3MFGA 4AJWA 4LJPB 3ABVB 3Q2AC 4MT5A 4G0NB 2VRRB 2QILA 2FCMA 3EUB2 3KQ4A 3KWLA 1JWAD 2JQRB 2WU5B 3W5VB 3PRMB 4NNJB 1XEEA 2QSDA 2NVUI 3KW5B 3ETRA 3RUIB 4P16A 4IDIA 3TEXA 4YWGG 3RD2A 3PLVA 3I9V1 1ET6A 3GE3C 5DPWA 4HLEA 2PVOD 1KM7A 3W1SC 4IM0A 2L0TA 3AE4B 3H9DA 2JWZA 2WGSA 3PO0A 1B9RA 1QOAA 4LK0M 1D5MC 1Z5SB 4IWPA 1AARA 3HM6X 1YN5A 2LGDA 1D6EC 2DYBA 2BTEA 3ZKJC 4B95A 3PV1A 1RAXA 2WX0A 4HKQA 4IKGA 4ANWA 2MJDA 4ITKA 1SF0A 3ZRFA 4M0WA 2GBJA 4EKUA 3DVGX 1TKYA 2BKFA 3OLMD 4MGKE 2DZIA 2WXOA 1Q1OA 4FXCA 3QX1A 5D94A 1ZP0B 2V4IB 2HTME 3H7SA 4B0EA 4FN2A 5GXGB 2LGIA 2R2OA 4KSKC 5IKCM 1DGJA 1UUPA 1C79A 4I6LB 4LNIA 1UD7A 2KWUB 4JGHB 1L4ZB 1NVID 5E6NA 2BYFA 3W5UB 2FNJB 4C4VB 2DBYA 2GMIC 3Q3NC 3ZNHB 3HVDA 1GC7A 1JWBD 4HDQA 3HK0A 3Q14C 1KF6B 1UBQA 3ZXVA 3VHTC 1V1OA 2IO3B 1E7UA 5IAAC 2LI5A 2IGDA 1GPXA 1TJEA 5IN7A 2JF5A 4MH8A 1V97A 2UWQA 1H4RA 2M0AA 3WANA 3X23A 3HM3A 3VTUA 3WAOA 2ACZB 1AYFA 2ZEQA 4A9AA 2L8JA 1TZ1A 1I42A 1Y8RC 2BYVE 4YT0B 2BS3B 2V0GA 4REZA 1JRUA 4FULA 2WXIA 2D3CA 5L83A 2WDRB 3MJ5A 2ZVNA 3RNFC 2O2VA 4ARIA 3N1ZC 2KJ6A 3FILA 3OJ4B 4BVUC 1FXTB 1NYRA 1L6UA 2FIFA 2JUOA 2KDMA 2Y3AA 3Q8CA 4LTUA 3AN1A 4MJSB 1MI0A 1JWSD 3OAWA 2ZCBA 5E6JA 5JH5C 1WF9A 1FFUA 2PJHA 4RGOS 2INNE 5LXHA 1TT5B 3IAS1 3VR9B 3VUXA 3QIJA 2A4ZA 3AE3B 4RM8A 3VVWB 3CIRB 5HI1A 2C7MB 1QOFA 5EE1A 2N9PC 3ZIMA 3JVZX 2KNBA 5IP4D 3B9JA 3V6EB 4C4VA 2IY0B 2ICIA 3BYTB 2FAZA 4M8NA 3BWUD 3N32A 1N5XA 1L7YA 2KAJA 2BW2A 1NEKB 4TKNA 4EZLA 1H8CA 4ZHOA 2UYZB 2HD5B 1FM0D 1IBXA 4FADA 1IPGA 5AEKB 2WNMA 2LGXA 2KWCA 2GBMA 1YMHE 4US8A 1F1HA 3R2TA 3AH7A 3AB5A 2IDYA 3BK1A 4TSSA 4G11A 3TSSA 1FXAA 2CJNA 2HTHA 4HKZE 3TEZA 1P7FA 3Q6BA 4OZAA 1ACCA 1V2YA 2ZPYA 1P7EA 3RCZA 2DAFA 3H8HA 1QT9A 4KV2A 4H2AA 1E8ZA 4PYZA 3X0WA 5CHVC 3AE1B 1HZ5A 3E56A 2WP9B 3UF8A 2EMTA 2LFIA 4ZYSA 1VJKA 1XXGA 2WQYB 3MHZA 4ANXA 3LDZE 5HHDG 1N60A 2KT7A 2XBBC 2LHDA 3DHGC 1FRDA 1TZOA 1Y56A 5CHWA 4KKJA 2C9WB 2V3PA 4KGRA 4N6EB 1CJEA 1I4GA 2WX1A 3N1XC 1FEHA 5FR3A 1D4BA 4YTMB 1DOIA 3VXWA 1UH6A 5G5GA 2LRUA 5KHQA 4AWJA 1HZ6A 4DK5A 3VFKA 1WXQA 1WX9A 4IW0A 3L16A 3SHQA 3ZO5B 2KQSA 2XK5B 1B1ZA 1V86A 3ZDMC 1XT9B 3A9KA 2DAJA 4USAA 3L4PA 4XWTA 4P1BC 3I3TB 3EFUA 2NBUA 2JYTA 2K8BA 5EE0A 2Z0EB 2BKRB 4AS1A 2MLBA 4JPSA 1TGZB 4K81A 5BYSA 1WXVA 1JWUD 1XO3A 3BY4B 4G3XB 1ZKHA 2WXLA 1KRHA 1D5ZC 1TKGA 4EZKA 5BMGA 2J0MA 3U8ZA 2PTLA 1F2RI 2KQ7A 3ZTCA 1QOBA 4RCOA 2BS4B 2YEPB 3KUDB 3NZ3A 1KOTA 3LJ3A 4K7UA 1BUIC 1YX6B 4W9CA 1WRIA 1FNVA 4F7ZA 3NZUA 3AECB 3DPDA 4KDIC 1GNUA 3TIXA 1EU3A 5E6OA 2BBCA 2NCNA 2GBNA 3ALBA 4HRSA 1T6BX 4ICUA 5D3DA 3CSFA 5DCNA 1HA5A 1V49A 4KZ0A 5JZEB 1R4NB 2WDQB 3DQVA 1ISNA 2E3TA 2GRIA 1SIJA 2X8XX 3L08A 3ZJTA 3AE7B 4KGTA 1M94A 2KVZA 2LUMA 4W9LA 2LD9A 3FKYA 1EUVB 2KO3A 1DOYA 2RSUA 4R3DA 3BK2A 2KDEB 1FXIA 4DDID 3NUHB 1I35A 1FRRA 1TYGB 2FIDA 1RYJA 4NJCA 3W1SA 3KYDD 3RN9C 4OVUA 2JVCA 1MPEA 3ZVVA 1N63A 1TS3A 3IHPC 4LNOA 3RYTA 2FBWB 3V3XA 3TJPA 3K9OB 4WQMA 4FA6A 2LUEA 1WGKA 2NPTA 4ZYNA 2WXHA 2KJHB 4WWOA 2KVRA 3B0AA 4KDLB 2OHFA 3QA8A 4AUQC 2RR9A 4Q2JA 3EA6A 4PYUA 1OQYA 4MGYE 2N9LA 3N30A 2I1JA 1VLBA 1CZPA 1E6EB 1HQRD 2NBVB 4G50A 2MBQA 3NS8A 1NDDA 1OQQA 5J2RA 4P7IA 4KIKA 3PPAA 4MGIE 4MEMA 1C3TA 1SE2A 2MH7A 1WH3A 3Q8EA 3AM9A 1SXTA 1A5RA 2KANA 4IWQA 1OEYA 1CMXB 5G55A 1XLQA 2CKHB 2FCSA 2L83A 3U7ZA 3IVFA 1GOZA 3P4SB 4ZRIA 1I7HA 3I57A 4KX6B 4RGMA 1C78A 2ZVOA 1M4VA 1UBIA 3WALA 3IT4B 1QLBB 2RMMA 4P1CC 3DBRB 2I38A 2BB6A 2JRIB 2YLMA 2L3ZA 1VR9A 2AX5A 3VH3B 4C56C 4HJGE 4OVVA 1T0SC 2V3NA 1WGYA 3W2DA 1CQVA 2MBEA 2KDIA 4DXFA 3O13A 3SFEB 2KMAA 2GBKA 1DOXA 3BIID 3P2BA 2INDC 1RFAA 2KC1A 2ZW0A 4HJKA 2L0FA 3R7QA 5EE3A 3DVNU 2MX2A 1WX7A 3L13A 4DXAB 2WXJA 2D2QA 4NZLB 3DVGY 4O1NA 1J7CA 2PVGC 3AMZA 1I4XA 2ZNVB 4N58A 3A1QA 1EF1A 4XX5A 3PZ8A 3AEGB 4W9DA 3AU5A 3A9JA 4L1BA 1YJ1A 3AU4A 2FCNA 2AL6A 4WH4A 4JWUC 2KACA 3CSTA 5HG2A 2LVOA 1E10A 4NY0A 4MELA 1JRPA 3NJTA 1PQSA 1I4RA 3RMKC 2J0KA 2BT6A 1SBBB 3UINB 2BF8B 2MCNB 1BMLC 1Q5WB 1V81A 5FR6A 4JL9A 4HPPA 2VH2A 3AI5A 4K7WA 2K0PA 3L17A 1FO4A 2OOBB 3A33B 4JWSC 4PS3A 1UGJA 2KTRB 1ZPSA 4BKSD 1Q0WB 5AUKA 4PK1A 2QMTA 1OTRB 3RPFC 3HHMA 3ZNGC 2SEBD 4WJNA 2C5LC 2EMSA 2LHEA 3BVMA 1I4HA 4BKTA 2NTSA 2DYOA 1TY2A 1RFKA 2LVQA 4OZCA 2DZJA 3QCAA 2C60A 2ZPNA 2HDEA 4A8XC 4DHJB 2JZPA
chains in the Genus database with same CATH topology
2FAZA 4M8NA 1MG8A 2JT4B 3EC8A 3Q3JA 1E8YA 4NQKE 1WMHA 4HPMB 2O6VD 3N32A 3PTFC 2IZVB 4EOYA 1L7YA 4RM9A 1WE7A 4TKNA 1WGRA 4EZLA 1V5OA 4HK2A 1H8CA 4GN1A 2UYZB 4WJQA 2DENB 2HD5B 5AZGA 4ZDVA 4FADA 5G2NA 1IPGA 1LQBA 1ZGUB 5AEKB 2AEHA 3KYCD 2LGXA 2KWCA 2GBMA 1WR6E 1C1YB 3MTNB 4I6NB 1WZ0A 3GZNI 2M17A 3V60A 3UGBB 5J18A 2G45B 4MDKE 4IG7B 1ZW7A 4G11A 1WFYA 5LXIB 2KFKA 5D2MB 4IC7B 3JYUA 2HTHA 2G3QB 4FHKA 4BBNC 1P98A 2D11A 4DHZE 2LJ5A 1WJNA 3M62B 2C7HA 1V2YA 4FJVB 2ZPYA 3RCZA 2DAFA 5LLIA 1WJUA 1RRBA 1WMHB 1XQQA 1K8RB 4KV2A 3Q3FA 1E8ZA 3PVLA 3QAQA 4MH0E 4PYZA 1TTNA 3K9PB 3X0WA 1P9DU 5CHVC 2V1YA 1WY8A 4II3B 2KHWB 4W9KA 3AULA 2N4FA 4W9GA 4ASWC 4FJYA 3ZRCA 2C7NB 2A5UA 2D3GA 1V9JA 2CU1A 4GDLA 3UF8A 4LCDE 4WWNA 3TCAA 2KFKB 2EMTA 4BOSC 2NS5A 2NBWB 3ECIA 4PS7A 4KSLC 4ANXA 3MHSD 3APFA 2YVCA 5GMVA 1UELA 2KLGA 3LDZE 4E3CA 2ZZPB 2KK8A 1SGHA 2K1FA 2XBBC 2M0XA 3H7PB 2PE6B 1WYWB 2KD0A 4HPLB 5CHWA 3ENEA 1NBFC 2O6VA 2FCQA 2LRWA 3R7RA 5JHBA 1RLFA 2LXAA 4FHJA 3W1YA 1LM8B 2C9WB 2IBIB 3VH4B 3IG3A 3KVFB 3M63B 2WWZA 2GBRA 3VUYA 4MJSA 4TUUA 4GOCA 2RPQA 2WX1A 3D32A 4I6PA 4CHKA 3VXWA 4DBGA 1UH6A 1OGWA 2W9NA 2LRUA 3L0WB 2JZ3B 2BWFA 2V4LA 1L2NA 3ML8A 5KHQA 1E8XA 4AWJA 2N1WA 