1OEYJ

Heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
HMTNWLRVYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pb1 Domain-Mediated Heterodimerization in Nadph Oxidase and Signaling Complexes of Atypical Protein Kinase C with Par6 and P62
pubmed doi rcsb
molecule keywords NEUTROPHIL CYTOSOL FACTOR 2
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 105
sequence length 105
chains with identical sequence K, L, M
ec nomenclature
pdb deposition date 2003-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1oeyJ00
4MJSA 3VXWA 3ZO5B 4AJYB 2O6VA 2YLMA 1V6EA 3RULA 1UBIA 5G55A 2JRHA 2O2VA 2M4NA 3U7DA 2AWTA 4WAAA 3WAMA 1V9JA 1S3SG 4HCNB 3QJZA 1EO6A 1E5WA 2IO1B 2N7EA 3EFUA 2KWCA 1V86A 2BGFA 2LXCA 2N9PC 3LJ3A 2W9NA 1WX9A 4GGQA 2FNJB 3IBEA 3KUCB 2OJRA 2C7HA 3NZUA 2KDIA 3QK0A 3PV1A 2LASA 3QAQA 1E90A 1WJUA 2BYVE 3PTFC 3P2BA 3KVFB 1FXTB 4CYEA 3L08A 4J6IA 5GMVA 4MSQB 1SGHA 4RM8A 1WMHB 3DBSA 3ECIA 5LXIB 2KNBA 3ZNGC 4IWOA 3R7RA 4GSWA 2KFKB 1Q0WB 4BKTA 3L54A 4WJPA 2C5LC 2KWVB 4FBJB 5D6JB 3RZFA 3ZUNA 3T9LA 4BKSA 2NCNA 2L00B 5JHBA 2K25A 2XK5B 2PEAA 1J0GA 2KC2A 1WZ3A 4WJOA 1BT0A 1VCBA 1YX6B 1ZKHA 2J7QB 2KFKA 3HK0A 1I42A 4K7UA 1ZGUB 2GMIC 2VRRB 3PLUA 4W9EA 1WX7A 4FJYA 4GMVA 2KZRA 1IP9A 1WF9A 5DPSA 3CSFA 4F7ZA 1RRBA 2A4ZA 2L7RA 2DZJA 3DBHI 1WI0A 1R4MI 4KDLB 4W9HA 2XK5A 2HE7A 2GBJA 1WXVA 4DDGD 1R4NI 2DAFA 3PRZA 2LGXA 3AULA 4GDKA 3KUDB 2KVRA 4FJZA 3RYTA 2BF8B 3K9OB 2ZJDA 1CMXB 3CF6E 1EF5A 2R2OA 3W1SA 3IFWB 2AL6A 3PGEA 5AZHA 2J0JA 1I35A 3UF8A 1WJ4A 1P1AA 3NS8A 4IG7B 4KSKC 5CHWA 2KWUB 3TJPA 2KQSA 5E6PA 5D2MB 1Z2MA 4MDKE 4K1RB 3QCAA 4DHZB 2ZNVC 4IWQA 3SU8X 3TBLD 2KX0A 4AP4C 4M8NA 2RR9A 2MBHA 3H7SA 2KLCA 2G4DB 2MWSB 1IPGA 4IM0A 2GBRA 3R66C 5C1ZA 3UQAA 2ZNVB 2RSUA 1NDDA 4NPNA 4PYZA 4ICUA 1J8CA 4LDTD 4ANVA 1TGZB 1E8XA 3A4RA 3BINA 2KTRB 4GDLA 2M0XA 3V62A 4HPMB 3PHWB 3PRMB 2MLBA 2ZVNA 4URKA 5J18A 2KDEB 3PLVA 2GBNA 3HM6X 1QZEA 2NS5A 3A9JA 4EKUA 4EZJA 2Z0DB 4BBNF 1RFAA 1WXAA 1YX5B 4LCDE 3ALBA 3LDZE 1WXSA 2YVCA 4B95A 3QQ8B 3A1QA 2NR2A 2KTRA 2LZ6A 1OEYJ 3NY5A 4K81A 1ISNA 1HE8A 1PQSA 2DENB 2KK8A 3PT2B 4MJSB 2M8SA 4N9F4 1SIFA 3NOBA 4NQKE 1YD8U 2NVUI 3ZW3A 2MW5A 3UQBA 2CU1A 2O2VB 3DOWA 3N3KB 4BKSD 3VH3B 2CKHB 2JWZA 4LDTB 3R7QA 2LVQA 4EFOA 2LRUA 4I6NB 2DX5B 3TCAA 2MRPA 3DQVA 4A3OA 2KJHB 1LQBA 2BYEA 3APFA 4BOZB 1OQYA 2DZMA 2FCMA 5D94A 3APDA 4NNJB 4FN2A 1RLFA 3V6CB 4CHKA 1OGWA 4ZRKA 5CX3A 3GOEA 4W9CA 1UD7A 2Y5BB 4IWPA 2KTFA 2LGDA 2IO0B 1TZ1A 4G3XB 1C1YB 2XEWA 3Q3FA 5TR5A 3H7PB 4DDID 1TBEA 4HDOA 5KHOA 4TV3A 1S1QB 2L3ZA 2MP2A 4KVGB 1KLVA 2MBOA 4MGKE 1T0YA 1X1MA 1MG8A 5AZGA 3IG3A 4XX5A 3A33B 4WJNA 2K8BA 4GB9A 1L7YA 3VAWA 3T8MA 1XQQA 1YQBA 2BWFA 3A9KB 3JW0X 2FIFA 3ZTDA 3DVNU 3HIZA 2IYDB 2WDTB 4DHJB 3H7PA 2M17A 1UELA 2ZPNA 5J17A 3UIOB 3V60A 3NZSA 1L2NA 2CHZA 2V4LA 2WX1A 3JYUA 1KM7A 3JSVA 1ZW7A 4II3B 4MGIE 5JHAA 3PVLA 5EDSA 3M63B 4K7SA 4K7WA 3WANA 2ZEQA 4EOYA 4JGHB 4HPLB 1E7UA 3U8ZA 3A9KA 1V81A 3UIPB 3I3TB 3K9PB 2L76A 4BOSC 2KX3A 3ZRCA 4KDIC 3RUIB 1WE7A 3W1SC 2A5UA 2L0TA 2NBUA 3DCGA 4MEMA 1JRUA 1LXDA 2GBKA 2MBEA 2C7NB 2KMAA 2UWQA 4IM3A 4GDKB 2LJ5A 1UZXB 1EF1A 1WJ6A 3X0WA 3ZNZB 2KOXA 2EMSA 4DK5A 4FA6A 1WZ0A 1WE6A 3VUXA 4WJQA 1LFDA 4ICVA 2L0FA 3TL5A 2WWZA 4DBGA 2IO2B 4X57B 2D10A 4E3CA 3WA0A 3SHQA 4EEWA 2N9EB 4JQWC 4NQLB 4TUUA 5CTRC 2HJ8A 2DAJA 3M62B 2KFJA 4ZRIA 4GN1A 2GOWA 2NBVB 2WYQA 3M95A 4WWPA 2LUEA 3VQIA 2REXA 1GNUA 4G0NB 2B3AA 2MX2A 1EUVB 2HTHA 3L16A 3OJ3A 1GG3A 1WGYA 2N7DA 1H8CA 3B0AA 1V49A 4RMAA 2D3GA 1GC6A 5E6NA 4GDLB 2G45B 2FUHB 1WGGA 2MBQA 4W9LA 2N4FA 1TTNA 3DBRI 2ASQA 2MQJA 3B08A 3A9JB 3EC8A 2UYZB 4TQ1A 1V5OA 2NPTA 2AEHA 3A1QB 2J0MA 2PE6B 3WALA 2HD5B 3VUYA 1WRDB 2K39A 4BFRA 2IBIB 3BY4B 4W9KA 5JZEB 2DZIA 1XT9B 2L8JA 4FHKA 2JZ3B 4GIVA 4IC7B 4LJOB 4OVVA 4W9IA 1Q5WB 4YL8A 3WAOA 2EMTA 3PSEB 2XBBC 3VHTC 2D07B 3QARA 2JPHA 3VTWA 1E8ZA 3QA8A 4EUTA 3O65B 3OJ4B 2JXXA 1WM3A 3DVGY 2D2QA 4W9GA 4M0WB 2JUOA 4ZDVA 1V2YA 2NBWB 4P7IA 3M3JA 3ZLZA 3TMPB 4MH0E 2V1YA 3RZWC 3DDCB 1U4AA 4ANUA 2R2QA 1P0RA 2KO3A 3QX1A 5DCNA 4HCPB 4DXAB 3KYCD 4W9JA 5CHVC 3H9DA 4MGZE 4PS3A 5C23A 2CHWA 4XC2A 2BYFA 1KJTA 2BPSA 4DHJD 3ZTCA 4I6LB 2DYBA 3IVFA 3W1YA 2MP2B 2Z0EB 4FULA 4ASWC 1GC7A 3PRPB 3APCA 2AL3A 2K8HA 3A4SC 2KLGA 3EECA 4KZCA 1NI2A 2JY6A 2C60A 3DVGX 3PZDA 4PYUA 1E8YA 3ZDMC 2FCNA 3MJWA 3DPDA 3ZKJC 4IW0A 4PS8A 3DVNV 1WGDA 2IY0B 3UGBB 4B6WA 5L95C 5KHQA 3JSVB 4RM9A 2Z59B 3ENEA 4CO7A 5IAAC 5DPTA 2K1FA 1V5TA 2IY1B 3CMMB 1SE9A 3R3MA 3WIMA 3VTUA 4F1SA 4NY0A 1WH3A 2G3QB 4WWOA 4FLHA 2RPQA 1IYFA 2ZCCA 4FADA 2KHWB 3PREA 2KJ6A 4B9KA 2I1KA 3ML9A 1E8WA 3UINB 3L10B 4AJWA 3V61A 4A20A 5L83A 2JRIB 3H6NA 3U30A 3ZRFA 3KYDD 4ZYNA 1WY8A 4HDQA 3ML8A 2K6QA 2KJRA 4M8MA 4HVBA 3PHXB 3PS6A 4EZKA 1D3ZA 2FCQA 1OTRB 2LRWA 2LVPA 4KIKB 2K6DB 3EHVA 2JVCA 3AI5A 4XZ4A 2ZZPB 1P3QU 5LLIA 4BVUC 5HKHA 1A5RA 3QHTA 3H1UA 1P9DU 3AU4A 2DYMA 2OOBB 4OVUA 3X23A 3ZVVA 2KN5A 4FJVB 3ONSA 2EKEC 4E74A 1UH6A 3GZNI 1H4RA 2DHZA 2BKFA 3SDLC 4G50A 5CHFA 2K8CA 4KSLC 3WAPA 2LWPA 1WMHA 4MM3A 5AZFA 2M1MA 4I6PA 2JF5A 2V3SA 4KIKA 1WFYA 2AYOB 3QIJA 3SD5A 3V6EB 2N9XA 3VFKA 4II2B 5LXHA 1C3TA 3B1LX 3NHEB 5E6OA 1KOTA 2MCNB 4EZLA 2WX0A 3QWZB 1J19A 2NPTB 1Z5SB 2ZPYA 2RGFA 4HK2A 3ZIMA 2LVOA 2LI5A 2BKRB 5J2RA 4DHZE 1NBFC 3OLMD 3VVWB 1WGRA 3OAWA 3KH0A 4TKNA 2CR5A 2KMCA 2KC1A 2I1JA 2G4SA 2KDBA 3L0WB 4G11A 1RAXA 1WIAA 4MELA 4MSMB 1F9JA 4WWNA 4ZRJA 3N30A 3RT3B 4F8CB 3MHSD 4FHJA 1GJZA 1E7VA 3L17A 1GUAB 3S2AA 1UGMA 1P98A 2FIDA 3CSTA 2BWES 1WX8A 2FAZA 2QHOA 3DBLI 3VH4B 5AEKB 5D7GA 1UBQA 4GU2A 4HLEA 5G2NA 1XD3B 3RD2A 3TIXA 2FCSA 4WQOB 4JIOU 1LM8B 1K8RB 3VUWA 4DWFA 3VDZA 2PPHA 2DYOA 2IO3B 2JT4B 2N1WA 3JVZX 4KZ0A 5BO4B 2O6VD 4E71A 1V80A 5JH5C 4JL9A 3N32A 4GOCA 5DPRA 4A3PA 2KQ7A 2ZCBA 1Q1OA 4HJKA 4HXDA 2RD0A 4W9FA 4AWJA 2KKCA 3QC8B 4ANWA 1M94A 4GXBA 4W9DA 4TQ0A 2MBBB 1YIWA 2D11A 2LD9A 2IZVB 2CS4A 4NAWB 5FR6A 1WR1A 2ZVOA 4AUQC 4NJ7A 1WGHA 2PE9A 1OEYA 1WM2A 2JZZA 1G6JA 3ZDTA 3Q3JA 2CHXA 3IHPC 3ZNHB 4IM2A 4PS7A 2KDFB 3AU5A 2GBMA 3C0RB 3HHMA 5DPWA 2LXAA 1AARA 2L05A 1WYWB 3KUZA 4BBNC 2PJHA 4NAWA 4HWIB 4LJPB 1VD2A 2DZKA 2KXJA 2O6VB 3D32A 3L13A 3VTVA 2MSED 4NJ6A 5IA7A 1WR6E 1YJ1A 2LGYA 4IUMB 3RCZA 4AOFA 3MTNB 3ZNID 2KANA 1Y8RC 3HM3A 4KV2A 2N1VA 2C9WB 2C7MB 4ANXA 4JLCA 4BKGA 3AXCA 4MGYE 3KW5B 3PPAA 2J0KA 2MA9B 1WXMA 1WJNA 2KD0A
chains in the Genus database with same CATH superfamily
