1OFIA

Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
309
structure length
299
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of an Asymmetric Complex between Hslv and I-Domain Deleted Hslu, a Prokaryotic Homolog of the Eukaryotic Proteasome
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
total genus 84
structure length 299
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ofiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ofiA01
4XWAA 2NQ2C 4MKIA 2NMVA 3QXSA 3MGCA 4IVQA 2PJRA 2QL6A 3NBXX 1T4GA 2ZM5A 3R9IA 4LHYA 2CCKA 1VHLA 3MMPA 4PANA 3VMFA 3K0CC 2WWIA 2GCPA 1S0UA 2D2EA 4CEIB 4PR0A 1AIPA 2AKAB 1A2BA 2HT6A 2QROA 3W3ZB 4IDNA 2ZE6A 2REBA 5IRCD 1NN5A 4V02A 5EP4A 2RB4A 3MJRA 2YOFA 1JR3D 3W8RA 4MKFA 3GLIB 1TU4A 1OSNA 2WPDA 3IUYA 4NTZA 2R44A 4BLPA 1OPXA 2FX3A 2QP3A 4EJSB 1DTSA 2YKGA 3GLHA 4HEJA 4UXIA 5JEEA 5A4JA 3A4MA 1VIAA 5FBRB 2BKEA 4Q1FA 3RRMA 4A82A 4E07A 1J90A 3ZDQA 1NBMD 3NDBB 1NJGA 1SKYB 1Z22A 2WIBA 3NKVA 2I3BA 2JJ8A 2RHDA 3R8CA 1E1QA 4F38A 2OFWA 5TB5A 1NY6A 1QHHA 2E87A 2OFXA 1TQ4A 121PA 2CJWB 3O8CA 3L0SA 1E2FA 3T35A 2VQSA 5JWHA 4URZR 2XJ9A 3TE6A 1FUKA 2WKPA 4OQFA 2FZ4A 4IDQA 1KY3A 2F9MA 1ZUHA 3ZLJA 3GD7A 1CRQA 4GITA 4KVGA 1G3MA 2O8CA 3FKQA 4S35A 1UF9A 4HB4A 1M7BA 2LKCA 2B8WA 1F60A 1Z83A 2XZPA 3BERA 3WNCA 2D74A 1TF7A 3SYKA 1FX0A 3BGWA 3KFXA 2FV8A 1YZGA 2XAUA 4IDOA 4IDPA 2DWQA 2REXB 1YZKA 2JJ2D 1G8HA 3QXXA 4OHVA 2IYXA 5LB4A 2J0UA 3RDPA 2A5GA 5DYIA 3RS5A 4H1UA 2EVWX 4QJ5A 4JLPA 4P32A 3P20A 2QN6A 4BFXA 1E98A 2VSXA 4Q9HA 1Z6YA 1NL3A 3KTAB 4U7DA 3V9PA 1AQYA 4UNSA 1EESA 1KMHB 1O87A 1U90A 1YU9A 3CRVA 2OM2A 2BMEA 4M1MA 1QZMA 1T0JB 3ZVRA 1KOFA 2ZEJA 4O2RA 4DSNA 1G8FA 4IKEA 2FSFA 5DE3A 2R62A 1Z47A 3LBHA 4IEEA 4RKFA 5KYKA 1T8UA 1TX4B 4C0HA 4Q7JB 1WB9A 4C0KA 4JBYA 1G8GA 2BOVA 1G41A 3ZVLA 4D80A 4RZXA 1J2JA 2KBFA 2P6RA 3GLHB 1HQYE 4A8JB 1S9HA 1E2IA 1CEEA 2P2LA 1ZBDA 4QGGA 3IIMA 2IYTA 1SHZA 2DYKA 2GRJA 3H1TA 3FMPB 3ONWA 2AN9A 3T61A 2FFHA 2MMCA 2WWGA 2AHOA 1Q57A 2GCOB 1GL6A 3OIWA 3LW7A 1K5DA 2ZJ8A 3EZ7A 4TLDA 1G21E 5FTJA 1KI4A 2ANCA 3AP3A 3PENA 1HH4A 4FW9A 4WZ6A 4AG6A 4EKDA 4OHZA 3ADCA 3IQXA 2PZFA 3RRZA 1NMYA 1QHNA 1VDZA 2DWZB 1XMIA 3GJ8A 621PA 1ZW6A 4KSCA 3KL4A 4ASUA 5L8VA 4FCTA 2DHRA 1J8YF 5H1YA 4MGYR 3WYAA 2EQBA 1MKYA 2KJQA 1E1QD 1T0HB 1Z2AA 4ON9A 4PXAA 3EPLA 5JJIA 2OV2A 4EUNA 1D9ZA 4GI7A 1E9EA 2A9KA 3HP1A 3PITA 2WIAA 1EXMA 2GILA 5CDFA 3CPJB 1OXTA 4DLSA 5EQTA 1KI6A 4HAZA 1XP8A 1VCOA 3K0CA 3EIEA 4UNPA 3X1YA 1N6PA 1Z0IA 2OCBA 5GJBA 2PZGA 1KSGA 1DAMA 2J0QA 4C7OB 2G3YA 1IXRC 2W2XA 1II0A 2WTUA 3WXMA 1ZYUA 3GEEA 3D8BA 3Q7PA 2ZS7A 4WA7A 4B3XA 1DAEA 2GAOA 2Q9CA 1LW7A 3L8ZA 2HEIA 4N0DA 3CONA 3SOPA 4LDJA 2JLQA 1BH2A 3QQ5A 5DN6D 4RY2A 3P26A 2ANBA 2FPMA 1GP2A 4KBFA 4RSGA 5FBLB 2XSZD 5KDLA 3AKDA 1PJRA 3WY9A 4D4MA 4YXWD 4BGDA 3BJIC 4KBGA 3I62A 5J4HA 421PA 1N6KA 4Z1MA 2PZEA 3W34A 2GXUA 3GLGA 3I73A 2WWFA 3QI2A 1CJVC 2ZJBA 2Z43A 5IK2D 1SVSA 4C30A 4DDUA 4DDWA 2VP2A 4C2UA 1FTNA 1YZUA 2UKDA 1SVLA 1HURA 4QNMA 1DAGA 1II8B 1S4QA 3OESA 3TUJC 3SJBA 2ZSAA 3P4XA 2H8KA 3QY0A 4OL0A 2IA5A 4PC3A 2ZRKA 2VF7A 4B3DA 2HF9A 2XNDA 2CJWA 3B85A 1Q0UA 2ZUDA 2BC9A 4PHHA 1U8YA 1J7KA 2W0SA 3UG7A 4ESVA 2XGJA 1JR6A 1W4BA 1XTIA 4GFDA 4IDHA 5AWFC 2SHKA 2VHQA 1KI9A 2P65A 4CGZA 1Z6TA 2IEZA 1G19A 1R0XA 1ZD8A 3OFND 1KSHA 3I8XA 4LJ7A 1N6RA 2CLSA 2EW1A 2IX3A 2IC5A 4BRUA 2XXAB 1ZIOA 3QKTA 1E2LA 2PT7A 1G7RA 2PBRA 4JS0A 1W1WA 4GOJA 1JNYA 1ZUIA 4HLUA 4AKHA 1R0WA 1TTTA 2DWPA 2FNAA 2BM0A 2VH5R 4LC0A 3W6OA 3KKQA 4Z54A 5BN4A 4WXPA 3VNVA 4LJ5A 4E22A 3ADDA 4A0HA 3LVQE 3ZQ6A 3QKUA 5AUPB 2N46A 1ZD9A 1E9AA 1HE8B 3O8BA 2FMXA 4JJKA 5CITA 5FTLA 3FE2A 3NBYC 4GSYA 2O8EB 4AG5A 4R7ZA 1GTVA 1R5OA 4NONA 1IJFA 2ZJZA 2CL0X 1TAGA 1N6IA 1ZU4A 5SZKB 1W47A 4P4SA 3T15A 4C0BA 1OLOA 2IXGA 4Q9KA 3HR8A 2V54A 4RCYA 1T91A 1R8SA 1YZQA 4G01B 2VP0A 1GRRA 1KI6B 1Q20A 1NI3A 4C9BA 1D2NA 4MRPA 1S96A 4K8OA 1VG9B 4HZUB 3FFBA 4DLXA 2F55A 1GKYA 2DCUA 3GPLA 4OK6A 1RE0A 3QBVA 3UXMA 3D6TB 1G7CA 4KFRA 4KJZA 3LXXA 1X6VA 4Q4AB 2ZI5A 2NO0A 2WSMA 3AM1A 4M53A 5CYOA 1KK1A 2J0VA 5HKKA 2W6JD 1JJ7A 4OI4A 1IAQA 4YXWA 4R2IA 5CDFE 4PPFA 5A0FA 1CJUC 2O8BB 1F2UA 3CH5A 4NMMA 5LB2A 1UBFA 3CZPA 4GNKA 1U8ZA 5FFMA 4BZQA 2BCJQ 3FMIA 3NTUA 4D4LA 1J70A 3FYHA 3IKJA 4JBXA 1NRJB 2GETA 3A37A 4XSHA 2C2HA 1E0SA 4PC6A 1ZCAA 2DFNA 2G6BA 3RLFA 3QKSB 5HCIA 3TAHA 5FOXA 4ZI3A 1Y63A 1GVNB 4BECA 4ACBA 4GBMA 2FGKA 1KAOA 1XCGB 2OT3B 4WVFA 1UFQA 4XSGA 4DDTA 1HE1C 4Y0AA 2JDIA 4IFEA 4HB2A 3EA5A 4DJTA 5LD2B 4WW0A 2C77A 3AVYA 2ZYVX 2ODEA 2QAGA 1ESMA 3D3QA 4PQFA 5B30A 4M9SA 3BRWD 2NO1A 2OAQ1 4TSFA 4A36A 4A2QA 2ZROA 1XEXA 2DBYA 2NZJA 3C41J 2XTMA 1ZMXA 4KV9A 4N1AA 2QTFA 2VHCA 3PQCA 3DEFA 1RVDA 1KMHA 3GLFA 3NG1A 5P21A 3BB4A 4WIAA 4BE7B 5FUWA 2UZIR 4LRWA 5B2ZA 3AGPA 5FL3A 4D6PA 3N5CA 3NH6A 1NG9A 5EXTA 4I81A 1FQKA 2GA8A 5EXPA 2R9VA 3LQRA 1F6BA 1G6HA 4QBGB 1G3IA 2ZRBA 2XB2A 4GOKA 2F1RA 2I1QA 3JZAA 4DDVA 1NVVR 1R5NA 2J0UB 4DUGD 4QM7A 1UAAA 4DLTA 2CHGA 1IBRA 2IYVA 1G3RA 4HZUA 1RRGA 3KXKA 3OFNA 4JMPA 2W83A 2EFHB 1ZUNB 3HU3A 4DLZA 1P2TA 1T3LA 2O0KA 5EP2A 