2LGYA 4DK5A 1VD2A 5AZHA 3VFKA 3DBLI 1LFDA 5JHAA 2MWSB 1WM2A 2DYMA 3RZFA 1WX9A 4IW0A 1YX5B 3L16A 4CO7A 3SHQA 2ZNVC 3A4RA 3JW0X 2K6DB 2PPHA 3EECA 4M8MA 1OEYJ 3ZO5B 2KQSA 2XK5B 2D07B 2DX5B 1KLVA 1V86A 3ZDMC 3MJWA 1XT9B 1WXMA 4HXDA 4RMAA 3VDZA 3VQIA 1P1AA 3A9KA 4GMVA 4K1RB 4K7SA 1WX8A 3TMPB 3OJ3A 3PGEA 2DAJA 1E5WA 1E7VA 2L05A 2BWES 2GOWA 4WAAA 2KTRA 2K25A 4LDTB 3ZNID 2REXA 1V6EA 4DDGD 3KH0A 3QHTA 4TV3A 2O6VB 4LDTD 2G4DB 1J19A 3SDLC 3I3TB 2KTFA 2NBUA 3EFUA 3U30A 2BYEA 4BFRA 1TBEA 1R4NI 3QJZA 2MA9B 2K8BA 4HCNB 2JY6A 1WI0A 2M4NA 2Z0EB 3ONSA 4TQ0A 2BKRB 5J17A 4GB9A 1EO6A 4IM3A 1YD8U 3ML9A 4CYEA 2MLBA 1GJZA 1TGZB 4K81A 4B6WA 4X57B 2L00B 1WXVA 4MSMB 3BY4B 4IUMB 4G3XB 4KIKB 4BKSA 1ZKHA 3QARA 3AXCA 4FBJB 4HVBA 4EZKA 1E90A 5DPRA 4II2B 1P0RA 2I1KA 2J0MA 2KOXA 4JLCA 3TBLD 3U8ZA 3VAWA 2KWVB 4F1SA 2LXCA 4AP4C 1WXAA 2KQ7A 3R3MA 1WIAA 2PEAA 2Y5BB 3PHWB 3ZTCA 2Z59B 1WGGA 4NPNA 1G6JA 2N9XA 3CF6E 3JSVA 3KUDB 4W9FA 4W9IA 1KOTA 4GDKB 1WGDA 3WAPA 2L7RA 4FLHA 3LJ3A 2HE7A 4K7UA 1VCBA 1YX6B 4W9CA 2BGFA 2K39A 2MP2B 3L54A 4MM3A 4F7ZA 3NZUA 2KX3A 3QK0A 4E74A 4HCPB 5D6JB 2N7EA 3DPDA 1WJ6A 3O65B 4KDIC 1GNUA 5EDSA 3TIXA 5E6OA 4BBNF 4JQWC 2WYQA 2NCNA 4GSWA 2GBNA 1NI2A 3CMMB 3ALBA 2RD0A 4WJOA 3H6NA 3TL5A 2JRHA 3VTVA 3GOEA 2N9EB 4BKGA 3PS6A 2M1MA 3C0RB 2MQJA 3PHXB 2KN5A 2CHZA 4ICUA 2MP2A 3CSFA 4GIVA 4F8CB 4AJWA 5DCNA 3UQBA 4LJPB 3PRZA 1V49A 4KZ0A 2KFJA 4G0NB 5JZEB 4BOZB 2VRRB 3PT2B 2FCMA 2BPSA 5C23A 3DQVA 1ISNA 4GGQA 3IFWB 3PRMB 4NNJB 2LVPA 1U4AA 3N3KB 3L08A 4AJYB 5E6PA 5L95C 4GDKA 3H1UA 2N7DA 1YQBA 1M94A 4IM2A 1BT0A 4NAWA 4N9F4 3KW5B 2NVUI 4B9KA 3RUIB 4W9LA 2LD9A 3PSEB 1IP9A 2JPHA 1EUVB 2KO3A 3T9LA 2RSUA 1J0GA 2CHXA 3DDCB 2K6QA 2KXJA 2NPTB 2CHWA 2KDEB 4NJ6A 3RD2A 4DDID 1UZXB 1I35A 2JXXA 3PLVA 4ZRJA 2FIDA 3W1SA 4HWIB 3KYDD 3V6CB 4OVUA 2JVCA 3ZVVA 3WA0A 3M95A 5DPWA 1UGMA 3DVNV 3KUZA 2LASA 2PE9A 3IHPC 3RYTA 4HLEA 3APDA 1KM7A 3UIPB 5AZFA 4IM0A 3TJPA 2L0TA 3W1SC 2J7QB 3K9OB 1SIFA 2LUEA 2MBHA 3H9DA 2NPTA 4FA6A 4W9EA 4ZYNA 2JWZA 2KJHB 2O2VB 1GC6A 3B1LX 4WWOA 2KVRA 3B0AA 4KDLB 1Z5SB 4IWPA 2KLCA 2CS4A 4AUQC 3QA8A 2RR9A 1AARA 3HM6X 5CHFA 4WQOB 3KUCB 5TR5A 4PYUA 2LGDA 1OQYA 3T8MA 2DYBA 4MGYE 3ZKJC 4B95A 3QQ8B 3A9KB 3PV1A 1RAXA 2WX0A 3N30A 2AL3A 2MBOA 3V62A 3RZWC 5IA7A 5HKHA 3NHEB 2I1JA 2NBVB 4G50A 2MBQA 4ANWA 4A3OA 3NS8A 1R4MI 3M3JA 1NDDA 5J2RA 1D3ZA 3S2AA 5DPSA 4P7IA 4KIKA 5DPTA 4A20A 5BO4B 5C1ZA 2IY1B 4NAWB 4XZ4A 3ZRFA 3PPAA 2GBJA 4MGIE 4DWFA 3DVGX 4EKUA 2KMCA 2OJRA 3JSVB 4MEMA 4ICVA 1C3TA 1WH3A 2BKFA 3B08A 3RULA 3OLMD 2QHOA 4MGKE 2FUHB 2MW5A 2DZIA 2M8SA 4YL8A 1A5RA 1Q1OA 2KANA 3QX1A 4IWQA 1OEYA 5D94A 4J6IA 1CMXB 5G55A 3RT3B 1J8CA 3H7SA 1T0YA 3ZNZB 2CKHB 2FCSA 3VTWA 4FN2A 3ZTDA 1E8WA 1WZ3A 1KJTA 5KHOA 3IVFA 2R2OA 4KSKC 4ANVA 4ZRIA 4I6LB 2AWTA 1WJ4A 1UD7A 4WJPA 5D7GA 2ZVOA 2KWUB 4JGHB 1WXSA 3NOBA 2LWPA 1UBIA 2R2QA 3WALA 5E6NA 2MBBB 3ZUNA 2BYFA 5CX3A 2FNJB 2JRIB 1SE9A 2YLMA 2GMIC 4EEWA 1WGHA 4URKA 2L3ZA 3VUWA 3ZNHB 2KDBA 3VH3B 3WIMA 3U7DA 1V5TA 3NY5A 4EZJA 3DBHI 1GC7A 1WE6A 1HE8A 2IYDB 3ZLZA 4HDQA 3HK0A 4OVVA 1QZEA 1UBQA 1WGYA 3VHTC 2IO3B 4MGZE 4A3PA 1E7UA 5IAAC 2MBEA 2KDIA 2L76A 2JZZA 3A1QB 3EHVA 4LJOB 2LI5A 2KMAA 1IYFA 2GBKA 2D10A 2MSED 1WR1A 3P2BA 2JF5A 4M0WB 2EKEC 2DZMA 3ZDTA 2UWQA 4AOFA 1H4RA 1RFAA 1F9JA 3L10B 2KC1A 1EF5A 3WANA 2KJRA 1GG3A 3HM3A 3VTUA 4HJKA 5CTRC 2L0FA 3WAOA 3X23A 1GUAB 3R7QA 2B3AA 3DVNU 3PZDA 2ZEQA 2DZKA 2ASQA 3APCA 2MX2A 2L8JA 1WX7A 1TZ1A 4TQ1A 1Y8RC 2BYVE 2WDTB 3HIZA 3SU8X 4E71A 1I42A 3L13A 4KZCA 3A9JB 4DXAB 4JIOU 2K8HA 2D2QA 1JRUA 2DHZA 3DCGA 4KVGB 3DVGY 4FULA 1WM3A 3V61A 1S1QB 5L83A 4XC2A 2ZNVB 1XD3B 4W9JA 3A1QA 2KC2A 1X1MA 2KX0A 4DHZB 2ZVNA 1EF1A 4XX5A 2O2VA 3UIOB 2J0JA 3DBSA 4W9DA 3AU5A 3A9JA 2KJ6A 3DBRI 3PRPB 4GXBA 4ANUA 1YJ1A 3AU4A 4ZRKA 2FCNA 2AYOB 3OJ4B 2AL6A 2K8CA 4BVUC 4EUTA 1FXTB 4GDLB 3UQAA 1YIWA 3CSTA 2LVOA 2LZ6A 2NR2A 3H7PA 3QWZB 4NY0A 4MELA 1PQSA 2FIFA 4HDOA 2XEWA 2J0KA 2JUOA 1WRDB 2KKCA 3UINB 3PREA 2RGFA 4GU2A 4W9HA 2BF8B 1LXDA 3IBEA 2MCNB 2CR5A 4MJSB 1Q5WB 1V81A 3OAWA 2ZCBA 1P3QU 4JL9A 2KDFB 5FR6A 5JH5C 1WF9A 3AI5A 4K7WA 3SD5A 2PJHA 4NQLB 5LXHA 3L17A 1S3SG 4DHJD 2OOBB 2IO0B 2N1VA 2ZCCA 1V80A 3A33B 2IO2B 2KZRA 3DOWA 3R66C 4PS3A 2KTRB 3VUXA 3QIJA 3ZW3A 2A4ZA 4IWOA 4FJZA 3BINA 4WWPA 2MRPA 4BKSD 1Q0WB 4RM8A 3A4SC 2G4SA 3VVWB 2V3SA 2C7MB 1OTRB 2IO1B 3HHMA 3WAMA 3ZNGC 2XK5A 3NZSA 1Z2MA 4WJNA 2Z0DB 2C5LC 2EMSA 2N9PC 3ZIMA 3JVZX 4BKTA 2KNBA 4EFOA 4NJ7A 2DYOA 3V6EB 2IY0B 2LVQA 2DZJA 2ZJDA 3QCAA 2HJ8A 4MSQB 2C60A 2ZPNA 4DHJB 3PLUA 3QC8B 4PS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAZ A;  4M8N A;  1MG8 A;  2JT4 B;  3EC8 A;  3Q3J A;  1E8Y A;  4NQK E;  1WMH A;  4HPM B;  2O6V D;  3N32 A;  3PTF C;  2IZV B;  4EOY A;  1L7Y A;  4RM9 A;  1WE7 A;  4TKN A;  1WGR A;  4EZL A;  1V5O A;  4HK2 A;  1H8C A;  4GN1 A;  2UYZ B;  4WJQ A;  2DEN B;  2HD5 B;  5AZG A;  4ZDV A;  4FAD A;  5G2N A;  1IPG A;  1LQB A;  1ZGU B;  5AEK B;  2AEH A;  3KYC D;  2LGX A;  2KWC A;  2GBM A;  1WR6 E;  1C1Y B;  3MTN B;  4I6N B;  1WZ0 A;  3GZN I;  2M17 A;  3V60 A;  3UGB B;  5J18 A;  2G45 B;  4MDK E;  4IG7 B;  1ZW7 A;  4G11 A;  1WFY A;  5LXI B;  2KFK A;  5D2M B;  4IC7 B;  3JYU A;  2HTH A;  2G3Q B;  4FHK A;  4BBN C;  1P98 A;  2D11 A;  4DHZ E;  2LJ5 A;  1WJN A;  3M62 B;  2C7H A;  1V2Y A;  4FJV B;  2ZPY A;  3RCZ A;  2DAF A;  5LLI A;  1WJU A;  1RRB A;  1WMH B;  1XQQ A;  1K8R B;  4KV2 A;  3Q3F A;  1E8Z A;  3PVL A;  3QAQ A;  4MH0 E;  4PYZ A;  1TTN A;  3K9P B;  3X0W A;  1P9D U;  5CHV C;  2V1Y A;  1WY8 