1OFIA

Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
309
structure length
299
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of an Asymmetric Complex between Hslv and I-Domain Deleted Hslu, a Prokaryotic Homolog of the Eukaryotic Proteasome
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
total genus 84
structure length 299
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ofiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ofiA01
4IOLA 3LWNA 1ZMXA 2FPLA 4IRUB 2E87A 2IW3A 1QHSA 3TR0A 1R5NA 3DOFA 2QA5A 1GDDA 4PR0A 3IDQA 1KAOA 2Y8EA 1E2DA 2DY1A 2VP4A 3L0PA 1NVXQ 4KITB 3FKQA 4F92B 2I1VB 2HF8A 4NMMA 4QGFA 3LX8A 3MFYA 3I62A 3FWYA 3QKUA 3TJZA 3BE4A 1W47A 4JKIA 2YINC 4RD6A 3OE7D 2D2FA 1MRNA 3N2IA 1XEWY 2IUUA 1GUAA 4QBIA 3TLXA 2HUPA 4QG7A 5DI3B 1XPOA 1KK2A 3I4LA 3VU9A 5BYJA 3K9HA 2P65A 5EP3A 1WF3A 3OFNA 4N0DA 3B1ZA 3FPAA 2QM8A 4GBMA 1XNJA 3TVDA 5FBVB 4MYCA 4LJ8A 1NRJB 4OK5A 5EE1A 2PZGA 1KAGA 2CNWA 2DZOB 1R10A 3C15C 5UKDA 2F9LA 3WBKA 5JRJA 1F2TA 2HLDD 1GP2A 3KJIA 4GITA 1M7BA 3IIKA 4JLPA 4IFEA 4Q7MB 1SVMA 4ZDJA 2WM9B 5EE9A 4D0NA 5DE3A 2PJZA 5JECA 2WMOB 1XB2A 4D4LA 1XMIA 4DJTA 2F1HA 1NLYA 2QMHA 3KKPA 5L3SB 2WPDA 1ZNXA 2QORA 1XEFA 2VF8A 4MKIA 3QXXA 5JHHB 2JATA 1E96A 3U3JA 4DSNA 1YZLA 3AF3A 3B85A 3SU8A 4TL9A 2Q9BA 2AKAB 2QAJA 2ERYA 5BWMA 1P4SA 4Q5IA 3IILA 2YYZA 4PHFA 5DLQC 1GKIA 2ZSFA 1YZNA 2V1UA 5G40A 4NCJA 3EC1A 3EZ7A 1G5TA 1E9AA 2VSXA 1II8B 4OHYA 4RFSB 2V6ZM 4LUCA 1FL9A 5BN4A 4DLVA 4WW0A 3D6TB 1TF7A 4HDCA 1KI6A 1WP9A 3QJYA 2H57A 2HV8A 3HPQA 3WXMA 2O8FB 2YOFA 2IX3A 1OH7A 4YXWD 1RZ3A 1YR9A 2O5VA 3UANA 2ZJOA 2MMCA 4B3DA 5CJPA 1YRBA 3TGPA 4NCNA 5KSOA 3DM5A 2DWQA 2E1RA 1QDEA 2R2AA 3B1WA 1VMAA 3GEHA 4MH0R 1ZJ6A 2QROA 2W6JD 4KODA 4Q66C 5SZKB 2FU5C 1EGAA 5DIFA 2YWHA 2BHRA 5J5CA 2BMJA 5AJVB 4P32A 5AK0A 1SXJC 1GNPA 1C1KA 4BRWA 5HTKA 4C0BA 2JLWA 4Q1EA 4V0KA 4OJKA 3SHWA 4HZUB 1TAGA 1X6VA 4B71A 5AWFC 4JYCA 3RANA 3SJZA 4KBGA 4AC9A 1ZD9A 5FL7A 2NG1A 2ZVPX 4AK9A 4PAQA 2A2ZA 3QSYA 4EJSA 1GAJA 2JJ1D 3CRMA 5FOTA 2ZU0C 3RYTC 3DO6A 3BK7A 2J9RA 3WBJA 3TSOA 2OSBA 4AKEA 5P21A 3I61A 3AJIB 4S2EA 2OXRA 3G0HA 4CVNA 1OXXK 2GESA 2UKDA 1VG8A 2NO0A 2ORVA 3SEAA 2REBA 3HR7A 3DKPA 4TMVA 1R6BX 3OIYA 4NCHA 1G18A 2JJ2A 1J70A 2D62A 2GXSA 4RSGA 4HLUA 1OXSC 4LZZA 1E2JA 3T06B 3GD7A 2C98A 4E07A 4TWZA 3WYAA 4GT1A 1MO4A 3CH4B 2KBFA 1J7KA 1XD2A 4LBWA 2GEVA 4GZMA 4A2QA 3HU1A 3RRYA 2IWRA 3EA5A 3C16C 1U0HC 2OM2A 4ZPXA 2IK8A 2JLVA 4KLZA 3VQTA 3X1WA 3P20A 3NDPA 5FPKA 3ADDA 3S1AA 1MT0A 5BW8A 3RS7A 1WE2A 3THOA 4ZI3A 2ZJZA 2OAP1 4M21A 3TR5A 3SQWA 5D3MB 4A15A 3IHWA 2QY9A 4DKXA 1FTSA 2JLXA 3ETLA 1C9KA 1YVDA 2XTNA 1R5OA 2Z6VA 2UZ3A 2BMEA 2RGXA 3HDTA 3KUDA 5FPHA 3Q8XB 4AURA 3MG9A 1KDRA 1OW3B 1C4OA 1GL7A 2WWWA 2JCSA 3VAAA 1UPTA 1KJYA 2N42A 3MHVC 2X1VA 4MGKR 3AF0A 2OFXA 3IBYA 4C7OB 1ZM3A 4LJ9A 1F60A 5EP2A 4G0NA 5M04A 1VG0B 3BH6A 2G9NA 4JL8A 5J4HA 5F3WB 4QHSA 3IQWA 3QEOA 2ZJYA 2H1LA 3FFAA 1E79A 2ZRIA 2DFNA 3BB3A 5DYIA 5TMPA 1GTVA 4ZKDA 3BRWD 2OBNA 1ZCBA 2V54A 3MWJA 2W0MA 3A1SA 1EWRA 2DR3A 4DLRA 1G4UR 1W0JD 1B23P 5DN6A 1L8QA 1T91A 4Q4AB 1J8MF 3R9WA 3LA6A 4FI3C 3VLFB 5A0FA 4BFZA 1OE0A 4B35A 4ZDKA 1IBRA 1S1CA 3BB1A 1EFUA 3ECCA 4EPYA 4LJ4A 3IPYA 5AR1A 3EARA 3U5ZB 1ZUNB 3VNVA 4IEIA 1I4TD 1G6HA 4RZUA 2PCJA 2CBZA 3CPHA 2ONJA 2GWHA 5GJCA 3K0FB 3QXCA 4I1SA 4BLPA 3PEWA 2FDCA 3EC2A 4G3XA 2VBCA 4BPBA 1H8HD 1S4QA 2XB4A 3THYA 1NVWQ 2DFLA 1A82A 4D25A 2GVDC 3B1YA 1LW7A 1M2OB 3P26A 2XAUA 3NWJA 2HYIC 2J0UA 4IOMA 1P9WA 2BOVA 1UBFA 2WJHA 3KJEA 4IVRA 4B3GA 4CT5A 3L43A 1OXTA 3K09C 4LBYA 3FVQA 2JLUA 3SDZA 3SJAA 2ZI5A 5FTNA 2R8RA 1VCMA 4BGDA 3CKLA 2A5YB 2BBTA 4E09A 4EQ6A 3ZQ6A 1W46A 3W5JA 4P4SB 1KMQA 3CRW1 3UATA 3LLMA 3Q9LA 4Q9IA 3RHFA 4DLYA 4GOXA 1U98A 3B9QA 1UADA 3FHCB 3U3MA 2KI5A 2UVQA 3E70C 1XD8A 4NYJR 3SI7A 2DPXA 4D6PA 3HJNA 2EYQA 4DIDA 4QRHA 4C2UA 3KXLA 1NJGA 4DBLC 3EAQA 5IK2A 1Z0IA 4D0LB 4PPGA 1E2IA 3K0CC 3RS0A 1YHNA 5H68A 4M9XA 1A2BA 2ASEA 1KHTA 1EFRD 2XJ4A 5HZHA 4A1FA 3GLHA 3VTKA 1D2MA 4IVPA 1LY1A 2GTPA 2CNWD 1ESNA 1KY2A 3JVVA 3TBKA 4I1UA 4IW3B 4JBYA 5J4VA 5KPJA 2AFIE 1XPRA 2A78A 4FN5A 1DAMA 2JGNA 2XNDA 3DZ8A 1EWQA 4WZAE 1S1MA 4PZYA 4FINA 3ZDQA 5KDOA 2W0SA 2BJWA 2QBYB 4PSVA 1PLLA 1KDOA 4M1WA 5B30A 3SHFA 1T5LA 3VR6A 1G21E 3B60A 3KQUA 4M0LA 1G3UA 4WXRA 4UXIA 2CLCX 2ZRLA 1XDBA 1HEIA 1T0HB 3VR4A 3ICQB 4P4TA 3SJCA 1HQYE 3PQCA 1ZRHA 4IDOA 1TTTA 2RKOA 1NVMA 4B6EA 2G77B 2HT1A 1XPUA 1R8QA 2GILA 4LOAA 1N0VC 5C4MA 1W2GA 2B92A 5JJLA 4AYTA 3THXA 1HURA 4ON9A 2YWFA 2GF9A 5G41A 1RPZA 2CE7A 2DCUA 1WB9A 1EX6A 3LFUA 1RJ9A 4B3XA 2DZNB 1A5TA 2XZLA 4M9ZA 4KV9A 3SBEA 1TU4A 2IC5A 3MAAC 3KB1A 1E4VA 5EXXA 2F55A 4MYUA 5IDVA 3DHWC 1FOEB 1FFHA 1ZM9A 1UBCA 1VG1A 3KB2A 2CLSA 3ICEA 2HDNB 2FX3A 1ZP6A 1S0UA 1X3SA 4LBVA 4OHXA 1RFLA 2B8TA 3HWSA 1LF0A 2FZLA 4OK3A 1P6XA 1ZIOA 2ZRNA 2CXXA 4C2TA 2EU8A 3SFVA 3CNLA 3WRXC 4I4LA 2NOAA 4M22A 3GEEA 1SKYB 2PT7A 1KI8A 4Z8YA 2ZITA 1EFCA 4JLJA 4AY2A 4P31A 5TVKA 2O8FA 5EUMA 2C5LA 2GDJA 4D82A 1PUIA 4XIGS 1QVRA 2O52A 1E2KA 3GCGA 2NPIA 1TUEA 2F43B 2JLQA 4A4DA 1EFTA 1XTRA 3K1JA 