2O6VA 1WYGA 2QSDA 4ARIA 5G55A 2M4NA 2BQQA 4WAAA 4P1CC 4M01A 1EO6A 1E5WA 4NJCA 2KWCA 3ETRA 4YTNB 2IDYA 1WSPA 2JU6X 2LASA 1E90A 1WJUA 4CYEA 1I4GA 3AEAB 1SGHA 5D3DA 1WMHB 2KNBA 1A70A 3SFDB 3ZNGC 4P6VF 3O13A 1MVKA 1STEA 2KFKB 4BKTA 3L54A 5D6JB 3ZYYX 4BKSA 2NCNA 1EM7A 1D5XC 2MJDA 2LHDA 1L0VB 1J0GA 1VCBA 1YX6B 1ZKHA 2J7QB 1I42A 1HEZE 2GMIC 3RNEC 1RRBA 1WI0A 1XF5L 1QOGA 2HE7A 1SSNA 4REZA 4RH6A 2LGXA 3MC8A 4WAFA 2GLSA 2ZJDA 5T8IA 1DYQA 5AZHA 2J0JA 3GS2A 3UF8A 5E6PA 1Z2MA 2BS4B 3TBLD 4AP4C 1HA5A 3TEXA 2RR9A 1MJDA 4XWTA 1TY2A 5D3IB 2GBRA 4NPNA 4ICUA 1J8CA 4LDTD 4ANVA 3MP9A 2KT7A 3PHWB 2ZVNA 4URKA 5J18A 3PLVA 2GBNA 1QZEA 2EELA 2NS5A 4EKUA 5HHDG 1WXSA 2LUMA 3A1QA 2NR2A 2KTRA 3P4QB 2LZ6A 4ZHPA 1OFFA 1ISNA 1HE8A 1PQSA 2DENB 3PT2B 4XWWA 4N9F4 2N9KA 3NS1A 2NVUI 2CKHB 3R7QA 2LVQA 1J7AA 2ON8A 4I6NB 2DX5B 2MRPA 2KJHB 1LQBA 5FKAC 2AQ1B 4DQOC 2ZW1A 1L0YB 2W3RA 1UWXA 3V6CB 3GOEA 1D4BA 4IWPA 2KTFA 2IO0B 3AE4B 5C3JB 1TBEA 3NRZA 1S1QB 2MP2A 1L6UA 1KLVA 2MBOA 1I4HA 1SEBD 1T0YA 1X1MA 3RMKC 4XX5A 3A33B 2KACA 4WJNA 2K8BA 4JWSC 3T8MA 1XQQA 1YQBA 4XGAB 3HIZA 2IYDB 2WDTB 5H8YE 5BMHA 5C2TB 2K5PA 3GE3C 1EU3A 3JYUA 4YWGG 4MGIE 3PVLA 5EDSA 4K7SA 1TS2A 4JGHB 3A9KA 1V81A 4WURA 2BB6A 2KX3A 3ZRCA 1WE7A 3EFCA 2A5UA 2GBKA 2LJ5A 1WJ6A 1EF1A 2INNE 2J53A 2PVGC 1C78A 1WZ0A 1WE6A 2BS2B 3L4PA 1LFDA 4DBGA 1SE4A 2D10A 3WA0A 4JQWC 4NQLB 4TUUA 2BS3B 2HJ8A 1WGKA 4WIPA 4ZRIA 2KFJA 3M95A 2WYQA 4WWPA 2LUEA 3VQIA 4G0NB 4RGOS 1YQ3B 1V49A 4ITKA 2L32A 1MPEA 4W9LA 3MHZA 1TTNA 2G9HD 2MQJA 3R2IA 3EC8A 2UYZB 2AEHA 4L23A 1TKYA 4BFRA 2WU2B 2IBIB 4WWMA 1XT9B 4OVZA 2JZ3B 4OZCA 1Q5WB 2EMTA 2ONQA 1FO4A 1E8ZA 1FM0D 2JXXA 1V2YA 2NBWB 2BT6A 4MH0E 3RZWC 1PDXA 3Q2AC 4ANUA 2R2QA 3I57A 3KWVA 5DCNA 4XC2A 3LB8C 2MJ3A 3IVFA 1C4CA 2Z0EB 1GC7A 2AL3A 3N20C 1EU4A 3W5UB 1ZE3D 3UI3A 2JY6A 2C60A 1YJJA 1VZ7A 3ZDMC 3NG0A 3HUIA 4PS8A 1WGDA 2KYWA 5HI1A 3JSVB 1FXAA 4L2YA 2N7JA 5DPTA 1V5TA 2IY1B 3NZ3A 4LNIA 3WIMA 1V1OA 2KDMA 4FLHA 1HTQA 2KHWB 3PREA 4JE3B 4B9KA 1E8WA 3CIRB 3T3NA 2WXOA 1N63A 2W3SA 5HFYA 3U30A 2GB1A 1WY8A 3ML8A 1KTKA 3PHXB 1ET9A 3RNFC 4S17A 2FCQA 1C4PA 2LRWA 3B2GA 4KIKB 5LLIA 1A5RA 1CZPA 3SR6A 4LNFA 1M4VA 3ONSA 1UH6A 1IGCA 2LWPA 2RPVA 4A9AA 2JF5A 3VFKA 2N9XA 3AE9B 1KOTA 1ENFA 2RGFA 4HK2A 3ZIMA 2LI5A 4YT0B 4RGTA 4DHZE 4UDUC 2QC8A 4TKNA 2I1JA 5AUKA 1T5XD 1DOYA 4MSMB 1F9JA 4WWNA 3AEEB 4F8CB 3MHSD 1ZDVA 4HLEA 4JIOU 1JW9D 3GB1A 1IUEA 2NMQA 5JH5C 3PZ7A 2KQ7A 3U52E 3QC8B 2WDVB 2ZVOA 1HZ6A 3RNCC 4NZLB 1GB4A 2JZZA 2KQ4X 3Q3JA 3ZNHB 2GBMA 3WCQA 1AN8A 3IXSA 4HWIB 2O6VB 3VTVA 1I7HA 1HXYD 3ZNID 2C9WB 1E10A 2OEDA 4ANXA 4BKGA 4GLSC 1C77A 1P7EA 4N6EB 1WJNA 5JHAA 4MJSA 1GAQB 4AJYB 2YLMA 4RF0A 3U4EG 4FXCA 1C9FA 2JRHA 1SIJA 1K53A 4US9A 2BYTA 2X38A 1P7FA 2IO1B 2N7EA 3PTFC 3EFUA 2BGFA 5HG2A 3BZDB 1QKZA 3PO0A 2BTEA 2WNMA 2K3UA 3HVZA 2KDIA 3NZUA 2DBYA 2VZKD 3P2BA 1JQ4A 3KVFB 1XCQL 4J6IA 2OJWA 4MSQB 1J7CA 4MM3B 2WXHA 2YEPB 3ZUNA 4ZHOA 2PEAA 2KAJA 3MC9A 1BT0A 3AEBB 1SXTA 3HK0A 2VRRB 1WX7A 4GMVA 1IP9A 2KZRA 1WF9A 3Q8BA 4HEA1 2GBJA 1WXVA 3OG5A 4DDGD 2DAFA 3AULA 4LTUA 3U2SC 4XDCA 3K9OB 1EF5A 4USAA 3W1SA 3NVYA 3PGEA 1I35A 2V3PA 1P1AA 4KSKC 3LYYA 3TJPA 5IP4D 4MDKE 4K1RB 3QCAA 1XO3A 2WXJA 2KX0A 1UF0A 4IKGA 3AE3B 1IPGA 3R66C 2QCZA 2RSUA 4WQMA 3FC4A 3A4RA 3BINA 2KTRB 2BBCA 4HPMB 2MLBA 1FNVA 2V4IB 2MHJA 3U7ZA 2Z0DB 5H92C 4BBNF 1RFAA 4LCDE 2L83A 3ALBA 1ZUD2 3NY5A 1JWMD 1GB1A 1KF6B 3ZW3A 4C4VA 2RDBC 2MW5A 2O2VB 3N3KB 4BKSD 1UGJA 3VH3B 4LDTB 3ZJTA 4EFOA 3TCAA 2D3CA 3DQVA 1OQYA 2J42A 1PYWD 1FEHA 4LLGM 3APDA 1YMHE 4ZRKA 4C7ZA 2MEKA 2CJNA 4LNNA 3Q3FA 3ZXRA 1T6BX 1T0SC 1TS3A 4MACA 3KQ4A 1L4DB 1QOAA 5AZGA 5LNK1 1EWYC 4LNOA 1DGJA 1L7YA 3Q14C 3A9KB 1IBXA 1PGAA 2AX5A 2M17A 1UELA 5J17A 3V60A 3NZSA 2CHZA 2D3BA 4K7WA 4ZRQA 2ZEQA 4HPLB 4ARCA 3MC0B 3UIPB 1F1HA 2L76A 3FILB 4MEMA 2C7NB 4N59A 2KMAA 2UWQA 4GDKB 4PK1A 3X0WA 3B9JA 2EMSA 2QMTA 4WJQA 2IO2B 2H88B 3AN1A 2V3NA 5CTRC 3C19A 3SFEB 3T3OA 5EE3A 2JSVX 2XN9C 4EE2A 4OHJA 2MX2A 1EUVB 2HTHA 3OJ3A 1H8CA 3BK2A 4GDLB 1QOFA 1T3QA 2G45B 2LJIA 2GRIA 3B08A 3A9JB 1K51A 1TS4A 4N58A 3VUYA 4W9KA 4GIVA 4FHKA 4LJOB 3ZJUA 2MJEA 5MPOA 1FCCC 1R7SA 2FE8A 2D07B 3RFZB 2WXFA 3QA8A 2PLPA 3O65B 3DVGY 1WM3A 2QDFA 4W9GA 4M0WB 2JUOA 4P7IA 3TUOA 4C80A 4HRSA 3DDCB 3BYTB 3NJTA 2INDC 3AECB 4DXAB 3KYCD 4W9JA 4MGZE 2CHWA 2DLBA 4CQNA 4MT5A 4XE0A 1KJTA 2BPSA 3ZTCA 1XXGA 3W1YA 1TS5A 5AUIA 4FULA 4ASWC 5BYSA 3APCA 4A90A 1VJKA 1E8YA 1E7PB 1D6EC 3DVNV 1XLPA 3AE6B 2ACZB 3GE8C 5KHQA 2WP9B 1YQ4B 3CMMB 1YNTE 3VTUA 1F52A 1WH3A 2G3QB 4WWOA 2KJ6A 2MH7A 2W54A 3KYDD 4DXGA 4HDQA 2KJRA 4M8MA 4HVBA 2GI9A 3PS6A 4EZKA 2IPKD 2PVOD 3RI7C 1P3QU 4B0MA 4XDDA 3DBHB 3AU4A 2DYMA 2WXGA 1EWCA 4FJVB 2EKEC 2M19A 4KSLC 3WAPA 1CK1A 1WMHA 1TYGB 5AZFA 3SD5A 5FK9C 2LMCA 4II2B 3R2TA 3NHEB 2WX0A 2NPTB 2ZPYA 2LVOA 2BKRB 5EE9A 3OLMD 3HVDA 3VVWB 2CR5A 1TY0A 3KWLA 3L0WB 4G11A 1RAXA 3GP7A 3N30A 3RT3B 1E7VA 1L4ZB 3S2AA 4ZYSA 1NYRA 4XYCA 2QEJC 4GU2A 4A6QA 4ACFA 3TIXA 4J3OD 2PW9A 4WQOB 3RD2A 1HQRD 4DWFA 1I4RA 3I63C 1JROA 2IO3B 2N1WA 3JVZX 4KZ0A 3B2FA 3Q3NC 1D5MC 4JL9A 2WXKA 2K0PA 2ZCBA 1FFUA 4W9FA 2KKCA 3DWMA 4GXBA 4W9DA 3LXFA 1YIWA 2LD9A 2WHIA 1C79A 5FR6A 1SF0A 1WGHA 1WM2A 2JWUA 3ZDTA 2CHXA 4IM2A 2QJLA 5IO9A 2KDFB 3AU5A 4KX6B 2DWQA 3C0RB 1V1PB 1WYWB 2PJHA 3V05A 3L13A 2MSED 3AE1B 1ZXIA 4IUMB 3Q3OC 1D5ZC 2KANA 1Y8RC 3HM3A 2C7MB 1MI0A 4JLCA 3AXCA 4MGYE 2J0KA 3EA6A 2NTTA 3ZO5B 1F2RC 2Y3AA 2AWTA 3WAMA 4ZRPA 1V9JA 4HCNB 3QJZA 2LXCA 1V86A 2N9PC 4M02A 3LJ3A 2W9NA 1WX9A 3IBEA 2OJRA 1L5PA 2C7HA 3QK0A 2OHFA 3PV1A 2BYVE 1FXTB 1HTOA 3I5JC 4RM8A 2WDQB 1TJEA 3R7RA 1YOVB 4WJPA 1F2RI 4FBJB 5JXVA 2K25A 1YN5A 1SBBB 1XLOA 2KC2A 3AE2B 1TKEA 4HKQA 3AE8B 4K7UA 1ZGUB 4FJYA 1KFYB 1FCLA 4F7ZA 2L7RA 2DZJA 3Q6BA 2VZKB 3DBHI 3Q69A 4KDLB 4W9HA 2IGGA 2XK5A 2INCC 1E0ZA 1FD6A 3PRZA 4FJZA 3RYTA 2BF8B 1ZXHA 1OQRA 1CMXB 2D5GA 3CF6E 3ZGZA 2R2OA 1RFKA 3NS8A 3DBLB 4IG7B 2KWUB 1V97A 2KQSA 5D2MB 1B1ZA 4DHZB 2ZNVC 3R8BA 1FFVA 2MBHA 3H7SA 2KLCA 2G4DB 2WXNA 3AH7A 3P1MA 3UQAA 4PYZA 1XLQA 3V62A 2BB5A 2M0XA 3PRMB 3VRAB 2KDEB 3BIID 3HM6X 3BVZA 5IOIA 5G5GA 1K50A 2LGIA 1YX5B 3DHHC 3LDZE 2YVCA 1VLBA 4HROA 1OEYJ 2VH2A 3ABVB 3N9YC 4K81A 4KGSA 3IAM1 1XCTL 2KK8A 2M8SA 3NOBA 4NQKE 1YD8U 1FIQA 3EGRA 4Q2JA 3Q3MC 3DOWA 2LRUA 4A3OA 2BYEA 2FBWB 1PGBA 4KGTA 4FN2A 1RLFA 4CHKA 1OGWA 1DOIA 1TZ1A 2J4XA 5TR5A 2XEWA 3BVMA 1RWSA 5KHOA 2L1AA 2L3ZA 4JWUC 2EKIA 3VAWA 2BWFA 2LGSA 3JW0X 3DVNU 2K9XA 3VRBB 3NVVA 3H7PA 3UIOB 2WX1A 1KM7A 3JSVA 1ZW7A 1JWUD 4II3B 3M63B 4DXFA 3WANA 4EOYA 1E7UA 3GZNB 3U8ZA 2RDHA 3I3TB 3K9PB 1L6VA 3V3XA 4KDIC 3RUIB 3W1SC 3DCGA 1JRUA 2BW2A 2MBEA 4OZAA 3EUB2 3ZNZB 1UZXB 2BVCA 4JPSA 1SE2A 4A8XC 3VUXA 3TEWA 2LHEA 4HKZE 3TL5A 1TKGA 1L0XB 4X57B 3SEBA 1FXIA 3N1XC 3M62B 4GN1A 2L52A 2GOWA 2NBVB 3H8HA 3N1ZC 3RN9C 2REXA 2B3AA 1WGYA 2N7DA 2JXTA 2WS3B 1GC6A 1VR9A 2FUG1 1WGGA 5BMIA 2MBQA 1MHXA 4HJGE 1AWDA 1ZOYB 1I4QA 4TQ1A 1V5OA 4A55A 1KRHA 1RYJA 3ZXVA 3A1QB 2J0MA 1KLUD 1OQQA 4C00A 5JZEB 2L8JA 4OVVA 2R61A 3WAOA 4YL8A 3QARA 2PIAA 2JPHA 1JWBD 3VTWA 3RNBC 4EUTA 2D2QA 3CWIA 3VR8B 2WU5B 4ZDVA 3TMPB 3W2DA 1U4AA 5BYQA 1P0RA 2KO3A 3QX1A 1SE3A 4HCPB 3Q8FA 5CHVC 2BYFA 4RGNA 1FNWA 3W9CB 4I6LB 3IT4B 2HJ1A 2MP2B 3N1YC 3PRPB 1BMLC 2K8HA 3A4SC 2WXQA 3EECA 4MH8A 1NI2A 4ZOHC 4PYUA 1N5WA 1IGDA 2FCNA 1UWMA 3MJWA 3DPDA 3ZKJC 4IW0A 2IY0B 4B6WA 1F77A 4QAYA 3URYA 2YEPF 4CO7A 3ENEA 1MHHE 1KLGD 1SE9A 3R3MA 4F1SA 4NY0A 1E9MA 2W82A 4YSZB 2WQYB 3C8YA 1IYFA 4AS1A 3MJ5A 2I1KA 3ML9A 2WXIA 3UINB 4AJWA 3V61A 4A20A 3NVZA 5IN7A 4ZYNA 2K6QA 3EHVA 2X8XX 4XZ4A 5HKHA 2G1EA 3QHTA 3AV8A 3H1UA 1R4MB 4D2KA 2OOBB 4OVUA 3X23A 2KN5A 1MFWA 1QT9A 1QOBA 3OWEB 4E74A 1R4NB 3DHIC 2V0GA 2N0SB 3GZNI 2DHZA 2BKFA 4TMAB 3SDLC 5CHFA 2K8CA 4MM3A 2V3SA 3RPFC 3Q8EA 3QIJA 2MCNB 3I9V1 5EE0A 3QWZB 1HZ5A 1J7BA 1ET6A 3DWGC 1NBFC 4KKJA 1WGRA 4RFBA 2KDBA 2RMMA 4MELA 4L1BA 1ZPSA 1YN3A 1GUAB 3CSTA 2JQRB 2BWES 1WX8A 2TSSA 3BK1A 2FAZA 1N60A 5D7GA 1UBQA 5G2NA 4US8A 1XD3B 1WWTA 2FCSA 4C56C 1LM8B 1K8RB 3E56A 3VUWA 