A;  4II3 B;  2KHW B;  4W9K A;  3AUL A;  2N4F A;  4W9G A;  4ASW C;  4FJY A;  3ZRC A;  2C7N B;  2A5U A;  2D3G A;  1V9J A;  2CU1 A;  4GDL A;  3UF8 A;  4LCD E;  4WWN A;  3TCA A;  2KFK B;  2EMT A;  4BOS C;  2NS5 A;  2NBW B;  3ECI A;  4PS7 A;  4KSL C;  4ANX A;  3MHS D;  3APF A;  2YVC A;  5GMV A;  1UEL A;  2KLG A;  3LDZ E;  4E3C A;  2ZZP B;  2KK8 A;  1SGH A;  2K1F A;  2XBB C;  2M0X A;  3H7P B;  2PE6 B;  1WYW B;  2KD0 A;  4HPL B;  5CHW A;  3ENE A;  1NBF C;  2O6V A;  2FCQ A;  2LRW A;  3R7R A;  5JHB A;  1RLF A;  2LXA A;  4FHJ A;  3W1Y A;  1LM8 B;  2C9W B;  2IBI B;  3VH4 B;  3IG3 A;  3KVF B;  3M63 B;  2WWZ A;  2GBR A;  3VUY A;  4MJS A;  4TUU A;  4GOC A;  2RPQ A;  2WX1 A;  3D32 A;  4I6P A;  4CHK A;  3VXW A;  4DBG A;  1UH6 A;  1OGW A;  2W9N A;  2LRU A;  3L0W B;  2JZ3 B;  2BWF A;  2V4L A;  1L2N A;  3ML8 A;  5KHQ A;  1E8X A;  4AWJ A;  2N1W A;  2LGY A;  4DK5 A;  1VD2 A;  5AZH A;  3VFK A;  3DBL I;  1LFD A;  5JHA A;  2MWS B;  1WM2 A;  2DYM A;  3RZF A;  1WX9 A;  4IW0 A;  1YX5 B;  3L16 A;  4CO7 A;  3SHQ A;  2ZNV C;  3A4R A;  3JW0 X;  2K6D B;  2PPH A;  3EEC A;  4M8M A;  1OEY J;  3ZO5 B;  2KQS A;  2XK5 B;  2D07 B;  2DX5 B;  1KLV A;  1V86 A;  3ZDM C;  3MJW A;  1XT9 B;  1WXM A;  4HXD A;  4RMA A;  3VDZ A;  3VQI A;  1P1A A;  3A9K A;  4GMV A;  4K1R B;  4K7S A;  1WX8 A;  3TMP B;  3OJ3 A;  3PGE A;  2DAJ A;  1E5W A;  1E7V A;  2L05 A;  2BWE S;  2GOW A;  4WAA A;  2KTR A;  2K25 A;  4LDT B;  3ZNI D;  2REX A;  1V6E A;  4DDG D;  3KH0 A;  3QHT A;  4TV3 A;  2O6V B;  4LDT D;  2G4D B;  1J19 A;  3SDL C;  3I3T B;  2KTF A;  2NBU A;  3EFU A;  3U30 A;  2BYE A;  4BFR A;  1TBE A;  1R4N I;  3QJZ A;  2MA9 B;  2K8B A;  4HCN B;  2JY6 A;  1WI0 A;  2M4N A;  2Z0E B;  3ONS A;  4TQ0 A;  2BKR B;  5J17 A;  4GB9 A;  1EO6 A;  4IM3 A;  1YD8 U;  3ML9 A;  4CYE A;  2MLB A;  1GJZ A;  1TGZ B;  4K81 A;  4B6W A;  4X57 B;  2L00 B;  1WXV A;  4MSM B;  3BY4 B;  4IUM B;  4G3X B;  4KIK B;  4BKS A;  1ZKH A;  3QAR A;  3AXC A;  4FBJ B;  4HVB A;  4EZK A;  1E90 A;  5DPR A;  4II2 B;  1P0R A;  2I1K A;  2J0M A;  2KOX A;  4JLC A;  3TBL D;  3U8Z A;  3VAW A;  2KWV B;  4F1S A;  2LXC A;  4AP4 C;  1WXA A;  2KQ7 A;  3R3M A;  1WIA A;  2PEA A;  2Y5B B;  3PHW B;  3ZTC A;  2Z59 B;  1WGG A;  4NPN A;  1G6J A;  2N9X A;  3CF6 E;  3JSV A;  3KUD B;  4W9F A;  4W9I A;  1KOT A;  4GDK B;  1WGD A;  3WAP A;  2L7R A;  4FLH A;  3LJ3 A;  2HE7 A;  4K7U A;  1VCB A;  1YX6 B;  4W9C A;  2BGF A;  2K39 A;  2MP2 B;  3L54 A;  4MM3 A;  4F7Z A;  3NZU A;  2KX3 A;  3QK0 A;  4E74 A;  4HCP B;  5D6J B;  2N7E A;  3DPD A;  1WJ6 A;  3O65 B;  4KDI C;  1GNU A;  5EDS A;  3TIX A;  5E6O A;  4BBN F;  4JQW C;  2WYQ A;  2NCN A;  4GSW A;  2GBN A;  1NI2 A;  3CMM B;  3ALB A;  2RD0 A;  4WJO A;  3H6N A;  3TL5 A;  2JRH A;  3VTV A;  3GOE A;  2N9E B;  4BKG A;  3PS6 A;  2M1M A;  3C0R B;  2MQJ A;  3PHX B;  2KN5 A;  2CHZ A;  4ICU A;  2MP2 A;  3CSF A;  4GIV A;  4F8C B;  4AJW A;  5DCN A;  3UQB A;  4LJP B;  3PRZ A;  1V49 A;  4KZ0 A;  2KFJ A;  4G0N B;  5JZE B;  4BOZ B;  2VRR B;  3PT2 B;  2FCM A;  2BPS A;  5C23 A;  3DQV A;  1ISN A;  4GGQ A;  3IFW B;  3PRM B;  4NNJ B;  2LVP A;  1U4A A;  3N3K B;  3L08 A;  4AJY B;  5E6P A;  5L95 C;  4GDK A;  3H1U A;  2N7D A;  1YQB A;  1M94 A;  4IM2 A;  1BT0 A;  4NAW A;  4N9F 4;  3KW5 B;  2NVU I;  4B9K A;  3RUI B;  4W9L A;  2LD9 A;  3PSE B;  1IP9 A;  2JPH A;  1EUV B;  2KO3 A;  3T9L A;  2RSU A;  1J0G A;  2CHX A;  3DDC B;  2K6Q A;  2KXJ A;  2NPT B;  2CHW A;  2KDE B;  4NJ6 A;  3RD2 A;  4DDI D;  1UZX B;  1I35 A;  2JXX A;  3PLV A;  4ZRJ A;  2FID A;  3W1S A;  4HWI B;  3KYD D;  3V6C B;  4OVU A;  2JVC A;  3ZVV A;  3WA0 A;  3M95 A;  5DPW A;  1UGM A;  3DVN V;  3KUZ A;  2LAS A;  2PE9 A;  3IHP C;  3RYT A;  4HLE A;  3APD A;  1KM7 A;  3UIP B;  5AZF A;  4IM0 A;  3TJP A;  2L0T A;  3W1S C;  2J7Q B;  3K9O B;  1SIF A;  2LUE A;  2MBH A;  3H9D A;  2NPT A;  4FA6 A;  4W9E A;  4ZYN A;  2JWZ A;  2KJH B;  2O2V B;  1GC6 A;  3B1L X;  4WWO A;  2KVR A;  3B0A A;  4KDL B;  1Z5S B;  4IWP A;  2KLC A;  2CS4 A;  4AUQ C;  3QA8 A;  2RR9 A;  1AAR A;  3HM6 X;  5CHF A;  4WQO B;  3KUC B;  5TR5 A;  4PYU A;  2LGD A;  1OQY A;  3T8M A;  2DYB A;  4MGY E;  3ZKJ C;  4B95 A;  3QQ8 B;  3A9K B;  3PV1 A;  1RAX A;  2WX0 A;  3N30 A;  2AL3 A;  2MBO A;  3V62 A;  3RZW C;  5IA7 A;  5HKH A;  3NHE B;  2I1J A;  2NBV B;  4G50 A;  2MBQ A;  4ANW A;  4A3O A;  3NS8 A;  1R4M I;  3M3J A;  1NDD A;  5J2R A;  1D3Z A;  3S2A A;  5DPS A;  4P7I A;  4KIK A;  5DPT A;  4A20 A;  5BO4 B;  5C1Z A;  2IY1 B;  4NAW B;  4XZ4 A;  3ZRF A;  3PPA A;  2GBJ A;  4MGI E;  4DWF A;  3DVG X;  4EKU A;  2KMC A;  2OJR A;  3JSV B;  4MEM A;  4ICV A;  1C3T A;  1WH3 A;  2BKF A;  3B08 A;  3RUL A;  3OLM D;  2QHO A;  4MGK E;  2FUH B;  2MW5 A;  2DZI A;  2M8S A;  4YL8 A;  1A5R A;  1Q1O A;  2KAN A;  3QX1 A;  4IWQ A;  1OEY A;  5D94 A;  4J6I A;  1CMX B;  5G55 A;  3RT3 B;  1J8C A;  3H7S A;  1T0Y A;  3ZNZ B;  2CKH B;  2FCS A;  3VTW A;  4FN2 A;  3ZTD A;  1E8W A;  1WZ3 A;  1KJT A;  5KHO A;  3IVF A;  2R2O A;  4KSK C;  4ANV A;  4ZRI A;  4I6L B;  2AWT A;  1WJ4 A;  1UD7 A;  4WJP A;  5D7G A;  2ZVO A;  2KWU B;  4JGH B;  1WXS A;  3NOB A;  2LWP A;  1UBI A;  2R2Q A;  3WAL A;  5E6N A;  2MBB B;  3ZUN A;  2BYF A;  5CX3 A;  2FNJ B;  2JRI B;  1SE9 A;  2YLM A;  2GMI C;  4EEW A;  1WGH A;  4URK A;  2L3Z A;  3VUW A;  3ZNH B;  2KDB A;  3VH3 B;  3WIM A;  3U7D A;  1V5T A;  3NY5 A;  4EZJ A;  3DBH I;  1GC7 A;  1WE6 A;  1HE8 A;  2IYD B;  3ZLZ A;  4HDQ A;  3HK0 A;  4OVV A;  1QZE A;  1UBQ A;  1WGY