3EPLA 4Q7LA 2CVHA 1N0UA 1SKYE 3U3OA 1KKLA 1SQ5A 4U00A 1XZQA 2ZI7A 3RVBA 2VPPA 2O8CB 3RWOA 1KI4A 2F1JA 1U8YA 1OFTA 3F0TA 4ITRC 5E3HA 4Q4HB 1OKKA 5SZJA 2FPMA 2KRKA 3QKTA 4URWR 3KKOA 4NYMQ 3IO5A 4NBSA 3SR0A 2EWVA 5ANRB 1BIFA 1BYIA 1DAHA 1Z47A 5G3ZA 1P72A 2GXAA 3PXGA 3PITA 2NO6A 3U61B 2J87A 4WZBE 1R2QA 4A0HA 2GZAA 3NVAA 1KKMA 1JR3E 1UKYA 2IA5A 1IN7A 1MKYA 3PUXA 4C0JA 4CEJA 3LW7A 3GJ3A 5E7MA 5FPSA 4Z54A 4US2R 1FW6A 1N25A 2GEUA 4JYBA 2X2FA 4B2LA 1PUJA 5KYKA 3WNDA 1NIPA 2BKUA 1KO8A 4GI7A 2C03A 1OIVA 4LJ7A 3AUYA 4PO9A 1AS2A 1MABA 2GK7A 1A1VA 3T5GA 3KX2A 4JBXA 1JXOA 5CYOA 2VP9A 3T35A 4EDHA 4MUBA 5KDLA 2Q0HA 5GVRA 2ZROA 4W7SA 3ASZA 4JVMA 1H65A 5FOUA 4EQ6B 2LKDA 2VHJA 4PC3A 1TQDA 4O0MA 1EX7A 1NKSA 4FMCB 1G8GA 2ZRFA 4TT3D 3ZLJA 1WXQA 3CX7A 2V6JA 4JLMA 3UIEA 4CZ2A 1OYYA 2WKRA 3GLHE 4R2IA 2CJWA 1JQLB 1ZU4A 4CRWB 4C0KA 1UEIA 2FEMA 2XZPA 3CF0A 3T1TA 3TKLA 4IOKA 4URXR 1NY5A 1C1YA 3IO3A 3MWKA 4JVSB 2PZFA 3I5XA 3K0FA 4Q03A 4LBZA 521PA 5JHGB 4QL3A 1WQ1R 4O25A 1DS6A 1LV7A 4DDWA 1IY1A 4B2PA 2C96A 2NTYC 3DKVA 2J46A 4R71A 5JWRA 2OLJA 3DDCA 1Z0AA 1SXJA 2ERXA 4UXHA 4ZCIA 3LW8A 4BFSA 4AD8A 1BS1A 3KL4A 4AI6A 1DAFA 1Q1BA 1N6NA 2IYTA 4HAVA 5FBQB 2H18A 4M8NE 4PHGA 3RC3A 2DWOA 1J99A 3DPUA 1HH4A 2ODWA 2NZ8A 2ZR0A 3PUYA 5JS7A 3K70B 3NBYC 1CU1A 5F9HA 3KFXA 1R5BA 2FN4A 2OFOA 4NYMR 1H8HA 1E0KA 1E3MA 1RRPA 3OIWA 1BMFD 3HYRA 4QGHA 3EASA 3LBNA 3DL0A 1XP8A 4LYFA 4M2LA 2V6IA 4L5BA 4MRVA 2XZOA 2ZUCA 3W3ZB 3K53A 1I4LD 3A4NA 5BN5A 3AKCA 4MRRA 4Q7KA 3SJBA 2H7VA 3CIOA 3IUYA 4PAMA 2VIIA 4JLNA 1JAHA 4QHYA 2WVJA 3FHOA 2V9PA 3CUEF 4I99A 1IAQA 1P73A 2JASA 1OB2A 3GLGB 3QF7A 4NP6A 3B9PA 4WA7A 1AZTA 2OFWA 3NDBB 5JI2E 2GZDA 5SZIA 4IXNA 1KIMA 2OV2A 121PA 3C8UA 3QKRB 2OEPA 1QG2A 2WKPA 4FMBB 1YR7A 2EFEB 3BD9A 2YVUA 5TV2A 5FL7D 2QTFA 1K8RA 3AF2A 3T34A 1E9EA 4XWKA 4CW7A 5EXPA 5JI3E 1E32A 3WNCA 2JJ1A 2YHSA 1L2TA 3AB3A 2AXPA 4CIDA 3QXHA 2JEOA 3OFND 4DSTA 5GJVC 3HU2A 4GP6A 1S3GA 1OYWA 3CZPA 4EKDA 2L0XA 3R9IA 2C99A 2F1IA 2CCKA 4Q4JB 1ZM2A 4JLDA 1MR3F 3R8CA 3KQLA 4AKHA 3M1IA 3PVSA 1H8ED 1T6NA 1OSNA 2WWYA 2RAPA 5DHAA 1Q44A 4ZCMA 3EPJA 4XD7A 1AZSC 2QRNA 3A8TA 5CM9C 3NG1A 3SYNA 4NKRA 1KSHA 1BO6A 2G1JA 3GFPA 3LXRA 2IS2A 2D4HA 4FCVA 3EW9A 4FWGA 2YOGA 4XVUA 1TEVA 2ORIA 1KY3A 4DB4A 1QRAA 3GJ0A 1F3OA 3ZVMA 3F3YA 2FSIA 4MUAA 4UJ3A 2H8KA 4PO1A 3OHMA 3THXB 4HAYA 4GZLA 1KSJA 4IVQA 5E7IA 3QPVA 2XGJA 1PV4A 5HCIA 2VRWA 2G3YA 1TQ2A 4BLTA 2GRJA 1E99A 4RCYA 4JS0A 4R7ZA 1G291 3L2OB 2IUSA 5D3QA 4LCBA 4OQXA 5AUNB 1FTNA 2X8AA 1R7RA 3QPUA 1VCIA 1AIPA 1SHZA 2IT1A 1NLFA 3RWMB 1XX6A 2CDNA 3HP1A 3EZFA 1DAGA 1SZPA 1TUIA 1KO7A 4GOJA 5SZHB 2A5DA 4RCZA 2ORWA 4R98A 2YJTD 1CJVC 2FGKA 3QG5A 4HZUA 3VX3A 3H4MA 2BBSA 5ELXA 4KLNA 1ZNWA 2FFQA 2CHVA 4URVR 2J0SA 4W5JA 4US0R 3M0EA 3PJRA 3CRQA 4Q19A 4YMVA 3PEYA 3L8ZA 4NHOA 3SBDA 3IEUA 4QNRA 4D80A 3UPUA 2A5GA 5KTYA 1LTQA 5CLLA 3OEED 2OESA 1OLOA 4DHEA 2XNDD 2HCBA 3F5FA 1UFQA 2ZE5A 4NL4H 5CM8B 2ONKA 1X8KA 4DDVA 1ZCAA 2REOA 2RGCA 4JT2A 2A5FA 3GLHB 3MSXA 2V1XA 2QU8A 2WAYA 4BFUA 3GPLA 4AWXA 1G7RA 2QG6A 2QAGA 3ZVLA 3GEIA 3IKJA 4TQAA 3CNNA 1KK0A 3T1VA 5KSYA 3Q5DA 3W6NA 3EPKA 4DSOA 3FYHA 4B3FX 2CL7X 2V7QA 2IHBA 1F2UB 4XVQA 1LFDB 4FXPA 4XH9B 2JJ2D 4LV5B 3N2EA 1OXUA 2QNRA 4KFSA 3T1OA 3FMFA 1OH6A 2JIZA 3AVXA 2FSFA 4B74A 1FX0A 4KO8A 2R6FA 3RAPR 1WBBA 2BMFA 4HB0A 3GFTA 3KDSE 3BWDD 3ZYCA 4YC7A 3HPRA 1X8LA 4RFVA 1JAIA 1DOAA 2YOHA 1KNXA 2LKCA 3Q7QA 4NDZA 4H9GA 4QC2A 4QNMA 4Z1MD 1PJRA 2AFHE 621PA 1IN4A 3P32A 1XD9A 3IQXA 4JVNA 2IXEA 4OHWA 3GLGA 3CONA 4TQ9A 4YMWA 2RMKA 3OIUA 2VYFA 2BC9A 2OCBA 2QMEA 5CK5A 5F9FA 3NBFA 2PL3A 3D8BA 2P6UA 2O8BA 4L16A 4PC2A 1G3RA 2FSGA 4GFDA 3QXSA 2B21A 4Q00A 2JLZA 5FOXA 3W8NA 1NMXA 2KB0A 2D2EA 1Z2AA 2FFAA 3NBZC 5FR1A 1E0SA 4BLRA 4G01B 2BV3A 4C7OA 3V4RA 5FPYA 2G6BA 5C2JB 2GVZC 2ZREA 3LRPA 4XSHA 3CWZA 3AVYA 1JR3A 5JMTA 4IJMA 3FDIA 1P2UA 1R0XA 2VHQA 1AS3A 4BZPA 4PQRA 5G53C 4Q1CA 2OXCA 4JVLA 1IN6A 4Q48A 4TQUS 1SXJD 2XX3A 5DHFA 5D3MA 5CLQA 1NVVQ 3KZ1E 2PJRA 3AH8A 3I8SA 4BFYA 1MRSA 4KBFA 3GJ4A 1VHLA 1DVRA 2YNMA 3SYKA 4OJQA 3RS4A 3TAHA 2C2HA 3N5CA 1XMJA 2Q3MA 4NU0A 4EPVA 2FV8A 2QAGC 2ZU6A 2GJSA 4HUQB 2ZQ5A 1KK1A 1KYIA 2P3SA 1HY3A 4JSTA 3FOZA 2ZJ8A 1IONA 1Q12A 1G4AE 2BEJA 4O2RA 4KHZA 5CITA 4ERNA 3RRZA 5HZKA 2ZJBA 4D2IA 1AM4D 2ZYTX 3KKNA 4F93B 2BDTA 3ADBA 1Q1ZA 1A4RA 1X8JA 4PPNA 4DLXA 4QBFA 2RCNA 4YMTA 1KSFX 4XWAA 5HE9A 2AK3A 1KI7A 1ZM4A 3DVLA 1RKBA 2JLSA 1DELA 1KDTA 2AD5A 4PHTA 4UNSA 4A82A 4ZIRB 2AWOA 4U7DA 5JJKA 1SVLA 2F1RA 1AKEA 1IXRC 2ZE7A 4EJSC 3LD9A 3IGFA 2GETA 2KJQA 3BS4A 4IDPA 4LY6A 1N5LA 4OK6A 4Q4JA 3TAUA 1UKZA 1JJVA 1W36D 1XBTA 3LDAA 3QKSB 1D9XA 2HT6A 1KI1A 4LJYA 5EXSA 4B44A 2CHGA 1ZM7A 3H0KA 4Q01A 5LB4A 2D7CA 3VR2A 4DB2A 1AJEA 2C04A 3QVUA 4OBEA 5KNCA 1OH5A 1OIXA 1SVIA 2G1KA 4WXPA 1YR6A 4NTZA 3U60B 4B34A 4A8JC 1JR3D 2P2LA 3O47A 4B3CA 5KNBA 5FOVA 4CEJB 1TMKA 2PH1A 1W49A 3O8DA 4LI0A 2ZEJA 4PANA 4A8JB 2VH5R 4BECA 3UMSA 3X1DA 2CVFA 4ZIRA 3U44A 1NIJA 3KKMA 4XSGA 1XCPA 3UXMA 4MDEA 3MJRA 2OUKA 3CPJB 3QOFA 1EXMA 1N0WA 2QPOA 1U0JA 2EWWA 4UJ5A 5L3VA 3BH7A 4HLDA 4TYWA 