2I38A 3VDZA 2PPHA 2JT4B 2SAKA 2JX5A 1V80A 2WLBA 4HJKA 2RD0A 4NAMA 5GXGB 1M94A 2JYTA 4KKIA 1PFDA 1B9RA 2CU3A 1WR1A 1LO5D 2PE9A 3W5VB 2M56B 4WH4A 1G6JA 1ZDXA 3IHPC 4PS7A 1AARA 2UU7A 2L05A 3ZJVA 1JWAD 3KUZA 4NAWA 1GPXA 4LJPB 2DZKA 2KXJA 5IA7A 4NJ6A 1WR6E 1YJ1A 2LGYA 3P42A 4RCOA 4AOFA 1V8CA 4KV2A 2N1VA 5IKCM 1F0ZA 4K3CA 3PPAA 1WXMA 3VXWA 4AQ7A 1V6EA 3RULA 1UBIA 3U7DA 1K52A 2O2VA 1NVID 1NEKB 1S3SG 2WXRA 3HRDD 4GGQA 2FNJB 1ZP0B 3KUCB 3P4SB 4S0RA 1SJHD 2PTLA 3QAQA 3L08A 5GMVA 3DBSA 3ECIA 5LXIB 1VZ6A 4IWOA 4GSWA 3FKYA 5TSSA 1Q0WB 1AYFA 5I4DA 2C5LC 2KWVB 3RZFA 1BUIC 3T9LA 3FAHA 2L00B 5JHBA 2XK5B 3BWUD 3P4PB 1WZ3A 4WJOA 3AEDB 2KFKA 3BVGA 3PLUA 2WDRB 4W9EA 2Y5CA 5DPSA 3CSFA 2A4ZA 1C76A 1PGXA 1R4MI 1LGRA 3AM9A 3FILA 5E6JA 2IGDA 3DBRB 1R4NI 4GDKA 4YTPB 3KUDB 2KVRA 1I4XA 3AE7B 2WXMA 1VDVA 3IFWB 3P4RB 2AL6A 1XLNA 1WJ4A 3J9CA 4P16A 5CHWA 1E6EB 3BYYB 4IWQA 3SU8X 4M8NA 2W55A 1Y56A 1SJED 2MWSB 4IM0A 5C1ZA 2ZNVB 1NDDA 1QILA 1TGZB 1E8XA 4GDLA 1VRAB 4OZBA 2PKOA 1JRPA 3A9JA 4JX1C 4EZJA 1WXAA 1N5XA 4B95A 2HDEA 3QQ8B 2AQ2B 3AEGB 4MJSB 1SIFA 2KMMA 4YSXB 5EE1A 1QLBB 3UQBA 2CU1A 4TSSA 2JWZA 4M0WA 1NI3A 3APFA 4BOZB 1WXQA 2Q5WD 2DZMA 2FCMA 5D94A 4NNJB 2IJ0A 5CX3A 1TZOA 1FMAD 1UD7A 4W9CA 2Y5BB 3TSSA 2B76B 1NYQA 2LGDA 4G3XB 1C1YB 1SB3C 4DDID 3H7PB 4HDOA 4TV3A 4KVGB 4MGKE 1MG4A 1MG8A 3IG3A 3NUHB 4GB9A 4YXDB 1AW7A 2FIFA 3Q8CA 3AB5A 3ZTDA 4DHJB 1DOXA 2ZPNA 1L2NA 2V4LA 4BAXA 2PMVA 1ACCA 4BOSC 2JYEA 2NBUA 2L0TA 1LXDA 4IM3A 2KOXA 4DK5A 4FA6A 4ICVA 2D3AA 1FRRA 2JZPA 2L0FA 2WWZA 4E3CA 3SHQA 4EEWA 2N9EB 2NTSA 2DAJA 3RNGC 3Q8AA 1T0RC 5G5HA 1GNUA 4LNKA 3L16A 1GG3A 2ZW0A 3B0AA 4RMAA 2D3GA 2DNFA 5E6NA 4B0EA 2FUHB 1XEEA 2N4FA 1WRIA 3DBRI 2ASQA 1ESFA 3NVWA 2NPTA 2PE6B 3WALA 2HD5B 1WRDB 2K39A 3BY4B 3MFGA 2QILA 2DZIA 4C7YA 4IC7B 4W9IA 2E3TA 3PSEB 2XBBC 3VHTC 4C4VB 2INPE 3OJ4B 1JCKB 2AQ3B 3M3JA 3ZLZA 4KGRA 2V1YA 4RNAA 4HPPA 1JALA 1QF6A 5BMGA 3H9DA 4PS3A 5C23A 1UUPA 2IGHA 1CJEA 4DHJD 2WXPA 2DYBA 4R3DA 1FRDA 1YJIA 2WGSA 1N6ZA 1T0QC 2KLGA 4KZCA 3DVGX 3TEZA 3PZDA 4K3BA 2K22A 1N62A 1IBXB 4BZAA 3IAS1 4O1NA 3UGBB 5L95C 4RM9A 2Z59B 2LEKA 1V1PA 5IAAC 2Y5PA 2K1FA 4M00A 2HTME 3RNAC 4YSYB 2RPQA 1N61A 3TEYA 2ZCCA 4FADA 1I4PA 3L10B 5L83A 1JWSD 2JRIB 3H6NA 2I2YA 4H2AA 3ZRFA 1KH0A 1D3ZA 2Z8LA 3DHGC 1OTRB 3AEFB 2LVPA 2K6DB 1FPYA 2JVCA 3AI5A 2ZZPB 4BVUC 1P9DU 1TIFA 1ROEA 5BYRA 2VH1A 3ZVVA 2RDGA 5FR3A 1H4RA 4G50A 2KVZA 2M1MA 4I6PA 4KIKA 1WFYA 2AYOB 3V6EB 5LXHA 2KWDA 1C3TA 3B1LX 5E6OA 4EZLA 4LK0M 1J19A 1Z5SB 2KN4A 3IT6B 4P1BC 3AMZA 3VR9B 3ZQ4A 5J2RA 1UNSA 3OAWA 3KH0A 2KMCA 2KC1A 2G4SA 1WIAA 4PT5A 4ZRJA 1PUTA 4YTMB 1GJZA 4FHJA 3L17A 2H89B 1BXTA 1UGMA 1NENB 1P98A 2FIDA 2XNAC 2M0AA 2QHOA 3DBLI 3VH4B 5AEKB 2LFIA 2CJOA 1FNUA 3PZ8A 2ICIA 2DYOA 5BO4B 3P63A 1GOZA 2O6VD 4E71A 4IDIA 3N32A 4GOCA 5DPRA 4A3PA 2J52A 1JMLA 1Q1OA 1VZ8A 4HXDA 4AWJA 4ANWA 1Q10A 2SEBD 4TQ0A 2MBBB 2D11A 1CQVA 4RGMA 2IZVB 2CS4A 4NAWB 1C4AA 4AUQC 4NJ7A 4RF1A 1OEYA 2WXLA 4OW0A 3KLSX 3HHMA 5DPWA 4IOIE 2LXAA 1YN4A 4BBNC 2QIEB 1QQRA 1VD2A 3D32A 1RM6C 3RCZA 3MTNB 2V9HA 3E9SA 1TT5B 3AE5B 2E6XA 2N9LA 3KW5B 2MA9B 2KD0A
chains in the Genus database with same CATH topology
4MJSA 3VXWA 3ZO5B 4AJYB 2O6VA 2YLMA 1V6EA 3RULA 1UBIA 5G55A 2JRHA 2O2VA 2M4NA 3U7DA 2AWTA 4WAAA 3WAMA 1V9JA 1S3SG 4HCNB 3QJZA 1EO6A 1E5WA 2IO1B 2N7EA 3EFUA 2KWCA 1V86A 2BGFA 2LXCA 2N9PC 3LJ3A 2W9NA 1WX9A 4GGQA 2FNJB 3IBEA 3KUCB 2OJRA 2C7HA 3NZUA 2KDIA 3QK0A 3PV1A 2LASA 3QAQA 1E90A 1WJUA 2BYVE 3PTFC 3P2BA 3KVFB 1FXTB 4CYEA 3L08A 4J6IA 5GMVA 4MSQB 1SGHA 4RM8A 1WMHB 3DBSA 3ECIA 5LXIB 2KNBA 3ZNGC 4IWOA 3R7RA 4GSWA 2KFKB 1Q0WB 4BKTA 3L54A 4WJPA 2C5LC 2KWVB 4FBJB 5D6JB 3RZFA 3ZUNA 3T9LA 4BKSA 2NCNA 2L00B 5JHBA 2K25A 2XK5B 2PEAA 1J0GA 2KC2A 1WZ3A 4WJOA 1BT0A 1VCBA 1YX6B 1ZKHA 2J7QB 2KFKA 3HK0A 1I42A 4K7UA 1ZGUB 2GMIC 2VRRB 3PLUA 4W9EA 1WX7A 4FJYA 4GMVA 2KZRA 1IP9A 1WF9A 5DPSA 3CSFA 4F7ZA 1RRBA 2A4ZA 2L7RA 2DZJA 3DBHI 1WI0A 1R4MI 4KDLB 4W9HA 2XK5A 2HE7A 2GBJA 1WXVA 4DDGD 1R4NI 2DAFA 3PRZA 2LGXA 3AULA 4GDKA 3KUDB 2KVRA 4FJZA 3RYTA 2BF8B 3K9OB 2ZJDA 1CMXB 3CF6E 1EF5A 2R2OA 3W1SA 3IFWB 2AL6A 3PGEA 5AZHA 2J0JA 1I35A 3UF8A 1WJ4A 1P1AA 3NS8A 4IG7B 4KSKC 5CHWA 2KWUB 3TJPA 2KQSA 5E6PA 5D2MB 1Z2MA 4MDKE 4K1RB 3QCAA 4DHZB 2ZNVC 4IWQA 3SU8X 3TBLD 2KX0A 4AP4C 4M8NA 2RR9A 2MBHA 3H7SA 2KLCA 2G4DB 2MWSB 1IPGA 4IM0A 2GBRA 3R66C 5C1ZA 3UQAA 2ZNVB 2RSUA 1NDDA 4NPNA 4PYZA 4ICUA 1J8CA 4LDTD 4ANVA 1TGZB 1E8XA 3A4RA 3BINA 2KTRB 4GDLA 2M0XA 3V62A 4HPMB 3PHWB 3PRMB 2MLBA 2ZVNA 4URKA 5J18A 2KDEB 3PLVA 2GBNA 3HM6X 1QZEA 2NS5A 3A9JA 4EKUA 4EZJA 2Z0DB 4BBNF 1RFAA 1WXAA 1YX5B 4LCDE 3ALBA 3LDZE 1WXSA 2YVCA 4B95A 3QQ8B 3A1QA 2NR2A 2KTRA 2LZ6A 1OEYJ 3NY5A 4K81A 1ISNA 1HE8A 1PQSA 2DENB 2KK8A 3PT2B 4MJSB 2M8SA 4N9F4 1SIFA 3NOBA 4NQKE 1YD8U 2NVUI 3ZW3A 2MW5A 3UQBA 2CU1A 2O2VB 3DOWA 3N3KB 4BKSD 3VH3B 2CKHB 2JWZA 4LDTB 3R7QA 2LVQA 4EFOA 2LRUA 4I6NB 2DX5B 3TCAA 2MRPA 3DQVA 4A3OA 2KJHB 1LQBA 2BYEA 3APFA 4BOZB 1OQYA 2DZMA 2FCMA 5D94A 3APDA 4NNJB 4FN2A 1RLFA 3V6CB 4CHKA 1OGWA 4ZRKA 5CX3A 3GOEA 4W9CA 1UD7A 2Y5BB 4IWPA 2KTFA 2LGDA 2IO0B 1TZ1A 4G3XB 1C1YB 2XEWA 3Q3FA 5TR5A 3H7PB 4DDID 1TBEA 4HDOA 5KHOA 4TV3A 1S1QB 2L3ZA 2MP2A 4KVGB 1KLVA 2MBOA 4MGKE 1T0YA 1X1MA 1MG8A 5AZGA 3IG3A 4XX5A 3A33B 4WJNA 2K8BA 4GB9A 1L7YA 3VAWA 3T8MA 1XQQA 1YQBA 2BWFA 3A9KB 3JW0X 2FIFA 3ZTDA 3DVNU 3HIZA 2IYDB 2WDTB 4DHJB 3H7PA 2M17A 1UELA 2ZPNA 5J17A 3UIOB 3V60A 3NZSA 1L2NA 2CHZA 2V4LA 2WX1A 3JYUA 1KM7A 3JSVA 1ZW7A 4II3B 4MGIE 5JHAA 3PVLA 5EDSA 3M63B 4K7SA 4K7WA 3WANA 2ZEQA 4EOYA 4JGHB 4HPLB 1E7UA 3U8ZA 3A9KA 1V81A 3UIPB 3I3TB 3K9PB 2L76A 4BOSC 2KX3A 3ZRCA 4KDIC 3RUIB 1WE7A 3W1SC 2A5UA 2L0TA 2NBUA 3DCGA 4MEMA 1JRUA 1LXDA 2GBKA 2MBEA 2C7NB 2KMAA 2UWQA 4IM3A 4GDKB 2LJ5A 1UZXB 1EF1A 1WJ6A 3X0WA 3ZNZB 2KOXA 2EMSA 4DK5A 4FA6A 1WZ0A 1WE6A 3VUXA 4WJQA 1LFDA 4ICVA 2L0FA 3TL5A 2WWZA 4DBGA 2IO2B 4X57B 2D10A 4E3CA 3WA0A 3SHQA 4EEWA 2N9EB 4JQWC 4NQLB 4TUUA 5CTRC 2HJ8A 2DAJA 3M62B 2KFJA 4ZRIA 4GN1A 2GOWA 2NBVB 2WYQA 3M95A 4WWPA 2LUEA 3VQIA 2REXA 1GNUA 4G0NB 2B3AA 2MX2A 1EUVB 2HTHA 3L16A 3OJ3A 1GG3A 1WGYA 2N7DA 1H8CA 3B0AA 1V49A 4RMAA 2D3GA 1GC6A 5E6NA 4GDLB 2G45B 2FUHB 1WGGA 2MBQA 4W9LA 2N4FA 1TTNA 3DBRI 2ASQA 2MQJA 3B08A 3A9JB 3EC8A 2UYZB 4TQ1A 1V5OA 2NPTA 2AEHA 3A1QB 2J0MA 2PE6B 3WALA 2HD5B 3VUYA 1WRDB 2K39A 4BFRA 2IBIB 3BY4B 4W9KA 5JZEB 2DZIA 1XT9B 2L8JA 4FHKA 2JZ3B 4GIVA 4IC7B 4LJOB 4OVVA 4W9IA 1Q5WB 4YL8A 3WAOA 2EMTA 3PSEB 2XBBC 3VHTC 2D07B 3QARA 2JPHA 3VTWA 1E8ZA 3QA8A 4EUTA 3O65B 3OJ4B 2JXXA 1WM3A 3DVGY 2D2QA 4W9GA 4M0WB 2JUOA 4ZDVA 1V2YA 2NBWB 4P7IA 3M3JA 3ZLZA 3TMPB 4MH0E 2V1YA 3RZWC 3DDCB 1U4AA 4ANUA 2R2QA 1P0RA 2KO3A 3QX1A 5DCNA 4HCPB 4DXAB 3KYCD 4W9JA 5CHVC 3H9DA 4MGZE 4PS3A 5C23A 2CHWA 4XC2A 2BYFA 1KJTA 2BPSA 4DHJD 3ZTCA 4I6LB 2DYBA 3IVFA 3W1YA 2MP2B 2Z0EB 4FULA 4ASWC 1GC7A 3PRPB 3APCA 2AL3A 2K8HA 3A4SC 2KLGA 3EECA 4KZCA 1NI2A 2JY6A 2C60A 3DVGX 3PZDA 4PYUA 1E8YA 3ZDMC 2FCNA 3MJWA 3DPDA 3ZKJC 4IW0A 4PS8A 3DVNV 1WGDA 2IY0B 3UGBB 4B6WA 5L95C 5KHQA 3JSVB 4RM9A 2Z59B 3ENEA 4CO7A 5IAAC 5DPTA 2K1FA 1V5TA 2IY1B 3CMMB 1SE9A 3R3MA 3WIMA 3VTUA 4F1SA 4NY0A 1WH3A 2G3QB 4WWOA 4FLHA 2RPQA 1IYFA 2ZCCA 4FADA 2KHWB 3PREA 