1OFIA

Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
309
structure length
299
Chain Sequence
b'SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure and Reactivity of an Asymmetric Complex between Hslv and I-Domain Deleted Hslu, a Prokaryotic Homolog of the Eukaryotic Proteasome
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 84
structure length 299
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ofiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ofiA01
1IN5A 1Q21A 2IEYA 3NBXX 1G8GA 4U5XA 2I4IA 4C0BA 1UF9A 2GBLC 2H16A 1A7JA 1P5ZB 1VHTA 1A5TA 5CK4A 2ZSAA 3EPJA 1Q0UA 3K09C 4NCNA 5KO2A 2W6JD 1XWIA 4A36A 4RD0A 2Q6TA 2YOHA 2ZYVX 3DZDA 1XB2A 2FGKA 2B8WA 3M1IA 4H1UA 2PLRA 2XAUA 2P5TB 1DARA 1KI4A 1D6JA 2NO6A 4Y0VA 2CCKA 5HCNA 3ZQ6A 5CB8A 2QG6A 3B7GA 3HR8A 2GESA 3FMIA 4IOKA 4MRPA 1SXJB 4PANA 3U7FB 2Z4RA 4PC7A 4GL2A 3GLHB 4IDNA 2WBLC 1I2DA 5E95A 2MMGA 2ZM5A 5J4YA 4G5RA 1UKVY 2RGEA 2CE7A 5DN6A 4DLRA 4CEHA 2ZRJA 3PUYA 4A0HA 5FR2A 1KY2A 2HLDD 3A4LA 1CU1A 2GXUA 3F5FA 1ZC3A 2IX3A 4OI0A 1YR7A 1N6KA 4IDPA 4PPNA 2F43A 3QVVA 3VU9A 2ORIA 2A9KA 3AF1A 3HU2A 4W5WA 3TGPA 1W0KD 4FD2A 3FDIA 3BFKA 1S2MA 5HCIA 3FHOA 1UEIA 2H92A 1VMAA 3ICQB 5FOXA 2QBYB 4F92B 1DO2A 3GQBA 1RJ9A 4LHZA 4M0LA 2CLDX 4JLKA 3W6PA 5EP4A 3FKQA 4DIDA 4DLZA 2EWVA 1AIPA 1UKEA 1KI7A 2PMKA 5LD2C 3LLUA 3PEWA 1ZM7A 3VNUA 1IN8A 1NMXA 4OHXA 5HTKA 1BS1A 2ZJOA 1IJFA 4OHWA 3BS4A 3THYB 1VKJA 3QXSA 4GP7A 3THWB 3PUVA 2OE2A 4U00A 3RABA 1IN4A 4QXAA 1GP2A 5C4GB 2IXEA 4QC2A 1NL3A 1CJKC 4M8NE 1JQLB 1K5DA 1EFRA 1R6BX 1OSNA 2FPMA 2R6DA 1HUQA 4CT5A 2Z4SA 2J59A 3LV8A 1E0SA 3TNFA 3ZDQA 1PZNA 5JBQA 3U6BA 3F8TA 3M0EA 4MGIR 2EW1A 2X1VA 1KK0A 5J4LA 3WRYC 4KYIB 2R6FA 3NDBB 4HUTA 1W48A 1KJYA 3QKRA 3HDTA 2YHSA 3CO5A 1XPOA 1OV4A 4IOJA 2V6ZM 1TF7A 2ZS7A 4A6PA 3WHLA 3EWAA 3NIBA 1SXJA 3ZYCA 4KBFA 3WY9A 1XD8A 3GLHA 1KZGB 2D7CA 2CCGA 4DLWA 5CLQA 4EDHA 4F4CA 4DDTA 1XJ0A 4RD6A 1NJFA 4TZ0A 