A;  3VHT C;  2IO3 B;  4MGZ E;  4A3P A;  1E7U A;  5IAA C;  2MBE A;  2KDI A;  2L76 A;  2JZZ A;  3A1Q B;  3EHV A;  4LJO B;  2LI5 A;  2KMA A;  1IYF A;  2GBK A;  2D10 A;  2MSE D;  1WR1 A;  3P2B A;  2JF5 A;  4M0W B;  2EKE C;  2DZM A;  3ZDT A;  2UWQ A;  4AOF A;  1H4R A;  1RFA A;  1F9J A;  3L10 B;  2KC1 A;  1EF5 A;  3WAN A;  2KJR A;  1GG3 A;  3HM3 A;  3VTU A;  4HJK A;  5CTR C;  2L0F A;  3WAO A;  3X23 A;  1GUA B;  3R7Q A;  2B3A A;  3DVN U;  3PZD A;  2ZEQ A;  2DZK A;  2ASQ A;  3APC A;  2MX2 A;  2L8J A;  1WX7 A;  1TZ1 A;  4TQ1 A;  1Y8R C;  2BYV E;  2WDT B;  3HIZ A;  3SU8 X;  4E71 A;  1I42 A;  3L13 A;  4KZC A;  3A9J B;  4DXA B;  4JIO U;  2K8H A;  2D2Q A;  1JRU A;  2DHZ A;  3DCG A;  4KVG B;  3DVG Y;  4FUL A;  1WM3 A;  3V61 A;  1S1Q B;  5L83 A;  4XC2 A;  2ZNV B;  1XD3 B;  4W9J A;  3A1Q A;  2KC2 A;  1X1M A;  2KX0 A;  4DHZ B;  2ZVN A;  1EF1 A;  4XX5 A;  2O2V A;  3UIO B;  2J0J A;  3DBS A;  4W9D A;  3AU5 A;  3A9J A;  2KJ6 A;  3DBR I;  3PRP B;  4GXB A;  4ANU A;  1YJ1 A;  3AU4 A;  4ZRK A;  2FCN A;  2AYO B;  3OJ4 B;  2AL6 A;  2K8C A;  4BVU C;  4EUT A;  1FXT B;  4GDL B;  3UQA A;  1YIW A;  3CST A;  2LVO A;  2LZ6 A;  2NR2 A;  3H7P A;  3QWZ B;  4NY0 A;  4MEL A;  1PQS A;  2FIF A;  4HDO A;  2XEW A;  2J0K A;  2JUO A;  1WRD B;  2KKC A;  3UIN B;  3PRE A;  2RGF A;  4GU2 A;  4W9H A;  2BF8 B;  1LXD A;  3IBE A;  2MCN B;  2CR5 A;  4MJS B;  1Q5W B;  1V81 A;  3OAW A;  2ZCB A;  1P3Q U;  4JL9 A;  2KDF B;  5FR6 A;  5JH5 C;  1WF9 A;  3AI5 A;  4K7W A;  3SD5 A;  2PJH A;  4NQL B;  5LXH A;  3L17 A;  1S3S G;  4DHJ D;  2OOB B;  2IO0 B;  2N1V A;  2ZCC A;  1V80 A;  3A33 B;  2IO2 B;  2KZR A;  3DOW A;  3R66 C;  4PS3 A;  2KTR B;  3VUX A;  3QIJ A;  3ZW3 A;  2A4Z A;  4IWO A;  4FJZ A;  3BIN A;  4WWP A;  2MRP A;  4BKS D;  1Q0W B;  4RM8 A;  3A4S C;  2G4S A;  3VVW B;  2V3S A;  2C7M B;  1OTR B;  2IO1 B;  3HHM A;  3WAM A;  3ZNG C;  2XK5 A;  3NZS A;  1Z2M A;  4WJN A;  2Z0D B;  2C5L C;  2EMS A;  2N9P C;  3ZIM A;  3JVZ X;  4BKT A;  2KNB A;  4EFO A;  4NJ7 A;  2DYO A;  3V6E B;  2IY0 B;  2LVQ A;  2DZJ A;  2ZJD A;  3QCA A;  2HJ8 A;  4MSQ B;  2C60 A;  2ZPN A;  4DHJ B;  3PLU A;  3QC8 B;  4PS8 A; 
#chains in the Genus database with same CATH topology
 1F52 A;  2WXG A;  4NQK E;  4HPM B;  3UI3 A;  1VRA B;  4EOY A;  2WXQ A;  1TS2 A;  1JRO A;  4GN1 A;  4WJQ A;  2DEN B;  2OED A;  5G2N A;  1LQB A;  1ZGU B;  3KYC D;  1WWT A;  3MTN B;  4I6N B;  4XDD A;  3RNB C;  4OHJ A;  3BVZ A;  4L2Y A;  5J18 A;  1L4D B;  2G45 B;  1ZW7 A;  4OZB A;  1WFY A;  5D2M B;  1R4M B;  3P4Q B;  3U4E G;  2RDH A;  2G3Q B;  2JXT A;  2D11 A;  4DHZ E;  2X38 A;  3M62 B;  2BQQ A;  1WJU A;  2V9H A;  3Q3F A;  4MM3 B;  4ZRP A;  3K9P B;  4B0M A;  2V1Y A;  3LB8 C;  3URY A;  4W9K A;  3R2I A;  2PW9 A;  1SEB D;  1TS5 A;  1N5W A;  4LCD E;  4WWN A;  3TCA A;  2KFK B;  2NS5 A;  2NBW B;  1MVK A;  3ECI A;  1QOG A;  1FCC C;  1I4P A;  2YVC A;  2ZZP B;  2KK8 A;  3H7P B;  1ENF A;  2PE6 B;  4HPL B;  3WCQ A;  2J53 A;  2O6V A;  2FCQ A;  2LRW A;  5JHB A;  3NG0 A;  5H92 C;  1J7B A;  3VH4 B;  3KVF B;  2GBR A;  3D32 A;  3AE2 B;  2H89 B;  4CHK A;  4DBG A;  2W9N A;  4TMA B;  2BWF A;  2V4L A;  4LNF A;  1ZOY B;  3Q69 A;  4CO7 A;  4M8M A;  3EEC A;  4YSZ B;  1CK1 A;  2LJI A;  3MJW A;  3VDZ A;  1P1A A;  1YJI A;  1STE A;  4K7S A;  2QCZ A;  2BB5 A;  2BWE S;  4LDT B;  1JQ4 A;  3ZNI D;  3HVZ A;  3KH0 A;  2KWD A;  2O6V B;  3GP7 A;  1JAL A;  1J19 A;  3OWE B;  1N6Z A;  2BYE A;  1TBE A;  1R4N I;  1WI0 A;  4YTP B;  2M4N A;  5J17 A;  2LEK A;  3ZYY X;  2M56 B;  4CYE A;  2L00 B;  4MSM B;  1UWM A;  4BKS A;  3QAR A;  3AXC A;  2Z8L A;  3Q8B A;  2I1K A;  2KOX A;  4JLC A;  4A90 A;  4AP4 C;  1WXA A;  3KWV A;  2J4X A;  3R3M A;  1R7S A;  5MPO A;  4NPN A;  2N9X A;  2IGH A;  4GDK B;  3WAP A;  2QC8 A;  1VCB A;  2K39 A;  3L54 A;  4MM3 A;  2K5P A;  4HCP B;  1PDX A;  1WJ6 A;  5C3J B;  5EDS A;  1Q10 A;  1ZDX A;  4BBN F;  1FIQ A;  2WLB A;  3CMM B;  2RD0 A;  4WJO A;  1MG4 A;  3VTV A;  1TIF A;  3ZJV A;  1SE3 A;  3C0R B;  2MQJ A;  3PHX B;  1T0Q C;  2MP2 A;  3UQB A;  3PRZ A;  4M00 A;  4KGS A;  4XYC A;  1QKZ A;  4BOZ B;  2BPS A;  5FKA C;  3N9Y C;  2K22 A;  2CJO A;  5E6P A;  3GS2 A;  5L95 C;  4GDK A;  1YQB A;  4N9F 4;  2I2Y A;  4B9K A;  3P4P B;  3PSE B;  1IP9 A;  2J42 A;  2GI9 A;  1RWS A;  2CHX A;  3DDC B;  3I63 C;  2NPT B;  4NJ6 A;  2CU3 A;  3GE8 C;  1PGA A;  4HWI B;  3V6C B;  3WA0 A;  3V05 A;  3M95 A;  4ZOH C;  1UGM A;  2PE9 A;  3UIP B;  5AZF A;  1SIF A;  2MJE A;  1K53 A;  1IGD A;  5I4D A;  2G9H D;  2O2V B;  4A55 A;  3B1L X;  4XGA B;  4RF0 A;  2CS4 A;  1KTK A;  4WQO B;  3KUC B;  4WIP A;  3A9K B;  3KLS X;  2AL3 A;  2XN9 C;  3RZW C;  5HKH A;  3NHE B;  1AWD A;  3M3J A;  1D3Z A;  3Q3M C;  5DPS A;  1YN3 A;  5DPT A;  5BO4 B;  5C1Z A;  2IY1 B;  4NAW B;  1HTO A;  4DWF A;  4LNN A;  4ICV A;  3B08 A;  4XWW A;  1J7A A;  2FUH B;  2MW5 A;  2M8S A;  2QEJ C;  3B2F A;  1PYW D;  1WSP A;  4J6I A;  2K3U A;  3RT3 B;  1T0Y A;  5BYR A;  5FK9 C;  3VTW A;  2D3B A;  1E8W A;  1NI3 A;  2GLS A;  1FCL A;  1FD6 A;  2PLP A;  2AWT A;  2BVC A;  5D7G A;  1WXS A;  2MBB B;  1FNU A;  1YN4 A;  4EEW A;  2JX5 A;  3VUW A;  2KDB A;  2DWQ A;  3N1Y C;  4C7Z A;  3NRZ A;  1FMA D;  3WIM A;  3NY5 A;  3N20 C;  3DBH I;  1F77 A;  3IT6 B;  2IGG A;  1QZE A;  3VRB B;  2AQ2 B;  2L76 A;  2JZZ A;  3EHV A;  1IYF A;  1WR1 A;  4P6V F;  4S17 A;  2DZM A;  3ZDT A;  4AOF A;  1L0Y B;  3L10 B;  1EF5 A;  2KJR A;  1ZXH A;  5CTR C;  1T0R C;  3PZD A;  3Q8A A;  2D5G A;  2DZK A;  2WDV B;  