2ATVA 2EFGA 3QF7A 3EARA 4M1SA 4MKHA 3I61A 2RGCA 4A6XA 2IHBA 2OLJA 5FOVA 4G5SA 2OESA 4FIDA 3UWOA 5DI9A 4KU4A 1C1KA 2PJZA 2R6DA 4ZDWA 5CB6A 2QU8A 1JEEA 4LV8B 3Q5EA 3FDIA 3KZ1E 1W44A 3F3YA 2R2AA 2IYQA 1UJ2A 4G5QA 4TZ0A 1VYUA 3UANA 2WWHA 1TPZA 2GDJA 2NO9A 3ZJYA 1MO5A 3NBFA 4MRVA 4LGMA 3MD0A 5KNCA 1YR7A 1OXSC 1OXVA 2IYSA 2NG1A 2OAP1 2RHMA 3KTAA 1YE8A 4URUR 2XOKD 4ARZA 3PIRA 1EX7A 2ZE7A 4MGIR 3K0SA 3GEIA 1ETUA 1XBTA 2V6ZM 5JFGA 2ONJA 2R8RA 3E1SA 4ZV4A 2YINC 1OV4A 4US1R 3TKLA 1CS4C 1IHUA 2XSZA 2RH5A 4DRZA 2HJVA 5K8IA 1M8PA 1DAFA 1RKBA 4NYIR 5SZIA 1KI1A 1M7GA 1IY0A 3MWLA 2YVUA 4PAQA 2CL6X 2JGNA 2QT0A 3H84A 4EAQA 1CIPA 2RGXA 1PUIA 1E6CA 5TY0A 4IVPA 3HU2A 1GOTA 2GJAA 3PR1A 1Z6AA 4NP6A 4AWXA 2ZR7A 3QPUA 1E2NA 4NCHA 1E94E 3GLGB 1U9IA 3IQWA 3IDQA 1SXJB 1N2CE 5E95A 3EPKA 1UKEA 1P9RA 1UBEA 1KI3A 2OHFA 1ZJ6A 4NYMR 1CR1A 3PUWA 3BOSA 2ZXUA 1XD2A 2KE5A 5FBWB 1TADA 5JRJA 4DWJA 1KKLA 1ZC4A 4LX0A 5BXQC 5F9HA 2B92A 5EXXA 2IWHA 1D8TA 1N6LA 4LHWA 3ETLA 2ZETA 2C03A 2AD5A 2IWRA 4YQFA 1LF5A 1KO4A 1R5BA 4D4KA 4V0KA 2QMHA 3CF6R 2FFAA 5AUQA 2DY1A 4JT4A 4B48A 4N0EA 5DGXA 1X3SA 3VR3A 1OH7A 1Z6XA 1Z6GA 4UJ5A 3UATA 3LBNA 1U8AA 4FXPA 4NDZA 3W5IA 2VSFA 5AJYA 2MMGA 3BWDD 5M04A 3RAPR 4RD4A 1EK0A 2GESA 2VA8A 3U3KA 5L3QA 2XTNA 2ZJ5A 4NHOA 3A1VA 1Q1BA 2B21A 5G3ZA 2P3SA 4JLBA 4XIGS 5DIFA 3H86A 4XJXA 4AK9A 3MSXA 5BW8A 2FJUA 1PZNA 2GWHA 2VBCA 3TK1A 1XTRA 1XEWX 4RD6A 4XD7D 4FD2A 4PSAA 1UBCA 4BEBA 4F4CA 2IYLD 2G0NA 2EWVA 1G8YA 721PA 2FDCA 3VKGA 3SBDA 3OEHA 1K6MA 4A0GA 1S1CA 4OQMA 2OBMA 2H57A 1XPUA 1U2RA 2ZRJA 3MFYA 2RGEA 3CRW1 2IYYA 2W2VA 2ZE8A 3DKVA 3WYFA 4UXJA 3TVTA 1E1RA 2ORWA 2PT5A 2NO7A 4KHZA 5L3VA 5B64A 4B3CA 3QKSA 4Q4AA 4PAMA 3U2QA 1IY1A 1GNQA 4TTRA 3SZRA 4XH9B 1QZXA 1H8ED 3CX7A 2QG6A 3PUXA 1NVWQ 4Q21A 3KB1A 1SVKA 2J46A 1VG1A 1WF3A 1L2TA 2W00A 3QVUA 4JVSB 2R6AA 4C0JA 1G9XA 1CKEA 3HWSA 2WJGA 4ITRC 4NBSA 1JJVA 1JR3A 3AF1A 1EFCA 3KDSE 2JLVA 4RD1A 1G1MA 2WWXA 1MABA 4A0RA 1GKUB 1OH6A 2OILA 3QKRB 4TL6A 1OHHD 3JVUA 4QRHA 4YMUA 2OBLA 1KZGB 2LCFA 1YZLA 2V8OA 4HUQB 4YMVA 1C9KA 1V5WA 3DKPA 4Q7LA 3VFDA 1EG7A 2AKYA 5K8LA 1ZNZA 1SXJE 5KUTA 3KJEA 3PUZA 1P5ZB 2NOAA 4FMBB 1CF4A 4KAXA 4K81B 3PEYA 2X19A 3BFKA 3I8SA 2V7QA 1KDRA 2YC2C 1Z06A 4N3NA 4A92A 3ZD7A 4UJ3A 3B9QA 2RKOA 3B8HA 5JLJA 2JASA 3K9HA 1W0JD 2Q3MA 3FWYA 1GILA 3QPVA 4QM6A 5DI3A 4TMVA 1KGDA 5JS7A 5EUQB 1J8MF 4O3MA 4YLGA 4I1UA 3BB1A 2FPKA 3DHWC 4TTPA 2FWRA 4GP6A 3DVLA 2DZNB 1S8FA 2ONKA 1HEIA 2I1VB 1FFHA 1XJCA 3B6EA 1NMZA 3RWMB 1II9A 4B73A 1FTSA 4BFYA 4FWTA 3C4JA 3FKSA 1TQDA 1RFLA 4PC1A 1E9DA 1FW6A 1KSFX 5FBVB 2OCPA 3CB4A 1ZINA 3V4RA 1VCMA 1KNQA 2DWOA 5C1BA 1XTJA 2YZ2A 3B1YA 4M4SA 3THYB 4NYMQ 2A78A 3VX4A 3ZIAA 1P9NA 2O8CB 2NTYC 3K0AB 2JLUA 4POAA 4DIEA 4ZKDA 2KRKA 1S3SA 3GLIA 4TZ6A 3J81k 1AGRA 3Q85A 1KIMA 1NLYA 1OXUA 1NN3A 1UDWA 3BK7A 3VTKA 5TMPA 4C0AC 1XCPA 5JCPA 3L82B 3IO5A 3LX5A 3NIBA 2ZANA 4DT1A 4WOPA 1A2KC 2ZRCA 4MYUA 1XJQA 1E2DA 2QRNA 2ZE5A 5BYJA 1P61B 3Q3JB 1Y3AA 4OI0A 3CBQA 3DZ8A 3EC1A 4LBVA 4MRNA 4LBWA 5FPHA 2IF2A 2BDTA 4IRUB 1N5LA 2CHVA 1NMXA 2Q9BA 4BFUA 2FU5C 5TVKA 3AVOA 5CJ2A 3DL0A 2J0SA 4PHFA 2R6GA 2J9RA 3QJYA 3W6PA 4LYAA 2V3CC 1W0KA 4MUBA 4LWZA 2L0XA 4I1VA 3LLMA 3PV0A 3AVTA 4V0MA 2GXSA 1W2HA 2DZOB 3PFIA 1NN1A 4EPTA 5FBQB 2W6ID 2GCNA 3IGFA 1EFRD 3TQCA 4D0NA 2B7CA 4PSKA 1EFHA 2VEDA 3X1DA 3I1FA 4P4SB 4ERNA 4MGZR 4WAUA 2QP4A 5C2JB 3SN6A 1Z29A 2QM8A 2V6JA 4PO1A 2O0HA 4BWYA 4LUCA 4OQNA 4B32A 1XPRA 3G5UA 1NJFA 3N70A 3NBZC 2HUPA 3SYLA 1OIWA 2C95A 1G3QA 5J4YA 3SQXA 3A36A 3JVVA 5JBQA 1VIYA 3LAWA 3CX6A 5G40A 1JI0A 3IBYA 3ZD6A 1NSFA 1Z28A 3TH5A 2FN4A 5IDVA 3GLHE 3AJIB 4TSFD 5CYPA 1BKDR 1LFDB 5KNBA 2IF0A 4B76A 2WICA 3CUEF 1JXOA 3A1WA 2IUTA 3CPHA 3FHOA 3K09C 4RCZA 4EFMA 2J3EA 5DYGA 1TF5A 4DCNA 2YOGA 4DVGA 3TVDA 4F91B 3HJNA 2Z5FA 3TSWA 4JLMA 2CCGA 2ZVPX 1DS6A 3EW9A 3BAFA 4M22A 4OKSA 1OKKA 4HLUC 2A5YB 2GNOA 4BUJA 4JKYA 5KDOA 4A1FA 2VP4A 5FOWA 3U3MA 4CEJA 1W4AA 3BXZA 4TLAA 3RS7A 4NZYA 4L9WA 1Q22A 3QIAA 3NC0C 4AD8A 2H92A 2XZLA 4OHYA 2O8DA 1AM4D 1NVMA 2YWGA 4AY2A 5IF9A 1FPMA 5KSOA 1FP6A 4BRWA 3VHLB 1ODFA 4OK5A 1P62B 2AR7A 1GRNA 3UWKA 2GTPA 3ZVNA 1AA9A 2ZU0C 4CVNA 5FI0B 3B1VA 4V0ME 4BFZA 3SFVA 1R8QA 2KSQA 4PC2A 3DPUA 2PEYA 1P9WA 2Z0MA 1IN5A 2YWEA 5KHOC 4AYWA 2F9LA 1DG1G 5SZHB 3T06B 2QEQA 3TW8B 2EU8A 5CM8B 4V0OA 3IO3A 2WOOA 1XNJA 5AR1A 1KK2A 2WWYA 4OI1A 2ZRGA 3SR0A 1GSIA 1CTQA 1C4OA 3WMFA 1IN4A 1Z0JA 2JLWA 4OJQA 4GMDA 5D3MB 4US2R 2QPOA 2Q3HA 2BMFA 1YRAA 3D31A 3IIJA 4LV5B 5J4VA 2IS6A 1OKKD 2QPTA 1COWD 2F6RA 4LJ9A 4TLEA 3RHFA 4BLRA 3AVVA 3TBKA 1DE0A 5TARA 5JJKA 1ZIPA 3IBGA 1W5TA 1G291 5GVSA 3K9NA 5G41A 2C9OA 1I4DD 1CJKC 2OXRA 5GJCA 2X2EA 1QG2A 2IYUA 1TNDA 2IYRA 2YHSA 1FOEB 1P3JA 1KJZA 4H1VA 1E2JA 2BBWA 3HU1A 4KLNA 4PAOA 1E2EA 1OJLA 1EWQA 4QJ4A 2WHXA 5DSZA 4DEYA 4HZIA 4JKIA 5C46F 3TSOA 2WSSD 3C16C 1WE2A 3K70D 2OO7A 3CPEA 1ZNXA 1BO6A 4M1TA 4O25A 1G8PA 4RVCA 2ORIA 3BB3A 1NIJA 2ODWA 4M1KA 2IXEA 1RYHA 3CX8A 1PLLA 3U7FB 3DO6A 3K53A 3LA6A 5JS8A 1WBDA 2FEOA 2XITA 1P72A 4MYTA 2IHYA 5DO9A 2GXAA 2NO6A 1AJEA 4LCBA 1EWRA 2OFOA 1I4LD 