1T4GA 4LSGA 2PMDA 1Z83A 4KI0A 4JJKA 4K81B 3W34A 1SGWA 1KK3A 4LHXA 2J1LA 2VP5A 2R6DA 2WSSD 3EZ2A 4ILEA 4OI4A 3P27A 2PEZA 5DNYB 1MO6A 2ZSAA 3CR8A 1YRAA 2AD1A 1NP6A 1F5NA 1PLKA 1DE0A 2JDID 1W2HA 3HU3A 1N3BA 1W5TA 4LJ5A 2AWNA 2WIAA 1LB1B 1W7AA 3K70C 1G64A 2QPAA 4CYMA 1IN8A 1CR0A 4C0QC 1FQJA 2ZR9A 4Q1FA 221PA 2J0UB 2GNOA 3VNUA 4NYIR 1IQPA 4N3NA 3W5IA 1GSIA 2QGNA 3PUZA 1YZGA 2WOOA 1NBMD 5FUXA 3ZGXA 4RKFA 4M1OA 4XTRA 1G7SA 1WMSA 2HLDA 2QMUA 4PHHA 4US1R 5FR2A 4DDTA 5J4LA 1GKYA 4KFRA 1Y63A 3OIVA 2W6IA 1E9RA 3MJHA 4FMDF 3A37A 2HYDA 2X19A 1JPNA 1AGPA 4V0ME 2ZSBA 3RRNA 3C4JA 4QGGA 2D74A 3U3KA 2AK2A 3A1TA 3B6EA 1NN0A 3KKQA 1D9ZA 3R9XA 2J5XA 4PX9A 1U90A 4TL7A 1KO1A 5JS8A 4MKHA 1EFHA 5HKKD 4HLQB 2O8CA 2ZI6A 4QGAA 2XTMA 1FZQA 1XEXA 4EUNA 1BOFA 4DVGA 1H8EA 2WJJA 3K09A 3LVRE 2HJVA 3I3SR 5CIWA 4BEJA 2P5TB 4TTRA 1OB5A 1VYVA 6Q21A 4B3BA 1LS1A 1E69A 1HQCA 1QHHB 1XTSA 1B0UA 2WIBA 3MRSA 1VIYA 1RE0A 2DBYA 3A36A 4AKIA 2ZE8A 5FUWA 1OKKD 1U81A 1J8YF 3K9NA 1SVSA 3QI2A 5F2EA 1QHNA 1KTVA 2VSFA 1WBDA 4YXWA 1XXHE 3T1QA 1GM5A 1P2VA 4HLUC 2GBLA 1E94E 2RGNC 4G5RA 4OI1A 1G5PA 1KMHA 2CK3D 2FZ4A 3W6PA 2QAGB 3B1XA 3ZIAD 3H1TA 4F4CA 5J4YA 1JECA 4LHZA 1Z8FA 5DISB 5CK4A 4JL5A 3AV0B 1QZMA 3ZZ0A 4DCNA 2FF7A 2W6JA 2QEQA 4P3YA 1W4BA 2DWPA 2ATVA 3KJGA 3KJHA 1XD2B 1G3IA 5AJXA 4V03A 1GRQA 1R0YA 4HDQB 1DAEA 2IYZA 3TE6A 2ZRBA 3OZXA 4ACAA 3G5UA 4Q9HA 1OFIA 1YZUA 4ARZB 1DTSA 1XJ0A 1JI0A 4JSYA 3HR8A 1Z6AA 2C77A 1MOZA 1J2JA 3ONWA 3I5YA 4URZR 4NZYA 2PMKA 4M1YA 2CE2X 5LPNA 3AF4A 5KU1A 3O8CA 1IN5A 2HCJB 1IXSB 1G8HA 2Q9AA 3BOSA 2O8DA 2O0HA 1IY0A 3R7WB 2ZRCA 2D7DA 5IT5A 2DVWB 4GDFA 3MUFA 4A0GA 2OBLA 1WA5A 4TYYA 1FP7A 1EESA 3PUWA 2VTKA 3SOPA 2FWRA 3QUSA 4D81A 3X2SA 4KYUA 3WHLA 4TT3A 2IF0A 3CPEA 1W4CA 2FG5A 4ESVA 5H70A 1XJCA 4K46A 1Z22A 4PZLA 4R2HA 1KDPA 1T3HA 3LX5A 2KWIA 2FGJA 3S1AB 1E9SA 1U94A 2ZM5A 3WP1B 2ZETA 4LRTA 4GMDA 4HLCA 3OESA 4UNRA 4EFNA 4L8GA 5IF9A 2KE5A 8OHMA 2WTUA 3U7GA 4L4UA 2IBMA 2W00A 4JLBA 2F9MA 2HXSA 5GVSA 1SULA 4DWJA 2V8OA 4TTPA 5KPDA 4AYWA 3U6KA 2NMVA 2V7QD 5J47A 1Z6YA 1E2MA 1CULC 4EFMA 5BQ5A 1NG1A 1G1MA 1Q3TA 3LBHA 4QHTA 5DO9A 3V00A 3THWA 2XXAB 3AVTA 1A7JA 3QQ5A 4I1VA 5CJ2A 2DHRA 3CR7A 1M6NA 3QG1A 1NVUQ 3UMFA 3U2QA 5HR5A 5GJBA 4JL6A 4IFBA 1CKEA 1Q3HA 2WKQA 1RYHA 3BFKA 3GQBA 1GITA 4KYIB 5FL3A 2PZEA 5JEDA 2FSHA 4HB4A 3OE7A 1U99A 3K70D 2GEDA 1VKJA 3QVVA 5JJIA 3U3RA 4TSFA 3ADCA 3ZD7A 4A6XA 1M8PA 1XF9A 2VQSA 5AJZA 1VYUA 4XVRA 2IL1A 1ZINA 3QENA 3KQHA 1AQUA 2WV9A 5C46F 5FTLA 1OT3A 4BZXA 4MDFA 4Q02A 1Q1EA 1CS4C 5HPYB 3LV8A 1S9HA 2AL7A 2IXGA 2JLYA 1UDXA 3AKEA 4KVGA 1JBKA 2RGEA 4LC1A 1YKSA 1Z08A 1G20E 3EIQA 2Z4RA 4G5QA 1P3JA 4EPTA 4QOSA 2MSEB 2QGZA 4CEIB 3OEEA 3D3QA 4NYIQ 4A92A 1O87A 2JJ8A 3WMGA 2GJ8A 1KMHB 2MMGA 4Q9LA 5FUYA 2WJYA 1ANKA 2Q9CA 4RY2A 1N2CE 2GAAA 4XOIA 5EP4A 4A2WA 4JZKA 2FA9A 4Y0AA 4PSAA 3CX8A 2NO9A 1J90A 4DEYA 2QT1A 1JEEA 1GOTA 1RC8A 2PLFA 1XFAA 4P4SA 2QL6A 3P1JA 3W8RA 3UWOA 4DRZA 4TMKA 4TLDA 4EFLA 4POAA 1DADA 1OFUX 2XTZA 4KFTA 4A36A 2Q21A 1NJFA 1G6OA 3WMFA 3L0IB 2F43A 4HATA 1JB1A 2DFTA 2VL7A 3ZZUA 3NEYA 2ODBA 4KAXA 2WJVA 2JIZD 2R6AA 2YV5A 4W5HA 4XD7D 1YZTA 1OHHD 1WDTA 1W0KA 4BFVA 4DCTA 1LF5A 1TEXA 1OIWA 3B82A 3TW4A 3MCAA 1HT2E 2BEKA 2ZYWX 1RRGA 4Q4LA 3RDPA 2FFBA 1DBSA 1ETUA 1QHYA 3NIBA 2QUZA 4G1UC 4IEEA 4MYHA 4QJ3A 4JLVA 1U8ZA 3I32A 4TSFD 2DWZB 4OKSA 1K5GA 1KO4A 4PQYA 1Z29A 4EIWA 1QZXA 1ZVQA 3AP2A 4K8OA 4UQOA 2XB2A 4J0QA 3PUVA 5CYPA 4HB2A 1NN1A 3EZ6A 5EJEA 1E2HA 3BXZA 3WMEA 1GG2A 1EFRA 4JT4A 3QF4A 4LRSA 4KSBA 1NBMA 1G8FA 4UKDA 4MYTA 4TMTA 2RHMA 2OCPA 1SXJE 3QBTA 4ZKEA 2Z83A 5JCPA 2W83A 3E2IA 4LHVA 4AIIA 5AUQA 1G3MA 3BGWA 3DM9B 5L3QB 1F6BA 1P62B 3EA0A 3AKYA 1F2UA 4B76A 1P7CA 2DFKB 5IHPA 3MWYW 3NC1C 3NC0C 2H17A 3QY0A 1N6IA 1P2SA 1CR4A 3NHAA 1NN3A 3WNBA 1SXJB 3L82B 1RRFA 1MV5A 2EFDB 1P2TA 2IYUA 4FWHA 2WWFA 4PPQA 2EYUA 4V02A 3L8YA 2ZJ2A 2NZJA 2R6GA 4UNPA 4Q7JB 2OZEA 5CDFE 1MO5A 1M1YE 1Z0DA 4ASUD 3U7FB 1FUKA 2R9VA 3PV0A 1RW4A 1GKUB 1AQYA 3WRYC 2PT5A 2XSZA 3REGA 2NIPA 3CNOA 3TUJC 3WY9A 2ANBA 2GCPA 4JLKA 4HI0E 1KNQA 1Z6GA 4DCSA 3C14C 1AKYA 2W2VA 1AS0A 1RRCA 2ODEA 3TIFA 2OE2A 3WHKA 1U0LA 2B6HA 1OJLA 3TQCA 1TX4B 3PEUA 4LPKA 1VTKA 3ZVRA 3Q85A 1NMZA 3X1ZA 4BQSA 3AGQA 5EZ5A 4AG5A 1FX0B 1N6LA 3T5DA 3U6BA 3FE2A 1E98A 2CK3A 3GMTA 4PPFA 4YMSA 1GNQA 2JDIA 4UNQA 3OF5A 1G19A 2QT0A 3B78A 3BC1A 5LD2C 4X8OA 1IJFA 4BASA 3PIRA 4LYAA 4LHYA 1KI6B 3BIFA 2IF2A 3SNHA 1QG4A 3CBQA 4M53A 1M7GA 5JSZA 2I3BA 1ZBDA 2GF0A 3LXXA 1S96A 4RFSA 5DI3A 4PZZA 3OEHA 3PCRB 3GLIE 4Z8XA 2N1BA 5EE3A 4DCUA 4V0NA 4O2LA 3FMIA 1Z6TA 2ECKA 2Z43A 1ZYUA 3KTAA 3DMNA 4KU4A 4A0FA 5IK2D 3O8RA 1CR1A 4BE7B 2F6RA 3X1YA 1E2EA 2NQ2C 4ARZA 5GADl 2J0VA 4TYPA 1Q20A 3FTQA 4TL6A 1NSTA 2AKYA 4I1OA 4RD1A 1XCGB 3QF4B 2BBOA 4AYXA 2GKSA 3B8HA 3CWQA 4KXFB 3UWKA 2ZIAA 1VCNA 2QQ0A 3Q5EA 4QM6A 3TMKA 4EPRA 4P33A 4AG6A 3EZ9A 4KCGA 3LQRA 2R62A 2LWIA 4TLBA 2VLIA 1XEWX 1EG7A 1W4RA 2G0NA 4FWIB 2BJVA 5AJYA 4GMXA 1ONBA 3EPHA 4RD4A 1CIPA 2ZR7A 1DPFA 1YR8A 1ESMA 2FJUA 3JVUA 4QJ5A 2NPFA 3WP0A 5FOWA 5JZVA 3GJ5A 2KBEA 2YC4C 3BFVA 2QP4A 3NHBA 