2KJ6A 4B9KA 2I1KA 3ML9A 1E8WA 3UINB 3L10B 4AJWA 3V61A 4A20A 5L83A 2JRIB 3H6NA 3U30A 3ZRFA 3KYDD 4ZYNA 1WY8A 4HDQA 3ML8A 2K6QA 2KJRA 4M8MA 4HVBA 3PHXB 3PS6A 4EZKA 1D3ZA 2FCQA 1OTRB 2LRWA 2LVPA 4KIKB 2K6DB 3EHVA 2JVCA 3AI5A 4XZ4A 2ZZPB 1P3QU 5LLIA 4BVUC 5HKHA 1A5RA 3QHTA 3H1UA 1P9DU 3AU4A 2DYMA 2OOBB 4OVUA 3X23A 3ZVVA 2KN5A 4FJVB 3ONSA 2EKEC 4E74A 1UH6A 3GZNI 1H4RA 2DHZA 2BKFA 3SDLC 4G50A 5CHFA 2K8CA 4KSLC 3WAPA 2LWPA 1WMHA 4MM3A 5AZFA 2M1MA 4I6PA 2JF5A 2V3SA 4KIKA 1WFYA 2AYOB 3QIJA 3SD5A 3V6EB 2N9XA 3VFKA 4II2B 5LXHA 1C3TA 3B1LX 3NHEB 5E6OA 1KOTA 2MCNB 4EZLA 2WX0A 3QWZB 1J19A 2NPTB 1Z5SB 2ZPYA 2RGFA 4HK2A 3ZIMA 2LVOA 2LI5A 2BKRB 5J2RA 4DHZE 1NBFC 3OLMD 3VVWB 1WGRA 3OAWA 3KH0A 4TKNA 2CR5A 2KMCA 2KC1A 2I1JA 2G4SA 2KDBA 3L0WB 4G11A 1RAXA 1WIAA 4MELA 4MSMB 1F9JA 4WWNA 4ZRJA 3N30A 3RT3B 4F8CB 3MHSD 4FHJA 1GJZA 1E7VA 3L17A 1GUAB 3S2AA 1UGMA 1P98A 2FIDA 3CSTA 2BWES 1WX8A 2FAZA 2QHOA 3DBLI 3VH4B 5AEKB 5D7GA 1UBQA 4GU2A 4HLEA 5G2NA 1XD3B 3RD2A 3TIXA 2FCSA 4WQOB 4JIOU 1LM8B 1K8RB 3VUWA 4DWFA 3VDZA 2PPHA 2DYOA 2IO3B 2JT4B 2N1WA 3JVZX 4KZ0A 5BO4B 2O6VD 4E71A 1V80A 5JH5C 4JL9A 3N32A 4GOCA 5DPRA 4A3PA 2KQ7A 2ZCBA 1Q1OA 4HJKA 4HXDA 2RD0A 4W9FA 4AWJA 2KKCA 3QC8B 4ANWA 1M94A 4GXBA 4W9DA 4TQ0A 2MBBB 1YIWA 2D11A 2LD9A 2IZVB 2CS4A 4NAWB 5FR6A 1WR1A 2ZVOA 4AUQC 4NJ7A 1WGHA 2PE9A 1OEYA 1WM2A 2JZZA 1G6JA 3ZDTA 3Q3JA 2CHXA 3IHPC 3ZNHB 4IM2A 4PS7A 2KDFB 3AU5A 2GBMA 3C0RB 3HHMA 5DPWA 2LXAA 1AARA 2L05A 1WYWB 3KUZA 4BBNC 2PJHA 4NAWA 4HWIB 4LJPB 1VD2A 2DZKA 2KXJA 2O6VB 3D32A 3L13A 3VTVA 2MSED 4NJ6A 5IA7A 1WR6E 1YJ1A 2LGYA 4IUMB 3RCZA 4AOFA 3MTNB 3ZNID 2KANA 1Y8RC 3HM3A 4KV2A 2N1VA 2C9WB 2C7MB 4ANXA 4JLCA 4BKGA 3AXCA 4MGYE 3KW5B 3PPAA 2J0KA 2MA9B 1WXMA 1WJNA 2KD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJS A;  3VXW A;  3ZO5 B;  4AJY B;  2O6V A;  2YLM A;  1V6E A;  3RUL A;  1UBI A;  5G55 A;  2JRH A;  2O2V A;  2M4N A;  3U7D A;  2AWT A;  4WAA A;  3WAM A;  1V9J A;  1S3S G;  4HCN B;  3QJZ A;  1EO6 A;  1E5W A;  2IO1 B;  2N7E A;  3EFU A;  2KWC A;  1V86 A;  2BGF A;  2LXC A;  2N9P C;  3LJ3 A;  2W9N A;  1WX9 A;  4GGQ A;  2FNJ B;  3IBE A;  3KUC B;  2OJR A;  2C7H A;  3NZU A;  2KDI A;  3QK0 A;  3PV1 A;  2LAS A;  3QAQ A;  1E90 A;  1WJU A;  2BYV E;  3PTF C;  3P2B A;  3KVF B;  1FXT B;  4CYE A;  3L08 A;  4J6I A;  5GMV A;  4MSQ B;  1SGH A;  4RM8 A;  1WMH B;  3DBS A;  3ECI A;  5LXI B;  2KNB A;  3ZNG C;  4IWO A;  3R7R A;  4GSW A;  2KFK B;  1Q0W B;  4BKT A;  3L54 A;  4WJP A;  2C5L C;  2KWV B;  4FBJ B;  5D6J B;  3RZF A;  3ZUN A;  3T9L A;  4BKS A;  2NCN A;  2L00 B;  5JHB A;  2K25 A;  2XK5 B;  2PEA A;  1J0G A;  2KC2 A;  1WZ3 A;  4WJO A;  1BT0 A;  1VCB A;  1YX6 B;  1ZKH A;  2J7Q B;  2KFK A;  3HK0 A;  1I42 A;  4K7U A;  1ZGU B;  2GMI C;  2VRR B;  3PLU A;  4W9E A;  1WX7 A;  4FJY A;  4GMV A;  2KZR A;  1IP9 A;  1WF9 A;  5DPS A;  3CSF A;  4F7Z A;  1RRB A;  2A4Z A;  2L7R A;  2DZJ A;  3DBH I;  1WI0 A;  1R4M I;  4KDL B;  4W9H A;  2XK5 A;  2HE7 A;  2GBJ A;  1WXV A;  4DDG D;  1R4N I;  2DAF A;  3PRZ A;  2LGX A;  3AUL A;  4GDK A;  3KUD B;  2KVR A;  4FJZ A;  3RYT A;  2BF8 B;  3K9O B;  2ZJD A;  1CMX B;  3CF6 E;  1EF5 A;  2R2O A;  3W1S A;  3IFW B;  2AL6 A;  3PGE A;  5AZH A;  2J0J A;  1I35 A;  3UF8 A;  1WJ4 A;  1P1A A;  3NS8 A;  4IG7 B;  4KSK C;  5CHW A;  2KWU B;  3TJP A;  2KQS A;  5E6P A;  5D2M B;  1Z2M A;  4MDK E;  4K1R B;  3QCA A;  4DHZ B;  2ZNV C;  4IWQ A;  3SU8 X;  3TBL D;  2KX0 A;  4AP4 C;  4M8N A;  2RR9 A;  2MBH A;  3H7S A;  2KLC A;  2G4D B;  2MWS B;  1IPG A;  4IM0 A;  2GBR A;  3R66 C;  5C1Z A;  3UQA A;  2ZNV B;  2RSU A;  1NDD A;  4NPN A;  4PYZ A;  4ICU A;  1J8C A;  4LDT D;  4ANV A;  1TGZ B;  1E8X A;  3A4R A;  3BIN A;  2KTR B;  4GDL A;  2M0X A;  3V62 A;  4HPM B;  3PHW B;  3PRM B;  2MLB A;  2ZVN A;  4URK A;  5J18 A;  2KDE B;  3PLV A;  2GBN A;  3HM6 X;  1QZE A;  2NS5 A;  3A9J A;  4EKU A;  4EZJ A;  2Z0D B;  4BBN F;  1RFA A;  1WXA A;  1YX5 B;  4LCD E;  3ALB A;  3LDZ E;  1WXS A;  2YVC A;  4B95 A;  3QQ8 B;  3A1Q A;  2NR2 A;  2KTR A;  2LZ6 A;  1OEY J;  3NY5 A;  4K81 A;  1ISN A;  1HE8 A;  1PQS A;  2DEN B;  2KK8 A;  3PT2 B;  4MJS B;  2M8S A;  4N9F 4;  1SIF A;  3NOB A;  4NQK E;  1YD8 U;  2NVU I;  3ZW3 A;  2MW5 A;  3UQB A;  2CU1 A;  2O2V B;  3DOW A;  3N3K B;  4BKS D;  3VH3 B;  2CKH B;  2JWZ A;  4LDT B;  3R7Q A;  2LVQ A;  4EFO A;  2LRU A;  4I6N B;  2DX5 B;  3TCA A;  2MRP A;  3DQV A;  4A3O A;  2KJH B;  1LQB A;  2BYE A;  3APF A;  4BOZ B;  1OQY A;  2DZM A;  2FCM A;  5D94 A;  3APD A;  4NNJ B;  4FN2 A;  1RLF A;  3V6C B;  4CHK A;  1OGW A;  4ZRK A;  5CX3 A;  3GOE A;  4W9C A;  1UD7 A;  2Y5B B;  4IWP A;  2KTF A;  2LGD A;  2IO0 B;  1TZ1 A;  4G3X B;  1C1Y B;  2XEW A;  3Q3F A;  5TR5 A;  3H7P B;  4DDI D;  1TBE A;  4HDO A;  5KHO A;  4TV3 A;  1S1Q B;  2L3Z A;  2MP2 A;  4KVG B;  1KLV A;  2MBO A;  4MGK E;  1T0Y A;  1X1M A;  1MG8 A;  5AZG A;  3IG3 A;  4XX5 A;  3A33 B;  4WJN A;  2K8B A;  4GB9 A;  1L7Y A;  3VAW A;  3T8M A;  1XQQ A;  1YQB A;  2BWF A;  3A9K B;  3JW0 X;  2FIF A;  3ZTD A;  3DVN U;  3HIZ A;  2IYD B;  2WDT B;  4DHJ B;  3H7P A;  2M17 A;  1UEL A;  2ZPN A;  5J17 A;  3UIO B;  3V60 A;  3NZS A;  1L2N A;  2CHZ A;  2V4L A;  2WX1 A;  3JYU A;  1KM7 A;  3JSV A;  1ZW7 A;  4II3 B;  4MGI E;  5JHA A;  3PVL A;  5EDS A;  3M63 B;  4K7S A;  4K7W A;  3WAN A;  2ZEQ A;  4EOY A;  4JGH B;  4HPL B;  1E7U A;  3U8Z A;  3A9K A;  1V81 A;  3UIP B;  3I3T B;  3K9P B;  2L76 A;  4BOS C;  2KX3 A;  3ZRC A;  4KDI C;  3RUI B;  1WE7 A;  3W1S C;  2A5U A;  2L0T A;  2NBU A;  3DCG A;  4MEM A;  1JRU A;  1LXD A;  2GBK A;  2MBE A;  2C7N B;  2KMA A;  2UWQ A;  4IM3 A;  4GDK B;  2LJ5 A;  1UZX B;  1EF1 A;  1WJ6 A;  3X0W A;  3ZNZ B;  2KOX A;  2EMS A;  4DK5 A;  4FA6 A;  1WZ0 A;  1WE6 A;  3VUX A;  4WJQ A;  1LFD A;  4ICV A;  2L0F A;  3TL5 A;  2WWZ A;  4DBG A;  2IO2 B;  4X57 B;  2D10 A;  4E3C A;  3WA0 A;  3SHQ A;  4EEW A;  2N9E B;  4JQW C;  4NQL B;  4TUU A;  5CTR C;  2HJ8 A;  2DAJ A;  3M62 B;  2KFJ A;  4ZRI A;  4GN1 A;  2GOW A;  2NBV B;  2WYQ A;  3M95 A;  4WWP A;  2LUE A;  3VQI A;  2REX A;  1GNU A;  4G0N B;  2B3A A;  2MX2 A;  1EUV B;  2HTH A;  3L16 A;  3OJ3 A;  1GG3 A;  1WGY A;  2N7D A;  1H8C A;  3B0A A;  1V49 A;  4RMA A;  2D3G A;  1GC6 A;  5E6N A;  4GDL B;  2G45 B;  2FUH B;  1WGG A;  2MBQ A;  4W9L A;  2N4F A;  1TTN A;  3DBR I;  2ASQ A;  2MQJ A;  3B08 A;  3A9J B;  3EC8 A;  2UYZ B;  4TQ1 A;  1V5O A;  2NPT A;  2AEH A;  3A1Q B;  2J0M A;  2PE6 B;  3WAL A;  2HD5 B;  3VUY A;  1WRD B;  2K39 A;  4BFR A;  2IBI B;  3BY4 B;  4W9K A;  5JZE B;  2DZI A;  1XT9 B;  2L8J A;  4FHK A;  2JZ3 B;  4GIV A;  4IC7 B;  4LJO B;  4OVV A;  4W9I A;  1Q5W B;  4YL8 A;  3WAO A;  2EMT A;  3PSE B;  2XBB C;  3VHT C;  2D07 B;  3QAR A;  2JPH A;  3VTW A;  1E8Z A;  3QA8 A;  4EUT A;  3O65 B;  3OJ4 B;  2JXX A;  1WM3 A;  3DVG Y;  2D2Q A;  4W9G A;  4M0W B;  2JUO A;  4ZDV A;  1V2Y A;  2NBW B;  4P7I A;  3M3J A;  3ZLZ A;  3TMP B;  4MH0 E;  2V1Y A;  3RZW C;  3DDC B;  1U4A A;  4ANU A;  2R2Q A;  1P0R A;  2KO3 A;  3QX1 A;  5DCN A;  4HCP B;  4DXA B;  3KYC D;  4W9J A;  5CHV C;  3H9D A;  4MGZ E;  4PS3 A;  5C23 A;  2CHW A;  4XC2 A;  2BYF A;  1KJT A;  2BPS A;  