1ET9 A;  3HIZ A;  5D3I B;  3AEA B;  2WXR A;  3A9J B;  2K8H A;  1RM6 C;  1XLN A;  4KVG B;  4K3B A;  4W9J A;  1HTQ A;  4WWM A;  1C9F A;  2KC2 A;  2KX0 A;  2J0J A;  3DBS A;  4QAY A;  1ZE3 D;  1T5X D;  4ZRK A;  2AYO B;  1KFY B;  1NYQ A;  5TSS A;  4EUT A;  2LZ6 A;  3NVY A;  1VZ7 A;  2W55 A;  1N62 A;  3GZN B;  4M02 A;  1WRD B;  3AE6 B;  1KLG D;  2SAK A;  2KKC A;  1LO5 D;  3P63 A;  2RGF A;  4MAC A;  4W9H A;  3IBE A;  2CR5 A;  1P3Q U;  2KDF B;  3SD5 A;  2QDF A;  1S3S G;  2IO0 B;  1A70 A;  2W3S A;  3AV8 A;  3DOW A;  2IO2 B;  2KZR A;  2W3R A;  3R66 C;  3ZW3 A;  4IWO A;  4FJZ A;  2MRP A;  4RGN A;  2G4S A;  3AEF B;  3DBH B;  2IO1 B;  3WAM A;  2XK5 A;  3NZS A;  1Z2M A;  5H8Y E;  2Z0D B;  2MJ3 A;  2WU2 B;  4EFO A;  3T3N A;  4NJ7 A;  4S0R A;  4MSQ B;  3QC8 B;  2N9K A;  4PS8 A;  3Q3J A;  1WMH A;  5AUI A;  2O6V D;  3PTF C;  1ROE A;  4RM9 A;  1WE7 A;  3IAM 1;  4LLG M;  2KN4 A;  1TKE A;  5AZG A;  2OJW A;  2AEH A;  2Q5W D;  1WR6 E;  1C1Y B;  4JE3 B;  3RNC C;  1WZ0 A;  3GZN I;  2M17 A;  3V60 A;  2BS2 B;  3UGB B;  1UWX A;  3DWM A;  4IG7 B;  5LXI B;  1GAQ B;  2W54 A;  2WXK A;  3JYU A;  1JW9 D;  4FHK A;  2VZK D;  1P98 A;  3BZD B;  2DLB A;  4FJV B;  2ZW1 A;  1SJH D;  1QQR A;  5LLI A;  2AQ3 B;  1RRB A;  1WMH B;  1XQQ A;  3PVL A;  4XDC A;  3QAQ A;  1TTN A;  1DYQ A;  1P9D U;  1TY0 A;  2E6X A;  1WY8 A;  2WS3 B;  4II3 B;  2JWU A;  2KHW B;  3AUL A;  2N4F A;  4W9G A;  4FJY A;  2A5U A;  2D3G A;  4WUR A;  3DBL B;  4BOS C;  1ZDV A;  2ONQ A;  3FIL B;  1VZ6 A;  1XF5 L;  3MHS D;  1SB3 C;  4NAM A;  1UEL A;  2KLG A;  2MHJ A;  3VRA B;  3RFZ B;  2M19 A;  5BYQ A;  2KYW A;  2K1F A;  1OFF A;  1WYW B;  4AQ7 A;  5BMI A;  3ENE A;  1C77 A;  1ESF A;  2LXA A;  1LM8 B;  2JSV X;  3M63 B;  4BZA A;  3VUY A;  4MJS A;  4GOC A;  1I4Q A;  1OQR A;  1FNW A;  3L0W B;  3ML8 A;  2LGY A;  2K9X A;  1VD2 A;  2FE8 A;  1WM2 A;  2DYM A;  2MWS B;  3RZF A;  1KLU D;  1YX5 B;  2ZNV C;  3A4R A;  3JW0 X;  2K6D B;  2PKO A;  2VZK B;  2D07 B;  2AQ1 B;  3VQI A;  2WXF A;  4HXD A;  3TMP B;  3PGE A;  3ZGZ A;  1E7V A;  1PFD A;  2GOW A;  4WAA A;  2KTR A;  3TUO A;  3AEE B;  4DDG D;  2REX A;  4TV3 A;  4DXG A;  1WYG A;  3SDL C;  2KTF A;  3U30 A;  3QJZ A;  2MA9 B;  4HCN B;  3TEY A;  3RI7 C;  3ONS A;  4TQ0 A;  4GB9 A;  1D5X C;  4IM3 A;  1UNS A;  1C4P A;  1GJZ A;  4LNK A;  4IUM B;  3BYY B;  4KIK B;  2VH1 A;  4FBJ B;  3PZ7 A;  5T8I A;  3VAW A;  3PHW B;  2TSS A;  1WGG A;  3JSV A;  2R61 A;  1WGD A;  4FLH A;  2RDB C;  2HE7 A;  2RDG A;  1JCK B;  2MP2 B;  3QK0 A;  2N7E A;  3O65 B;  3FC4 A;  2WYQ A;  4GSW A;  3H6N A;  4RF1 A;  2JRH A;  3GOE A;  2N9E B;  4YTN B;  4BKG A;  2M1M A;  4WAF A;  2KN5 A;  4F8C B;  4CQN A;  2KFJ A;  1HEZ E;  2KQ4 X;  3PT2 B;  4DQO C;  3FAH A;  3DHH C;  5C23 A;  1ZUD 2;  2XNA C;  4GGQ A;  3IFW B;  2LVP A;  1U4A A;  3J9C A;  3N3K B;  1FPY A;  2IPK D;  2YEP F;  4AJY B;  4PT5 A;  1JML A;  2N7J A;  3H1U A;  4GLS C;  2N7D A;  4C7Y A;  4IM2 A;  4NAW A;  1BT0 A;  1BXT A;  4ACF A;  2JPH A;  4L23 A;  4IOI E;  3T9L A;  1J0G A;  2K6Q A;  2KXJ A;  2CHW A;  1UZX B;  4A6Q A;  1V8C A;  2EKI A;  2JXX A;  4ZRJ A;  1MFW A;  4C00 A;  4C80 A;  3I5J C;  4J3O D;  3DVN V;  3KUZ A;  2LAS A;  3APD A;  2J7Q B;  2GB1 A;  2MBH A;  4W9E A;  1GC6 A;  1TS4 A;  2KLC A;  1E0Z A;  5CHF A;  2N0S B;  5TR5 A;  3T8M A;  1QF6 A;  3QQ8 B;  1VZ8 A;  3V62 A;  2MBO A;  5IA7 A;  1NEN B;  2JYE A;  4YSY B;  3C19 A;  4A3O A;  1R4M I;  1EM7 A;  3AE5 B;  3S2A A;  4A20 A;  2UU7 A;  4XZ4 A;  3SFD B;  4M01 A;  2KMC A;  2OJR A;  3JSV B;  3Q8F A;  3RUL A;  2QHO A;  4EE2 A;  1IUE A;  4YL8 A;  1MHH E;  1K52 A;  1J8C A;  3ZNZ B;  3R8B A;  3ZTD A;  1WZ3 A;  1K51 A;  1KJT A;  2LGS A;  5KHO A;  4ANV A;  2WXP A;  3RNA C;  1EU4 A;  1WJ4 A;  1IBX B;  4WJP A;  1PUT A;  3NOB A;  2LWP A;  2R2Q A;  3ZUN A;  5CX3 A;  1SE9 A;  1WGH A;  4URK A;  3RNE C;  1KH0 A;  4JX1 C;  3U7D A;  1T3Q A;  1V5T A;  4EZJ A;  1WE6 A;  1HE8 A;  2IYD B;  3ZLZ A;  2FUG 1;  5EE9 A;  3B2G A;  3MC0 B;  4MGZ E;  4A3P A;  3W9C B;  1C4A A;  3DWG C;  2L32 A;  3CWI A;  4RH6 A;  3AE9 B;  3A1Q B;  1YOV B;  4LJO B;  3NVV A;  4RFB A;  2D10 A;  2MSE D;  1YQ4 B;  4M0W B;  1XLO A;  2EKE C;  1F9J A;  2LMC A;  1GG3 A;  1GUA B;  2B3A A;  2ASQ A;  3APC A;  5IO9 A;  1GB1 A;  4TQ1 A;  3SU8 X;  2WDT B;  4E71 A;  2BYT A;  4KZC A;  4JIO U;  3SR6 A;  2MEK A;  3DCG A;  2DHZ A;  4N59 A;  4YXD B;  1WM3 A;  3V61 A;  1S1Q B;  4XC2 A;  1XD3 B;  1X1M A;  4DHZ B;  3UIO B;  3P1M A;  2L52 A;  2D3A A;  3AED B;  1EWY C;  3DBR I;  3PRP B;  4GXB A;  4ANU A;  4UDU C;  4OW0 A;  4K3C A;  2K8C A;  4GDL B;  3UQA A;  1YIW A;  2NR2 A;  3H7P A;  3QWZ B;  2PMV A;  3NS1 A;  4HDO A;  2XEW A;  1F2R C;  3TEW A;  1F0Z A;  3PRE A;  4GU2 A;  1LXD A;  2B76 B;  2QJL A;  4ZRQ A;  1N61 A;  2WXN A;  2H88 B;  4NQL B;  4DHJ D;  1SSN A;  2N1V A;  2ZCC A;  4RNA A;  1V80 A;  3ZJU A;  1LGR A;  3Q3O C;  3BIN A;  4WWP A;  1MHX A;  3A4S C;  2V3S A;  1SE4 A;  1SJE D;  5JXV A;  3T3O A;  2ZJD A;  2HJ8 A;  3PLU A;  3IXS A;  1MG8 A;  2JT4 B;  3EC8 A;  3VR8 B;  1E8Y A;  1L0X B;  2J52 A;  2IZV B;  3U52 E;  1WGR A;  1V5O A;  2NTT A;  2RPV A;  4HK2 A;  4ZDV A;  1YQ3 B;  3AEB B;  3ZXR A;  1C76 A;  4XE0 A;  3SEB A;  5HFY A;  1XCT L;  1MJD A;  1XCQ L;  5C2T B;  1L6V A;  3NVW A;  1GB4 A;  5LNK 1;  4MDK E;  3E9S A;  2KFK A;  3P42 A;  2PIA A;  4IC7 B;  2INP E;  4BBN C;  2LJ5 A;  1WJN A;  2C7H A;  3MC8 A;  1K8R B;  3EFC A;  3HRD D;  4MH0 E;  3MP9 A;  5G5H A;  4ASW C;  3ZRC A;  2C7N B;  