4IOJA 2WBLC 5E7JA 2YKGA 1YJ5A 3DMDA 1QHHA 2X77A 3ASYA 4FWDA 4EPXA 4ZI2A 2HXYA 2J7PA 1X1RA 5K8UA 4C0LA 2BVNA 3WYFA 5JLJA 3VU9B 3K8YA 4LRWA 2EVWX 3QPWA 4LV6A 3AVPA 3W90A 1II0A 5H1YA 2H16A 1NLZA 4GP7A 2UZIR 1D5CA 2PEYA 3DEFA 2GK6A 2AR7A 2N46A 5EZ6B 1BKDR 2QP9X 4DLUA 1CLUA 2LCFA 4BEBA 1CXZA 4H1VA 1JJ7A 2ZRGA 1E6CA 4OI2A 1Z2CA 4WOPA 5L3QA 2CL0X 3THWB 5EP1A 5C1BA 1HE1C 4BRUA 1Q0UA 1QHGA 4Q9JA 4ESHA 2RB4A 4MRPA 4PC1A 3VX4A 2C9YA 3AP1A 4DUGD 4RZ2A 4EAQA 2GAOA 4PQFA 2WOJA 4QBHA 2QSYA 5FFMA 3TH5A 2CEAA 2W6ID 4TLCA 4WAUA 1X86B 2KSQA 1VPLA 4LWZA 4BFWA 1N5JA 1ZU5A 3EIEA 3TW8B 4IKEA 4TTQA 2FH5B 4B6FA 3TQFA 4JIMA 4II7A 1R8SA 4OQNA 3BORA 2JLRA 1KI2A 2JAQA 2GJ9A 1DO2A 1IHUA 3U4QA 2IS6A 2W2TA 1G7CA 3K0AA 2IXFA 3AEZA 4UXJA 5C4GB 721PA 4HDOB 3LBIA 1TQ6A 3VMFA 4Z51A 1N6OA 1SVKA 1CJTC 1Z28A 3L0OA 1P5ZB 4PC7A 3VHXA 1NNEA 4M9SA 3PG5A 4M9QA 3RS3A 2P5SA 3H86A 3VR1A 4DT1B 1E2QA 1YZQA 3U7EB 1VHTA 1KI3A 1ZC3A 4LJAA 2ZTSA 3PFIA 4ABYA 2TMKA 3RABA 2GCNA 2GZHA 2FEOA 4PO8A 2ZXUA 4BZQA 3E5HA 4QM7A 3KQKA 4DIEA 1GL9B 4EJSB 1KSGA 2Q3FA 1ZUIA 2AXNA 1FQKA 4CGZA 1W0JA 4TN1A 4MGIR 4DLTA 3RC8A 3ZIAA 2ZUBA 1MH1A 2GA8A 3UK6A 4CEHA 3A1UA 1GZSA 2B7CA 3FKSA 4PFSA 4TL8A 3R8FA 3BFXA 4U5XA 1W5SA 3GJ6A 1IM2A 3SC3A 3UG6A 821PA 4C4PA 4LHWA 2V4ZA 1US8B 1SVOA 5FTMA 1QVAA 1UEJA 4HAWA 3RLFA 3SQXA 2WSSA 2ZRDA 1G7TA 3VKWA 1E9DA 2ZVQX 1Z3IX 3A4LA 1ZAKA 2A3RA 1COWA 2A5JA 1P75A 2CHQA 1T3SA 3PENA 4RZXA 4KFUA 4KVAA 1U8AA 3ZD6A 1AN0A 3MGCA 1E9CA 1E0JA 2BM1A 2VP0A 4MQBA 2P6RA 1MABB 1CRQA 4HAZA 4LK2A 5LB2A 3I8XA 3MLEA 1G16A 5KOYA 1SVWA 3T12A 1T3LA 1FPMA 4V0LA 1N5IA 5DI9A 5CB6A 2QP3A 1ZW6A 1AK2A 4F7WA 1W36B 3PR1A 3R7WA 2K5UA 2R44A 2ZYVX 4YDHB 2CMKA 1UKVY 1QHIA 2EQBA 3WYGA 2RHDA 4YQFA 4OI0A 4JBWA 4M1SA 4NYJQ 2BCJQ 1E1RA 2VSOA 4RVCA 4ZCLA 2IYVA 1R0WA 2P6NA 4HB3A 4A0RA 3CLVA 3B2EA 3RS5A 2AN9A 4M4SA 2EFHB 1GL6A 2ZJ5A 4FMCF 1ZD8A 3VR3A 1HTWA 3GLIB 4X8LA 2ZANA 1XJQA 1XTQA 3NXSA 3LVQE 4G5SA 4M1KA 3N70A 2ATXA 1KJWA 2QTVB 1CRPA 5C18A 2Z0MA 4M1MA 3U7HB 3RS2A 4ASUA 1GVNB 1FMJA 3CZQA 1NY6A 4FW9A 3CF6R 4GPTA 2DB3A 2WAXA 2ZPTX 4JJZA 4MA4A 5FBWB 4URUR 1TU3A 1ZNZA 2FMXA 1T5IA 1NBME 4GSYA 5FH9A 1D6JA 2P67A 2QPTA 4O3MA 4C0AC 5L3RA 1Y3AA 1LVGA 1W0KD 5B58C 2DYKA 3DOEA 3OEHD 2QQEA 1Z0FA 3H2YA 5LDDC 3IHLA 1BMFA 4LGMA 1T8TA 1QBKC 2ZRJA 1E1QD 4D4MA 1NSFA 3OAAD 4CF7A 2FE4A 1XWIA 1P9NA 2QSZA 2RGGA 2NO1A 3ND9A 2GCOA 3AKDA 5CIQA 1DEKA 4FWTA 1RYFA 3I92A 4B73A 2X2EA 2BBWA 5JEEA 1KZ7B 2BKEA 1ZD1A 5FTKA 2RGDA 4Q21A 2VHTA 2MSCB 3JZAA 4QFMA 3JZMA 1ZNYA 4F4JA 2FOLA 2ZYUX 2QBYA 2HF9A 4MRNA 4HUTA 1M7HA 3B1VA 2OCAA 4BFXA 4F4IA 4RJLA 2A30A 3TNFA 1W44A 3W9YA 1E2FA 1E2PA 1YQTA 2ZSDA 4X8HA 4QKQA 1CBUA 3K0SA 3Q3JB 4L9SA 4JLAA 4RKEA 1S8FA 4HUQA 1ZC4A 1XU4A 1Q22A 1TPZA 2MSDB 3AQ4A 1EK0A 1CR2A 4NONA 5KSZA 2IYXA 3TUIC 3GLGE 1P61B 3ADKA 5L8VA 1S2MA 2NO7A 5HCNA 3Q7PA 1UBGA 4BFTA 3QE0A 2I1QA 3FFBA 2FFHA 1CF4A 3GJ8A 3W3AA 2IHYA 5KSPA 3D7MA 1RJ9B 1YE8A 3BJIC 4TLEA 3AVQA 1BYUA 2O0JA 1Q57A 5BYKA 2O0KA 3TRFA 1K5DA 4BLOA 2CCJA 3QKSA 5TY0A 3KTAB 4HZIA 1KGDA 2VF7A 3H84A 3KXIA 3AVOA 1QHXA 1OHHA 1JXMA 1E4YA 4A9AA 1A2KC 1G3QA 3TSWA 4BUJA 1X1SA 1G8YA 5F98A 5J4KA 1S3SA 4HEJA 4FCTA 4LDJA 1HUQA 2J3EA 5H8WA 1E9BA 4DUGA 1E1QA 2QE7D 1KOFA 3GLIA 3OAAA 4ZO4A 2PLRA 4NH0A 1XRJA 4NCIA 1II9A 4WVFA 2CLDX 3A6PC 4HSEA 4E5UA 1XZPA 1NL3A 4WBSA 3VR5A 3BB4A 2ZS9A 4NCKA 2H5EA 4G5OA 2CJWB 2C95A 2Z5FA 3MD0A 1JPJA 3C5HA 2P0EA 1DO0A 3AM1A 3B7GA 1OXVA 3RSLA 1DAIA 4QXAA 4UNNA 4C0HA 1L7VC 2ZRAA 1IOZA 5J40A 1UAAA 5JBQA 1JQJC 4GNKA 1VG9B 5KUTA 5B2ZA 4YDSA 5LD2B 1UKEA 2J41A 4DT1A 2IEYA 4DLZA 5CB8A 4IHQA 4JN6A 2REXB 1I2MA 2IS4A 3HYTA 1VDZA 2D3WA 3VKGA 4S35A 5JFGA 5FBRB 4DZZA 1GNRA 2RH5A 4HAXA 1UM8A 1V43A 2ZRMA 1YU9A 4ACBA 5L3SA 3EIHA 2YWEA 3TUZC 2WZQA 2A7QA 3EX7C 2C9OA 2C8VA 1II8A 4LJ6A 3QXJA 5BN3A 2JA1A 2O8DB 1XTIA 4TMWA 2QENA 2IEZA 5TXGA 3SZRA 2VHCA 5JCZA 2F7SA 3CH5A 2XSZD 1OV4A 3M6AA 3BH0A 2G88A 3BERA 4B48A 4W9MC 1W48A 3GJXC 5DH9A 4KSCA 2ZJAA 2YZ2A 2QE7A 3GLFA 3AGPA 2OILA 2WWIA 5JRZA 3V9PA 4TMXA 2J7PD 4TZ6A 1HYQA 1IY2A 3KQNA 1KJZA 3FMPB 1HV8A 2GCOB 3FB4A 4N0EA 1OF1A 1U9IA 2IYLD 4OQFA 3EWSA 5GJWC 4C30A 1S9DA 1T0JB 3RSOA 2XITA 4Q1BA 1Z0JA 1G9XA 2O8EB 4G5GA 4WIAA 2QI9C 4R9UC 2GBLC 1N5KA 2OAQ1 2RGNA 2PBRA 4PTLA 3KFVA 5TARA 3SE0A 4DXAA 1L4UA 4QJ4A 3BAFA 2CCGA 1U2RA 1VCOA 2O8EA 1TL7C 2WWXA 5FBLB 4LYJA 2IYRA 3ZZTA 1Z6XA 5KDDA 1CEEA 1NF3A 3P4YA 4A6PA 2V3CC 4B32A 3T15A 3UG7A 1JR6A 5JWHA 3VKHA 3A4MA 1JNYA 1XTJA 1D8TA 5A5GA 4FCWA 2FPKA 3IIMA 2Q3HA 2O8BB 1UBEA 4Q4AA 4CT4B 4DEXA 4D4KA 4XJXA 5DN6D 5FUVA 3SN6A 4Q1DA 1XCMA 4Q1AA 2YWGA 2Q6TA 2J0QA 1K6MA 3J81k 1GIAA 3I73A 4D0GA 1R4AA 1E2NA 2WJGA 4NE2A 1CJMA 1GRNA 4DLWA 5BXQC 2WWGA 3A58B 4B33A 4DC9A 5E95A 2HEIA 4BWYA 1D2EA 5AUOB 1OPXA 5JSZB 2GXUA 1DG1G 1LNZA 1CTQA 4Q9KA 1GFIA 2IWHA 2QTHA 3L0SA 1F48A 3IPXA 2WICA 5TB5A 4YLGA 2ZS8A 4P4UA 3LAWA 2IUTA 2WSMA 2C78A 4X8MA 4NPHA 2XOKD 4JKYA 2W2XA 1CP2A 4HYYA 4CDGA 3B5JA 1N6PA 5EE5B 2GJAA 3BBPA 1Z63A 3V4FA 1DARA 2XXAA 1I4DD 2AHOA 4JLOA 2ZS7A 3W6OA 5JWOA 2AX4A 5KNDA 3A1VA 4Z1MA 1NG9A 3QEJA 3TK1A 4A3VB 