1QRAA 4Q7KA 1E2PA 1CR2A 1T5LA 3EA0A 3ZIAD 5HZHA 4TMKA 2VIIA 3U7HB 1W46A 2QGZA 4QL3A 1OE0A 5TXGA 4HLCA 1NIPA 1GZSA 4FMCF 5IK2A 4BEJA 4PHTA 1G5TA 4I4LA 4G5GA 2CE7A 3UMFA 2WJHA 2V1UA 4RKEA 2QZ4A 1ZNYA 2WM9B 1SHKA 2A3RA 4JN6A 3QKRA 3RABA 4FCVA 3C15C 5EE9A 3ZZUA 4TYWA 1EFRA 4KYIB 4Q03A 2O8EA 4JT2A 3GJ6A 1VYTA 3DMDA 5FTNA 2Z6VA 1NG1A 3FTQA 2JLZA 4Q4LA 3SJAA 3OHMA 3IILA 3AP2A 4HYYA 2QUZA 2WAXA 2VHUA 4D82A 2CHQA 1KZ7B 4NE2A 4BLTA 2HT1A 3G0HA 3SNHA 4URYR 3RRYA 4TL8A 4JLKA 2V9PA 2GCOA 2OLKA 1H8HD 2V6IA 5IHPA 1FNNA 1WQ1R 1HA3A 2J7KA 3WHKA 1W4CA 1OIVA 3ND8A 4PHGA 3TMKA 3KUCA 4MRSA 3OF5A 3REFA 1EFUA 3RS3A 1FQJA 2NGRA 1OH8A 2KB0A 4GDFA 1E2HA 2CL7X 1T5IA 4Q4HA 4ZI2A 1QBKC 5HZKA 3THYA 3SC3A 1XCMA 1R0YA 1J99A 1RIFA 4JLDA 3AF2A 3KUDA 1KKMA 1LS6A 5KPJA 1Z0DA 3V00A 1G3UA 1I2DA 2ZYUX 4FMCB 1NY5A 3VU9A 4MRRA 3LVRE 4ZKEA 4TL7A 5CLLA 1GNPA 2QMUA 1F5NA 2Z4RA 4JVMA 3BH0A 5LD2C 3GFPA 1Z2CA 4H9GA 3X1XA 2EYUA 4TMZA 1KDTA 2IYWA 2P6NA 4KFUA 1QHSA 2JEOA 2WAYA 1KJWA 2QNRA 1CR0A 3WHLA 1VYVA 1MR3F 4EPVA 5HTKA 2QTVB 5J4LA 2ECKA 4TL9A 5LBIA 3P1JA 1GL9B 3UKDA 4URVR 4TQAA 3A4NA 3WYGA 4FMDB 1Q44A 1TUEA 1W36B 2CNWD 1M2OB 1L8QA 821PA 2D2FA 1TL7C 2ORVA 3TAUA 1RPZA 2IL1A 3K70B 1SVOA 4U5XA 5EE0A 4PX9A 2RGDA 1KJYA 4Q1CA 4TYNA 1IN8A 3BD9A 1LTQA 4FCWA 1XDBA 1XWIA 4CEHB 4JYBA 3KKOA 1YJ5A 1DADA 1X8LA 2ZJAA 2GK7A 2IK8A 2E9SA 1VHTA 3U3OA 2AD1A 3KW6A 2EFCB 1HQCA 1SXJA 1IONA 1ZM7A 4IOMA 1LY1A 2ZI9A 4HDCA 3ZZ0A 1K5GA 5H8WA 3MWJA 4DSTA 2CLDX 2VLIA 4QBHA 3RS4A 1SKQA 2PMKA 3I32A 3GLFE 5DHAA 4DZZA 3MWYW 1F48A 3K0AA 1U9IC 3Q5DA 2ZRIA 3CWQA 4BASA 2CBZA 5AK0A 1KYIA 2A30A 3UG6A 5GJVC 1S9DA 1E0AA 5KO2A 2MSEB 2WPDD 2EFDB 2KWIA 1AZSC 2XZOA 3GJ0A 4XD7A 3R9XA 4Q19A 4PC7A 4NL4H 3CRMA 1SGWA 4LI0A 4G3XA 2ZSEA 3DDCA 4LYJA 4R71A 3IPYA 5HR5A 1EX6A 1N6HA 4AKEA 3TR0A 3AP1A 4OQLA 2P67A 1E2QA 4KSBA 4US0R 3BFXA 2N42A 2JIZD 2ZRHA 5D3MA 1BMFA 3KXIA 1KO1A 2WZQA 2FF7A 2ZRPA 1G4UR 1P2SA 2YWFA 1BMFD 3CH4B 5H70A 3THXA 3LY5A 3Q8XB 1PLJA 1OFUX 2CEAA 4QBIA 4D81A 5CB8A 4TN1A 4UQOA 4DCSA 1RRFA 2Q0HA 3AF0A 4DCUA 2GK6A 5KNDA 1PUJA 3KKPA 2D7CA 1GKIA 1JPNA 4LBYA 3T5GA 1E79A 4CRWB 5BWMA 3E2IA 1DEKA 4NYIQ 4C0QC 2R6CA 2W58A 3LWNA 5L3QB 2VL7A 2CLCX 1WBBA 2GF0A 4KCGA 3TUIC 4CYMA 4B43A 3T1QA 3KQNA 4W5WA 4OK3A 1FMJA 1E3MA 1KAGA 1GDDA 3M1IA 1HT2E 5CIWA 4DLRA 4DUGA 1IXSB 3U7EB 3W6NA 3MAAC 3EZFA 4B47A 4ZPXA 2F1HA 4F7WA 2ZI6A 4E03A 5E7IA 3H2YA 3VHXA 1I2MA 4RZUA 4D0LB 4QBFA 1Q12A 1P4SA 2FGJA 2W0MA 4DCVA 1XF9A 2AK2A 2LWIA 4GP7A 1KDOA 5F98A 3KQUA 4TYPA 1KK3A 2G83A 3OE7A 4R9UC 3L0PA 1JPJA 1QG4A 2ZRMA 3U3RA 1KHTA 2GF9A 3OEED 3RC8A 2BCGY 2NPIA 1G20E 4JBWA 3SBEA 1OFTA 3VR4A 2DPXA 3UPUA 3QOFA 4M9ZA 5KSPA 2VSOA 2ZS9A 2ZYWX 4FI3C 1NF3A 4PQRA 1PVOA 1W4RA 3B7GA 4RJLA 3VAAA 4AYTA 5AJZA 4FWDA 2ZI4A 2X2FA 4JSTA 1WDTA 3L2OB 4MGKR 1ZC3A 1G16A 1VMAA 2H1LA 2QQEA 5KU1A 2QSZA 4L9SA 4RD2A 1RC8A 2ZVQX 2FPLA 3WNDA 3HDTA 2GEDA 4B71A 2CVHA 2HV8A 5EZ5A 3WMEA 1X8KA 5CM9C 4OYHA 4P4UA 4RFSA 4JL8A 2HYIC 2V1XA 2NIPA 2O5VA 3QG5A 4QGAA 3VR1A 4IHQA 3CF0A 2WVJA 3QF4A 1E9RA 4Q1AA 4E09A 2WV9A 1A82A 4I1SA 1S1MA 1SZPA 1AS2A 1R0ZA 4JZKA 3EXAA 3AH8A 4Q02A 3OIYA 5J5CA 3BH7A 3S1AB 4MYHA 2C9CA 2O8FA 2YNMA 1TUIA 1Z07A 2VP6A 2R65A 2RGNA 2H17A 4HDQB 3H4MA 3RYTC 4YDSA 3ASYA 5KTYA 1E96A 2ZPTX 3QG1A 4LPSA 3AV0B 4TLBA 1UKYA 3AGQA 3THWB 3O8DA 1OYYA 3L43A 1SQ5A 4PZYA 4YMSA 2NPFA 5G53C 3K0FA 4UXHA 3WBJA 4JL5A 4O0MA 3A58B 1XTQA 5CJPA 3PEWA 4IOJA 4KFSA 2J87A 1DBSA 3GFTA 3LQQA 2GJ8A 1QHXA 1UADA 2IT1A 2DFTA 4DC9A 3D7MA 1GAJA 4V0LA 2Q3FA 4S2EA 4BZXA 1SVWA 3UMSA 4FWHA 2OEPA 4JLOA 4HLQB 1MRNA 5J4KA 3M0EA 2ODBA 5FR2A 8OHMA 4B2PA 4M21A 1WRBA 1EFTA 1KY2A 1XMSA 5G3YA 3GLFB 2CMKA 3BORA 2QI9C 3WRXC 1QVRA 2BBOA 4OQXA 5KDDA 4HSEA 2C04A 4MKGA 3RRNA 3NH9A 2C78A 4FWIB 1G18A 1MABB 3W8NA 1A1VA 3Q72A 2A2ZA 2HXSA 2ZIAA 3WNBA 5DH9A 3QXHA 2J41A 1YR9A 1ZM4A 4KI0A 2DFLA 2GAAA 3EG5A 1P73A 4XOIA 1G4AE 2REOA 1Z0KA 4R98A 3KQLA 1G6OA 5HKKD 1YZTA 4G5OA 1RYFA 4GZLA 4B33A 1XTKA 2RGAA 2YOHA 1JEDA 1KDPA 1BIFA 3A4LA 3C8UA 2EWWA 2J59A 1QVAA 3FHTA 1Z8FA 1BS1A 1N5KA 2B8TA 1N3BA 1DARA 2QSYA 1YZNA 4ILEA 3B1ZA 4MQBA 4Q1DA 5F3WB 2ATXA 1ZM9A 3RSLA 1EGAA 5GADl 4ESHA 1IN6A 4MUAA 2A5FA 1COWA 1Z5ZA 1FP7A 2QY9A 3L0OA 3KJHA 1UDXA 2YC4C 2JDID 1GIAA 2QENA 4QKQA 3TJZA 2GVDC 4NCNA 3VR6A 2D4HA 2QORA 1ANKA 1VCIA 1M6NA 1W36C 3WP1B 1RRCA 1UEJA 5FPKA 3U44A 3AUXA 5KSYA 1KO7A 3W90A 2QPAA 2F43A 5FUYA 1T6NA 3ZS9A 4GRAA 1WCV1 2D7DA 4Z8XA 2BMJA 3QVVA 4QC2A 3CIOA 1I4TD 3CW2A 2H18A 4PFSA 3PUVA 5BQ5A 2GZDA 3A1TA 2A7QA 3NHBA 2OCAA 4L5BA 2XNSA 1D2MA 4DSUA 1E99A 1MO4A 3MCAA 3ICEA 4QJ3A 1UKVY 4WZAE 4MYCA 1MO6A 3ADKA 1CXZA 3THWA 1JXMA 4HAWA 3EPHA 1CJMA 2XB4A 4F92B 1F2TB 3Q7QA 1WMSA 2G1KA 3K9LA 4KFTA 1AS3A 4YC7A 1NN0A 1U94A 1GITA 3DZDA 1BOFA 4C4PA 3T1VA 4C7OA 2CK3D 4B3FX 4NCJA 2ZU6A 5EE3A 3K1JA 3AKYA 4DLYA 2VO1A 4IJMA 3K0EA 1ZVQA 2BEKA 4JVNA 4KLZA 1GWNA 5FOSA 4CW7A 5ANRB 2RGNC 3RVBA 2IW3A 2W6JA 4TMTA 1RRPA 5EZ6B 4OHWA 3EZ6A 4AIIA 2WMNB 3P27A 2J5XA 4HDOB 1N0WA 3X2SA 1X1RA 1U98A 2ERXA 4C2TA 3QEOA 1LS1A 3RS0A 4Z8YA 2C96A 3RANA 1KSJA 2G9NA 1Z08A 5IT5A 