2Y5P A;  1V9J A;  2CU1 A;  4GDL A;  4ARC A;  4PS7 A;  4KSL C;  3APF A;  1L5P A;  1PGX A;  5GMV A;  2INC C;  4RGT A;  4E3C A;  3LXF A;  1SGH A;  2M0X A;  2KD0 A;  2DNF A;  1L0V B;  1V1P B;  1NBF C;  3LYY A;  3R7R A;  1AW7 A;  1RLF A;  4FHJ A;  3W1Y A;  4HRO A;  1AN8 A;  3U2S C;  2IBI B;  1K50 A;  3IG3 A;  4YSX B;  2WWZ A;  1EWC A;  4TUU A;  1VDV A;  2RPQ A;  4I6P A;  3NVZ A;  1OGW A;  4KKI A;  2JZ3 B;  3HUI A;  1L2N A;  1JWM D;  1E8X A;  2N1W A;  5AZH A;  2JU6 X;  3DBL I;  1LFD A;  5JHA A;  1IGC A;  3AE8 B;  2ON8 A;  2PPH A;  1YNT E;  1OEY J;  1KLV A;  2DX5 B;  4US9 A;  4RMA A;  1XLP A;  1WXM A;  3EGR A;  1HXY D;  5BMH A;  4GMV A;  4K1R B;  1WX8 A;  1C4C A;  3OJ3 A;  1E5W A;  2L05 A;  2K25 A;  1QIL A;  5IOI A;  1V6E A;  3BVG A;  3QHT A;  1V1P A;  3RNG C;  4LDT D;  2G4D B;  3P4R B;  2IJ0 A;  4BFR A;  2HJ1 A;  4D2K A;  2JY6 A;  1E9M A;  1EO6 A;  1YD8 U;  3ML9 A;  1PGB A;  1UF0 A;  4B6W A;  3C8Y A;  4X57 B;  3OG5 A;  2L1A A;  1E7P B;  3ZQ4 A;  3DHI C;  4HVB A;  1E90 A;  5DPR A;  4II2 B;  1P0R A;  3TBL D;  2G1E A;  2KWV B;  4F1S A;  2LXC A;  2WXM A;  1WIA A;  2PEA A;  2Y5B B;  2Z59 B;  1FFV A;  4ZHP A;  1G6J A;  3CF6 E;  4W9F A;  4W9I A;  3MC9 A;  2L7R A;  2EEL A;  1ZXI A;  3GB1 A;  2BGF A;  2KMM A;  2W82 A;  2KX3 A;  4E74 A;  5D6J B;  4JQW C;  1NI2 A;  3TL5 A;  2WHI A;  2NMQ A;  3PS6 A;  4OVZ A;  1YJJ A;  2CHZ A;  2QIE B;  4BAX A;  4GIV A;  4HEA 1;  2Y5C A;  3MFG A;  4AJW A;  4LJP B;  3ABV B;  3Q2A C;  4MT5 A;  4G0N B;  2VRR B;  2QIL A;  2FCM A;  3EUB 2;  3KQ4 A;  3KWL A;  1JWA D;  2JQR B;  2WU5 B;  3W5V B;  3PRM B;  4NNJ B;  1XEE A;  2QSD A;  2NVU I;  3KW5 B;  3ETR A;  3RUI B;  4P16 A;  4IDI A;  3TEX A;  4YWG G;  3RD2 A;  3PLV A;  3I9V 1;  1ET6 A;  3GE3 C;  5DPW A;  4HLE A;  2PVO D;  1KM7 A;  3W1S C;  4IM0 A;  2L0T A;  3AE4 B;  3H9D A;  2JWZ A;  2WGS A;  3PO0 A;  1B9R A;  1QOA A;  4LK0 M;  1D5M C;  1Z5S B;  4IWP A;  1AAR A;  3HM6 X;  1YN5 A;  2LGD A;  1D6E C;  2DYB A;  2BTE A;  3ZKJ C;  4B95 A;  3PV1 A;  1RAX A;  2WX0 A;  4HKQ A;  4IKG A;  4ANW A;  2MJD A;  4ITK A;  1SF0 A;  3ZRF A;  4M0W A;  2GBJ A;  4EKU A;  3DVG X;  1TKY A;  2BKF A;  3OLM D;  4MGK E;  2DZI A;  2WXO A;  1Q1O A;  4FXC A;  3QX1 A;  5D94 A;  1ZP0 B;  2V4I B;  2HTM E;  3H7S A;  4B0E A;  4FN2 A;  5GXG B;  2LGI A;  2R2O A;  4KSK C;  5IKC M;  1DGJ A;  1UUP A;  1C79 A;  4I6L B;  4LNI A;  1UD7 A;  2KWU B;  4JGH B;  1L4Z B;  1NVI D;  5E6N A;  2BYF A;  3W5U B;  2FNJ B;  4C4V B;  2DBY A;  2GMI C;  3Q3N C;  3ZNH B;  3HVD A;  1GC7 A;  1JWB D;  4HDQ A;  3HK0 A;  3Q14 C;  1KF6 B;  1UBQ A;  3ZXV A;  3VHT C;  1V1O A;  2IO3 B;  1E7U A;  5IAA C;  2LI5 A;  2IGD A;  1GPX A;  1TJE A;  5IN7 A;  2JF5 A;  4MH8 A;  1V97 A;  2UWQ A;  1H4R A;  2M0A A;  3WAN A;  3X23 A;  3HM3 A;  3VTU A;  3WAO A;  2ACZ B;  1AYF A;  2ZEQ A;  4A9A A;  2L8J A;  1TZ1 A;  1I42 A;  1Y8R C;  2BYV E;  4YT0 B;  2BS3 B;  2V0G A;  4REZ A;  1JRU A;  4FUL A;  2WXI A;  2D3C A;  5L83 A;  2WDR B;  3MJ5 A;  2ZVN A;  3RNF C;  2O2V A;  4ARI A;  3N1Z C;  2KJ6 A;  3FIL A;  3OJ4 B;  4BVU C;  1FXT B;  1NYR A;  1L6U A;  2FIF A;  2JUO A;  2KDM A;  2Y3A A;  3Q8C A;  4LTU A;  3AN1 A;  4MJS B;  1MI0 A;  1JWS D;  3OAW A;  2ZCB A;  5E6J A;  5JH5 C;  1WF9 A;  1FFU A;  2PJH A;  4RGO S;  2INN E;  5LXH A;  1TT5 B;  3IAS 1;  3VR9 B;  3VUX A;  3QIJ A;  2A4Z A;  3AE3 B;  4RM8 A;  3VVW B;  3CIR B;  5HI1 A;  2C7M B;  1QOF A;  5EE1 A;  2N9P C;  3ZIM A;  3JVZ X;  2KNB A;  5IP4 D;  3B9J A;  3V6E B;  4C4V A;  2IY0 B;  2ICI A;  3BYT B;  2FAZ A;  4M8N A;  3BWU D;  3N32 A;  1N5X A;  1L7Y A;  2KAJ A;  2BW2 A;  1NEK B;  4TKN A;  4EZL A;  1H8C A;  4ZHO A;  2UYZ B;  2HD5 B;  1FM0 D;  1IBX A;  4FAD A;  1IPG A;  5AEK B;  2WNM A;  2LGX A;  2KWC A;  2GBM A;  1YMH E;  4US8 A;  1F1H A;  3R2T A;  3AH7 A;  3AB5 A;  2IDY A;  3BK1 A;  4TSS A;  4G11 A;  3TSS A;  1FXA A;  2CJN A;  2HTH A;  4HKZ E;  3TEZ A;  1P7F A;  3Q6B A;  4OZA A;  1ACC A;  1V2Y A;  2ZPY A;  1P7E A;  3RCZ A;  2DAF A;  3H8H A;  1QT9 A;  4KV2 A;  4H2A A;  1E8Z A;  4PYZ A;  3X0W A;  5CHV C;  3AE1 B;  1HZ5 A;  3E56 A;  2WP9 B;  3UF8 A;  2EMT A;  2LFI A;  4ZYS A;  1VJK A;  1XXG A;  2WQY B;  3MHZ A;  4ANX A;  3LDZ E;  5HHD G;  1N60 A;  2KT7 A;  2XBB C;  2LHD A;  3DHG C;  1FRD A;  1TZO A;  1Y56 A;  5CHW A;  4KKJ A;  2C9W B;  2V3P A;  4KGR A;  4N6E B;  1CJE A;  1I4G A;  2WX1 A;  3N1X C;  1FEH A;  5FR3 A;  1D4B A;  4YTM B;  1DOI A;  3VXW A;  1UH6 A;  5G5G A;  2LRU A;  5KHQ A;  4AWJ A;  1HZ6 A;  4DK5 A;  3VFK A;  1WXQ A;  1WX9 A;  4IW0 A;  3L16 A;  3SHQ A;  3ZO5 B;  2KQS A;  2XK5 B;  1B1Z A;  1V86 A;  3ZDM C;  1XT9 B;  3A9K A;  2DAJ A;  4USA A;  3L4P A;  4XWT A;  4P1B C;  3I3T B;  3EFU A;  2NBU A;  2JYT A;  2K8B A;  5EE0 A;  2Z0E B;  2BKR B;  4AS1 A;  2MLB A;  4JPS A;  1TGZ B;  4K81 A;  5BYS A;  1WXV A;  1JWU D;  1XO3 A;  3BY4 B;  4G3X B;  1ZKH A;  2WXL A;  1KRH A;  1D5Z C;  1TKG A;  4EZK A;  5BMG A;  2J0M A;  3U8Z A;  2PTL A;  1F2R I;  2KQ7 A;  3ZTC A;  1QOB A;  4RCO A;  2BS4 B;  2YEP B;  3KUD B;  3NZ3 A;  1KOT A;  3LJ3 A;  4K7U A;  1BUI C;  1YX6 B;  4W9C A;  1WRI A;  1FNV A;  4F7Z A;  3NZU A;  3AEC B;  3DPD A;  4KDI C;  1GNU A;  3TIX A;  1EU3 A;  5E6O A;  2BBC A;  2NCN A;  2GBN A;  3ALB A;  4HRS A;  1T6B X;  4ICU A;  5D3D A;  3CSF A;  5DCN A;  1HA5 A;  1V49 A;  4KZ0 A;  5JZE B;  1R4N B;  2WDQ B;  3DQV A;  1ISN A;  2E3T A;  2GRI A;  1SIJ A;  2X8X X;  3L08 A;  3ZJT A;  3AE7 B;  4KGT A;  1M94 A;  2KVZ A;  2LUM A;  4W9L A;  