2J0VA 1RZ3A 3GJ0A 1W0JD 3L0IB 1SHZA 1TQ6A 2IYWA 2FNAA 5JWHA 3QPUA 1JXOA 3H84A 1D2EA 2HDNB 2B7BA 2FZLA 2ZYWX 4C30A 4E03A 4XD7A 3AVWA 3E1SA 2EYQA 2W2XA 4M9SA 1O3YA 1R8SA 4KODA 1N0VC 1LVGA 4PAMA 5LBIA 3KFVA 1W44A 4O3MA 1G64A 5DGXA 5KUTA 4NYMR 4X8HA 3OF5A 2W6IA 1S0UA 5EXTA 4RCZA 1X1SA 1ZW6A 2PMDA 4MKIA 4D2IA 1DS6A 2OUKA 1VG8A 3A1VA 3AKDA 1XMJA 1ZM9A 2GNOA 1NG9A 2IYXA 1E9EA 2BEJA 4NDZA 4D25A 4GNKA 3VHLB 4B74A 5H68A 4C0SA 1G7RA 5A5GA 3GP8A 3TE6A 3T1TA 4W9MC 4HDQB 3N2IA 1HEIA 4BEJA 1NF3A 1FP6A 4LJ8A 2AD1A 3THYA 4JKYA 3ZLJA 4BRWA 1OW3B 3THWA 1Z28A 3UPUA 2JLQA 2ODEA 2P3SA 4RCYA 3QEJA 4YXWD 5JSZA 3SYLA 1CJTC 1GOTA 3VTKA 1P2TA 3W3ZB 1YRAA 1E2FA 1SVSA 3VQTA 2XOKD 1US8B 3WNDA 3HR7A 1OFUX 5H1YA 1DAHA 2O0HA 2IXGA 4PHHA 2GXSA 1QHGA 3WBKA 4E5UA 1AJEA 2JLUA 1LF0A 1KSGA 4MQBA 2WKRA 3DMDA 3FE2A 1E2MA 3C14C 5HZHA 4RZ2A 4B33A 4MKHA 4CIDA 1KSJA 3W3AA 4ZCMA 3CR7A 4ZDKA 2P67A 2IWRA 5JHGB 3UWOA 2HXSA 5KNBA 3A1WA 2V54A 2ZR7A 3BJIC 5FOSA 4XIGS 3QXXA 1DAEA 3A1UA 3TSWA 4ZI3A 1BMFD 2OILA 1CBUA 5D3MB 2ZI3A 1ZU4A 4BRUA 4LOAA 3LBIA 1SVMA 2PLFA 2QMOA 2YV5A 5FBLB 1RFLA 3G5UA 3U44B 2P2LA 4JT4A 1LV7A 5CITA 1GL7A 4ZKEA 1NVMA 1C1YA 2I1VB 4URWR 4X8MA 3U3JA 4F38A 3TMKA 3QIAA 1G17A 3MJHA 4B3BA 4LHYA 1S96A 4EIWA 1DEKA 1XU4A 3OE7A 1G7CA 3DEFA 1R5NA 3V00A 1PLLA 1FMJA 3GCGA 5JEDA 1N5KA 2NTYC 4B48A 4OI1A 4B3CA 2HUPA 3NBYC 1P61B 4E07A 2IF0A 4OI4A 1QF9A 1FTNA 2JDID 1DG3A 2WMNB 1NLZA 4YMUA 5KPDA 1JECA 3WNBA 1SVOA 2ZSFA 1JBKA 4B6EA 4TLEA 1KO8A 4GMDA 5J4HA 4NCHA 2IBMA 3IPXA 3FHCB 3MG9A 2QGNA 3ZD6A 1E3MA 4ZIRB 2WHXA 5SZKB 3PCRB 3QXCA 2PJZA 1US8A 4BLQA 2R2AA 2QP3A 3C5HA 4B35A 5JECA 2QM7A 2GEDA 2NG1A 2JIZD 4LC1A 4N1AA 3RS5A 2YWEA 2YZ2A 3CZQA 1H8HA 4TTRA 3UATA 2VP4A 2VP2A 1XBTA 4WIAA 3MRSA 5J4VA 3ECCA 2GILA 1HQCA 3CM0A 1CR4A 5DHFA 1Z8FA 3X2SA 4LDJA 4GDFA 4HAWA 4HLUC 4TYQA 4LRSA 1KSFX 1OJLA 4DWJA 1YRBA 4QHYA 5DYIA 1UAAA 1XTQA 1TF2A 4Q21A 2ODNA 2G88A 4O2LA 4XWAA 4P31A 4PPFA 5D3MA 