4CT5A 4PTLA 3TGPA 1F2UB 4ARZB 4IOLA 3ECCA 3M6AA 1JQJC 3LV8A 2HDNB 1E4YA 1JQLB 1L4UA 5AJVB 4Z1MD 5JJLA 2X77A 3PVSA 2JA1A 4HAYA 1R2QA 2G0TA 3VQTA 4V0NA 4M1OA 1ZAKA 1E2MA 5HE9A 1UPTA 4BLOA 4ZCMA 3SJCA 4AKIA 4XTCS 1XRJA 1GFIA 1W0KD 2QQ0A 1E2GA 1UEIA 4NYJR 3HPQA 1XX6A 3MJHA 3VNUA 5FPSA 5F2EA 2W6IA 4P33A 3NEYA 2F1IA 3FPAA 1MRSA 4L8GA 2ODNA 4RFVA 3K9GA 3C14C 2ZJ2A 1ELOA 3AVUA 2RAPA 3R7WB 5A5GA 4W5JA 1Q21A 2EYQA 4B75A 2TMKA 4NU0A 4XVRA 4D0GA 3T12A 3ZZTA 2ZRNA 3OIUA 2F1JA 2AXPA 4MDFA 1H65A 5FL7D 1T3HA 2ZRDA 4B3BA 4CF7A 1IY2A 1P60A 4HAXA 3FMOB 3K8YA 3GEHA 3K0FB 4DLUA 4DCTA 1HV8A 3X1WA 1W48A 2FSIA 2IS2A 2GJ9A 3GP8A 4TMXA 2JATA 1DOAA 2LKDA 5CLQA 3I72A 1OIXA 5DLQC 3CNNA 4CDGA 3ZH9B 5K8UA 3CWZA 3THXB 5ELXA 1SVIA 3HYTA 5AJXA 4AYXA 1OB5A 2QA5A 4ZDJA 5KPDA 4QGHA 3AVXA 3WRYC 3KFVA 3CR8A 4NKRA 3QUSA 5L3RA 2RGBA 1XXHA 3OIVA 2ZRLA 4Q48A 4HAUA 4U00A 1VCNA 3EZ9A 1E9CA 3PCRB 1ZNWA 2AWNA 4IVRA 1IQPA 2WJVA 3A1SA 2VYFA 4EDHA 2H7VA 2BBSA 4DEXA 1QHHB 3ZGXA 4IOKA 521PA 3MUFA 1NKTA 3OEHD 3OZXA 2AL7A 2CDNA 4OI2A 4PQYA 2BIFA 3KKMA 1NNEA 3ICQB 1GRQA 3DOFA 4LHVA 2ZUBA 3OEEA 4TWZA 2O8BA 1MH1A 1QHGA 2KBEA 4Q4HB 4BFVA 4IXNA 4IEIA 4ASUD 3M4YA 1E4VA 1TF2A 1R6BX 2GZHA 3MWKA 4IW3B 3IEVA 3MG9A 2BM1A 1VG0B 2AXNA 2QMOA 4BLSA 4Q01A 5EUMA 2N1BA 1N6OA 1YVDA 4FINA 5JHGB 3A1UA 5B57C 3C7KA 4EPWA 2HYDA 1F2TA 4K46A 4EPRA 3U6BA 1S2MA 1XXHB 4LRSA 2D62A 3DOEA 1XZQA 5JI2E 1E9SA 2IBMA 1XMVA 2ZYTX 3EZ2A 3FGNA 1WA5A 4Z51A 2G77B 3EWAA 3DM9B 5BN3A 5DISB 1NKSA 5E4FA 3WBKA 4LYHA 3TUZC 4BQSA 3FFAA 4W7SA 4QXAA 3NHAA 4Q5IA 4ZCIA 1XPOA 1NBMA 2PLRA 3W9YA 2VHTA 3AKCA 4DKXA 2IEYA 2OXCA 3O47A 2DFKB 1KMQA 4GOXA 3IEUA 2QAGB 2Y8EA 5K8TA 2Q9AA 1GL7A 3IHLA 2XEXA 4UKDA 1ZM3A 4HB3A 1T9HA 2F7SA 2C98A 5FUXA 2ZAOA 2WBLC 1D5CA 3B82A 2AFIE 4FMDF 1A7JA 2E1RA 2V55B 3PUYA 3IIKA 1KI7A 1TEVA 1YR8A 3GJXC 2AFHE 4F4IA 3AVWA 2OE2A 4I99A 3OE7D 4BFWA 5FH9A 2OCYC 4PPNA 3OAAD 4B34A 1GM5A 2AWOA 2W2TA 2J1LA 2NZ8A 3EIHA 3P4YA 3KX2A 4A2PA 4DSOA 3KXLA 1PV4A 1RW4A 4ZO4A 3B2EA 3RSOA 3EPJA 3U5ZB 2IXFA 1YQTA 5JRZA 1OYWA 4UNRA 1CU1A 3B78A 3LDAA 2D3WA 2PL3A 2WKQA 4DT1B 3QF4B 3SHFA 1W0JA 1XEXB 1UKZA 2FFBA 6Q21A 2RMKA 3E5HA 1Z3IX 3I92A 4LJYA 2I4IA 3CNLA 1E9BA 1W5SA 3UK6A 4A3VB 1KK0A 1NP6A 1Z0AA 3ASZA 2XXAA 5FPTA 4KVAA 1DVRA 4QHSA 1YR6A 2FSHA 4LPKA 1P6XA 4QG7A 4RD0A 3EASA 1IN7A 3IPXA 1JAHA 1TQ2A 3KJGA 4JVLA 1RJ9B 3S1AA 2VP9A 5FR1A 5AUOB 1G7SA 1U0HC 4ZCLA 3OAAA 3SJZA 5JHHB 1XD9A 1Q1EA 2PCLA 3AKEA 1DELA 3BC1A 2FOLA 1JAIA 3HR7A 1HYQA 4EJSA 2ZSBA 2IUUA 1UM8A 3B5JA 5E3HA 3HYRA 4DLVA 4JLAA 1DO0A 1XU4A 2PX3A 4O2LA 1R7RA 1IOZA 3LD9A 1DAKA 4G1UC 3QBTA 3LFUA 1G17A 2WJYA 1LVGA 2KI5A 4HUTA 1US8A 4BLQA 2QGNA 2DVWB 5E7JA 2PCJA 4LHXA 3O8RA 1DG3A 1II8A 1N5IA 4G5RA 3MRSA 3PEVA 5EE5B 3NEJA 5JCZA 1N6NA 5CK5A 2WJIA 4GMXA 1KO5A 1WXQA 5CIQA 2ZR9A 4ZDKA 1OF1A 2QRZA 4U02A 1WP9A 2QE7D 2XOKA 4MH0R 2WJJA 5KOYA 2D06A 2CXXA 2HCJB 3G82C 4QNRA 2P5TB 2ZJYA 3ZQJA 3GFOA 2VPPA 4BZPA 3BBPA 4M0LA 2JIZA 5FOUA 4CEIA 4XVQA 3TIFA 2ZUCA 4L4UA 2GBLC 5HCNA 3CLVA 3SHWA 3EX7C 4IXMA 3PG5A 2WWWA 2BJWA 4M1WA 1GG2A 1SXJD 2BKUA 2FFQA 1Z63A 1US8B 2Z4SA 3JZMA 3VX3A 1P2VA 3REGA 1XD2B 2ZI7A 4HATA 3W5JA 1Q1ZA 4JIMA 4Q18A 4TT3D 4TYQA 4V03A 3AEZA 1CP2A 4KYUA 5JEDA 1OW3B 1G5PA 2G1JA 2A5DA 4URWR 4PZLA 3BIFA 3U3JA 3KQHA 4ZIRB 4F4JA 4TMWA 4CEJB 3T34A 1E69A 3TRFA 3U61B 4P4TA 2OBNA 1X37A 2WSSA 1H8EA 2ZJOA 3RC3A 1AKYA 3BFVA 3FB4A 1RJ9A 3AVQA 4R2HA 2G88A 2GJKA 1G5RA 3QNUA 4OJKA 1M1YE 4X8LA 3I4LA 4XWKA 5D3QA 1XZPA 1XFAA 3AB3A 5FUVA 3GJ4A 4EQ6A 1XD8A 3F0TA 1P7CA 5EE1A 1TMKA 4A8JA 1QHYA 2YJTD 2K5UA 1K8RA 1G64A 2ZRFA 3QPWA 1DPFA 3CZQA 2J45A 1DO2A 4RZ3A 1HT1E 1N5JA 4G0NA 5FPYA 1FL9A 2PMDA 2C5LA 2JLSA 4B35A 4UNNA 3DMNA 1ZP6A 1TEXA 1JR3E 4YMTA 2J7PA 1XEFA 2F3TA 3LBIA 4KITB 4ZIRA 2IS1A 1HTWA 3N2IA 2JLXA 2R6FA 1ONBA 2XTZA 3RS2A 1P75A 4RFSB 3WMGA 1VTKA 3B1WA 3DM5A 1AS0A 2GKSA 5LPNA 3CM0A 4E5UA 3B60A 4HB0A 4DBLC 4URXR 4A8JC 4LOAA 3I3SR 4A4DA 4LY6A 1SULA 1H8HA 2HF8A 4EFLA 1G7TA 3LNCA 5F9FA 5J40A 3V4FA 1XTSA 3LRPA 3BS4A 4WBSA 2AK3A 2JLYA 3EIQA 3PJRA 4Q1BA 4C3ZA 2O52A 1B0UA 2IYZA 4D2IA 2B6HA 3RWOA 1YRBA 2VP5A 3NDPA 3PEUA 2C8VA 2CNWA 3GMTA 4EPXA 3TSZA 5JZVA 5FL7A 2A5JA 4HLDA 4LSGA 2IUSA 1X8JA 1KTVA 4LHZA 4GZMA 5H68A 1A4RA 221PA 2JCSA 4UNQA 1KI2A 2QMEA 4LV6A 4L16A 4M1YA 2BBTA 4BPBA 1DAIA 3E70C 2RCNA 4LJ6A 3CRQA 1N0VC 3VU9B 1D9XA 3FOZA 3CNOA 1TQ6A 4PO9A 1CBUA 1W2GA 3THOA 5JSZB 5CK4A 4C0SA 3TLXA 3LO5A 3EAQA 4X8MA 3KJIA 2QAJA 4NCIA 2CK3A 2ZSDA 1ZM2A 4JJZA 1MT0A 2AX4A 4PPQA 3SQWA 1E0JA 3ND9A 1XEWY 2MSCB 2QBYB 3CR7A 4DB4A 5C4GB 3KQKA 1KNXA 1U0JA 3KKNA 4EFNA 2C9YA 2GXQA 1PLKA 4JYCA 2HLDA 1XB2A 2VTKA 4X8HA 3A8TA 3F5FA 5JWRA 4B44A 4LRTA 2GEVA 5DNYB 3I5YA 1W7AA 4Q4JA 4W9MC 1ZCBA 1OFHA 4A9AA 4LC1A 3B9PA 2HLDD 2QTHA 2ZREA 4GPTA 1AGPA 3AF4A 4KODA 1MV5A 2Q6TA 5KSZA 1XJ0A 3SU8A 3SFZA 2VRWA 1QDEA 4DXAA 4B6FA 2OG2A 5EJEA 1W49A 2BJVA 4EJSC 3NWJA 3UIEA 2OSBA 2EFEB 1LNZA 2JJ1D 4P0TA 5FI1B 4NPHA 1NVUQ 2GVZC 2ZR0A 4A2WA 3U44B 3NXSA 1ESNA 1FX0B 2CVFA 3TQFA 3VR2A 4CZ2A 2JJ1A 4ABYA 4LJAA 3GJ5A 1CR4A 4II7A 4I1OA 3GLIE 2UVQA 1UBGA 