4DHJ D;  3ZTC A;  4I6L B;  2DYB A;  3IVF A;  3W1Y A;  2MP2 B;  2Z0E B;  4FUL A;  4ASW C;  1GC7 A;  3PRP B;  3APC A;  2AL3 A;  2K8H A;  3A4S C;  2KLG A;  3EEC A;  4KZC A;  1NI2 A;  2JY6 A;  2C60 A;  3DVG X;  3PZD A;  4PYU A;  1E8Y A;  3ZDM C;  2FCN A;  3MJW A;  3DPD A;  3ZKJ C;  4IW0 A;  4PS8 A;  3DVN V;  1WGD A;  2IY0 B;  3UGB B;  4B6W A;  5L95 C;  5KHQ A;  3JSV B;  4RM9 A;  2Z59 B;  3ENE A;  4CO7 A;  5IAA C;  5DPT A;  2K1F A;  1V5T A;  2IY1 B;  3CMM B;  1SE9 A;  3R3M A;  3WIM A;  3VTU A;  4F1S A;  4NY0 A;  1WH3 A;  2G3Q B;  4WWO A;  4FLH A;  2RPQ A;  1IYF A;  2ZCC A;  4FAD A;  2KHW B;  3PRE A;  2KJ6 A;  4B9K A;  2I1K A;  3ML9 A;  1E8W A;  3UIN B;  3L10 B;  4AJW A;  3V61 A;  4A20 A;  5L83 A;  2JRI B;  3H6N A;  3U30 A;  3ZRF A;  3KYD D;  4ZYN A;  1WY8 A;  4HDQ A;  3ML8 A;  2K6Q A;  2KJR A;  4M8M A;  4HVB A;  3PHX B;  3PS6 A;  4EZK A;  1D3Z A;  2FCQ A;  1OTR B;  2LRW A;  2LVP A;  4KIK B;  2K6D B;  3EHV A;  2JVC A;  3AI5 A;  4XZ4 A;  2ZZP B;  1P3Q U;  5LLI A;  4BVU C;  5HKH A;  1A5R A;  3QHT A;  3H1U A;  1P9D U;  3AU4 A;  2DYM A;  2OOB B;  4OVU A;  3X23 A;  3ZVV A;  2KN5 A;  4FJV B;  3ONS A;  2EKE C;  4E74 A;  1UH6 A;  3GZN I;  1H4R A;  2DHZ A;  2BKF A;  3SDL C;  4G50 A;  5CHF A;  2K8C A;  4KSL C;  3WAP A;  2LWP A;  1WMH A;  4MM3 A;  5AZF A;  2M1M A;  4I6P A;  2JF5 A;  2V3S A;  4KIK A;  1WFY A;  2AYO B;  3QIJ A;  3SD5 A;  3V6E B;  2N9X A;  3VFK A;  4II2 B;  5LXH A;  1C3T A;  3B1L X;  3NHE B;  5E6O A;  1KOT A;  2MCN B;  4EZL A;  2WX0 A;  3QWZ B;  1J19 A;  2NPT B;  1Z5S B;  2ZPY A;  2RGF A;  4HK2 A;  3ZIM A;  2LVO A;  2LI5 A;  2BKR B;  5J2R A;  4DHZ E;  1NBF C;  3OLM D;  3VVW B;  1WGR A;  3OAW A;  3KH0 A;  4TKN A;  2CR5 A;  2KMC A;  2KC1 A;  2I1J A;  2G4S A;  2KDB A;  3L0W B;  4G11 A;  1RAX A;  1WIA A;  4MEL A;  4MSM B;  1F9J A;  4WWN A;  4ZRJ A;  3N30 A;  3RT3 B;  4F8C B;  3MHS D;  4FHJ A;  1GJZ A;  1E7V A;  3L17 A;  1GUA B;  3S2A A;  1UGM A;  1P98 A;  2FID A;  3CST A;  2BWE S;  1WX8 A;  2FAZ A;  2QHO A;  3DBL I;  3VH4 B;  5AEK B;  5D7G A;  1UBQ A;  4GU2 A;  4HLE A;  5G2N A;  1XD3 B;  3RD2 A;  3TIX A;  2FCS A;  4WQO B;  4JIO U;  1LM8 B;  1K8R B;  3VUW A;  4DWF A;  3VDZ A;  2PPH A;  2DYO A;  2IO3 B;  2JT4 B;  2N1W A;  3JVZ X;  4KZ0 A;  5BO4 B;  2O6V D;  4E71 A;  1V80 A;  5JH5 C;  4JL9 A;  3N32 A;  4GOC A;  5DPR A;  4A3P A;  2KQ7 A;  2ZCB A;  1Q1O A;  4HJK A;  4HXD A;  2RD0 A;  4W9F A;  4AWJ A;  2KKC A;  3QC8 B;  4ANW A;  1M94 A;  4GXB A;  4W9D A;  4TQ0 A;  2MBB B;  1YIW A;  2D11 A;  2LD9 A;  2IZV B;  2CS4 A;  4NAW B;  5FR6 A;  1WR1 A;  2ZVO A;  4AUQ C;  4NJ7 A;  1WGH A;  2PE9 A;  1OEY A;  1WM2 A;  2JZZ A;  1G6J A;  3ZDT A;  3Q3J A;  2CHX A;  3IHP C;  3ZNH B;  4IM2 A;  4PS7 A;  2KDF B;  3AU5 A;  2GBM A;  3C0R B;  3HHM A;  5DPW A;  2LXA A;  1AAR A;  2L05 A;  1WYW B;  3KUZ A;  4BBN C;  2PJH A;  4NAW A;  4HWI B;  4LJP B;  1VD2 A;  2DZK A;  2KXJ A;  2O6V B;  3D32 A;  3L13 A;  3VTV A;  2MSE D;  4NJ6 A;  5IA7 A;  1WR6 E;  1YJ1 A;  2LGY A;  4IUM B;  3RCZ A;  4AOF A;  3MTN B;  3ZNI D;  2KAN A;  1Y8R C;  3HM3 A;  4KV2 A;  2N1V A;  2C9W B;  2C7M B;  4ANX A;  4JLC A;  4BKG A;  3AXC A;  4MGY E;  3KW5 B;  3PPA A;  2J0K A;  2MA9 B;  1WXM A;  1WJN A;  2KD0 A; 
#chains in the Genus database with same CATH topology
 2O6V A;  1WYG A;  2QSD A;  4ARI A;  5G55 A;  2M4N A;  2BQQ A;  4WAA A;  4P1C C;  4M01 A;  1EO6 A;  1E5W A;  4NJC A;  2KWC A;  3ETR A;  4YTN B;  2IDY A;  1WSP A;  2JU6 X;  2LAS A;  1E90 A;  1WJU A;  4CYE A;  1I4G A;  3AEA B;  1SGH A;  5D3D A;  1WMH B;  2KNB A;  1A70 A;  3SFD B;  3ZNG C;  4P6V F;  3O13 A;  1MVK A;  1STE A;  2KFK B;  4BKT A;  3L54 A;  5D6J B;  3ZYY X;  4BKS A;  2NCN A;  1EM7 A;  1D5X C;  2MJD A;  2LHD A;  1L0V B;  1J0G A;  1VCB A;  1YX6 B;  1ZKH A;  2J7Q B;  1I42 A;  1HEZ E;  2GMI C;  3RNE C;  1RRB A;  1WI0 A;  1XF5 L;  1QOG A;  2HE7 A;  1SSN A;  4REZ A;  4RH6 A;  2LGX A;  3MC8 A;  4WAF A;  2GLS A;  2ZJD A;  5T8I A;  1DYQ A;  5AZH A;  2J0J A;  3GS2 A;  3UF8 A;  5E6P A;  1Z2M A;  2BS4 B;  3TBL D;  4AP4 C;  1HA5 A;  3TEX A;  2RR9 A;  1MJD A;  4XWT A;  1TY2 A;  5D3I B;  2GBR A;  4NPN A;  4ICU A;  1J8C A;  4LDT D;  4ANV A;  3MP9 A;  2KT7 A;  3PHW B;  2ZVN A;  4URK A;  5J18 A;  3PLV A;  2GBN A;  1QZE A;  2EEL A;  2NS5 A;  4EKU A;  5HHD G;  1WXS A;  2LUM A;  3A1Q A;  2NR2 A;  2KTR A;  3P4Q B;  2LZ6 A;  4ZHP A;  1OFF A;  1ISN A;  1HE8 A;  1PQS A;  2DEN B;  3PT2 B;  4XWW A;  4N9F 4;  2N9K A;  3NS1 A;  2NVU I;  2CKH B;  3R7Q A;  2LVQ A;  1J7A A;  2ON8 A;  4I6N B;  2DX5 B;  2MRP A;  2KJH B;  1LQB A;  5FKA C;  2AQ1 B;  4DQO C;  2ZW1 A;  1L0Y B;  2W3R A;  1UWX A;  3V6C B;  3GOE A;  1D4B A;  4IWP A;  2KTF A;  2IO0 B;  3AE4 B;  5C3J B;  1TBE A;  3NRZ A;  1S1Q B;  2MP2 A;  1L6U A;  1KLV A;  2MBO A;  1I4H A;  1SEB D;  1T0Y A;  1X1M A;  3RMK C;  4XX5 A;  3A33 B;  2KAC A;  4WJN A;  2K8B A;  4JWS C;  3T8M A;  1XQQ A;  1YQB A;  4XGA B;  3HIZ A;  2IYD B;  2WDT B;  5H8Y E;  5BMH A;  5C2T B;  2K5P A;  3GE3 C;  1EU3 A;  3JYU A;  4YWG G;  4MGI E;  3PVL A;  5EDS A;  4K7S A;  1TS2 A;  4JGH B;  3A9K A;  1V81 A;  4WUR A;  2BB6 A;  2KX3 A;  3ZRC A;  1WE7 A;  3EFC A;  2A5U A;  2GBK A;  2LJ5 A;  1WJ6 A;  1EF1 A;  2INN E;  2J53 A;  2PVG C;  1C78 A;  1WZ0 A;  1WE6 A;  2BS2 B;  3L4P A;  1LFD A;  4DBG A;  1SE4 A;  2D10 A;  3WA0 A;  4JQW C;  4NQL B;  4TUU A;  2BS3 B;  2HJ8 A;  1WGK A;  4WIP A;  4ZRI A;  2KFJ A;  3M95 A;  2WYQ A;  4WWP A;  2LUE A;  3VQI A;  4G0N B;  4RGO S;  1YQ3 B;  1V49 A;  4ITK A;  2L32 A;  1MPE A;  4W9L A;  3MHZ A;  1TTN A;  2G9H D;  2MQJ A;  3R2I A;  3EC8 A;  2UYZ B;  2AEH A;  4L23 A;  1TKY A;  4BFR A;  2WU2 B;  2IBI B;  4WWM A;  1XT9 B;  4OVZ A;  2JZ3 B;  4OZC A;  1Q5W B;  2EMT A;  2ONQ A;  1FO4 A;  1E8Z A;  1FM0 D;  2JXX A;  1V2Y A;  2NBW B;  2BT6 A;  4MH0 E;  3RZW C;  1PDX A;  3Q2A C;  4ANU A;  2R2Q A;  3I57 A;  3KWV A;  5DCN A;  4XC2 A;  3LB8 C;  2MJ3 A;  3IVF A;  1C4C A;  2Z0E B;  1GC7 A;  2AL3 A;  3N20 C;  1EU4 A;  3W5U B;  1ZE3 D;  3UI3 A;  2JY6 A;  2C60 A;  1YJJ A;  1VZ7 A;  3ZDM C;  3NG0 A;  3HUI A;  4PS8 A;  1WGD A;  2KYW A;  5HI1 A;  3JSV B;  1FXA A;  4L2Y A;  2N7J A;  5DPT A;  1V5T A;  2IY1 B;  3NZ3 A;  4LNI A;  3WIM A;  1V1O A;  2KDM A;  4FLH A;  1HTQ A;  2KHW B;  3PRE A;  4JE3 B;  4B9K A;  1E8W A;  3CIR B;  3T3N A;  2WXO A;  1N63 A;  2W3S A;  5HFY A;  3U30 A;  2GB1 A;  1WY8 A;  3ML8 A;  1KTK A;  3PHX B;  1ET9 A;  3RNF C;  4S17 A;  2FCQ A;  1C4P A;  2LRW A;  3B2G A;  4KIK B;  5LLI A;  1A5R A;  1CZP A;  3SR6 A;  4LNF A;  1M4V A;  3ONS A;  1UH6 A;  1IGC A;  2LWP A;  2RPV A;  4A9A A;  2JF5 A;  3VFK A;  2N9X A;  3AE9 B;  1KOT A;  1ENF A;  2RGF A;  4HK2 A;  3ZIM A;  2LI5 A;  4YT0 B;  4RGT A;  4DHZ E;  4UDU C;  2QC8 A;  4TKN A;  2I1J A;  5AUK A;  1T5X D;  1DOY A;  4MSM B;  1F9J A;  4WWN A;  3AEE B;  4F8C B;  3MHS D;  1ZDV A;  4HLE A;  4JIO U;  1JW9 D;  3GB1 A;  1IUE A;  2NMQ A;  5JH5 C;  3PZ7 A;  2KQ7 A;  3U52 E;  3QC8 B;  2WDV B;  2ZVO A;  1HZ6 A;  3RNC C;  4NZL B;  1GB4 A;  2JZZ A;  2KQ4 X;  3Q3J A;  3ZNH B;  2GBM A;  3WCQ A;  1AN8 A;  3IXS A;  4HWI B;  2O6V B;  3VTV A;  1I7H A;  1HXY