5KPJA 4ESHA 1J70A 4N0EA 2RGCA 3BOSA 1N0UA 2NO9A 1QHYA 1NN0A 4C7OB 2VPPA 1ZJ6A 1QBKC 3JZAA 4ASUD 5IDVA 2YC2C 1T9HA 4DCTA 4IHQA 2BWJA 4DLTA 3IEUA 1E2LA 5TMPA 2YOGA 5EQTA 1XNJA 2VP9A 4KITB 2UZIR 2LWIA 2IYQA 3UMFA 1KK2A 4PSVA 3A36A 1XXHE 1YE8A 4MRNA 2WV9A 4HAVA 3OAAA 3KXLA 1RRFA 4WZBE 1E4YA 5F9HA 5TXGA 5E7MA 4BLSA 3BGWA 1QHHB 4JS0A 2AXNA 4M1MA 1HV8A 5KSZA 2QORA 5G41A 2VSFA 1COWA 3U60B 1KK1A 4TT3D 2FFBA 3GJ4A 1IHUA 3C41J 2ZUBA 1NN3A 3A4NA 3CWQA 1R0WA 3NTUA 1NN1A 1DAGA 2A5YB 4V0KA 1AK2A 2QENA 1TUIA 3HPRA 3UMRA 1IAQA 3B1WA 5BXQC 1R4AA 5CM9C 5G53C 4ZIRA 2ZANA 4MKFA 2CMKA 4TMVA 4C0AC 4WVFA 4LCBA 2VRWA 2DFKB 1FOEB 1WP9A 4QBIA 4E09A 1HH4A 5BWMA 3ND8A 1CIPA 3AV0B 3GD7A 1TQ2A 1X37A 1IN6A 2FJUA 2HF9A 1OH8A 4JYCA 3I8SA 1GRQA 4QRHA 3K8YA 4G01B 4M9QA 3NH9A 1P60A 5BYKA 1TX4B 3EW9A 4GBMA 1TQ4A 1LS1A 4MUAA 1AN0A 1YKSA 1CR1A 2ZU6A 1OT3A 1G291 4MRSA 4Q1AA 2WIBA 3CRW1 2D4HA 4C7OA 4EQ6B 3DM5A 4OYHA 2YC4C 2EFGA 2EFCB 1JAIA 2JJ1D 4LPSA 3EA0A 2A5JA 2UKDA 4TL8A 4DEYA 3EA5A 3CRMA 3HU1A 5DI3B 1M7BA 3L82B 1RRCA 3KTAB 4JLAA 2A30A 4LJYA 3H2YA 2HYDA 1UDWA 3KUDA 1G3RA 4UNPA 5KDOA 1QHHA 2GJKA 2O8CB 1P2UA 4DCNA 1E1RA 3HP1A 1IY2A 2ZRPA 5K8TA 2FV8A 1XX6A 1KMQA 2C9OA 3LBHA 4J0QA 1J99A 1G19A 4JJZA 4RVCA 4P4TA 1XEWX 2A5GA 3A1TA 3EASA 5EP2A 4IOLA 3L0OA 4URZR 2JLXA 2XNDD 1G8YA 4KHZA 1E2EA 2DFLA 5F3WB 4KFSA 1CR0A 2XJ9A 1Q3HA 1W2HA 1Z2CA 1XCPA 3NBFA 4PO8A 2E9SA 2GZAA 4L4UA 1FZQA 4LYAA 4W5HA 4DBLC 1KI6B 3IHLA 4G5SA 3PIRA 1GRRA 5FPKA 4ZV4A 3GLFE 2J7PA 1KHTA 2YYZA 2ZJAA 3VR6A 3TIFA 2V7QA 2WZQA 3B2EA 1T8UA 4QBHA 2D06A 5KSOA 3PJRA 5KDDA 2Q9CA 3H1TA 4Q02A 3CRQA 4ZKDA 3VKWA 4WZAE 1CULC 3KKPA 3MUFA 2ECKA 1U8AA 1RYHA 3REGA 4FWTA 4G5OA 1EFCA 1H8EA 1ZINA 4DKXA 4A82A 3OEEA 1IN7A 5GJWC 5DYGA 4G3XA 4I1SA 4IDOA 1ANKA 1E99A 4EQ6A 3PEYA 1OH7A 2WMOB 1AKEA 2V6JA 4F93B 1EGAA 1OH5A 2ZSDA 3T34A 1Z63A 1OKKA 1W5TA 3WXMA 4DT1B 1ZUIA 1P75A 1ZNYA 2W83A 4Q7KA 2WOJA 2V8OA 1JR3D 2CL6X 4NHOA 1XPRA 