2QT1A 4YDHB 3SS8A 5FTKA 3CO5A 4B74A 1JB1A 1E2KA 4OHXA 3T1OA 1FMLA 1CJTC 1O3YA 2P5SA 2ZQ5A 3IHWA 3QEJA 4GT1A 1MO3A 5JMTA 1GUAA 1T8TA 2F43B 1LF0A 1F3OA 1GNRA 1Q1QA 1SKYE 2GHIA 4M9XA 4XVUA 2ZI3A 3U7GA 1Q3HA 1VPLA 1L7VC 4CEHA 3Q9LA 4B2IA 4W5HA 4HI0E 2BVNA 5TV2A 4AC9A 2RGGA 1DAHA 1SVMA 5GVRA 3T5DA 4A0FA 3K09A 1BYUA 4Q1EA 3RNLA 3NC1C 4M8NE 3MHVC 3SYNA 1OXXK 4AKGA 1HUQA 4Q66C 4Q4JB 4MDEA 3LXRA 3QXJA 3QE0A 1T3SA 4LYFA 5EP3A 4DLWA 1QHIA 1FZQA 2FZLA 1JECA 4JLNA 3UMRA 3AQ4A 2PX0A 2V4ZA 5HPYB 4DIDA 4HAVA 4MA4A 2UZ3A 4Q9JA 4BFTA 3SEAA 1X86B 1V43A 4JLVA 1N0UA 5HE8A 1AZTA 3FMFA 3C5CA 1YHNA 2B7BA 4M9QA 4ACAA 3FKSD 3L0IB 4ZDIA 2Q21A 4QFMA 3VKHA 5JI3E 3GLGE 5JSZA 3F8TA 5JECA 1W36D 3B1XA 2FA9A 2ZS8A 3H0KA 3R8FA 5DI3B 2XX3A 4IFBA 3NVAA 2X1VA 3QXCA 4DHEA 5EXSA 1AK2A 5C4MA 3WP0A 3T1TA 3MLEA 3P32A 4QHYA 5EP1A 2CE2X 4PZZA 2QP9X 1NLFA 1QF9A 4NCKA 3QENA 5J47A 1U99A 2IS4A 5C18A 4RD3A 3SDZA 1R10A 2MSDB 2XNDD 2BMDA 2FEMA 2XJ4A 5UKDA 5BYKA 3FHCB 4B6EA 4TLCA 1HY3A 3X1ZA 2VHJA 3R20A 1NBME 4Q7MB 1AQUA 2ASEA 1C1YA 2BEJA 5JWOA 3CRRA 2WOJA 4F93B 2HCBA 4EIWA 5DN6A 2H5EA 4TTQA 4Q9IA 1NVXQ 2BV3A 3QSYA 2OZEA 1Q3TA 1U0LA 2GBLA 1D6JA 4YONB 3CKLA 4B2LA 3TW4A 4P31A 2C99A 2X8AA 1OHHA 4RZ2A 4YMWA 3FVQA 2PEZA 4AURA 4LJ8A 4PPGA 3I5XA 2QAGC 1CLUA 3TR5A 2PH1A 4CIDA 4EPYA 3K70C 2BWJA 2QM7A 1OB2A 1JALA 4FWGA 3R9WA 2FG5A 2PLFA 5SZJA 2JJ2A 4BFSA 4A6PA 4X8OA 3KB2A 1LB1B 1M7HA 4AI6A 1YKSA 1IJEA 2ZTSA 2OUKA 3EWSA 3GCGA 4KO8A 1E32A 1JBKA 2ZITA 1OFIA 3R7WA 4XWOA 3U60B 1OT3A 1RZ3A 4A15A 1NVVQ 1VKJA 5FTMA 3SI7A 3L8YA 2QBYA 2JLRA 4LBZA 2DR3A 1CRPA 3LH5A 4NH0A 5E7MA 2ERYA 4Q47A 2DB3A 2O8FB 1U81A 3AVPA 4L15A 4D25A 1KO8A 1BYIA 5AUNB 2ZAMA 1N25A 1E1RD 1VECA 4XTRA 4HUQA 3VR5A 1AKEA 2QE7A 1NLZA 3ZYCA 5B58C 4TYYA 2GEUA 4JSYA 5AJWA 2WKRA 3ZS8A 2O8DB 4JL6A 4JLJA 1M34E 1TU3A 4P3YA 3SE0A 3U6KA 1SXJC 1L4YA 2ZSFA 1E0KA 2CCJA 1AN0A 2WMOB 4TQ9A 5DHFA 5L3SA 4WXRA 3TNFA 3ADBA 2JAQA 4C0LA 3CF2A 1KI8A 1VG8A 4QGFA 1M74A 1MOZA 3GJ3A 4LZZA 3BE4A 5TDHA 5LDDC 4B3GA 3A6PC 4TT3A 2O0JA 5L3SB 2H16A 2YV5A 4EQ6B 4OBEA 3U4QA 1NSTA 3AUYA 3W3AA 4PO8A 4MITA 2FE4A 4QOSA 1ZU5A 2YWHA 3LLUA 2FH5B 4Y0VA 2Z83A 2GZAA 3EC2A 2HJGA 2ZRAA 4QHTA 4TQUS 4Q9LA 1B23P 2P6UA 3GQBA 3C5HA 3LX8A 1S3GA 1XXHE 1FUUA 4M2LA 2F3RA 1P2UA 3B13B 4Q00A 1E9FA 1ZD1A 1LV7A 4NYJQ 1D2EA 4GL2A 4LJ4A 2J7PD 5GJWC 2BHRA 3PXGA 4LK2A 1R4AA 2VF8A 3BH6A 4D4JA 1CULC 3N2EA 4CT4B 4PSVA 4DB2A 1XMJA 3GJ7A 3HPRA 4FN5A 2FSGA 5BN5A 1A5TA 1Z0FA 1ZRHA 2GJSA 2P0EA 3AF3A 3LW8A 2HXYA 1IXZA 1X1SA 1IM2A 4KXFB 3VKWA 3ZVMA 1OH5A 3VLFB 4J0QA 2YYZA 5FOTA 4WZBE 4D26A 3U4QB 1E79D 2V7QD 1FNMA
chains in the Genus database with same CATH superfamily
3FPJA 3LBFA 1RDFA 4MQUA 1K3UB 2NQ2C 3P9YA 3UH0A 4JB2A 4ENTA 5KS2A 1VPVA 3DMTA 3MGCA 1H3NA 4IVQA 7ABPA 5JYBA 2PJRA 1T4GA 4FYXA 2QF7A 1VJ1A 2OCDA 2YY6A 4G0PA 4LHYA 4RNAA 4OHRA 4PANA 3R9IA 3DZBA 3P96A 2I91A 2Y27A 2D2EA 2ZLBA 4CEIB 3WGTA 1OLXA 1AIPA 3P45A 4BCCA 2AKAB 2QROA 5K6TA 1EWYA 3BBLA 4IDNA 2ZBKB 2XDQB 4IJUA 2REBA 2IYAA 5I4BA 4HQFA 3K5PA 3MJRA 3D2CA 3E1GA 2RJOA 2PSJA 2FTKE 2YOFA 1VA4A 3QE3A 1GA6A 3JTEA 4B4OA 4LRXA 4NTZA 3WL3A 2R44A 1OPXA 1GZHB 5HIAA 3O3OB 2JGAA 1OAOC 1R3UA 1Y4ZA 3RAFC 1GPUA 2XXJA 1VIAA 4XW2A 3LGXA 2BKEA 3RRMA 3O2SB 2CXUA 4E07A 2CWBA 3MMSA 1NJGA 1K7SN 2C20A 2WJZB 4RZHA 3NKVA 2JJ8A 4YCLA 1PNVA 3ZDAA 1BXRA 1V4BA 1WCIB 2CKDA 2WKWA 4TWRA 1E3QA 2BDEA 2XZDA 4IXTA 3UHJA 5A3RA 4QD3A 4U2GA 3ROXA 1E2FA 3T35A 3E7DA 3L4BA 1K6XA 2K7ZA 3TE6A 2V7VA 4URZR 2WKPA 3OU6A 2DEUA 4BXOB 4OQFA 1RQGA 3SX2A 4AUEA 5LWHA 3EBLA 1J1IA 4OAQA 4ONEA 3VMMA 1F9EA 2G67A 2ZGVA 1PGOA 4GITA 2DQYA 3RSSA 5FLKA 5IEBA 2GLXA 3FKQA 3VC7A 3WGKA 3ZHRA 5H3HA 1KEUA 2LKCA 1N9KA 2VG8A 3V2HA 4BC1A 1QIFA 3UGJA 4G1VA 3WADA 1O6CA 2A6PA 3LK7A 1B8UA 3KVWA 3ZWPA 4KPUB 1UZLA 4IDOA 3AL0C 4ZAXA 1R1DA 1W85A 3WJ7A 4I9UA 2AG1A 4IDPA 3SC2A 1YZKA 4KWTA 3QXXA 1G8HA 3OZRA 4G26A 4NBLA 2YFQA 1KF0A 3KPVA 3AJRA 2Q07A 4IUCS 4BU0A 3RS5A 5B1SA 1TH4A 2KNAA 3PHIA 4QJ5A 1G1AA 1XZEA 4FIZA 5B36A 1EQ2A 4A23A 2B8NA 4L2IB 1GEGA 2WFLA 4PICA 4TUWA 1ISRA 4P58A 2X14A 4E70A 2D0DA 3KTAB 1QRUA 2IXBA 4U7DA 4HNQA 4UNSA 3A6HA 5E2BA 2E7ZA 4ZT5A 1YXMA 4F8YA 3L84A 9GPBA 1GCIA 1UMBB 4I6EA 1EVIA 3FLBA 1U90A 3BHMA 1CETA 2G9RA 3BVPA 2G1PA 3PSHA 1PDWA 2OHIA 1DQYA 1T0JB 1YZ3A 2EERA 2PT9A 2ZEJA 3C3MA 3L07A 1NBWB 4DSNA 4Y9TA 4CIDA 3ZNPA 4MA5A 5H02A 3IT0A 1DMRA 4WI1A 4IKEA 3QLTA 1TCBA 1WCIA 4ZICA 3ITNA 4IQFA 4INZA 1OUMA 1I7LA 2JH3A 3VOSA 5KYKA 3FNFA 2ZBUA 4C0HA 4Q7JB 3VPXA 1WB9A 1CVLA 2FXIA 2VHEA 3RYFA 1VPWA 5CP8A 3HQ4O 1QYDA 4FFRA 3A1CA 3GWZA 1A8PA 1MHPA 1BX3A 4M1QA 1LZKA 3JQAD 2OV6A 3NDRA 1J0DA 1ZUNA 4NS1A 1J2JA 3U4CA 1Z7GA 4AL4A 4TV9F 4BMPB 4A8JB 3X44A 3QLVC 2P6RA 3UENA 4ESEA 1ZBDA 2NYRA 3J27B 2PO7A 2DTDA 2CWWA 4OM8A 5IF3A 3ONWA 4LSMA 2GRJA 3T61A 2A67A 3E0QA 2AN9A 2IEGA 5DLPA 5A3SA 2WWGA 1V5GA 2ZIGA 2GCOB 2ZYAA 3P5BA 4TLDA 2YWRA 3ELYA 3LW7A 2RK4A 3FDFA 4DS3A 2ANCA 2GLTA 3CUSA 1HH4A 1XU7A 1NI4A 1CY6A 4DNQA 2NQTA 8LDHA 2X4DA 4BP1A 4EWLA 1ESEA 1PJTA 3VSDA 1QTQA 2SBTA 4PZ0A 4PAWA 1NMYA 1XMIA 3C3YA 1TT5B 3WL7A 1NC3A 