2LD9 A;  3FKY A;  1EUV B;  2KO3 A;  1DOY A;  2RSU A;  4R3D A;  3BK2 A;  2KDE B;  1FXI A;  4DDI D;  3NUH B;  1I35 A;  1FRR A;  1TYG B;  2FID A;  1RYJ A;  4NJC A;  3W1S A;  3KYD D;  3RN9 C;  4OVU A;  2JVC A;  1MPE A;  3ZVV A;  1N63 A;  1TS3 A;  3IHP C;  4LNO A;  3RYT A;  2FBW B;  3V3X A;  3TJP A;  3K9O B;  4WQM A;  4FA6 A;  2LUE A;  1WGK A;  2NPT A;  4ZYN A;  2WXH A;  2KJH B;  4WWO A;  2KVR A;  3B0A A;  4KDL B;  2OHF A;  3QA8 A;  4AUQ C;  2RR9 A;  4Q2J A;  3EA6 A;  4PYU A;  1OQY A;  4MGY E;  2N9L A;  3N30 A;  2I1J A;  1VLB A;  1CZP A;  1E6E B;  1HQR D;  2NBV B;  4G50 A;  2MBQ A;  3NS8 A;  1NDD A;  1OQQ A;  5J2R A;  4P7I A;  4KIK A;  3PPA A;  4MGI E;  4MEM A;  1C3T A;  1SE2 A;  2MH7 A;  1WH3 A;  3Q8E A;  3AM9 A;  1SXT A;  1A5R A;  2KAN A;  4IWQ A;  1OEY A;  1CMX B;  5G55 A;  1XLQ A;  2CKH B;  2FCS A;  2L83 A;  3U7Z A;  3IVF A;  1GOZ A;  3P4S B;  4ZRI A;  1I7H A;  3I57 A;  4KX6 B;  4RGM A;  1C78 A;  2ZVO A;  1M4V A;  1UBI A;  3WAL A;  3IT4 B;  1QLB B;  2RMM A;  4P1C C;  3DBR B;  2I38 A;  2BB6 A;  2JRI B;  2YLM A;  2L3Z A;  1VR9 A;  2AX5 A;  3VH3 B;  4C56 C;  4HJG E;  4OVV A;  1T0S C;  2V3N A;  1WGY A;  3W2D A;  1CQV A;  2MBE A;  2KDI A;  4DXF A;  3O13 A;  3SFE B;  2KMA A;  2GBK A;  1DOX A;  3BII D;  3P2B A;  2IND C;  1RFA A;  2KC1 A;  2ZW0 A;  4HJK A;  2L0F A;  3R7Q A;  5EE3 A;  3DVN U;  2MX2 A;  1WX7 A;  3L13 A;  4DXA B;  2WXJ A;  2D2Q A;  4NZL B;  3DVG Y;  4O1N A;  1J7C A;  2PVG C;  3AMZ A;  1I4X A;  2ZNV B;  4N58 A;  3A1Q A;  1EF1 A;  4XX5 A;  3PZ8 A;  3AEG B;  4W9D A;  3AU5 A;  3A9J A;  4L1B A;  1YJ1 A;  3AU4 A;  2FCN A;  2AL6 A;  4WH4 A;  4JWU C;  2KAC A;  3CST A;  5HG2 A;  2LVO A;  1E10 A;  4NY0 A;  4MEL A;  1JRP A;  3NJT A;  1PQS A;  1I4R A;  3RMK C;  2J0K A;  2BT6 A;  1SBB B;  3UIN B;  2BF8 B;  2MCN B;  1BML C;  1Q5W B;  1V81 A;  5FR6 A;  4JL9 A;  4HPP A;  2VH2 A;  3AI5 A;  4K7W A;  2K0P A;  3L17 A;  1FO4 A;  2OOB B;  3A33 B;  4JWS C;  4PS3 A;  1UGJ A;  2KTR B;  1ZPS A;  4BKS D;  1Q0W B;  5AUK A;  4PK1 A;  2QMT A;  1OTR B;  3RPF C;  3HHM A;  3ZNG C;  2SEB D;  4WJN A;  2C5L C;  2EMS A;  2LHE A;  3BVM A;  1I4H A;  4BKT A;  2NTS A;  2DYO A;  1TY2 A;  1RFK A;  2LVQ A;  4OZC A;  2DZJ A;  3QCA A;  2C60 A;  2ZPN A;  2HDE A;  4A8X C;  4DHJ B;  2JZP A; 
#chains in the Genus database with same CATH homology
 2FAZ A;  4M8N A;  1MG8 A;  2JT4 B;  3EC8 A;  3Q3J A;  1E8Y A;  4NQK E;  1WMH A;  4HPM B;  2O6V D;  3N32 A;  3PTF C;  2IZV B;  4EOY A;  1L7Y A;  4RM9 A;  1WE7 A;  4TKN A;  1WGR A;  4EZL A;  1V5O A;  4HK2 A;  1H8C A;  4GN1 A;  2UYZ B;  4WJQ A;  2DEN B;  2HD5 B;  5AZG A;  4ZDV A;  4FAD A;  5G2N A;  1IPG A;  1LQB A;  1ZGU B;  5AEK B;  2AEH A;  3KYC D;  2LGX A;  2KWC A;  2GBM A;  1WR6 E;  1C1Y B;  3MTN B;  4I6N B;  1WZ0 A;  3GZN I;  2M17 A;  3V60 A;  3UGB B;  5J18 A;  2G45 B;  4MDK E;  4IG7 B;  1ZW7 A;  4G11 A;  1WFY A;  5LXI B;  2KFK A;  5D2M B;  4IC7 B;  3JYU A;  2HTH A;  2G3Q B;  4FHK A;  4BBN C;  1P98 A;  2D11 A;  4DHZ E;  2LJ5 A;  1WJN A;  3M62 B;  2C7H A;  1V2Y A;  4FJV B;  2ZPY A;  3RCZ A;  2DAF A;  5LLI A;  1WJU A;  1RRB A;  1WMH B;  1XQQ A;  1K8R B;  4KV2 A;  3Q3F A;  1E8Z A;  3PVL A;  3QAQ A;  4MH0 E;  4PYZ A;  1TTN A;  3K9P B;  3X0W A;  1P9D U;  5CHV C;  2V1Y A;  1WY8 A;  4II3 B;  2KHW B;  4W9K A;  3AUL A;  2N4F A;  4W9G A;  4ASW C;  4FJY A;  3ZRC A;  2C7N B;  2A5U A;  2D3G A;  1V9J A;  2CU1 A;  4GDL A;  3UF8 A;  4LCD E;  4WWN A;  3TCA A;  2KFK B;  2EMT A;  4BOS C;  2NS5 A;  2NBW B;  3ECI A;  4PS7 A;  4KSL C;  4ANX A;  3MHS D;  3APF A;  2YVC A;  5GMV A;  1UEL A;  2KLG A;  3LDZ E;  4E3C A;  2ZZP B;  2KK8 A;  1SGH A;  2K1F A;  2XBB C;  2M0X A;  3H7P B;  2PE6 B;  1WYW B;  2KD0 A;  4HPL B;  5CHW A;  3ENE A;  1NBF C;  2O6V A;  2FCQ A;  2LRW A;  3R7R A;  5JHB A;  1RLF A;  2LXA A;  4FHJ A;  3W1Y A;  1LM8 B;  2C9W B;  2IBI B;  3VH4 B;  3IG3 A;  3KVF B;  3M63 B;  2WWZ A;  2GBR A;  3VUY A;  4MJS A;  4TUU A;  4GOC A;  2RPQ A;  2WX1 A;  3D32 A;  4I6P A;  4CHK A;  3VXW A;  4DBG A;  1UH6 A;  1OGW A;  2W9N A;  2LRU A;  3L0W B;  2JZ3 B;  2BWF A;  2V4L A;  1L2N A;  3ML8 A;  5KHQ A;  1E8X A;  4AWJ A;  2N1W A;  2LGY A;  4DK5 A;  1VD2 A;  5AZH A;  3VFK A;  3DBL I;  1LFD A;  5JHA A;  2MWS B;  1WM2 A;  2DYM A;  3RZF A;  1WX9 A;  4IW0 A;  1YX5 B;  3L16 A;  4CO7 A;  3SHQ A;  2ZNV C;  3A4R A;  3JW0 X;  2K6D B;  2PPH A;  3EEC A;  4M8M A;  1OEY J;  3ZO5 B;  2KQS A;  2XK5 B;  2D07 B;  2DX5 B;  1KLV A;  1V86 A;  3ZDM C;  3MJW A;  1XT9 B;  1WXM A;  4HXD A;  4RMA A;  3VDZ A;  3VQI A;  1P1A A;  3A9K A;  4GMV A;  4K1R B;  4K7S A;  1WX8 A;  3TMP B;  3OJ3 A;  3PGE A;  2DAJ A;  1E5W A;  1E7V A;  2L05 A;  2BWE S;  2GOW A;  4WAA A;  2KTR A;  2K25 A;  4LDT B;  3ZNI D;  2REX A;  1V6E A;  4DDG D;  3KH0 A;  3QHT A;  4TV3 A;  2O6V B;  4LDT D;  2G4D B;  1J19 A;  3SDL C;  3I3T B;  2KTF A;  2NBU A;  3EFU A;  3U30 A;  2BYE A;  4BFR A;  1TBE A;  1R4N I;  3QJZ A;  2MA9 B;  2K8B A;  4HCN B;  2JY6 A;  1WI0 A;  2M4N A;  2Z0E B;  3ONS A;  4TQ0 A;  2BKR B;  5J17 A;  4GB9 A;  1EO6 A;  4IM3 A;  1YD8 U;  3ML9 A;  4CYE A;  2MLB A;  1GJZ A;  1TGZ B;  4K81 A;  4B6W A;  4X57 B;  2L00 B;  1WXV A;  4MSM B;  3BY4 B;  4IUM B;  4G3X B;  4KIK B;  4BKS A;  1ZKH A;  3QAR A;  3AXC A;  4FBJ B;  4HVB A;  4EZK A;  1E90 A;  5DPR A;  4II2 B;  1P0R A;  2I1K A;  2J0M A;  2KOX A;  4JLC A;  3TBL D;  3U8Z A;  3VAW A;  2KWV B;  4F1S A;  2LXC A;  4AP4 C;  1WXA A;  2KQ7 A;  3R3M A;  1WIA A;  2PEA A;  2Y5B B;  3PHW B;  3ZTC