D;  3ZNI D;  2C9W B;  1E10 A;  2OED A;  4ANX A;  4BKG A;  4GLS C;  1C77 A;  1P7E A;  4N6E B;  1WJN A;  5JHA A;  4MJS A;  1GAQ B;  4AJY B;  2YLM A;  4RF0 A;  3U4E G;  4FXC A;  1C9F A;  2JRH A;  1SIJ A;  1K53 A;  4US9 A;  2BYT A;  2X38 A;  1P7F A;  2IO1 B;  2N7E A;  3PTF C;  3EFU A;  2BGF A;  5HG2 A;  3BZD B;  1QKZ A;  3PO0 A;  2BTE A;  2WNM A;  2K3U A;  3HVZ A;  2KDI A;  3NZU A;  2DBY A;  2VZK D;  3P2B A;  1JQ4 A;  3KVF B;  1XCQ L;  4J6I A;  2OJW A;  4MSQ B;  1J7C A;  4MM3 B;  2WXH A;  2YEP B;  3ZUN A;  4ZHO A;  2PEA A;  2KAJ A;  3MC9 A;  1BT0 A;  3AEB B;  1SXT A;  3HK0 A;  2VRR B;  1WX7 A;  4GMV A;  1IP9 A;  2KZR A;  1WF9 A;  3Q8B A;  4HEA 1;  2GBJ A;  1WXV A;  3OG5 A;  4DDG D;  2DAF A;  3AUL A;  4LTU A;  3U2S C;  4XDC A;  3K9O B;  1EF5 A;  4USA A;  3W1S A;  3NVY A;  3PGE A;  1I35 A;  2V3P A;  1P1A A;  4KSK C;  3LYY A;  3TJP A;  5IP4 D;  4MDK E;  4K1R B;  3QCA A;  1XO3 A;  2WXJ A;  2KX0 A;  1UF0 A;  4IKG A;  3AE3 B;  1IPG A;  3R66 C;  2QCZ A;  2RSU A;  4WQM A;  3FC4 A;  3A4R A;  3BIN A;  2KTR B;  2BBC A;  4HPM B;  2MLB A;  1FNV A;  2V4I B;  2MHJ A;  3U7Z A;  2Z0D B;  5H92 C;  4BBN F;  1RFA A;  4LCD E;  2L83 A;  3ALB A;  1ZUD 2;  3NY5 A;  1JWM D;  1GB1 A;  1KF6 B;  3ZW3 A;  4C4V A;  2RDB C;  2MW5 A;  2O2V B;  3N3K B;  4BKS D;  1UGJ A;  3VH3 B;  4LDT B;  3ZJT A;  4EFO A;  3TCA A;  2D3C A;  3DQV A;  1OQY A;  2J42 A;  1PYW D;  1FEH A;  4LLG M;  3APD A;  1YMH E;  4ZRK A;  4C7Z A;  2MEK A;  2CJN A;  4LNN A;  3Q3F A;  3ZXR A;  1T6B X;  1T0S C;  1TS3 A;  4MAC A;  3KQ4 A;  1L4D B;  1QOA A;  5AZG A;  5LNK 1;  1EWY C;  4LNO A;  1DGJ A;  1L7Y A;  3Q14 C;  3A9K B;  1IBX A;  1PGA A;  2AX5 A;  2M17 A;  1UEL A;  5J17 A;  3V60 A;  3NZS A;  2CHZ A;  2D3B A;  4K7W A;  4ZRQ A;  2ZEQ A;  4HPL B;  4ARC A;  3MC0 B;  3UIP B;  1F1H A;  2L76 A;  3FIL B;  4MEM A;  2C7N B;  4N59 A;  2KMA A;  2UWQ A;  4GDK B;  4PK1 A;  3X0W A;  3B9J A;  2EMS A;  2QMT A;  4WJQ A;  2IO2 B;  2H88 B;  3AN1 A;  2V3N A;  5CTR C;  3C19 A;  3SFE B;  3T3O A;  5EE3 A;  2JSV X;  2XN9 C;  4EE2 A;  4OHJ A;  2MX2 A;  1EUV B;  2HTH A;  3OJ3 A;  1H8C A;  3BK2 A;  4GDL B;  1QOF A;  1T3Q A;  2G45 B;  2LJI A;  2GRI A;  3B08 A;  3A9J B;  1K51 A;  1TS4 A;  4N58 A;  3VUY A;  4W9K A;  4GIV A;  4FHK A;  4LJO B;  3ZJU A;  2MJE A;  5MPO A;  1FCC C;  1R7S A;  2FE8 A;  2D07 B;  3RFZ B;  2WXF A;  3QA8 A;  2PLP A;  3O65 B;  3DVG Y;  1WM3 A;  2QDF A;  4W9G A;  4M0W B;  2JUO A;  4P7I A;  3TUO A;  4C80 A;  4HRS A;  3DDC B;  3BYT B;  3NJT A;  2IND C;  3AEC B;  4DXA B;  3KYC D;  4W9J A;  4MGZ E;  2CHW A;  2DLB A;  4CQN A;  4MT5 A;  4XE0 A;  1KJT A;  2BPS A;  3ZTC A;  1XXG A;  3W1Y A;  1TS5 A;  5AUI A;  4FUL A;  4ASW C;  5BYS A;  3APC A;  4A90 A;  1VJK A;  1E8Y A;  1E7P B;  1D6E C;  3DVN V;  1XLP A;  3AE6 B;  2ACZ B;  3GE8 C;  5KHQ A;  2WP9 B;  1YQ4 B;  3CMM B;  1YNT E;  3VTU A;  1F52 A;  1WH3 A;  2G3Q B;  4WWO A;  2KJ6 A;  2MH7 A;  2W54 A;  3KYD D;  4DXG A;  4HDQ A;  2KJR A;  4M8M A;  4HVB A;  2GI9 A;  3PS6 A;  4EZK A;  2IPK D;  2PVO D;  3RI7 C;  1P3Q U;  4B0M A;  4XDD A;  3DBH B;  3AU4 A;  2DYM A;  2WXG A;  1EWC A;  4FJV B;  2EKE C;  2M19 A;  4KSL C;  3WAP A;  1CK1 A;  1WMH A;  1TYG B;  5AZF A;  3SD5 A;  5FK9 C;  2LMC A;  4II2 B;  3R2T A;  3NHE B;  2WX0 A;  2NPT B;  2ZPY A;  2LVO A;  2BKR B;  5EE9 A;  3OLM D;  3HVD A;  3VVW B;  2CR5 A;  1TY0 A;  3KWL A;  3L0W B;  4G11 A;  1RAX A;  3GP7 A;  3N30 A;  3RT3 B;  1E7V A;  1L4Z B;  3S2A A;  4ZYS A;  1NYR A;  4XYC A;  2QEJ C;  4GU2 A;  4A6Q A;  4ACF A;  3TIX A;  4J3O D;  2PW9 A;  4WQO B;  3RD2 A;  1HQR D;  4DWF A;  1I4R A;  3I63 C;  1JRO A;  2IO3 B;  2N1W A;  3JVZ X;  4KZ0 A;  3B2F A;  3Q3N C;  1D5M C;  4JL9 A;  2WXK A;  2K0P A;  2ZCB A;  1FFU A;  4W9F A;  2KKC A;  3DWM A;  4GXB A;  4W9D A;  3LXF A;  1YIW A;  2LD9 A;  2WHI A;  1C79 A;  5FR6 A;  1SF0 A;  1WGH A;  1WM2 A;  2JWU A;  3ZDT A;  2CHX A;  4IM2 A;  2QJL A;  5IO9 A;  2KDF B;  3AU5 A;  4KX6 B;  2DWQ A;  3C0R B;  1V1P B;  1WYW B;  2PJH A;  3V05 A;  3L13 A;  2MSE D;  3AE1 B;  1ZXI A;  4IUM B;  3Q3O C;  1D5Z C;  2KAN A;  1Y8R C;  3HM3 A;  2C7M B;  1MI0 A;  4JLC A;  3AXC A;  4MGY E;  2J0K A;  3EA6 A;  2NTT A;  3ZO5 B;  1F2R C;  2Y3A A;  2AWT A;  3WAM A;  4ZRP A;  1V9J A;  4HCN B;  3QJZ A;  2LXC A;  1V86 A;  2N9P C;  4M02 A;  3LJ3 A;  2W9N A;  1WX9 A;  3IBE A;  2OJR A;  1L5P A;  2C7H A;  3QK0 A;  2OHF A;  3PV1 A;  2BYV E;  1FXT B;  1HTO A;  3I5J C;  4RM8 A;  2WDQ B;  1TJE A;  3R7R A;  1YOV B;  4WJP A;  1F2R I;  4FBJ B;  5JXV A;  2K25 A;  1YN5 A;  1SBB B;  1XLO A;  2KC2 A;  3AE2 B;  1TKE A;  4HKQ A;  3AE8 B;  4K7U A;  1ZGU B;  4FJY A;  1KFY B;  1FCL A;  4F7Z A;  2L7R A;  2DZJ A;  3Q6B A;  2VZK B;  3DBH I;  3Q69 A;  4KDL B;  4W9H A;  2IGG A;  2XK5 A;  2INC C;  1E0Z A;  1FD6 A;  3PRZ A;  4FJZ A;  3RYT A;  2BF8 B;  1ZXH A;  1OQR A;  1CMX B;  2D5G A;  3CF6 E;  3ZGZ A;  2R2O A;  1RFK A;  3NS8 A;  3DBL B;  4IG7 B;  2KWU B;  1V97 A;  2KQS A;  5D2M B;  1B1Z A;  4DHZ B;  2ZNV C;  3R8B A;  1FFV A;  2MBH A;  3H7S A;  2KLC A;  2G4D B;  2WXN A;  3AH7 A;  3P1M A;  3UQA A;  4PYZ A;  1XLQ A;  3V62 A;  2BB5 A;  2M0X A;  3PRM B;  3VRA B;  2KDE B;  3BII D;  3HM6 X;  3BVZ A;  5IOI A;  5G5G A;  1K50 A;  2LGI A;  1YX5 B;  3DHH C;  3LDZ E;  2YVC A;  1VLB A;  4HRO A;  1OEY J;  2VH2 A;  3ABV B;  3N9Y C;  4K81 A;  4KGS A;  3IAM 1;  1XCT L;  2KK8 A;  2M8S A;  3NOB A;  4NQK E;  1YD8 U;  1FIQ A;  3EGR A;  4Q2J A;  3Q3M C;  3DOW A;  2LRU A;  4A3O A;  2BYE A;  2FBW B;  1PGB A;  4KGT A;  4FN2 A;  1RLF A;  4CHK A;  1OGW A;  1DOI A;  1TZ1 A;  2J4X A;  5TR5 A;  2XEW A;  3BVM A;  1RWS A;  5KHO A;  2L1A A;  2L3Z A;  4JWU C;  2EKI A;  3VAW A;  2BWF A;  2LGS A;  3JW0 X;  3DVN U;  2K9X A;  3VRB B;  3NVV A;  3H7P A;  3UIO B;  2WX1 A;  1KM7 A;  3JSV A;  1ZW7 A;  1JWU D;  4II3 B;  3M63 B;  4DXF A;  3WAN A;  4EOY A;  1E7U A;  3GZN B;  3U8Z A;  2RDH A;  3I3T B;  3K9P B;  1L6V A;  3V3X A;  4KDI C;  3RUI B;  3W1S C;  3DCG A;  1JRU A;  2BW2 A;  2MBE A;  4OZA A;  3EUB 2;  3ZNZ B;  1UZX B;  2BVC A;  4JPS A;  1SE2 A;  4A8X C;  3VUX A;  3TEW A;  2LHE A;  4HKZ E;  3TL5 A;  1TKG A;  1L0X B;  4X57 B;  3SEB A;  1FXI A;  3N1X C;  3M62 B;  4GN1 A;  2L52 A;  2GOW A;  2NBV B;  3H8H A;  3N1Z C;  3RN9 C;  2REX A;  2B3A A;  1WGY A;  2N7D A;  2JXT A;  2WS3 B;  1GC6 A;  1VR9 A;  2FUG 1;  1WGG A;  5BMI A;  2MBQ A;  1MHX A;  4HJG E;  1AWD A;  1ZOY B;  1I4Q A;  4TQ1 A;  1V5O A;  4A55 A;  1KRH A;  1RYJ A;  3ZXV A;  3A1Q B;  2J0M A;  1KLU D;  1OQQ A;  4C00 A;  5JZE B;  2L8J A;  4OVV A;  2R61 A;  3WAO A;  4YL8 A;  3QAR A;  2PIA A;  2JPH A;  1JWB D;  3VTW A;  3RNB C;  4EUT A;  2D2Q A;  3CWI A;  3VR8 B;  2WU5 B;  4ZDV A;  3TMP B;  3W2D A;  1U4A A;  5BYQ A;  1P0R A;  2KO3 A;  3QX1 A;  1SE3 A;  4HCP B;  3Q8F A;  5CHV C;  2BYF A;  4RGN A;  1FNW A;  3W9C B;  4I6L B;  3IT4 B;  2HJ1 A;  2MP2 B;  3N1Y C;  3PRP B;  1BML C;  2K8H A;  3A4S C;  2WXQ A;  3EEC A;  4MH8 A;  1NI2 A;  4ZOH C;  4PYU A;  1N5W A;  1IGD A;  2FCN A;  1UWM A;  3MJW A;  3DPD A;  3ZKJ C;  4IW0 A;  2IY0 B;  4B6W A;  1F77 A;  4QAY A;  3URY A;  2YEP F;  4CO7 A;  3ENE A;  1MHH E;  