3GJ8A 3WHPA 5CYGA 2DFDA 2ONYA 4RK4A 4KSCA 3PEFA 3KL4A 4BP3A 3FWZA 5L8VA 2HA0A 2ZBDA 3FFTA 3EPLA 3QVGA 1MKYA 2WU1A 4WJZA 1EE9A 1T0HB 4PXAA 3SX0A 3HB4X 1B8NA 4AAYA 1DKLA 4GI7A 2C1XA 2JFZA 4BNLA 1E9EA 2I7TA 2Q1SA 2VJNA 1KH2A 3HP1A 3FGZA 3V5NA 4EI2A 5JPCA 4ZTZB 3LFTA 5CB4A 1FJGB 3IKMB 1H2WA 5CDFA 2N9UA 1OBOA 3CPJB 4DLSA 5LIPA 3B8EA 3QFHA 4HAZA 4AWBA 4BAUA 3HHEA 3X1YA 1JPUA 1NRWA 4HKTA 4G25A 1GHTA 1X2BA 4ARBA 3L25A 3WLLA 4RTPA 5J63A 2J0QA 2BFMA 4QSHA 3L77A 2OKCA 1MC8A 1NR1A 3DHYA 3U40A 3WA6A 2PGNA 4DV3M 1I3OA 1ZR2A 5TMDA 3KT6A 1II0A 1VL1A 3X0DA 4WA7A 3D8BA 2ZS7A 1NULA 4UHCA 3WB9A 3NBUA 1E0DA 4YDRA 1D4ZA 1CYEA 2OXEA 2Q9CA 2QM3A 2VDNB 4G1BA 1LW7A 2RI1A 3L8ZA 2UVPB 2HEIA 3SOPA 1Z74A 5K3CA 3A70A 1GUYA 2JLQA 3HM9A 2ZPAA 3CW9A 4BNTA 3PJEA 4MR8A 3IR7A 1I80A 4GX5A 4IGEA 1YQ9A 3TWOA 1AGYA 1PJRA 3O94A 4D4MA 1YOVA 1ZR4A 5FEMA 3BJIC 2VF2A 4KBGA 3VHXB 4JODA 2FWIA 4IDDA 2C7OA 1GO2A 1PWXA 3ETGA 2FYTA 7GPBA 5BMVB 2XVXA 2HRZA 3FF1A 4FTWA 3LDHA 3I73A 3F49S 2XMRA 1M72A 1UKBA 1EINA 1SO8A 5KYYB 2B2NA 4TV9B 4DDWA 2EZ9A 2Q6KA 4P7JA 2HMWA 2NZVG 1FTNA 2UKDA 2G9VA 5FNVB 2X42A 1DAGA 1II8B 4CMBA 1ULAA 3NUGA 3JASA 5IBRA 3F6EX 3MW8A 5F33A 3TUJC 4CLOB 3HS3A 1Z5PA 2ZSAA 4O6VA 3P4XA 1LDEA 4P82A 4DNPA 2X1LA 1H69A 3QY0A 4BO3A 2IA5A 5DM60 3HJSA 3ELBA 5JIBA 3AQIA 3OUZA 1FLAA 3P0EA 1JEYA 3GD5A 3KEMA 4NBNA 2Q2VA 2BC9A 1Z26A 2Y1XA 2ZK7A 4BQPA 2GX6A 4Z53A 1ZZEA 3JR5A 3ACDA 4M0KA 2REQA 4JI2M 4IDHA 4L0MA 3UK0A 4CHGA 5F5XA 3V9AA 3AJDA 1SIOA 5G4LA 3TXAA 4ZQHA 4ZPJA 3H1EA 1W8DA 3OFND 1KSHA 3I8XA 1ENYA 3K6KA 2A9FA 4NARA 4UREA 4LJ7A 4KHPM 1QF6A 5A5EA 1R37A 3ZIUA 5ALVA 1DBIA 1RWQA 2IC5A 4KEAA 3TL4X 4FEAA 1SWWA 4GU5A 1IH8A 2JKVA 5HFJA 2YR0A 3DDOA 4N5MA 2XXAB 1SURA 1KQGA 1SCJA 2Q4OA 1ADFA 1ZIOA 1S7GA 3H1AA 1NVEA 4G0QA 4EUEA 1HNXB 3GJZA 3MS7A 4N7MA 2FMUA 2ZIWB 4P98A 4GQIA 4UVHA 1NF2A 4CMGA 4TUYB 5KOIA 1I7QB 1JNYA 4BBJA 4HLUA 3I64A 1TTTA 3E5RA 2LNDA 2GBPA 3KKQA 2G17A 4HDSB 1SNYA 2E5LM 4AP5A 2G4VA 1QPGA 3ADDA 1N33M 3EFBA 1R9NA 3F5DA 5AUPB 2BFFA 5HIKA 1ZD9A 3KJQA 4F3NA 2P77A 1H0KA 3LF1A 2GZ2A 4RE5A 1HE8B 3WG9A 1LSOA 3DGEC 4MS4A 4NQZA 3RKRA 1PWZA 3PQ2A 3NBYC 2DBVO 2F5OA 2I6GA 4GSYA 4CG3A 1KVUA 2HHAA 3KZKA 4WXHA 1GTVA 3AR2A 3E53A 3R7SA 4RK5A 4GC9A 1JTVA 2CL0X 3N59A 1TAGA 1IUNA 5SZKB 1HORA 1SQ0A 3T15A 1W47A 3QXGA 2V3WA 2D7JA 4AY3A 4C0BA 2HRQA 1OLOA 2HJ9A 2HB6A 4MVJM 3HR8A 4I9HA 2ADMA 2AHMA 1I36A 1HNWM 2X9LA 1IPHA 1O4VA 1T4BA 1T91A 2YHBA 3OEWA 3SR4A 1QK3A 4G01B 2UYGA 1IUKA 3OJWA 1NI3A 2DTEA 4J3FA 4CI0B 1PL0A 2B9VA 1VG9B 3FFBA 4DLXA 2F55A 3RVDA 2DCUA 2AA3A 2LWXA 1F0KA 1OAKA 3AUKA 2RRUA 4OK6A 3U09A 4EG7A 3GHHA 2AFIB 1ZRMA 2ID8A 4KZPA 2VT3A 3SXJA 4YCCA 2B25A 3TB4A 5JQWA 1IVSA 1I9CA 1YBHA 4RVOA 2DPGA 3P7MA 1TH2A 2FP4B 2HWXA 1NDHA 4KN5A 4M53A 5CYOA 1T3TA 3K30A 4U3JB 1O6FA 1W35A 3CBGA 4P54A 4ID3A 2ZYGA 5DLYA 5FBZA 1A4IA 1IEVA 1XTPA 2HIHA 2OM6A 2WD8A 2FMHA 2B36A 3CZPA 1GXSA 1RLIA 4GNKA 4MARA 4KDFA 2C4TA 5JAIA 3H2BA 4BZQA 2BCJQ 1ZV1A 1A27A 1J70A 2DC1A 1QYVA 2FSPA 4KH0A 2RSLA 5K2OA 1KAHA 4OB6A 3OD5A 3LU1A 2BEVA 5SY9A 3RGPA 1NRJB 2PUJA 3JZIA 1HZZC 4I2VA 2C2HA 1G5QA 2O2ZA 2YHAA 2OORC 3DGFC 3IEXA 4MLPA 4QPDA 4RUKA 5M7EA 3TO5A 2GCEA 3TAHA 1JQDA 1AZLA 2GD1O 2PGJA 1E5TA 1V1RA 4IMJB 4IV5A 1G38A 1CNFA 3T5BA 3CLKA 3Q8KA 4GBMA 3NHJA 4AMUA 2X76A 2DZDA 3DCIA 1VLVA 1ZGAA 4F21A 4DDTA 4XDYA 1HE1C 2O0LA 4IIJA 4Y0AA 1K89A 3VTZA 4IFEA 1ISIA 4WW0A 2ZSIA 2GM3A 2C77A 3HLYA 3NYIA 1Z5WA 3W68A 2WW8A 1ESMA 2ZYVX 3BUSA 3Q6IA 4IXWA 4PQFA 5DW0A 3RYHA 4RVHA 3QV2A 1ZJZA 4LWOA 2GYWA 3FTFA 1ZKMA 4FNAA 4EX7A 1ZK0A 3T3OA 2VYVA 2XTMA 2YMLA 2BKXA 1OLXB 1QDTA 2QTFA 2VHCA 3QELB 4ENPA 3DEFA 5BSTA 3GLFA 5P21A 1TZKA 5EVCA 5DTEA 4ETNA 3FVRA 1DJLA 4R7GA 2UZIR 4DJ5X 5DNCA 3KJZA 5K4HA 1TJPB 1FRVA 2GN1A 3AHJA 3QLJA 3X1MA 2N0SA 4BYMA 1QJ4A 1G3IA 5DV9A 2ZRBA 2F1RA 4FHDA 4DDVA 1JWLA 1R5NA 1WDLA 8GPBA 4JZYA 1S8NA 6PFKA 1RE1A 1IBRA 4R5HA 3GO4A 4O08A 1G3RA 1HDYA 1BKSB 2IZZA 1WSWA 4KQWA 3PS9A 4LQLA 3DLBA 2O0KA 4K8RB 2ATVA 3F4KA 3EARA 3L04A 4MKHA 2I3DA 3C45A 5EWJA 3FNGA 3I3OA 2C2OA 2OECA 3VTFA 4F3CA 4CHTB 4G5SA 1ZVJA 3T94A 3UUFA 5DI9A 4IZIA 3RLIA 4KU4A 2MYUA 5HFAA 5IYZA 2PV0A 1ORRA 4ZDWA 5EYPB 1TZJA 5BURA 3TMYA 1XTVA 1UKAA 1JEEA 4QXPA 3S1LA 1PGPA 5FV7A 2R2AA 1H6CA 2IYQA 1UJ2A 1MIOA 4F8EA 2HTFA 1M83A 2OZKA 3EG9B 2WWHA 3UANA 4XWTA 1Z4KA 4WCFC 1MO5A 2D1YA 3NBFA 2EBHX 4MQ4A 2INGX 2RBGA 4MRVA 5KNCA 1FJXA 1MFPA 1OFUA 2BFWA 4MGKE 4F4HA 1P1BA 1OXVA 1H3FA 4DC1A 2V5AA 1L4KA 2XOKD 5JCOA 4ARZA 3ANMA 3L8EA 4LZWA 2K7FA 4MGIR 4MGEA 3E9RA 1GDHA 2XUJA 3BPSA 3DR3A 4MQFA 3RU2A 1ETUA 4X3CA 5FLXS 4HTAA 1XBTA 4F1JA 3W8EA 3ZYZA 4RLFA 1Y8CA 3L4BC 3J7TA 2QX9A 2YINC 4Q3OA 4S04A 3DDHA 1QZ3A 5GM2A 4RTKA 2XCRB 1WKBA 1C30B 1IHUA 4YPFA 4P3KA 2XNHA 3JR3A 2HJVA 4R2XA 3EXEA 1M8PA 5ICFA 4NYIR 1TLLA 1KI1A 2NP7A 2IU0A 1LPAB 4PAQA 4RQUA 2UXDB 2QT0A 3C6BA 3FCSB 1WB5A 2VBGA 4KNYA 2RGXA 1E6CA 1X19A 2Z8YA 3CIFA 4JC0A 4MDYA 2PZJA 1JEAA 2DWLA 3BKWA 1Z6AA 1FS6A 4RTMA 1UJ5A 3EAGA 1LBTA 2VPIA 3SG0A 3QPUA 3DVAA 1A96A 2AJTA 5CLIA 3D4BA 4R1OA 1NW7A 4RGQA 4KXVA 2V3VA 4FZ3A 2Z3WA 3VK8A 3VU1A 