A;  2Z59 B;  1WGG A;  4NPN A;  1G6J A;  2N9X A;  3CF6 E;  3JSV A;  3KUD B;  4W9F A;  4W9I A;  1KOT A;  4GDK B;  1WGD A;  3WAP A;  2L7R A;  4FLH A;  3LJ3 A;  2HE7 A;  4K7U A;  1VCB A;  1YX6 B;  4W9C A;  2BGF A;  2K39 A;  2MP2 B;  3L54 A;  4MM3 A;  4F7Z A;  3NZU A;  2KX3 A;  3QK0 A;  4E74 A;  4HCP B;  5D6J B;  2N7E A;  3DPD A;  1WJ6 A;  3O65 B;  4KDI C;  1GNU A;  5EDS A;  3TIX A;  5E6O A;  4BBN F;  4JQW C;  2WYQ A;  2NCN A;  4GSW A;  2GBN A;  1NI2 A;  3CMM B;  3ALB A;  2RD0 A;  4WJO A;  3H6N A;  3TL5 A;  2JRH A;  3VTV A;  3GOE A;  2N9E B;  4BKG A;  3PS6 A;  2M1M A;  3C0R B;  2MQJ A;  3PHX B;  2KN5 A;  2CHZ A;  4ICU A;  2MP2 A;  3CSF A;  4GIV A;  4F8C B;  4AJW A;  5DCN A;  3UQB A;  4LJP B;  3PRZ A;  1V49 A;  4KZ0 A;  2KFJ A;  4G0N B;  5JZE B;  4BOZ B;  2VRR B;  3PT2 B;  2FCM A;  2BPS A;  5C23 A;  3DQV A;  1ISN A;  4GGQ A;  3IFW B;  3PRM B;  4NNJ B;  2LVP A;  1U4A A;  3N3K B;  3L08 A;  4AJY B;  5E6P A;  5L95 C;  4GDK A;  3H1U A;  2N7D A;  1YQB A;  1M94 A;  4IM2 A;  1BT0 A;  4NAW A;  4N9F 4;  3KW5 B;  2NVU I;  4B9K A;  3RUI B;  4W9L A;  2LD9 A;  3PSE B;  1IP9 A;  2JPH A;  1EUV B;  2KO3 A;  3T9L A;  2RSU A;  1J0G A;  2CHX A;  3DDC B;  2K6Q A;  2KXJ A;  2NPT B;  2CHW A;  2KDE B;  4NJ6 A;  3RD2 A;  4DDI D;  1UZX B;  1I35 A;  2JXX A;  3PLV A;  4ZRJ A;  2FID A;  3W1S A;  4HWI B;  3KYD D;  3V6C B;  4OVU A;  2JVC A;  3ZVV A;  3WA0 A;  3M95 A;  5DPW A;  1UGM A;  3DVN V;  3KUZ A;  2LAS A;  2PE9 A;  3IHP C;  3RYT A;  4HLE A;  3APD A;  1KM7 A;  3UIP B;  5AZF A;  4IM0 A;  3TJP A;  2L0T A;  3W1S C;  2J7Q B;  3K9O B;  1SIF A;  2LUE A;  2MBH A;  3H9D A;  2NPT A;  4FA6 A;  4W9E A;  4ZYN A;  2JWZ A;  2KJH B;  2O2V B;  1GC6 A;  3B1L X;  4WWO A;  2KVR A;  3B0A A;  4KDL B;  1Z5S B;  4IWP A;  2KLC A;  2CS4 A;  4AUQ C;  3QA8 A;  2RR9 A;  1AAR A;  3HM6 X;  5CHF A;  4WQO B;  3KUC B;  5TR5 A;  4PYU A;  2LGD A;  1OQY A;  3T8M A;  2DYB A;  4MGY E;  3ZKJ C;  4B95 A;  3QQ8 B;  3A9K B;  3PV1 A;  1RAX A;  2WX0 A;  3N30 A;  2AL3 A;  2MBO A;  3V62 A;  3RZW C;  5IA7 A;  5HKH A;  3NHE B;  2I1J A;  2NBV B;  4G50 A;  2MBQ A;  4ANW A;  4A3O A;  3NS8 A;  1R4M I;  3M3J A;  1NDD A;  5J2R A;  1D3Z A;  3S2A A;  5DPS A;  4P7I A;  4KIK A;  5DPT A;  4A20 A;  5BO4 B;  5C1Z A;  2IY1 B;  4NAW B;  4XZ4 A;  3ZRF A;  3PPA A;  2GBJ A;  4MGI E;  4DWF A;  3DVG X;  4EKU A;  2KMC A;  2OJR A;  3JSV B;  4MEM A;  4ICV A;  1C3T A;  1WH3 A;  2BKF A;  3B08 A;  3RUL A;  3OLM D;  2QHO A;  4MGK E;  2FUH B;  2MW5 A;  2DZI A;  2M8S A;  4YL8 A;  1A5R A;  1Q1O A;  2KAN A;  3QX1 A;  4IWQ A;  1OEY A;  5D94 A;  4J6I A;  1CMX B;  5G55 A;  3RT3 B;  1J8C A;  3H7S A;  1T0Y A;  3ZNZ B;  2CKH B;  2FCS A;  3VTW A;  4FN2 A;  3ZTD A;  1E8W A;  1WZ3 A;  1KJT A;  5KHO A;  3IVF A;  2R2O A;  4KSK C;  4ANV A;  4ZRI A;  4I6L B;  2AWT A;  1WJ4 A;  1UD7 A;  4WJP A;  5D7G A;  2ZVO A;  2KWU B;  4JGH B;  1WXS A;  3NOB A;  2LWP A;  1UBI A;  2R2Q A;  3WAL A;  5E6N A;  2MBB B;  3ZUN A;  2BYF A;  5CX3 A;  2FNJ B;  2JRI B;  1SE9 A;  2YLM A;  2GMI C;  4EEW A;  1WGH A;  4URK A;  2L3Z A;  3VUW A;  3ZNH B;  2KDB A;  3VH3 B;  3WIM A;  3U7D A;  1V5T A;  3NY5 A;  4EZJ A;  3DBH I;  1GC7 A;  1WE6 A;  1HE8 A;  2IYD B;  3ZLZ A;  4HDQ A;  3HK0 A;  4OVV A;  1QZE A;  1UBQ A;  1WGY A;  3VHT C;  2IO3 B;  4MGZ E;  4A3P A;  1E7U A;  5IAA C;  2MBE A;  2KDI A;  2L76 A;  2JZZ A;  3A1Q B;  3EHV A;  4LJO B;  2LI5 A;  2KMA A;  1IYF A;  2GBK A;  2D10 A;  2MSE D;  1WR1 A;  3P2B A;  2JF5 A;  4M0W B;  2EKE C;  2DZM A;  3ZDT A;  2UWQ A;  4AOF A;  1H4R A;  1RFA A;  1F9J A;  3L10 B;  2KC1 A;  1EF5 A;  3WAN A;  2KJR A;  1GG3 A;  3HM3 A;  3VTU A;  4HJK A;  5CTR C;  2L0F A;  3WAO A;  3X23 A;  1GUA B;  3R7Q A;  2B3A A;  3DVN U;  3PZD A;  2ZEQ A;  2DZK A;  2ASQ A;  3APC A;  2MX2 A;  2L8J A;  1WX7 A;  1TZ1 A;  4TQ1 A;  1Y8R C;  2BYV E;  2WDT B;  3HIZ A;  3SU8 X;  4E71 A;  1I42 A;  3L13 A;  4KZC A;  3A9J B;  4DXA B;  4JIO U;  2K8H A;  2D2Q A;  1JRU A;  2DHZ A;  3DCG A;  4KVG B;  3DVG Y;  4FUL A;  1WM3 A;  3V61 A;  1S1Q B;  5L83 A;  4XC2 A;  2ZNV B;  1XD3 B;  4W9J A;  3A1Q A;  2KC2 A;  1X1M A;  2KX0 A;  4DHZ B;  2ZVN A;  1EF1 A;  4XX5 A;  2O2V A;  3UIO B;  2J0J A;  3DBS A;  4W9D A;  3AU5 A;  3A9J A;  2KJ6 A;  3DBR I;  3PRP B;  4GXB A;  4ANU A;  1YJ1 A;  3AU4 A;  4ZRK A;  2FCN A;  2AYO B;  3OJ4 B;  2AL6 A;  2K8C A;  4BVU C;  4EUT A;  1FXT B;  4GDL B;  3UQA A;  1YIW A;  3CST A;  2LVO A;  2LZ6 A;  2NR2 A;  3H7P A;  3QWZ B;  4NY0 A;  4MEL A;  1PQS A;  2FIF A;  4HDO A;  2XEW A;  2J0K A;  2JUO A;  1WRD B;  2KKC A;  3UIN B;  3PRE A;  2RGF A;  4GU2 A;  4W9H A;  2BF8 B;  1LXD A;  3IBE A;  2MCN B;  2CR5 A;  4MJS B;  1Q5W B;  1V81 A;  3OAW A;  2ZCB A;  1P3Q U;  4JL9 A;  2KDF B;  5FR6 A;  5JH5 C;  1WF9 A;  3AI5 A;  4K7W A;  3SD5 A;  2PJH A;  4NQL B;  5LXH A;  3L17 A;  1S3S G;  4DHJ D;  2OOB B;  2IO0 B;  2N1V A;  2ZCC A;  1V80 A;  3A33 B;  2IO2 B;  2KZR A;  3DOW A;  3R66 C;  4PS3 A;  2KTR B;  3VUX A;  3QIJ A;  3ZW3 A;  2A4Z A;  4IWO A;  4FJZ A;  3BIN A;  4WWP A;  2MRP A;  4BKS D;  1Q0W B;  4RM8 A;  3A4S C;  2G4S A;  3VVW B;  2V3S A;  2C7M B;  1OTR B;  2IO1 B;  3HHM A;  3WAM A;  3ZNG C;  2XK5 A;  3NZS A;  1Z2M A;  4WJN A;  2Z0D B;  2C5L C;  2EMS A;  2N9P C;  3ZIM A;  3JVZ X;  4BKT A;  2KNB A;  4EFO A;  4NJ7 A;  2DYO A;  3V6E B;  2IY0 B;  2LVQ A;  2DZJ A;  2ZJD A;  3QCA A;  2HJ8 A;  4MSQ B;  2C60 A;  2ZPN A;  4DHJ B;  3PLU A;  3QC8 B;  4PS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...