1KLG D;  1SE9 A;  3R3M A;  4F1S A;  4NY0 A;  1E9M A;  2W82 A;  4YSZ B;  2WQY B;  3C8Y A;  1IYF A;  4AS1 A;  3MJ5 A;  2I1K A;  3ML9 A;  2WXI A;  3UIN B;  4AJW A;  3V61 A;  4A20 A;  3NVZ A;  5IN7 A;  4ZYN A;  2K6Q A;  3EHV A;  2X8X X;  4XZ4 A;  5HKH A;  2G1E A;  3QHT A;  3AV8 A;  3H1U A;  1R4M B;  4D2K A;  2OOB B;  4OVU A;  3X23 A;  2KN5 A;  1MFW A;  1QT9 A;  1QOB A;  3OWE B;  4E74 A;  1R4N B;  3DHI C;  2V0G A;  2N0S B;  3GZN I;  2DHZ A;  2BKF A;  4TMA B;  3SDL C;  5CHF A;  2K8C A;  4MM3 A;  2V3S A;  3RPF C;  3Q8E A;  3QIJ A;  2MCN B;  3I9V 1;  5EE0 A;  3QWZ B;  1HZ5 A;  1J7B A;  1ET6 A;  3DWG C;  1NBF C;  4KKJ A;  1WGR A;  4RFB A;  2KDB A;  2RMM A;  4MEL A;  4L1B A;  1ZPS A;  1YN3 A;  1GUA B;  3CST A;  2JQR B;  2BWE S;  1WX8 A;  2TSS A;  3BK1 A;  2FAZ A;  1N60 A;  5D7G A;  1UBQ A;  5G2N A;  4US8 A;  1XD3 B;  1WWT A;  2FCS A;  4C56 C;  1LM8 B;  1K8R B;  3E56 A;  3VUW A;  2I38 A;  3VDZ A;  2PPH A;  2JT4 B;  2SAK A;  2JX5 A;  1V80 A;  2WLB A;  4HJK A;  2RD0 A;  4NAM A;  5GXG B;  1M94 A;  2JYT A;  4KKI A;  1PFD A;  1B9R A;  2CU3 A;  1WR1 A;  1LO5 D;  2PE9 A;  3W5V B;  2M56 B;  4WH4 A;  1G6J A;  1ZDX A;  3IHP C;  4PS7 A;  1AAR A;  2UU7 A;  2L05 A;  3ZJV A;  1JWA D;  3KUZ A;  4NAW A;  1GPX A;  4LJP B;  2DZK A;  2KXJ A;  5IA7 A;  4NJ6 A;  1WR6 E;  1YJ1 A;  2LGY A;  3P42 A;  4RCO A;  4AOF A;  1V8C A;  4KV2 A;  2N1V A;  5IKC M;  1F0Z A;  4K3C A;  3PPA A;  1WXM A;  3VXW A;  4AQ7 A;  1V6E A;  3RUL A;  1UBI A;  3U7D A;  1K52 A;  2O2V A;  1NVI D;  1NEK B;  1S3S G;  2WXR A;  3HRD D;  4GGQ A;  2FNJ B;  1ZP0 B;  3KUC B;  3P4S B;  4S0R A;  1SJH D;  2PTL A;  3QAQ A;  3L08 A;  5GMV A;  3DBS A;  3ECI A;  5LXI B;  1VZ6 A;  4IWO A;  4GSW A;  3FKY A;  5TSS A;  1Q0W B;  1AYF A;  5I4D A;  2C5L C;  2KWV B;  3RZF A;  1BUI C;  3T9L A;  3FAH A;  2L00 B;  5JHB A;  2XK5 B;  3BWU D;  3P4P B;  1WZ3 A;  4WJO A;  3AED B;  2KFK A;  3BVG A;  3PLU A;  2WDR B;  4W9E A;  2Y5C A;  5DPS A;  3CSF A;  2A4Z A;  1C76 A;  1PGX A;  1R4M I;  1LGR A;  3AM9 A;  3FIL A;  5E6J A;  2IGD A;  3DBR B;  1R4N I;  4GDK A;  4YTP B;  3KUD B;  2KVR A;  1I4X A;  3AE7 B;  2WXM A;  1VDV A;  3IFW B;  3P4R B;  2AL6 A;  1XLN A;  1WJ4 A;  3J9C A;  4P16 A;  5CHW A;  1E6E B;  3BYY B;  4IWQ A;  3SU8 X;  4M8N A;  2W55 A;  1Y56 A;  1SJE D;  2MWS B;  4IM0 A;  5C1Z A;  2ZNV B;  1NDD A;  1QIL A;  1TGZ B;  1E8X A;  4GDL A;  1VRA B;  4OZB A;  2PKO A;  1JRP A;  3A9J A;  4JX1 C;  4EZJ A;  1WXA A;  1N5X A;  4B95 A;  2HDE A;  3QQ8 B;  2AQ2 B;  3AEG B;  4MJS B;  1SIF A;  2KMM A;  4YSX B;  5EE1 A;  1QLB B;  3UQB A;  2CU1 A;  4TSS A;  2JWZ A;  4M0W A;  1NI3 A;  3APF A;  4BOZ B;  1WXQ A;  2Q5W D;  2DZM A;  2FCM A;  5D94 A;  4NNJ B;  2IJ0 A;  5CX3 A;  1TZO A;  1FMA D;  1UD7 A;  4W9C A;  2Y5B B;  3TSS A;  2B76 B;  1NYQ A;  2LGD A;  4G3X B;  1C1Y B;  1SB3 C;  4DDI D;  3H7P B;  4HDO A;  4TV3 A;  4KVG B;  4MGK E;  1MG4 A;  1MG8 A;  3IG3 A;  3NUH B;  4GB9 A;  4YXD B;  1AW7 A;  2FIF A;  3Q8C A;  3AB5 A;  3ZTD A;  4DHJ B;  1DOX A;  2ZPN A;  1L2N A;  2V4L A;  4BAX A;  2PMV A;  1ACC A;  4BOS C;  2JYE A;  2NBU A;  2L0T A;  1LXD A;  4IM3 A;  2KOX A;  4DK5 A;  4FA6 A;  4ICV A;  2D3A A;  1FRR A;  2JZP A;  2L0F A;  2WWZ A;  4E3C A;  3SHQ A;  4EEW A;  2N9E B;  2NTS A;  2DAJ A;  3RNG C;  3Q8A A;  1T0R C;  5G5H A;  1GNU A;  4LNK A;  3L16 A;  1GG3 A;  2ZW0 A;  3B0A A;  4RMA A;  2D3G A;  2DNF A;  5E6N A;  4B0E A;  2FUH B;  1XEE A;  2N4F A;  1WRI A;  3DBR I;  2ASQ A;  1ESF A;  3NVW A;  2NPT A;  2PE6 B;  3WAL A;  2HD5 B;  1WRD B;  2K39 A;  3BY4 B;  3MFG A;  2QIL A;  2DZI A;  4C7Y A;  4IC7 B;  4W9I A;  2E3T A;  3PSE B;  2XBB C;  3VHT C;  4C4V B;  2INP E;  3OJ4 B;  1JCK B;  2AQ3 B;  3M3J A;  3ZLZ A;  4KGR A;  2V1Y A;  4RNA A;  4HPP A;  1JAL A;  1QF6 A;  5BMG A;  3H9D A;  4PS3 A;  5C23 A;  1UUP A;  2IGH A;  1CJE A;  4DHJ D;  2WXP A;  2DYB A;  4R3D A;  1FRD A;  1YJI A;  2WGS A;  1N6Z A;  1T0Q C;  2KLG A;  4KZC A;  3DVG X;  3TEZ A;  3PZD A;  4K3B A;  2K22 A;  1N62 A;  1IBX B;  4BZA A;  3IAS 1;  4O1N A;  3UGB B;  5L95 C;  4RM9 A;  2Z59 B;  2LEK A;  1V1P A;  5IAA C;  2Y5P A;  2K1F A;  4M00 A;  2HTM E;  3RNA C;  4YSY B;  2RPQ A;  1N61 A;  3TEY A;  2ZCC A;  4FAD A;  1I4P A;  3L10 B;  5L83 A;  1JWS D;  2JRI B;  3H6N A;  2I2Y A;  4H2A A;  3ZRF A;  1KH0 A;  1D3Z A;  2Z8L A;  3DHG C;  1OTR B;  3AEF B;  2LVP A;  2K6D B;  1FPY A;  2JVC A;  3AI5 A;  2ZZP B;  4BVU C;  1P9D U;  1TIF A;  1ROE A;  5BYR A;  2VH1 A;  3ZVV A;  2RDG A;  5FR3 A;  1H4R A;  4G50 A;  2KVZ A;  2M1M A;  4I6P A;  4KIK A;  1WFY A;  2AYO B;  3V6E B;  5LXH A;  2KWD A;  1C3T A;  3B1L X;  5E6O A;  4EZL A;  4LK0 M;  1J19 A;  1Z5S B;  2KN4 A;  3IT6 B;  4P1B C;  3AMZ A;  3VR9 B;  3ZQ4 A;  5J2R A;  1UNS A;  3OAW A;  3KH0 A;  2KMC A;  2KC1 A;  2G4S A;  1WIA A;  4PT5 A;  4ZRJ A;  1PUT A;  4YTM B;  1GJZ A;  4FHJ A;  3L17 A;  2H89 B;  1BXT A;  1UGM A;  1NEN B;  1P98 A;  2FID A;  2XNA C;  2M0A A;  2QHO A;  3DBL I;  3VH4 B;  5AEK B;  2LFI A;  2CJO A;  1FNU A;  3PZ8 A;  2ICI A;  2DYO A;  5BO4 B;  3P63 A;  1GOZ A;  2O6V D;  4E71 A;  4IDI A;  3N32 A;  4GOC A;  5DPR A;  4A3P A;  2J52 A;  1JML A;  1Q1O A;  1VZ8 A;  4HXD A;  4AWJ A;  4ANW A;  1Q10 A;  2SEB D;  4TQ0 A;  2MBB B;  2D11 A;  1CQV A;  4RGM A;  2IZV B;  2CS4 A;  4NAW B;  1C4A A;  4AUQ C;  4NJ7 A;  4RF1 A;  1OEY A;  2WXL A;  4OW0 A;  3KLS X;  3HHM A;  5DPW A;  4IOI E;  2LXA A;  1YN4 A;  4BBN C;  2QIE B;  1QQR A;  1VD2 A;  3D32 A;  1RM6 C;  3RCZ A;  3MTN B;  2V9H A;  3E9S A;  1TT5 B;  3AE5 B;  2E6X A;  2N9L A;  3KW5 B;  2MA9 B;  2KD0 A; 
#chains in the Genus database with same CATH homology
 4MJS A;  3VXW A;  3ZO5 B;  4AJY B;  2O6V A;  2YLM A;  1V6E A;  3RUL A;  1UBI A;  5G55 A;  2JRH A;  2O2V A;  2M4N A;  3U7D A;  2AWT A;  4WAA A;  3WAM A;  1V9J A;  1S3S G;  4HCN B;  3QJZ A;  1EO6 A;  1E5W A;  2IO1 B;  2N7E A;  3EFU A;  2KWC A;  1V86 A;  2BGF A;  2LXC A;  2N9P C;  3LJ3 A;  2W9N A;  1WX9 A;  4GGQ A;  2FNJ B;  3IBE A;  3KUC B;  2OJR A;  2C7H A;  3NZU A;  2KDI A;  3QK0 A;  3PV1 A;  2LAS A;  3QAQ A;  1E90 A;  1WJU A;  2BYV E;  3PTF C;  3P2B A;  3KVF B;  1FXT B;  4CYE A;  3L08 A;  4J6I A;  5GMV A;  4MSQ B;  1SGH A;  4RM8 A;  1WMH B;  3DBS A;  3ECI A;  5LXI B;  2KNB A;  3ZNG C;  4IWO A;  3R7R A;  4GSW A;  2KFK B;  1Q0W B;  4BKT A;  3L54 A;  4WJP A;  2C5L C;  2KWV B;  4FBJ B;  5D6J B;  3RZF A;  3ZUN A;  3T9L A;  4BKS A;  2NCN A;  2L00 B;  5JHB A;  2K25 A;  2XK5 B;  2PEA A;  1J0G A;  2KC2 A;  1WZ3 A;  4WJO A;  1BT0 A;  1VCB A;  1YX6 B;  1ZKH A;  2J7Q B;  2KFK A;  3HK0 A;  1I42 A;  4K7U A;  1ZGU B;  2GMI C;  2VRR B;  3PLU A;  4W9E A;  1WX7 A;  4FJY A;  4GMV A;  2KZR A;  1IP9 A;  1WF9 A;  5DPS A;  3CSF A;  4F7Z A;  1RRB A;  2A4Z A;  2L7R A;  2DZJ A;  3DBH I;  1WI0 A;  1R4M I;  4KDL B;  4W9H A;  2XK5 A;  2HE7 A;  2GBJ A;  1WXV A;  4DDG D;  1R4N I;  2DAF A;  3PRZ A;  2LGX A;  3AUL A;  4GDK A;  3KUD B;  2KVR A;  4FJZ A;  3RYT A;  2BF8 B;  3K9O B;  2ZJD A;  1CMX B;  3CF6 E;  1EF5 A;  2R2O A;  3W1S A;  3IFW B;  2AL6 A;  3PGE A;  5AZH A;  2J0J A;  1I35 A;  3UF8 A;  1WJ4 A;  1P1A A;  3NS8 A;  4IG7 B;  4KSK C;  