4DR5M 3RC2A 3KDPA 4X65M 2NAFA 3EEOA 3OKAA 4MS3A 3IAAA 5JSYA 1NOIA 1P9RA 3ZC7B 1LRJA 2HQOA 2OHFA 4U39A 4MJLA 1CR1A 4NYMR 1X94A 1CUXA 1R5JA 2VZ9A 2WF6A 4N6GA 4HN2A 5AOAA 1XD2A 5K45A 3EZLA 5ER9A 3FVVA 4CKWA 1ZC4A 3T9FA 3KSJA 3SATA 1MUUA 5BXQC 5LLDA 2VT7A 1LPMA 3JQ8B 4B6GA 1LUAA 2HLPA 3I9MA 1F17A 4S0ZA 1TW2A 1DC4A 3LLCA 3O8QB 3ETLA 2AD5A 1ZOIA 3SIXA 2P5UA 3ORHA 4YQFA 1KO4A 3ZHXA 5KQDA 1NVGA 4CMEC 4II3A 3CF6R 2FFAA 4K03A 4LJSA 5H5JA 5L51A 4YRFA 3TW8A 3HP4A 3VR3A 2DXIA 2OO9A 1U7WA 3A27A 3LBNA 4NDZA 3WYEA 5AJYA 3UAYA 2JCBA 3O95A 3HJFA 4IJQA 1E8DA 4P3XA 2IE0A 2W90A 1LC0A 1JEOA 2X4IA 4MRMB 1V5EA 1YAJA 5L3QA 4G4RA 1RJDA 4ND7A 4MRAA 3QYBA 1FRQA 1C3JA 1S5PA 2BR4A 2VDWB 5D87A 5G3ZA 2Z04A 4BGUA 4HV4A 5AI4A 4JBHA 2POCA 5DIFA 3UW1A 4FX5A 3CZRA 1NNUC 4AJJA 2FJUA 3AR7A 1LSSA 3KQVA 5BY2A 1GTSA 4TKUB 4LFAM 1U1DA 2GTIA 4RD6A 3C7CB 1EJ6A 4PSAA 1M0EA 1ISHA 2IITA 2Q5FA 3RCBA 2EWVA 1HDEA 4YRJA 1KYQA 1FDWA 3ELDA 2FDCA 5BSVA 3VKGA 1VLHA 3C4VA 4V0RA 5I8ZA 4MP3A 2G5PA 4AZ3B 3C87A 3OCYA 5I9IA 1VMKA 1V35A 4X66B 2EARA 2WUEA 1H0RA 2V9ZA 1AQNA 5J43A 2CB9A 2HZBA 2O1XA 2RGEA 4DFDA 3PC2A 2W2VA 2C82A 2ZE8A 3A6KA 4D0RA 2O3TA 1S2GA 2RCYA 4HRVA 4MKRA 4KHZA 2HMTA 3TZQA 2ZBEA 5JNSA 3EXG1 2CZCA 3I6YA 4PAMA 1QDLB 1E89A 4NOKA 4UW9A 5F1KA 4MZDA 3UKOA 4DV4M 2NTJA 4F96A 1WETA 3CPSA 3PDCA 1GNQA 5E3IA 2PD3A 4ZV9A 5D7BA 3SZRA 4M0EA 5LQRA 2XRMA 2Z2YA 4P35A 5M29A 3DBOB 2QG6A 2Y1KA 1IMJA 1PR2A 1KZHA 4Q21A 1OXBB 3JQAB 5EKTA 1P2DA 3LTEA 2Q1UA 5T64A 1BVRA 4L5JA 3N07A 4HMPA 3TZHA 3HDHA 4NAVA 4G0ZA 3G89A 2DAIA 3A4TA 4B45A 4BQFA 1KS9A 1HEYA 3L6BA 5EHZA 5E8RA 5IREB 1YQQA 4E94A 4R3DA 4ZO7A 4F06A 2JLVA 4KPGA 4RD1A 1G1MA 2ZJ4A 3GNSA 3BXXA 2J67A 3GK3A 2PQ2A 4LOKA 3O1LA 4HF7A 2PUDA 1E2BA 2FR1A 4IZOA 1L4LA 5BT8A 4RL6A 3MJTA 2COKA 2V8OA 3AO0B 2X23A 1C9KA 4Q7LA 3CLHA 5B5SA 3ZDRA 2AKYA 3F2VA 5F7ZA 2AMYA 3GXOA 4JU8A 1N2CB 2FPOA 3KJEA 1PG2A 1OAAA 2PGOA 4FMBB 4GOND 3KS8A 1DIGA 4K81B 4KREA 1CF4A 1IJKA 1RBYA 1UP4A 3CKKA 3K20A 1YO6A 3OCWA 1SBTA 5BOSA 2B5VA 1JDNA 2YC2C 3ZXYA 4BJ3A 5BUQA 1IWOA 1EXWA 1RWOA 4N3NA 4LQCA 2FZGA 3ZD7A 4GQAA 3SBOA 3TLKA 3QVJA 2LCQA 3TRDA 1HQDA 3I76A 1D0VA 5GZ3A 1W0JD 3BILA 3L1HA 4XLLA 1X1DA 2C54A 2UZ1B 3D9QX 3FWYA 2AC4A 4JUBA 1FQOA 5BR4A 3A6EA 3QTLA 4CNBA 1KGDA 5JS7A 1BCSB 1M5TA 1QK4A 3M6IA 1LRLA 4GLLA 4RH0A 2QB5A 4X3PA 3AW9A 4LDRA 3K92A 3BB1A 3DHWC 2QXYA 3MPUA 2C8KA 4MYSA 4IBDA 1CDDA 1B4DA 1QKJA 2V97A 4FFMA 4BE4A 3RSZA 1SC9A 1NWCA 2XYQA 1JU3A 1W25A 4R2JA 1QYXA 3V80A 4M88A 2QRHA 2LXNA 4BFYA 2C97A 4ALIA 6AT1A 2M9MA 3HYSA 1FW6A 1KSFX 1L3IA 3VUFA 1YSYA 1S8OA 1FXSA 2OCXA 2OCPA 3GF4A 3JYPA 4I8DA 4ALLA 3UBTA 4M8KA 1IY8A 4TLMB 3TL3A 1A0OA 4YHHB 2YZ2A 3B1YA 5F35A 3PWKA 5DWQA 4RADA 3ZIAA 1P9NA 2O8CB 4EF4A 4JP5A 3HABA 5EJ9A 4J0IA 4X64B 4POAA 4EA7A 2FHPA 2QL7A 3ZWMA 4GUDA 1SQSA 2GAFA 2J3KA 4TZ6A 1NLUA 5CM2Z 1RXWA 1KIMA 1OXUA 1NN3A 3BK7A 5FAXA 3TTTA 3VTKA 3R3VA 3ZY5A 5TMPA 3NIBA 3BWYA 4OKIA 4DT1A 4KLAA 3SM9A 1A2KC 4MYUA 3WLHA 1XJQA 1U2GA 3N6VA 4UMFA 3VR5D 5DWDA 3ZU3A 3DKIA 3VKUA 1HDRA 3GLQA 2AFVA 3OLVA 5BW8A 1P61B 1CP3A 3OE5A 4OI0A 3AR4A 1HI9A 1DIOB 3OOSA 2BFNA 2QZJA 4GOOD 3EC1A 4MRNA 2IDMA 4LBWA 5E9WA 2H2AA 3N05A 4DV5B 3IPAA 2IF2A 2BDTA 3UB3A 4IRUB 2IODA 1T24A 3OCZA 2DHQA 4GX1A 4YIKA 3ZG6A 2CHVA 1RACA 2JKZA 2Q9BA 2X1MA 2XQGA 1QRSA 4F9GA 2GFIA 1LQUA 2QTAA 3AVOA 1WABA 5CJ2A 1XMQM 1VZ3A 4PHFA 2R6GA 3QJYA 4FFDA 3PFCA 4UZSA 3VPSA 1W0KA 4DJDC 4GLOA 4MUBA 3GRKA 2L0XA 4HR7A 3BDAA 4RF2A 5LMUM 5DULA 1EAYA 3PV0A 2V5UA 4LE1A 2GXSA 4H08A 4NAUA 1OX5A 1NN1A 4TQGA 2W6ID 1ZHFA 2GCNA 3IGFA 5FBQB 4AJHA 2B7CA 3HDJA 3HBAA 3DLPX 1EFKA 1DUVG 1NNI1 1Y4SA 4R1MA 3LLVA 2IP1A 5EESA 3TSAA 4P4SB 2C2XA 1P1RA 1QCDA 2XUIA 3EWNA 1SC3A 3PR3A 4CN8A 1YFJA 3KVNA 1ORDA 5BW6B 5G4KB 1W0CA 4QUJA 4PO1A 2V6JA 4QOFA 4LGYA 2O0HA 4LF4M 4BWYA 4DY4A 3CUVA 4ZEWA 2OFFA 1XPRA 3WQRA 4POOA 3RADC 2PBFA 3OZFA 1NJFA 1D0LA 3N70A 5J4YA 2UUAM 1BH6A 2HKJA 2H2HA 3BF7A 4D8XA 3LAWA 3CX6A 2OQ4A 1JI0A 2P4EA 2Y1GA 1FYXA 4IIJB 1YJCA 1NSFA 1NXQA 4XQCA 3LFHA 1Q17A 2A1UA 3Q3CA 4NU5A 1TM1E 5ELMA 1B3RA 4JYPA 4MVYA 4UHBA 2Y1DA 1H2HA 3I2IA 5CYPA 4YRMA 4ZAVA 1XTBA 3OZCA 2H7XA 2D5IA 4D9IA 4U4AA 1LWOA 3WK6A 2NXWA 3KLPX 1RADA 2WICA 2ZAYA 2Y4NA 5KNBD 2Q46A 3CPHA 4FZRA 2Z2ZA 4QU9A 5DF1A 5LFAA 5K3OA 3H4TA 4WZAA 4K1LA 1TZCA 4XBOA 2YOGA 3EVEA 5A5VA 3TSWA 3WGZA 4RZIA 3B20A 2ZVPX 3LSTA 1GV0A 1DS6A 1COZA 3BAFA 3EW9A 4M22A 3RG2A 1EM8A 5HIMA 3QU7A 4OKSA 3Q6NA 3R4CA 1M0TA 4BUJA 5JU6A 1CCWA 4A1FA 1WY7A 2NXCA 5FOWA 3U3MA 1NHWC 1W4AA 2ZSJA 2DJ5A 3KOZA 4YUYA 3FAZA 1BQEA 4ZO8A 4MVWA 3BXZA 3LOQA 4LA4A 1MX9A 1K3XA 4TLAA 2DAMA 3OICA 2XOXA 3HNOA 1R0RE 1MAHA 2BTEA 4WCFB 3K9FC 1M2VA 2VDUE 3ZWCA 5EKDA 5J2UA 4RZSA 4FOSA 1AM4D 1K97A 5IF9A 3U4DA 1RWPA 2VNSA 2FLVA 2B1IA 3MB5A 1E4EB 1GKLA 2FETA 1LPBB 3P52A 3PPIA 4Y2VA 3UO8B 4N65A 2AR7A 3VHLB 2EIXA 3AEQA 3UWKA 1DKOA 1FU7A 1AA9A 1U1FA 3B5EA 1BRTA 4JNCA 4WFQA 5KX5F 4RHCA 3HTXA 4QEDA 4KH1A 2N47A 1IK4A 1R8QA 1VE3A 1JSLA 1CZKA 1HMPA 2O8NA 4PC2A 3OOHA 2V45A 4DV2M 1WU8A 2Z0MA 1H5QA 2OGZA 3BJEA 4AYWA 4YYZA 4V3CA 1ZSVA 3T3EA 2W6NA 2QEQA 