4KJZA 1XTKA 5AJWA 2F3RA 4TZ0A 2OT3B 4OHZA 3AUXA 3A1WA 1ZUHA 2G83A 4YMUA 2EFCB 2R6CA 2B8WA 1VIAA 5AUPB 3SYLA 1N6KA 1RVDA 2GHIA 2I4IA 3P4XA 5EE0A 5B64A 3GFOA 5DGXA 4P0TA 421PA 3KXKA 1E9FA 3FGNA 4RZ3A 4URYR 2OG2A 3FHTA 3CB4A 3LQQA 3QIAA 4YONB 5CDFA 3LH5A 5KO2A 3C41J 1DAKA 1X37A 2VHUA 2YC2C 2QZ4A 4E22A 3AVUA 5FTJA 4PXAA 3SFZA 1TF2A 1E1RD 1MO3A 3ZQJA 2IYSA 1Z5ZA 1E0AA 2RGBA 3IBGA 1UF9A 2B7BA 3ND8A 1Z07A 4Q18A 4PC6A 3U4QB 3GJ7A 3AVVA 4N1AA 1XMSA 3ZVNA 2OCYC 4LV8B 3GP8A 5FOSA 2H92A 4LC0A 3NKVA 1JEDA 1M34E 4MGYR 2VO1A 4MKGA 3DZDA 1FMLA 2WMNB 4MRSA 3NEJA 1SKQA 1ODFA 4BLSA 2ZI4A 3EG5A 3K0CA 5DSZA 4C0SA 4RD2A 4F91B 4CEHB 3CF2A 2CL6X 2BWJA 2VEDA 4B43A 2GJKA 1T9HA 2WHXA 2IYYA 3LO5A 3CO5A 4Q4HA 1DG3A 2WPDD 4TMZA 4DLSA 2OO7A 4BLQA 3IIJA 3I72A 2VA8A 2ZE6A 4C3ZA 3FMOB 3NBXX 5B57C 1XEXB 4V0MA 1AGRA 2VP6A 2IYWA 4W5WA 3KW6A 1KI9A 4MKFA 3QBVA 4B47A 1D2NA 5TDHA 1GILA 5K8IA 2BCGY 3IEVA 4IDHA 1PVOA 3B13B 5FI0B 3AP3A 1R0ZA 3K9GA 1E2GA 3VFDA 5EXTA 1ZIPA 3K0AB 4JMPA 2C9CA 2ZSEA 4D4JA 3I1FA 4QBGB 2A9KA 1UDWA 3UKDA 5E4FA 1M74A 3AVWA 4PSKA 5FI1B 4D26A 3QKRA 1KZGB 1OH8A 4LX0A 2QRZA 1US8A 2Z4SA 2G0TA 2ZI9A 1F2TB 3GLFB 1IJEA 4XTCS 2ZRPA 4OHVA 4LYHA 3RNLA 4B75A 3E1SA 1NN5A 3R20A 1G17A 4FMDB 4LPSA 1Q21A 4OL0A 2ODNA 2PX3A 3CX6A 2ZI3A 1TADA 3ZS9A 5K8LA 3LY5A 4DSUA 4WZ6A 1G41A 2OBMA 2ZUDA 3NTUA 1O3YA 3GLFE 2HJGA 4L15A 2XNSA 1L4YA 1P9RA 1XXHA 3O8BA 4PAOA 4TYQA 3RRMA 1G5RA 2BMDA 3EXAA 4MITA 4IXMA 4TLAA 3Q72A 5IRCD 1NKTA 2NGRA 3NH9A 2ZAMA 5EQTA 1Z06A 4B2IA 4OQMA 1FNNA 2V55B 4U02A 4ZDIA 3NH6A 1UJ2A 5KHOC 3G82C 1W4AA 2PCLA 4A2PA 1NVVR 3TVTA 1FP6A 3QNUA 2EW1A 2VP2A 1PZNA 2SHKA 2PX0A 1N6RA 1AA9A 3FKSD 4Y0VA 1NI3A 3LNCA 1YZKA 4DCVA 4IDQA 3U44B 4CEIA 3ZJYA 1JALA 4FD2A 3ZH9B 1XXHB 2OHFA 1I2DA 2GXQA 4MGZR 1V5WA 4TYNA 1KO5A 3MMPA 1N6HA 1QF9A 5DYGA 1IXZA 1VECA 2WJIA 4FIDA 4OYHA 4C9BA 3PEVA 2FNAA 2J45A 2QM7A 3F8TA 1LS6A 1VYTA 3KUCA 1FUUA 1G8PA 2OLKA 4L9WA 1WCV1 1COWD 3EWAA 4F38A 3REFA 1HT1E 3MWLA 1GRRA 2RGAA 5FPTA 5A4JA 3CRVA 2IS1A 2W58A 2J7KA 1HE8B 2XJ9A 4HAUA 5EUQB 1W1WA 2QMOA 3D31A 4AKGA 1SHKA 4GL2A 3TSZA 3CW2A 1E79D 4ZDWA 2ZRHA 4ZV4A 2BM0A 2ZAOA 3K9LA 2D06A 4OQLA 1GWNA 3T61A 3X1XA 4A8JA 3M4YA 5HKKA 3VHLB 3ZS8A 2WWHA 1Z0KA 2J59A 4GOKA 5LBIA 4Q47A 4GRAA 4M1TA 1T8UA 2R65A 3UMRA 3AF1A 4RD3A 2IYQA 4DDUA 1HA3A 1P60A 4EPWA 1CJUC 1ELOA 1WRBA 2EFGA 3CRRA 2XEXA 1TF5A 2XOKA 4RD0A 2E9SA 5G3YA 1CJKC 3LLUA 3CM0A 1NMYA 3THYB 3SS8A 1TQ4A 2ZRKA 4V0OA 4XWOA 5K8TA 2F3TA 1U9IC 3C7KA 1TNDA 1E2LA 2ANCA 3K0EA 1FNMA 3C5CA 4IDNA 4I81A 1RIFA 1BH2A 1OFHA 2BIFA 4H1UA 1PLJA 1Q1QA 2QN6A 5HE8A 1W36C 4E03A 1XMVA
chains in the Genus database with same CATH superfamily
1ECPA 5BMVF 3HB0A 1U0GA 4G09A 3DDUA 2PIAA 4FYMA 1WS6A 4EK9A 2F4VB 1WMEA 2E5FA 2HWUA 4IRUB 1VE9A 2HHJA 1C3EA 4UBKA 3G59A 2JLAA 4IILA 1BDIA 2X0FA 1R5NA 2QRQA 1X7GA 2QA5A 2VH1A 1OCEA 1IH8A 3PHIA 1KAOA 2I6SA 4X7PA 3EVGA 1ST2A 1U2ZA 2PZJA 4KVZA 3MTEA 3WB0A 3L0PA 2Z9CA 2PNFA 3U13A 1ULHA 3ON5A 5HKAA 3ORFA 4KITB 3UA3A 1LUAA 2I1VB 1FQWA 4NOOB 5D7NA 1M34B 3IESA 4GMKA 1ZR2A 3BE4A 1DKQA 1W47A 4JKIA 4KK3A 3OE7D 2D2FA 1MRNA 3TLXA 3V42A 2A92A 1HC7A 3HRKA 4RL4A 3A10A 3DT9A 4A5OA 3NYRA 4DG8A 3HUFA 1W5EA 2VWHA 3CTPA 1KK2A 1R0CA 4UULA 2PV0A 3HQ4O 3NVDA 3VU9A 4HEQA 4ZT2A 1T9DA 4NS4A 5EP3A 2B8EA 3OFNA 5K2MA 1XHEA 4MCAA 3TVDA 3ECAA 2E5WA 1G42A 3EQ9A 1EGHA 4U7JA 2O0LA 2OZPA 4LJ8A 2Q3JA 5E0KB 3KPYA 4ZT3A 1THTA 1PG5A 1R4NB 4RKWA 2DZOB 1BWRA 3CF4A 4GRDA 3HVRA 5A02A 1VGVA 4OB7A 4QD3A 4BVKA 5JRJA 2GH1A 2QS9A 1T4MA 2HLDD 3KJIA 2QJFA 5F51A 1CY8A 3IIKA 4C22A 2CNLA 4Q7MB 4KNVA 5CLJA 1U1FA 1SVMA 3GUVA 3GB9A 4J7CA 4EI9A 2E18A 4A1OA 3H19A 2ADOA 2PJZA 1WMAA 4OU7A 2Q6IA 1FS4A 2YBEA 1XB2A 2ETVA 1ULAA 4RZSA 1DLIA 2VT3A 3QWFA 5HGJA 3UAWA 5IXYA 4XR4A 4DKJA 2HSEA 4KMRA 4WZAA 4C4OA 3GXBA 5KVVA 2V59A 3AHDA 3CT6A 3KKPA 1T15A 2WPDA 5EKSA 1E1CB 3AZPA 1XEFA 1DGFA 1LWNA 3MC1A 2GBFA 4DSNA 3COZA 3HNPA 1YZLA 3HP7A 2P75A 2YQ4A 3U4HA 3KC2A 3VZCA 3RAFC 1IJBA 3L6UA 1TF0B 2QAJA 3BTSA 3UJ7A 3BPSA 1EVLA 3HMQA 2H07A 3IILA 1JQ5A 2R5FA 1O6ZA 2YYZA 3L84A 4F4UA 4BUZA 4TV8F 3EZLA 5DLQC 5M29A 3CN7A 2RGOA 4YB8A 3WKBA 1C29B 5G40A 2EJBA 4WKOA 2JIQA 3IVAA 3HX3A 1E9AA 2FJ0A 2Y2VA 2ZSHA 4JNCA 3F7NA 4MR9B 2Q1YA 1WLSA 4RFSB 5BR1A 2FZKA 3ITKA 4HDMA 2JXNA 4WW0A 3RV4A 4Y2QA 5I7HA 3QTBA 3UAVA 2QX9A 2B6NA 2X5KO 3IP1A 4FGKA 3VH1A 3N9IA 1WP9A 2NUPB 9LDBA 5KTPA 2YOFA 4IBEA 1CUAA 1VBMA 3L8CA 3HBJA 3H5LA 1V9LA 5KOHB 2UUCM 3MQFA 3TQRA 4WZBA 3KE8A 2OVFA 3UJ9A 4X65B 5EHZA 5I5EA 9ATCA 2Z7JA 4NCNA 4RS3A 3EVNA 2G4CA 2R2AA 4U4AA 4XWGA 4IIXA 3D4BA 4Z9BA 4MH0R 1ENZA 1RHKA 3C3JA 3G9TA 3E0XA 2K7ZA 1U3WA 1IBLM 1SBTA 5K0LA 4IBFA 3E27A 3ZWKA 5LQKA 3ACBA 2C0QA 2BHRA 1YQUA 3QPBA 1SXJC 2WIKA 2Q07A 3SHWA 4BNGA 3GV0A 1U0BB 1NBEA 2JLWA 5J1SB 2JAXA 1PZGA 4B71A 3FPKA 1EQAA 3I6YA 1TTQB 3OCVA 3FUWA 3ST7A 1YVEI 4QE3A 1NOKA 3AJ9A 5ER6A 5K4AA 4RIIA 3VI4B 4ARIA 2NG1A 2ZVPX 2H1RA 1KEWA 4FFBA 4QEKA 1FFWA 4X93A 2ZDHA 1A76A 3NNSA 5FOTA 3U0BA 1NP3A 3KVOA 3IEKA 4EJSA 2ZU0C 3G5TA 2UZAA 4FGJA 1JZSA 4G67A 4I55F 3OJCA 5EA2A 2XOXA 1SUSA 3N75A 2VPQA 