5CHW A;  2KWU B;  3TJP A;  2KQS A;  5E6P A;  5D2M B;  1Z2M A;  4MDK E;  4K1R B;  3QCA A;  4DHZ B;  2ZNV C;  4IWQ A;  3SU8 X;  3TBL D;  2KX0 A;  4AP4 C;  4M8N A;  2RR9 A;  2MBH A;  3H7S A;  2KLC A;  2G4D B;  2MWS B;  1IPG A;  4IM0 A;  2GBR A;  3R66 C;  5C1Z A;  3UQA A;  2ZNV B;  2RSU A;  1NDD A;  4NPN A;  4PYZ A;  4ICU A;  1J8C A;  4LDT D;  4ANV A;  1TGZ B;  1E8X A;  3A4R A;  3BIN A;  2KTR B;  4GDL A;  2M0X A;  3V62 A;  4HPM B;  3PHW B;  3PRM B;  2MLB A;  2ZVN A;  4URK A;  5J18 A;  2KDE B;  3PLV A;  2GBN A;  3HM6 X;  1QZE A;  2NS5 A;  3A9J A;  4EKU A;  4EZJ A;  2Z0D B;  4BBN F;  1RFA A;  1WXA A;  1YX5 B;  4LCD E;  3ALB A;  3LDZ E;  1WXS A;  2YVC A;  4B95 A;  3QQ8 B;  3A1Q A;  2NR2 A;  2KTR A;  2LZ6 A;  1OEY J;  3NY5 A;  4K81 A;  1ISN A;  1HE8 A;  1PQS A;  2DEN B;  2KK8 A;  3PT2 B;  4MJS B;  2M8S A;  4N9F 4;  1SIF A;  3NOB A;  4NQK E;  1YD8 U;  2NVU I;  3ZW3 A;  2MW5 A;  3UQB A;  2CU1 A;  2O2V B;  3DOW A;  3N3K B;  4BKS D;  3VH3 B;  2CKH B;  2JWZ A;  4LDT B;  3R7Q A;  2LVQ A;  4EFO A;  2LRU A;  4I6N B;  2DX5 B;  3TCA A;  2MRP A;  3DQV A;  4A3O A;  2KJH B;  1LQB A;  2BYE A;  3APF A;  4BOZ B;  1OQY A;  2DZM A;  2FCM A;  5D94 A;  3APD A;  4NNJ B;  4FN2 A;  1RLF A;  3V6C B;  4CHK A;  1OGW A;  4ZRK A;  5CX3 A;  3GOE A;  4W9C A;  1UD7 A;  2Y5B B;  4IWP A;  2KTF A;  2LGD A;  2IO0 B;  1TZ1 A;  4G3X B;  1C1Y B;  2XEW A;  3Q3F A;  5TR5 A;  3H7P B;  4DDI D;  1TBE A;  4HDO A;  5KHO A;  4TV3 A;  1S1Q B;  2L3Z A;  2MP2 A;  4KVG B;  1KLV A;  2MBO A;  4MGK E;  1T0Y A;  1X1M A;  1MG8 A;  5AZG A;  3IG3 A;  4XX5 A;  3A33 B;  4WJN A;  2K8B A;  4GB9 A;  1L7Y A;  3VAW A;  3T8M A;  1XQQ A;  1YQB A;  2BWF A;  3A9K B;  3JW0 X;  2FIF A;  3ZTD A;  3DVN U;  3HIZ A;  2IYD B;  2WDT B;  4DHJ B;  3H7P A;  2M17 A;  1UEL A;  2ZPN A;  5J17 A;  3UIO B;  3V60 A;  3NZS A;  1L2N A;  2CHZ A;  2V4L A;  2WX1 A;  3JYU A;  1KM7 A;  3JSV A;  1ZW7 A;  4II3 B;  4MGI E;  5JHA A;  3PVL A;  5EDS A;  3M63 B;  4K7S A;  4K7W A;  3WAN A;  2ZEQ A;  4EOY A;  4JGH B;  4HPL B;  1E7U A;  3U8Z A;  3A9K A;  1V81 A;  3UIP B;  3I3T B;  3K9P B;  2L76 A;  4BOS C;  2KX3 A;  3ZRC A;  4KDI C;  3RUI B;  1WE7 A;  3W1S C;  2A5U A;  2L0T A;  2NBU A;  3DCG A;  4MEM A;  1JRU A;  1LXD A;  2GBK A;  2MBE A;  2C7N B;  2KMA A;  2UWQ A;  4IM3 A;  4GDK B;  2LJ5 A;  1UZX B;  1EF1 A;  1WJ6 A;  3X0W A;  3ZNZ B;  2KOX A;  2EMS A;  4DK5 A;  4FA6 A;  1WZ0 A;  1WE6 A;  3VUX A;  4WJQ A;  1LFD A;  4ICV A;  2L0F A;  3TL5 A;  2WWZ A;  4DBG A;  2IO2 B;  4X57 B;  2D10 A;  4E3C A;  3WA0 A;  3SHQ A;  4EEW A;  2N9E B;  4JQW C;  4NQL B;  4TUU A;  5CTR C;  2HJ8 A;  2DAJ A;  3M62 B;  2KFJ A;  4ZRI A;  4GN1 A;  2GOW A;  2NBV B;  2WYQ A;  3M95 A;  4WWP A;  2LUE A;  3VQI A;  2REX A;  1GNU A;  4G0N B;  2B3A A;  2MX2 A;  1EUV B;  2HTH A;  3L16 A;  3OJ3 A;  1GG3 A;  1WGY A;  2N7D A;  1H8C A;  3B0A A;  1V49 A;  4RMA A;  2D3G A;  1GC6 A;  5E6N A;  4GDL B;  2G45 B;  2FUH B;  1WGG A;  2MBQ A;  4W9L A;  2N4F A;  1TTN A;  3DBR I;  2ASQ A;  2MQJ A;  3B08 A;  3A9J B;  3EC8 A;  2UYZ B;  4TQ1 A;  1V5O A;  2NPT A;  2AEH A;  3A1Q B;  2J0M A;  2PE6 B;  3WAL A;  2HD5 B;  3VUY A;  1WRD B;  2K39 A;  4BFR A;  2IBI B;  3BY4 B;  4W9K A;  5JZE B;  2DZI A;  1XT9 B;  2L8J A;  4FHK A;  2JZ3 B;  4GIV A;  4IC7 B;  4LJO B;  4OVV A;  4W9I A;  1Q5W B;  4YL8 A;  3WAO A;  2EMT A;  3PSE B;  2XBB C;  3VHT C;  2D07 B;  3QAR A;  2JPH A;  3VTW A;  1E8Z A;  3QA8 A;  4EUT A;  3O65 B;  3OJ4 B;  2JXX A;  1WM3 A;  3DVG Y;  2D2Q A;  4W9G A;  4M0W B;  2JUO A;  4ZDV A;  1V2Y A;  2NBW B;  4P7I A;  3M3J A;  3ZLZ A;  3TMP B;  4MH0 E;  2V1Y A;  3RZW C;  3DDC B;  1U4A A;  4ANU A;  2R2Q A;  1P0R A;  2KO3 A;  3QX1 A;  5DCN A;  4HCP B;  4DXA B;  3KYC D;  4W9J A;  5CHV C;  3H9D A;  4MGZ E;  4PS3 A;  5C23 A;  2CHW A;  4XC2 A;  2BYF A;  1KJT A;  2BPS A;  4DHJ D;  3ZTC A;  4I6L B;  2DYB A;  3IVF A;  3W1Y A;  2MP2 B;  2Z0E B;  4FUL A;  4ASW C;  1GC7 A;  3PRP B;  3APC A;  2AL3 A;  2K8H A;  3A4S C;  2KLG A;  3EEC A;  4KZC A;  1NI2 A;  2JY6 A;  2C60 A;  3DVG X;  3PZD A;  4PYU A;  1E8Y A;  3ZDM C;  2FCN A;  3MJW A;  3DPD A;  3ZKJ C;  4IW0 A;  4PS8 A;  3DVN V;  1WGD A;  2IY0 B;  3UGB B;  4B6W A;  5L95 C;  5KHQ A;  3JSV B;  4RM9 A;  2Z59 B;  3ENE A;  4CO7 A;  5IAA C;  5DPT A;  2K1F A;  1V5T A;  2IY1 B;  3CMM B;  1SE9 A;  3R3M A;  3WIM A;  3VTU A;  4F1S A;  4NY0 A;  1WH3 A;  2G3Q B;  4WWO A;  4FLH A;  2RPQ A;  1IYF A;  2ZCC A;  4FAD A;  2KHW B;  3PRE A;  2KJ6 A;  4B9K A;  2I1K A;  3ML9 A;  1E8W A;  3UIN B;  3L10 B;  4AJW A;  3V61 A;  4A20 A;  5L83 A;  2JRI B;  3H6N A;  3U30 A;  3ZRF A;  3KYD D;  4ZYN A;  1WY8 A;  4HDQ A;  3ML8 A;  2K6Q A;  2KJR A;  4M8M A;  4HVB A;  3PHX B;  3PS6 A;  4EZK A;  1D3Z A;  2FCQ A;  1OTR B;  2LRW A;  2LVP A;  4KIK B;  2K6D B;  3EHV A;  2JVC A;  3AI5 A;  4XZ4 A;  2ZZP B;  1P3Q U;  5LLI A;  4BVU C;  5HKH A;  1A5R A;  3QHT A;  3H1U A;  1P9D U;  3AU4 A;  2DYM A;  2OOB B;  4OVU A;  3X23 A;  3ZVV A;  2KN5 A;  4FJV B;  3ONS A;  2EKE C;  4E74 A;  1UH6 A;  3GZN I;  1H4R A;  2DHZ A;  2BKF A;  3SDL C;  4G50 A;  5CHF A;  2K8C A;  4KSL C;  3WAP A;  2LWP A;  1WMH A;  4MM3 A;  5AZF A;  2M1M A;  4I6P A;  2JF5 A;  2V3S A;  4KIK A;  1WFY A;  2AYO B;  3QIJ A;  3SD5 A;  3V6E B;  2N9X A;  3VFK A;  4II2 B;  5LXH A;  1C3T A;  3B1L X;  3NHE B;  5E6O A;  1KOT A;  2MCN B;  4EZL A;  2WX0 A;  3QWZ B;  1J19 A;  2NPT B;  1Z5S B;  2ZPY A;  2RGF A;  4HK2 A;  3ZIM A;  2LVO A;  2LI5 A;  2BKR B;  5J2R A;  4DHZ E;  1NBF C;  3OLM D;  3VVW B;  1WGR A;  3OAW A;  3KH0 A;  4TKN A;  2CR5 A;  2KMC A;  2KC1 A;  2I1J A;  2G4S A;  2KDB A;  3L0W B;  4G11 A;  1RAX A;  1WIA A;  4MEL A;  4MSM B;  1F9J A;  4WWN A;  4ZRJ A;  3N30 A;  3RT3 B;  4F8C B;  3MHS D;  4FHJ A;  1GJZ A;  1E7V A;  3L17 A;  1GUA B;  3S2A A;  1UGM A;  1P98 A;  2FID A;  3CST A;  2BWE S;  1WX8 A;  2FAZ A;  2QHO A;  3DBL I;  3VH4 B;  5AEK B;  5D7G A;  1UBQ A;  4GU2 A;  4HLE A;  5G2N A;  1XD3 B;  3RD2 A;  3TIX A;  2FCS A;  4WQO B;  4JIO U;  1LM8 B;  1K8R B;  3VUW A;  4DWF A;  3VDZ A;  2PPH A;  2DYO A;  2IO3 B;  2JT4 B;  2N1W A;  3JVZ X;  4KZ0 A;  5BO4 B;  2O6V D;  4E71 A;  1V80 A;  5JH5 C;  4JL9 A;  3N32 A;  4GOC A;  5DPR A;  4A3P A;  2KQ7 A;  2ZCB A;  1Q1O A;  4HJK A;  4HXD A;  2RD0 A;  4W9F A;  4AWJ A;  2KKC A;  3QC8 B;  4ANW A;  1M94 A;  4GXB A;  4W9D A;  4TQ0 A;  2MBB B;  1YIW A;  2D11 A;  2LD9 A;  2IZV B;  2CS4 A;  4NAW B;  5FR6 A;  1WR1 A;  2ZVO A;  4AUQ C;  4NJ7 A;  1WGH A;  2PE9 A;  1OEY A;  1WM2 A;  2JZZ A;  1G6J A;  3ZDT A;  3Q3J A;  2CHX A;  3IHP C;  3ZNH B;  4IM2 A;  4PS7 A;  2KDF B;  3AU5 A;  2GBM A;  3C0R B;  3HHM A;  5DPW A;  2LXA A;  1AAR A;  2L05 A;  1WYW B;  3KUZ A;  4BBN C;  2PJH A;  4NAW A;  4HWI B;  4LJP B;  1VD2 A;  2DZK A;  2KXJ A;  2O6V B;  3D32 A;  3L13 A;  3VTV A;  2MSE D;  4NJ6 A;  5IA7 A;  1WR6 E;  1YJ1 A;  2LGY A;  4IUM B;  3RCZ A;  4AOF A;  3MTN B;  3ZNI D;  2KAN A;  1Y8R C;  3HM3 A;  4KV2 A;  2N1V A;  2C9W B;  2C7M B;  4ANX A;  4JLC A;  4BKG A;  3AXC A;  4MGY E;  3KW5 B;  3PPA A;  2J0K A;  2MA9 B;  1WXM A;  1WJN A;  2KD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...