1L5KA 1N3YA 3NHWA 4DLLA 4I5GA 4BO4A 3IO3A 1TUBA 3IE1A 4PG8A 3L7KA 2FPPB 2P41A 1SOVA 4J90A 3NONA 4ZAFA 4OXNA 2XVZA 1ICEA 4OI1A 5DSXA 4TXLA 1Z68A 4H7KA 1S3IA 4GZ6A 4F6LA 1D2GA 4BNMA 5FNZA 1P3DA 3CLTC 1XZKA 3AVUA 1P77A 4P7KA 2LUOA 4Z0TA 3M7IA 2XZFA 2IS6A 4FVTA 2IZ7A 2QPTA 4YFVA 3OUUA 3NHKA 4D8VA 3INTA 5TARA 3JPWA 2PXHA 3QHAA 1OLUB 1QB7A 1ZI9A 3OI7A 3IBGA 1NF8A 1W5TA 2ZB2A 1G2IA 2BGRA 3JQ6A 4W8OA 5EQJB 3TN7A 4HJXA 5GVSA 1P19A 3E1KA 2C9OA 3P9PA 3S0JA 4FOPA 4D1YA 4HP8A 4PFJA 3I1IA 2C5SA 2VQDA 3R3WA 3Q7SA 1FOEB 2BFOA 1IHDA 2DP4E 2B8JA 1THZA 5BN1A 5D85A 4L08A 5A9RA 4OLBA 5EQDA 3CG4A 3GJSA 3SKVA 2D1QA 1MHTA 1QXSA 1UP7A 3AERB 3L7YA 1ZNXA 5HIJA 2I4RA 3WOHA 1XA3A 4M1TA 4XJVA 1DXYA 2F8LA 1E3SA 2ORIA 2XECA 4WN9B 5KBYA 2ODWA 1T6BY 2IXEA 4R68A 3SPXA 1AV6A 3I01M 4IDAA 3K53A 4JV5M 2VJCA 3DBRB 2PM8A 1UOOA 2DLCX 4MYTA 4XJSA 2XE6A 5DO9A 1TKCA 2D1RA 4WJKB 4CLEA 1RPTA 1X70A 5EHNA 5B6PA 2LHGA 2NW6A 3L92A 1AJEA 4RKQA 3G3EA 2EJWA 1UQTA 4IBOA 3LT5A 1E2PA 4B6OA 1CR2A 5AJUA 4IPTA 3CKMA 1A3CA 3QM1A 2AUNA 2J09A 2FI1A 3ZHSA 2ZUEA 1ESDA 5KYUB 4TMKA 3OJOA 2NVUB 4DV0M 4E7OA 3E05A 1SUAA 4ND1A 2VIIA 2R00A 3PTAA 5C31A 1KGSA 4L07A 1PT6A 1OE0A 1L5ZA 4QL3A 2UUCB 1DC5A 3JU3A 3PNSA 4PGGA 1CS0A 4TGLA 5IK2A 3GVXA 2Y1EA 1FVOA 3VM6A 2I8AA 1C1XB 3UMFA 3AEQB 1GFZA 1LBIA 2GS9A 2QZ4A 4JX8A 4XX0B 5B7PA 3ER9A 4X62M 4K0KB 3OTOM 2PMCA 2O1SA 2NAPA 2HK8A 3KCNA 3DDNA 3M5CA 1QWSA 3ZZUA 3DLCA 3P2IA 1JUDA 4KYIB 3WLKX 1MEOA 2WUGA 4G4SO 1NW4A 4WERA 4ER7A 2L18A 3GJ6A 1VYTA 2B99A 1AKVA 3C43A 4BHTA 1VPEA 2DFVA 2Z6VA 3FTQA 2JLZA 3ZY4A 3NXKA 1U9ZA 4CIWA 4KN6A 2QZPA 2O59A 5E4TA 4N9QA 1KEVA 3AP2A 3NWOA 4IWYA 5FFNA 5IDXA 4ZJZA 2C2BA 2QUZA 1TM3E 2O54A 1PZFA 3CLRD 5D6NA 3OQ1A 3U26A 4D9GA 3BCSA 3IA7A 4HY3A 1N5RA 3D0OA 2QQFA 3DMFA 4XPIB 1PWEA 1XJWA 4URYR 2BRUA 2SICE 4JLKA 3RRYA 5CB4B 3KCQA 5BSRA 2E2WA 2V6IA 1GCOA 2CDAA 2Q49A 1RYNA 5IHPA 2J7KA 4AQYM 1OIVA 1ECCA 2OGUA 4MRSA 2HFJA 1WUIS 3REFA 1FQJA 2JFUA 2YWBA 4MB0A 2KB0A 4GHAA 5THQA 2X0FA 1RCFA 5DHPA 1OH8A 2V0GA 2LBCA 3GP5A 1YDEA 2CL7X 1AIPC 3ZNNA 1B93A 5HZKA 2QTRA 5DGIA 3SC3A 4J76A 5T4EA 2AS0A 5DEOA 5LM3A 2VQEB 4OP3A 5A03A 3AF2A 2FX5A 4CL0A 1QTIA 2DT8A 3CJQA 1G3UA 1I2DA 2ZYUX 2VZ8A 1NY5A 4FMCB 3OLCX 4PRKA 4PZUA 1QGYA 4R3UC 1N0IA 1YBAA 4MRRA 4ZKEA 1PNQA 5CLLA 1GNPA 4BAGA 2Z4RA 2GPSA 1QGZA 2QD5A 3VNSA 2CHUA 1YFKA 3TIIA 4BC0A 1F7VA 3GFPA 4JOSA 1MO2A 4LE2A 4H9GA 3PNLA 4TMFA 1CYDA 1KDTA 2P6NA 4NXNB 2PWZA 1DFIA 2V6BA 2AN3A 1HKHA 4BIIA 4R9VA 2FXVA 4F5DA 3WHLA 1EK2A 1FDTA 4ZYVA 4X91A 3R09A 5TF4A 3CRZA 4E1VA 5C34B 3MFQA 5HMMA 5C37A 5J4LA 3PKIA 4Q34A 4AZVA 3JSAA 3UKDA 1GL9B 2Y3IA 1QFSA 3E15A 1QFXA 3LY8A 3C7DB 4HGRA 4OGKA 1OASA 3KQPA 3ROQA 3N6XA 3S28A 3WYGA 4JI0B 4ZREA 4Z7JA 2JVIA 5CB0A 1H1LA 5ED0A 5IBQA 1K82A 1ZQ9A 3GPXA 1QOQB 1VE9A 3H5LA 3V4ZA 4ZZ3A 3TAUA 1TL7C 3VH2A 1GAXA 2ZW9A 4HDKB 4YJ3F 3ZDBA 1KERA 1H2AS 1ORWA 4GMGA 5AHKA 2PO5A 4Q1CA 4O2BA 5EPUA 1IN8A 1LTQA 5GP1A 4BVGA 1XDBA 4MWTA 5EIFA 5F2KA 3W2TA 4CEHB 4KN8A 2Y92A 5EFOA 4B6QA 1X8LA 1C8BA 3MQ4A 3D3WA 3N2KA 1IMOA 3HVIA 1SXJA 1IONA 1TRKA 3F2IA 4IOMA 3NW9A 4WUVA 3ZZ0A 1KC3A 1RAAA 3ZC3A 4AJ4A 5IJWA 3HVRA 3I52A 2RC6A 4G89A 5E9AA 4DSTA 2CLDX 3WB1A 4QBHA 3GLFE 1SKQA 3DDSA 3I32A 5T4HA 5DHAA 1RXIA 1X7HA 2QD2A 4KPFC 4E5PA 3SMPA 3RM3A 1F48A 2BKVA 4LOJA 4XAQA 5TEWA 3TLCA 3CWQA 3EBOA 4XRRA 2CBZA 5AK0A 4Z9FA 4BASA 2H4XA 2BM8A 3JAWA 2QVLA 3L49A 4F97A 2C59A 2WPDD 1KJQA 3CHYA 3DHNA 3MUEA 3I28A 4XD7A 4YJHB 4TTAA 2OGSA 2W8BB 3KKEA 3UOGA 1YZYA 4ZEMA 1UODA 2P1DA 1C50A 3G2PA 3HCWA 3DDCA 3FCYA 3GDWA 4HWRA 3U39A 5HR5A 2R87A 3H42B 3O5AA 1IZ8A 4AKEA 4CMIA 3KV3O 4XPIA 4L6AA 4N7BA 3EW7A 4M55A 4QXMA 1W73A 3IBSA 5J9FA 2ZRHA 3I9KA 4FHCA 5D3MA 1KO1A 2IY9A 3O3NB 4MWBA 3PVCA 3AF5A 2C4WA 2Z8YM 3PGMA 3PFBA 4L75A 4NK5A 3T7TA 1QHFA 2W82A 1Z4NA 2Z09A 3COSA 1BMFD 1JLSA 1HTBA 1KXJA 4LRTB 4CKBA 4HL6A 1E6EA 4RTOA 1BX0A 4GMQA 2YVAA 3K9PA 3IOCA 4P16A 4L8WB 5F5LA 1EK6A 2CEAA 1K3WA 4D81A 4QBIA 4CTJA 4TN1A 2GNAA 4UQOA 3SQNA 1RRFA 3G5MA 1RHKA 3STVA 2I7DA 3AF0A 2KM1A 4GLFA 1KJ9A 1TKRA 4JQYA 4WXYB 1J23A 3DMRA 4LBYA 3HKEB 3SKXA 3HCNA 5FA6A 1E79A 1W59A 3JYLA 5LQUA 1DEKA 1PQPA 2XYHA 3QU2A 3LWNA 3PKJA 1NR5A 2CLCX 4L57A 3HZOA 4EW1A 1MJ5A 2BCEA 2V9CA 2H2IA 4PO3X 1MN6A 4CKCB 1YL5A 3LF2A 5L40A 1F1JA 2X8WA 1KAGA 5JJ5A 1GDDA 4R3NA 1HT2E 1OVGA 2NVUA 2P9ZA 3TPCA 1OLUA 1D7AA 1IXSB 2XCUA 4XARA 4IF4A 1L5GB 3U7EB 3EGXB 2HAEA 3V8MA 1V0JA 3W6NA 1TCUA 3IQIX 3M6UA 2QJFA 3T7CA 3PR2B 3E6AA 3RT7A 4D0LB 2FGJA 4Y2XA 2QG9A 1KWGA 4DCVA 1XF9A 1HE2A 4L5IA 4TYPA 1A4UA 4OY3A 4ZQCB 1RP7A 3EXFA 4LSZA 1OCEA 1QG4A 2NPOA 2NV0A 1KHTA 5FLEX 2HJSA 4JUCA 3OEED 2BCGY 2NPIA 4ZTUB 3HXOA 1RRMA 1TUBB 1J5EB 1NVBA 4UMEA 3RD5A 5EJAA 5IDQA 4OO3A 1EB8A 1R6AA 4ZVUA 1KJJA 1NX9A 2V96A 1FYDA 4ZVSA 4N03A 1OWNA 4L4XA 1HRDA 3J7AS 1IB6A 1NF3A 1T6ZA 1W4RA 2A5LA 2CGEA 2Y68A 2WE7A 3B7GA 4KI7A 3A9SA 5I9MA 3WICA 2HSGA 3WJAA 2DAKA 4JJGA 3PT9A 4XUCA 5TF0A 4NU6A 4RIEA 4EHKA 3L2OB 3DBHA 4CL2A 3J80A 1G16A 4AN4A 5EHXA 2QQEA 1TM5E 4XUEA 3VO8A 5DTQA 4R2KA 1VJCA 2NZXA 3HDTA 4TZKA 3U4AA 4CR7A 4GKBA 1CE8B 3WMXA 3HCDA