3C4QA 1V2GA 4MQLA 5K0NA 1SWVA 2AFRA 3EMDA 1WWKA 3K16A 1FBNA 4FLMA 4AKEA 2BPOA 5ITYA 1QPZA 3UWSA 1NXWA 1U3DA 2GESA 4WFQA 1VE3A 3ELUA 4QASA 1VG8A 2BSAA 2NXNA 4H6PA 4C7KA 2REBA 3IODA 1I4OA 4TMVA 3E8XA 1G18A 3FYCA 2JJ2A 2FUG1 1CZOA 1J70A 4FM9A 1QZ3A 1A9PA 2DMRA 4RSGA 5G0TA 2COKA 3SP1A 3X1JA 1HT3A 4KXWA 4UMEA 3T9AA 4BNDB 4HLUA 2P8JA 3S27A 1PV2A 2YWDA 4L8WB 1Z0ZA 4E07A 4OBWA 3WB9A 5JWRA 2NZ2A 1K2VN 4P7BA 2H00A 1RJDA 1J7KA 1Q0SA 2QZSA 5TPZD 2R8ZA 4GZMA 5DGHA 1JLRA 4UTVA 3CEHA 4TTJA 3KZNA 3KP1A 4HQFA 2IK8A 2JLVA 4KLZA 3WL8A 5BNIA 2ZYHA 3ADDA 2JD2A 1DINA 1OFGA 1YIAA 4CG3A 4AJ9A 4D45A 5BW8A 4HWGA 5BSKA 4ZI3A 4AO7A 1SZDA 1Y89A 3GO4A 3H05A 3DMRA 5KOHA 2BH2A 3SQWA 3CRZA 4HNQA 2JLXA 1CB7A 3ESXA 4MS3A 4QUJA 1C9KA 1MB2A 1XTZA 2WU8A 2ZIGA 2RGXA 5A4KA 1KDRA 2P4SA 3ZOKA 1OW3B 1C4OA 1VLLA 1QG6A 3EFOB 1EM6A 2BFAA 4MPDA 2F5QA 4MZXA 1UPTA 4HWSA 3CUVA 1KJYA 1T5OA 3DQPA 1YKGA 1L4NA 2WFZA 2XHZA 3PWSA 2ZRQA 2FW1A 1AKVA 1TD9A 1X8XA 3VHRA 4BWGA 1YZFA 4C7OB 4X61A 2FUKA 1DIBA 3QEMA 5EP2A 1L5NA 1DGHB 3E9MA 2RRUA 3DPSA 2IDZA 4IIBA 5AVTA 2ZJYA 1VL1A 1JKJA 2CD9A 1GJTA 3PXBA 5DYIA 2IZOA 4ID3A 1PT5A 2WTBA 3CUYA 4NU6A 1JHQA 4QUGA 2W42A 1DC8A 2R8PA 2P3QA 2DJ5A 2N3ZA 2VTDA 1G4UR 2WVAA 4DLRA 1H6DA 1B23P 3U5TA 3NGLA 3WHIA 1L8QA 1WW3A 2PGXA 1JFRA 3GWZA 5JD5A 2NT4A 2FQXA 3CUTA 3FHLA 3WLPA 3MYRA 5A0FA 1OE0A 4QGSA 1FFXA 3ABRB 3UCEA 3WK5A 4YR9A 5L6MB 2L7HA 4HDKB 2X3YA 1QLWA 2XUIA 2C7GA 5AR1A 5FXMA 3VHQA 3U5ZB 4NEHB 4WY8A 4ZCQA 3ZK9A 1GPDG 2VQ6A 4Y6GB 2W8ZA 1RYMA 4ZHSA 5E6RB 1NNLA 3C6KA 4M9CA 2CBZA 3C7CB 3FGPA 3HY4A 2F3UA 3CJTA 5HS6A 2CHUA 5DMXA 2OWDA 1XQ6A 2XB6A 3EC2A 3ESQA 3I2KA 4G3XA 5B3JC 3WKAA 1V9CA 3HVKA 1X1DA 4YYZA 3IP7A 2B8JA 4HWOA 2JUJA 5HBRA 1LW7A 1M2OB 1VXOA 3P26A 3TPFA 1IOVA 2E6KA 5CX1A 3V2UA 4X95A 2BOVA 2H48A 1RZVA 1HNXM 2WJHA 3F1KA 1H1LA 3NV7A 3L43A 3GAFA 4X92A 5EZYA 4CL8A 3HZJA 1VXRA 5KJ1A 3DWGA 5K3FA 1N75A 3K8ZA 1PFQA 2QTBA 3QVXA 5FTNA 4K6OA 4ER3A 3L02A 1YD7A 1G6KA 1K7CA 2EJCA 4ZHQB 1FF9A 2IBTA 2A5YB 1TW3A 4O4HF 3LO8A 2Q5JA 1J1IA 4OJNA 4E09A 3ROPA 1FK8A 3B5IA 5A1JA 2FQQA 3ISJA 1W46A 4JP2A 5EJ4A 5HQ3B 3EGDA 3OUUA 3CRW1 3OICA 1G0OA 3H2BA 3Q9LA 1LPSA 4Q9IA 1RQPA 1KDZA 4GOXA 1QKJA 1YACA 1TA9A 1N2ZA 3VR2D 1CHNA 2C58A 1YRYE 3PJEA 4XJVA 3ZHBA 4DIDA 2E0IA 3CLUC 4QRHA 1VJGA 1NJGA 1U7OA 1Q95A 1WUTA 2AVNA 4FZJA 4KAAA 4RK1A 3SDBA 5AHXA 4PPGA 4D0LB 4F6LA 2R6ZA 2C4WA 1YHNA 4E13A 2ZTVA 3VV3A 1Y42X 4WN9A 1KHTA 2XUZA 4QUIA 4WKBA 2IV3A 2XDAA 5FF9A 4DMUB 5DK6A 3AR2A 3Q9UA 5BVGB 1QH8B 2AEMA 1KY2A 3UN1A 1GARA 1I30A 5JDCA 1LDBA 1CY7A 3GLRA 4JBYA 5TQJA 5DLYA 3RFVA 3ZPXA 5EQJB 1A7KA 4K40A 1IM5A 3L7CA 3WGMA 5EIBC 2AJTA 2QSFX 3BKWA 2BFEB 5ALUA 4IIYA 2QAIA 3RTGA 3VSCA 1DAMA 1HE4A 2OZLA 4YRKA 2WLSA 1VLVA 2XNDA 4DLKA 2OL4A 3V8BA 4MNTA 3B20A 2ZCUA 2AF3C 4MTCA 4YUYA 2DH6A 4GLBA 4CL0A 1KAMA 5G1NA 4WY5A 3ZDQA 2ZT5A 1G20A 4PSVA 1PLLA 3UICA 3VNRA 5B30A 2OVBA 4DCJA 2PUFA 3VR6A 4HNTA 1G21E 4LZNA 1RQGA 3I39X 2DFDA 4YHBA 2O0MA 3R09A 3GVXA 1C7ZA 3KQUA 4M0LA 1G3UA 1RZRD 1ZXBA 4UXIA 2CLCX 2PS9A 2YYSA 3OC0A 2B0CA 1HEYA 3MT8A 4U7WA 4WXYB 4YBRA 5D86A 5SY4A 3VR4A 4KAFA 4CLHA 1NQAO 5JANA 4D74A 4FHGA 1PGYA 2R7KA 1DI0A 2IEAA 4NOMA 4MVCA 3A11A 4LFAB 1P1BA 4LOAA 2GILA 4OQ4A 1ZCJA 1EE9A 1XALA 3BIOA 4YK7A 1VKOA 2Z3XA 1RXYA 2XUPA 1HURA 3K8QA 3KIPA 4HS9A 4MAAA 4UZSA 5LQMA 3D7LA 2CZGA 4X44A 4MQEA 3S70A 1RPZA 1L7EA 4XEHA 1EX6A 1MOPA 1R6XA 4YCJA 3LFUA 4JXJA 1RJ9A 2XZLA 1NI4A 1QQTA 2HCFA 3IB6A 1JQ3A 4YASA 3AR7A 5AVOA 1E4VA 1ZS9A 2RC5A 2OBBA 5IDVA 4XCQA 1WNFA 1HDXA 4YV7A 1ZM9A 1VG1A 2CLSA 3I12A 4G9BA 1DTEA 2HDNB 4OGLA 4RPLA 2FX3A 1ZP6A 2NSHA 1E66A 3RROA 5AVXA 5EIBD 1RFLA 3HWSA 1LF0A 4GYYA 1V8ZA 2QG9A 1QIEA 3L7OA 3PDIA 3VMMA 2C4KA 4G89A 1V8PA 3OLWA 3ZEIA 4HBZA 4DDMA 2CXXA 2XHEA 4NI5A 5M3BA 2TS1A 2VQFM 3WRXC 1FYXA 3G0IA 1SKYB 3AJEA 4X24A 3WTCA 1PIWA 2QTRA 2ZITA 5D2CA 4YN3A 2IPAB 1GPMA 2C5LA 4UAUA 1PUIA 1Z8HA 4QUEA 3AUUA 2Q4RA 4FFSA 4M0FA 2H2WA 1FSSA 4YO7A 1E2KA 2VWPA 5J63A 4EBFA 1TUEA 1CUFA 2E3JA 2F90A 3OZTA 4RE5A 4J75A 3ZW8A 1XTRA 3JVEA 1OZGA 2BZ1A 2V74B 2VSYA 4P7FA 3EPLA 3BMCA 1P2BA 4JA0A 1ENYA 4ZOLF 2JA2A 3U3OA 5GONB 3VZSA 1N2HA 4EZEA 4M88A 3QPCA 1XZQA 1QLHA 3GRRA 2VPPA 1EXDA 3N2GB 4DLAA 3H3FA 5ADUS 1A9YA 1CEXA 2PU7A 2OV8A 4ITRC 3N7AA 2F8LA 2GBCA 1JKMA 5SZJA 4EL0A 4WNAA 3BD6A 3RE1A 3T5AA 2B1GA 3RUEA 3WK6A 1CUVA 4W63A 1KJ9A 4NZZA 3RTCA 3SR0A 3W05A 1DMRA 4IV0A 5EJGA 4EATA 5ELMA 4MQFA 4D9EA 1DAHA 4IIVA 3GRFA 5HYVA 1SBZA 2PWZA 4HCJA 4K9RA 1YXMA 3BDAA 4A8TA 3U61B 2J87A 1V96A 3MTDA 4A0HA 2GZAA 2R00C 4AIRA 2J3IA 2ZUFA 3MEQA 5I9SA 1UKCA 2G1AA 1JNXX 3JCZA 4D5GA 1B7GO 8CATA 1MKYA 1PX0A 4OVZA 2FQYA 4TVSA 3LECA 4HNUA 5L4SA 5ILQA 3QYBA 2GN6A 5H9WA 4YGYA 5HNKA 4CEJA 1FW6A 5FPSA 5LQSA 1O5TA 5L9AA 4UHFA 4E30A 1RAAA 4RMIA 1PUJA 4X41A 5KYKA 1NIPA 3IUPA 4I9GA 1KO8A 4EP1A 2C03A 1IBMM 3LDUA 1YE3A 2GAIA 3AUAA 1I7NA 4FHCA 1S8AA 3AEUA 4H17A 3I5XA 1C7IA 3T5GA 2EA0A 4FDLA 5CYOA 5F2NA 1OWOA 2MOKA 2V7UA 1QGUA 2GN9A 2DBRA 1U3GA 3GZJA 4Z49A 1I0IA 1VC2A 2BUBA 4JVMA 3WGYA 4EQ6B 2B4YA 1OC4A 4H6XA 2XQIA 2BSXA 1LXCA 2REQA 5IJAA 4YJFB 2LKDA 3HBMA 1B43A 4O0MA 3FVVA 5IZ4A 3KLPX 4G4JA 3OCYA 1WXQA 1TGUA 1FDVA 3LUGA 1A2QA 3PTAA 3QVGB 4JLMA 4FFDA 1RI4A 4JX8A 3GLHE 2VQ3A 3OA0A 4LXYA 1N2EA 2QD5A 1JQLB 1M2JA 1VFPA 4CM7A 4G1FA 3NYQA 1AHPA 3E4RA 1WBJB 3RC2A 1XN4A 3AL2A 4O4JB 3CF0A 3L25A 1S01A 4LDPA 3TKLA 1SCKA 2EARA 3TPCA 2P9FA 2IU3A 3R7AA 1Z7BA 1D0LA 1H22A 2LGJA 2YL2A 3WIBA 4MGZE 4LBZA 1N1DA 4DDWA 1E59A 4R71A 4L02A 3RCBA 3EXEB 3JAKB 3DZFA 1UZMA 2NTEA 4UXHA 3VGPA 5IWCA 1SU4A 3KZXA 1HFEL 4GLOA 5KYUB 2D1RA 3ETJA 3NS7A 4G5XA 1Z4JA 2HK7A 3QBJA 3IUEA 1AXEA 4R4JA 3HB7A 2HV9A 4AD8A 3KL4A 3KQPA 4KMOA 1Q1BA 2IYTA 3LDGA 2H3HA 1W59A 5HJEA 3GF4A 2ZJ0A 1H1DA 3OG9A 2IPOA 2PKXA 3DPUA 2ODWA 1YFZA 2ZR0A 3G9ZA 3PUYA 4JYMA 4KQ6A 4H60A 2I99A 5TMDA 2Q6LA 3WAJA 4OLAA 3OZ7A 1CU1A 1R5BA 1CX9B 3R7FA 4BJHB 3GUYA 3OT1B 1E0KA 4QEZA 1RRPA 1Y5LA 1Y1QA 2EV9A 2BM8A 3I23A 2RI0A 3E3AA 2OWEA 2X8LA 2X9VA 3LNTA 1JTFA 2OQVA 3RVJA 4A6DA 5IH7A 4LYFA 4NU8X 3YASA 3AETA 3RUPA 4POOA 5FBHA 5D7BA 2YICA 5IZCA 4ZJUA 3CVOA 4BU0A 3Q8KA 2H7VA 4PAMA 3TLYA 3JX9A 1PM5A 4I9HA 4FK8A 2I3GA 2O7VA 3I2HA 2V9PA 4R2JA 4JI4M 1TEZA 1XL0A 5K0CA 4YCLA 1JG3A 1VDDA 2G9RA 2JASA 2DAMA 1Q11A 3GLGB 2EGGA 2HMWA 3TYXA 3LVWA 1QF7A 5JI2E 2GZDA 2RGYA 3BG5A 3PICA 4O6VA 4PLHA 3VO9A 3DLCA 4J0JA 2ECQA 2P9ZA 3C8UA 4YUWA 3KHTA 1Y4ZA 4HT3B 3DF7A 4DUYB 2UXDM 1N3LA 1YR7A 4MWZA 5JD3A 1LSJA 2YVUA 4XXHA 3T34A 1E9EA 1Y7TA 3EIFA 2PSEA 2PUHA 5EXPA 4WLOA 4ILKA 5FRDA 4IHAA 4MMYB 3COVA 4XWTA 3RUHA 3RYIA 4RZHA 5IAAA 3TB6A 3AB3A 2AXPA 2V4UA 2ZTLA 3QXHA 3OFND 3HGMA 3GELA 3Q0EA 1QM5A 1S3GA 4PV7A 4LF7M 2W93A 2AC4A 3PXUA 1W87A 3VK8A 1EB8A 1T2EA 2L0XA 3DWEX 3KNZA 1UFZA 1MW8X 3ONDA 4Q4JB 1MR3F 1GPKA 4IWYA 2B69A 1L7MA 3GMIA 4CV1A 1T6NA 2I6TA 2IX9A 3B1KA 3K30A 3A46A 4XIFA 2WWYA 2FPXA 1SCIA 4LA4A 1FA9A 2D5BA 5HRUA 1SCNE 3GX1A 3EPJA 1K08A 1ZD2P 1AZSC 2P1DA 4JWKA 4OU5A 5IKOA 1QYDA 4G0PA 5JHGB 2F8SA 3C7DB 1QTNA 1QGOA 2G1JA 1DEOA 3T9CA 1JXAA 5JXHA 1J2RA 3ITDA 3L77A 3SMPA 4E11A 2WG1A 2DFVA 1JW9B 4FCVA 1RYEA 4RKYA 1Q7BA 2P62A 3EW9A 2B9EA 3GARA 2VXCA 5IH3A 5GM2A 1KY3A 2PKQP 2DQZA 4L6V6 1BQ4A 2FWMX 3M1LA 4J7XA 2V6BA 3F3YA 1Z16A 2FSIA 2AVDA 1DL5A 2O23A 2Z2ZA 3PDUA 4UEJA 1KU6A 4AP5A 1UBMS 4WI1A 4ZYUA 3OHMA 3R76A 1EEXB 4XPZA 5E1MA 4YI5A 2EO2A 5KNDH 3QPVA 1PV4A 1W25A 2A1TS 2YY6A 2G3YA 5H59A 1TQ2A 3CF4G 3DE7X 4E4TA 2Y76A 3ROFA 4Z7OB 1T5DX 1VLJA 2R48A 1I8TA 4HQNA 4RCYA 2LH0A 3TWMA 3R6WA 4FTWA 4TXMA 2VJQA 4KE6A 2XA1A 2NX2A 1FC0A 1JSCA 2BGWA 3EFOA 2WABA 3SHOA 1WU8A 4MRMA 3SQOA 3WL7A 1KZ9A 1ECCA 2PGLA 2DENA 4U7GA 4WFIA 3FOCA 1GT6A 1KDYA 1XMQM 1EUCB 2CDNA 2O2ZA 2VHEA 2AOXA 5CVJA 1AUQA 4KO1S 1KO7A 3NRJA 3M33A 2A5DA 4RCZA 1Y9EA 2NZUG 1CJVC 2FGKA 2WRZA 3QG5A 5A05A 4D9KA 4HZUA 2WILA 1IOLA 3VX3A 3ETNA 1UBRS 4PXYA 2GR9A 4E2FA 3WWZA 3VU0A 2XZFA 4CG1A 2X4IA 5B1IA 4LGCA 4YRGA 1G4HA 2FFQA 3OMXA 2BF4A 3G2NA 4US0R 4WRRA 3O75A 3PJRA 5AHWA 3CRQA 4HH0A 4Q19A 3ETGA 3L8ZA 2YASA 4KXMA 1VE5A 1JYEA 4QNRA 4D80A 1X9HA 1E6MA 2VHZA 2I03A 3BVPA 1ISGA 3M2PA 2A5GA 2JAUA 3QI7A 1B8PA 1XDWA 2IBSA 2IP2A 3O2SB 2W70A 3T7JA 4FX5A 4C2AA 1KY5A 3KKEA 1N36B 4ZP1A 1RNLA 1PJLA 1QGZA 3FNFA 1V8OA 4NL4H 4J49A 5CM8B 4BNVA 5JTTA 4JEHA 3TOCA 4DYHA 3HLYA 1W5AA 2REOA 2CJPA 2JVIA 4IBBA 1AK1A 2A5FA 3R3WA 3GLHB 3PR2B 5KYGA 1OR8A 2QU8A 3UAOA 3R5HA 1RIIA 3H16A 4M0DA 2VDVE 3GPLA 2Q41A 1QUFA 3T0FA 3EPKA 2I54A 3PQ3A 1N7GA 3DTVD 3PWZA 4E5PA 2CL7X 2V7QA 4PX3A 1QGYA 2IOYA 4Z4GA 2IH5A 3CLSC 4XH9B 1UQTA 2JJ2D 1WSDA 3DKRA 3L41A 2UUBB 1OXUA 4RGYA 2QNRA 4F60A 1YL7A 2J5QA 4HEA6 1AF4A 4YUZA 4B3TB 5H7XA 5TRTA 1WY5A 4TS3A 3NJ8A 3ZOZA 2FOIA 3IR6A 4KO8A 1R18A 1E4EB 3ORQA 3RAPR 2KS6A 3NBQA 4HB0A 5IVIA 1CLEA 1E6WA 3KDSE 2NO5A 2ZSUA 4DAEA 4EYEA 3A6HA 3ZYCA 3HTXA 2NVWA 3DP9A 2E4YA 2F3PA 3LCVB 4AN1A 5AW1A 1KNXA 4WESA 4QNMA 3RC7A 3KSDO 4ZOCA 1MPTA 1K8YB 1SURA 3P32A 2FN8A 2J9GA 3RFCA 2VRNA 1SRQA 3SSNA 4AUNA 4DR7M 1T26A 2BTQA 4OHWA 3HJTA 4DJFC 4DY4A 2RMKA 1W9MA 4X84A 3WB1A 2VYFA 4KE7A 3BCSA 3JD4A 4H4EA 4LTNA 5KYVA 4YAGA 2W37A 4BUCA 3CUUA 1V8DA 1WUJS 3OM0A 3NBFA 4TWJA 1MVLA 5CDHA 3AR4A 4YP6A 1C7QA 2PHZA 4N40A 4ZXPA 1O94D 2G04A 2ZIXB 4H1TA 3KJNA 2IEIA 5IWAB 2E6UX 1ZMTA 4AL4A 2KB0A 3NUGA 5H4GA 1KAEA 1PF7E 3QFHA 1V8BA 3ND6A 2IDKA 4G01B 5L4LA 5GIOE 3NPMA 1WXEA 3Q3IA 1V0JA 3FUXA 1SRRA 1CQJA 5EIFA 2G6BA 4HN2A 2GVZC 5HDBB 2I8CA 2PXAA 5C2JB 4PRKA 1A0OA 1TKRA 3LRPA 4XSHA 3MWFA 3CWZA 2HIHA 2VOEA 1JR3A 1RLUA 5JMTA 1BW9B 4BJ1A 5CFNA 4BZPA 4ESEA 2ADFA 2XRYA 4J07A 3GQ4A 1GQRA 4X54A 4TQUS 1BGVA 3LPMA 4Q48A 5DHFA 5ICFA 4RHFA 4HTAA 5CLQA 1I2CA 3UMBA 3KZ1E 4XX0B 1MC4A 3QVLA 5E4TA 3DHVA 2PJRA 4B3MB 3O90A 5JH7B 3I8SA 3TIGA 2OQRA 5TSDA 1YS1X 1E1LA 4KBFA 3GJ4A 3KAJA 5E6RA 3TL4X 1DVRA 5ERYA 2YNMA 2PSSA 4BLCA 3SYKA 3IT0A 3D43A 4OJQA 4PGGA 1OLUB 1P7PA 3GCXA 3N5CA 2Q3MA 4LXXA 3TAHA 4E2YA 1YDMA 2NSJA 3NAZA 2IDMA 1DWPA 2L6OA 2NM0A 2FV8A 3Q40A 4FFOA 4GMFA 4MWOA 5HZMA 1A8SA 1E92A 2NLOA 1QVWA 4LMRA 5COAA 1DGQA 1R5JA 1IONA 1Q12A 1TIKA 4FDUA 1XNHA 1G4AE 1O6BA 4O2RA 1L3IA 1JEQB 2I33A 4RTPA 2DAGA 5LMCA 1MJ5A 2AZ4A 4ERNA 1LLFA 3ZGNA 5HZKA 5KNCH 4RHTA 1E3JA 2YVAA 4F93B 2B4AA 5A9SB 4CCWA 1ODTC 1X8JA 2A57A 2IQ5A 2QMZA 2WVHA 4LOKA 2RCNA 3SIXA 2BWBA 4DCMA 4YCMA 3CNEA 4JENA 4TWRA 5HE9A 1WVMA 4PDGA 5IREB 1CDEA 1ZM4A 3JQGA 1XRNA 3EXHB 2XODA 4U7DA 3IE1A 1N3IA 4JUIA 2AWOA 3NXKA 3HCBA 4EJSC 1AKEA 4W1SA 3TRIA 3BXFA 3IGFA 3GPBA 2GETA 3EXFB 4YGXB 1L7AA 1ORHA 4LY6A 4C01A 4B3IA 1HKHA 3DYBA 4DJAA 3QUTA 2MINB 1PN3A 3EQ6A 3HBNA 3HACA 4LE1A 1XMXA 5JYEA 2AZXA 3UK2A 1KH2A 1HDOA 1RBQA 2YUIA 5EXSA 2CHGA 1ZM7A 1GUFA 2JIOA 2X41A 3B9RA 3H0KA 2D7CA 3CMMA 3I58A 2XMDA 3O9VA 4Q01A 4X63A 5LB4A 2PSHA 3IAEA 4YAFA 1GCIA 3ZGZA 1AJEA 1SVIA 2G1KA 2F64A 4NTZA 3ZNOA 1R8JA 2PUEA 1FNSA 2P2LA 1N33B 2G17A 3O47A 2XT0A 5AI6A 4HY3A 2E2WA 3U4IA 2HFKA 3MUNA 6ADHA 4RF1A 2ZEJA 3KZCA 4J2TA 3HM9A 2MJLA 2WSYB 4BECA 4JHLA 1M1YA 2Q6KA 2NU9B 1NIJA 3UXMA 1XCPA 4KLAA 4R2LA 3TMAA 3VH4A 2GM3A 4PZUA 2OUKA 1L9XA 3CPJB 5IVDA 4YAUA 3QOFA 1N0WA 1NW3A 3A1CA 1VL2A 3FI9A 1D09A 1FUEA 3C85A 4UJ5A 5L3VA 3GGPA 3MVEA 1JYFA 3O4HA 4ARAA 4TYWA 3CMCO 5BP7A 5DEOA 3GFQA 1U0EA 5MN4A 4HWPA 1Z83A 4IICA 2IP4A 2P9BA 2BMAA 2PZKA 3VC3A 2QK4A 2VJLA 1QQWA 3D3EA 1DKRA 3HJGA 3THSA 2J1LA 3W9UA 4OI4A 1XMPA 5ARDA 4Z3DA 5DNYB 2GWRA 3VAYA 2W98A 5K99A 1AHNA 2HNKA 1UT8A 3T3NA 5JDIC 5DW3A 2BSQA 1K0FA 5EI5A 1F5NA 1YOVB 1RZRA 4R0VA 4ZOAA 2CXSA 2VJKA 2PX8A 1W2HA 3S40A 2X8JA 4KRYA 4RYLA 1N3BA 4LJ5A 3DMTA 4Y7CA 3WLNA 5KTTA 3JVIA 3RGPA 1E7WA 3PQ2A 3EOBI 3BK2A 1DKMA 4CYMA 1CR0A 1U0RA 1U2PA 1T8WA 2AUMA 2NWQA 2ZR9A 3QE2A 4Q1FA 4JI7B 3PE6A 2GNOA 4KLCA 4GOLD 4U2EA 1A8UA 4BDSA 3L1KA 2BGUA 4DR7B 5ER9A 4NX2A 3RBXA 1HFKA 1GT91 3AEQB 3PUZA 3RJMA 1DBIA 1NBMD 3DZJA 3RT7A 1KVSA 3GZTB 2HMTA 3DT6A 4MJ3A 1TFRA 4RU1A 3SZMA 2WJWA 2DSTA 3ASUA 2I71A 1M6HA 4BO1A 2HWXA 5J4LA 1AO3A 1GKYA 3N2LA 1B15A 1O77A 2FXVA 4OMDA 5AJUA 1R3UA 2AR9A 2FUG6 1JEAA 4QU5A 2NYVA 2DT8A 1JPNA 2P9JA 3JQAD 2ZSBA 2CJXA 2RK3A 4BFLA 2HDOA 4EW6A 2P35A 3C4JA 4EY6A 4GBJA 2D74A 4KN8A 3STXA 3U3KA 3UH0A 1MAVA 3E1KA 3C7AA 1GD1O 3B6EA 3EW7A 3SM3A 4MAMA 4IJEA 2J5XA 2VG8A 4QVGA 3CURA 3BGVA 3GAZA 2QV7A 2UVPA 4TWBA 4HLQB 3VVCA 3OWOA 4OJTA 2O8CA 2ZI6A 3IUMA 1NAHA 2H5XA 1XEXA 4EUNA 1BOFA 1EFKA 4H16A 3Q9SA 4OO3A 3EIUA 2JBAA 3K09A 4GEWA 1RS0A 5CA1A 1C7EA 2AZTA 3K1ZA 1KZ1A 2PX5A 3N74A 1S2OA 2XUOA 3KOUA 3OT1A 4RA9A 1YK1A 4FFLA 1TTHA 3G79A 3UJBA 2Q4DA 3PA6A 2WIBA 3ZWWA 2LZ0A 1RHRA 2C2GA 4L0MA 4MB6A 2ZE8A 5FUWA 1L1ZA 1WTCA 1U81A 2PWBA 5T6MA 5BV0A 3K9NA 1SVSA 4NZ9A 2JZNA 3KZKA 4R2WA 2X3UA 1CEQA 1KTVA 1WHTB 2GKOA 1MW9X 1BHSA 3O82A 4LC9A 5EGSA 1XXHE 2J09A 3T1QA 5INTA 1ZMWA 4RUKA 2XA2A 4HLUC 3T9FA 1E94E 4B3RB 3OTQA 2YN2A 2C84A 4IQGA 4G85A 1KMHA 1U2EA 2AQIA 2GN8A 3TL3A 3K1AA 3LF1A 3H1TA 3N1UA 4IZOA 1NVGA 4ZJYA 5A4AA 4YJ2A 1I3CA 2QD3A 2Y1WA 2IIPA 5DISB 1BZYA 2HSWA 3AEKB 2ONCA 4G4QA 3AV0B 3NC4A 4FGSA 4GYWA 4OEHA 1BDHA 2QEQA 3L8HA 4LZOA 3KJGA 3ZK8A 3KJHA 3E81A 3FCCA 3LVVA 1U4NA 2AZDA 3LQKA 3S81A 5HK8A 1QRDA 1GRQA 1R0YA 2AI1A 2WE8A 3KJFA 4OHRA 1HX7A 3CKKA 4ARZB 2P4UA 1OFIA 4MQEB 2I29A 5GGYA 3E2PA 4PNPA 3MT9A 5ESDA 6CHYA 3MCZA 1RWMA 2PL5A 4RPKA 4FFVA 1D07A 3P2KA 1N8SA 1P7VA 3SVTA 2F8MA 2WKSA 2C77A 2GS9A 1B6GA 3KZMA 2Y1LA 2GUWA 1EIZA 3D0KA 4K9OA 2FW8A 2VC2B 3O8CA 4XE5A 1IXSB 2Q50A 1YBAA 1BDJA 1G8HA 1J2YA 1LLQA 1YK0A 4QYSA 5HIAA 2O8DA 1WHSB 2G08A 1S2LA 2MGWA 1IY0A 5BXYA 5FP0A 3A14A 3QVKA 3KSUA 1GO5A 2MU1A 2J6HA 3WFJA 2VTKA 4UM8B 4HGNA 1FLNA 2FWRA 3BXPA 4KQCA 4D81A 2QZPA 3X2SA 2DTXA 2AN5A 1ZGJA 3CPEA 2Y1OA 2NAPA 1W4CA 4W5OA 3AX6A 3F92A 3WGQA 3DHYA 2XYVA 1QTIA 4W6QA 1PHRA 1ZH0A 2BFBB 1WV0A 4BNKA 5HIJA 5B7NA 4KSYA 1RQLA 3D8UA 5BMVB 4U2CA 2YYYA 3VNAA 4BNYA 4D44A 2C2KA 3HO1A 3OCZA 4QOIA 3W2GA 2VS1A 4GMDA 1BWQA 4HLCA 4IGFA 3OESA 4UNRA 4JI3B 4EFNA 2FXIA 5AVRA 4J4TA 1Q0HA 3BXOA 2R1VA 5EESA 3MCUA 2IITA 5CAEA 3U7GA 4JKOA 3IV7A 3K71B 1AZWA 4E2WA 1XYGA 4NXNB 1WVGA 3II6X 1Y4AE 1RWVA 2IZ6A 4TS9A 2P8SA 3OF3A 3L93A 4DWJA 2VTBB 4B31A 1U8EA 1VHJA 3U6KA 2FYTA 5CA1F 3UHJA 1Q6YA 4J0IA 3H6GA 4EFMA 5BQ5A 4M9RA 1G1MA 5BPFA 1TK3A 4LNUB 1VCHA 4ISCA 3AVTA 2FEWB 3VYVA 4FYIA 1ZICA 4MVJD 4M0EA 4MGEA 2DHRA 5CJ2A 5CCXA 4K9SA 3U2QA 1UZUA 5CJJA 4D9NA 4JL6A 5AOVA 3AC0A 3P2EA 5AKZA 2VBFA 4D9MA 2VHXA 1RYHA 1K06A 4LZWA 2Y21A 5LMUB 1FDIA 2CLKB 5DNAA 4HB4A 4ME6A 4LYDA 4QFDA 2ZAGA 4JYAM 4OLHA 4RK7A 3K70D 3QVVA 4CUZA 1GNSA 3QFTA 1ESEA 4MGHA 4M1ZA 1SR8A 1M8PA 2I0FA 3OZBA 3IBFA 4F85A 5AJZA 1HNXB 2PLWA 2XB9A 2FPIB 2PUVA 2DWMA 1E89A 3QENA 1E5TA 7YASA 4BZXA 3WNVA 5CNMA 5TE9A 3HCRA 4MDYA 5EJ2A 2HJWA 2WYHA 3BN3A 2D0PB 3LV8A 1NHWA 3ZE7A 5JY1A 3AJAA 5ALFA 1XNRB 2GN2A 3UHFA 3D3KA 3AKEA 1JMKC 5DEIA 3EXFA 2I8LA 4F4DA 3V1TC 3AWIA 1YKSA 2LUOA 3BGDA 1QB8A 3U5ZA 2JFUA 4QOSA 4U2GA 4EO9A 4PS0A 1MHPA 4HDKA 1DUIA 4N8SA 4MRAA 2D7JA 3HH8A 1ML4A 1O87A 4IY1A 3GGCA 3P9IA 5C7YA 2GJ8A 4JT9A 4Q9LA 3QVWA 3OLCX 4PBTA 3UK1A 2RHHA 2HEGA 1FDOA 3ABSB 1J09A 1YSYA 4A2WA 4JZKA 1ZRSA 4M9UA 3EULA 2C2BA 2HA2A 4I9UA 4AQYM 2O2EA 3CEPB 2NO9A 3E0QA 3LCRA 3MJFA 4HDSB 2YZKA 3O4IA 4PWYA 1SKMA 1QVVA 1JEEA 1YJAA 1GOTA 1OAIA 1GGEA 1I33A 3C74A 2PGNA 2QL6A 5ICCA 2Q62A 4M1QA 5E6UA 3UWOA 3PXEA 3WK8A 5IABA 5L8RF 1U7HA 3WWPA 1PWYE 3VC1A 4CMCA 4C03A 4HJXA 4J0EA 1A7AA 1OFUX 2F4VM 3B3FA