2FEOA 1NSTA 3KTAA 4PO9A 3P32A 5FTKA 2BIFA 4IXNA 3R9IA 3WMEA 1EG7A 2WJGA 5HKKA 1JR3E 1AZSC 2N46A 5DH9A 3I92A 1W36C 2O0KA 2AWNA 3X1WA 3O8CA 1IOZA 4PFSA 2GWHA 4FCWA 4MDEA 4PAOA 1PV4A 1TQDA 3SOPA 1Q20A 2VO1A 2FX3A 4HDCA 1CRQA 4LRWA 3SHFA 2R9VA 2REXB 1TL7C 2KE5A 5AR1A 1P9NA 5L3SB 4POAA 3TBKA 4TL9A 1J8MF 1KI6A 4HATA 5DLQC 3RYTC 1Q12A 4FWIB 3C5CA 2ZROA 1P6XA 2AWOA 3KKMA 4HEJA 2FFQA 1NBMA 3DVLA 2RGNC 5TVKA 4IVQA 4PHGA 2FOLA 3QJYA 1LF5A 2ANCA 3ZZTA 1ZCAA 5JRJA 1E2NA 3HYRA 3CRRA 2WAYA 4QJ3A 2VF7A 1BYIA 5LDDC 1DADA 3K70B 3ASYA 3P20A 3LFUA 4L8GA 2NO1A 2JEOA 1RVDA 1XDBA 2QAGC 2WOOA 3A37A 4Q9KA 1R8QA 3IDQA 3T5DA 2F55A 1Z0KA 2CXXA 4KLNA 2OT3B 4DJTA 3AF0A 2J9RA 3VR2A 4D4JA 3GLIB 2C04A 1E1QA 4I4LA 2OBMA 3DHWC 4DVGA 1AS2A 3EIHA 4DT1A 2AX4A 4DDUA 2GEUA 1P73A 4W7SA 5KSPA 4G5GA 5B30A 1PJRA 1ELOA 4I81A 4PX9A 1S1MA 3WP0A 3MHVC 1G8PA 4MITA 4DLYA 4F7WA 4O2RA 2NIPA 5DISB 2VBCA 3ZS8A 1EFRD 3QPWA 4MH0R 3QQ5A 1WDTA 2C9CA 4PZLA 2R8RA 4UQOA 4XTRA 2G1KA 4NE2A 3B8HA 1NNEA 1A2BA 4DXAA 2WJVA 1VYTA 3AVUA 5GJVC 2CVFA 3JVUA 4H9GA 2CBZA 1NKSA 3QBTA 1RKBA 1T0JB 1Z6AA 4EJSC 1QHXA 5L3SA 1SXJD 3B13B 2X2EA 1OH6A 2C9YA 1JNYA 1YZLA 2ZI5A 3E2IA 3IQWA 4AYWA 2P65A 2QQEA 3QENA 2G0NA 4LJ5A 1E69A 3CF2A 4Q1FA 1ZD8A 4AY2A 1E2KA 1NN5A 3VR1A 3B5JA 1SXJE 3LBNA 2Z43A 2ATXA 3JZMA 3GLHE 4M1SA 1OHHA 1ZC4A 2GAOA 2C96A 3I3SR 2F43B 4XD7D 2JLRA 4D81A 2HJVA 2VHTA 2L0XA 4PSKA 4OQMA 1VPLA 3CPJB 2WKQA 3U7GA 1LS6A 2JGNA 1E79A 3RSLA 3ZJYA 2FEMA 2OEPA 3B9QA 1Z6GA 3GEHA 2A2ZA 4TZ6A 1FMLA 4EUNA 2IUSA 3BB3A 1DOAA 2R62A 2BC9A 5FUWA 1VDZA 5G3YA 2FSIA 2BJWA 4Q1DA 4UXIA 1L4YA 1KDRA 1G7SA 1W46A 2GK6A 3WHKA 1G8FA 3ZH9B 4UNNA 2B6HA 2PEZA 1CF4A 2HCBA 2CL7X 4ZDWA 4DLSA 2BBOA 3ZD7A 1NY6A 2RCNA 3A6PC 1XMSA 4TWZA 2F1IA 1SKYB 1IXSB 1G20E 4G5QA 5AK0A 2YKGA 3KXKA 4LYFA 3U5ZB 3QXHA 1GL9B 1RE0A 2ZETA 3UXMA 1QG2A 2OXRA 1QRAA 5EE9A 2BMFA 2IYZA 3Q7QA 4XVUA 2BV3A 2Q21A 4NMMA 1Z0IA 3OFNA 2G3YA 4DSNA 3V4RA 4II7A 3U3MA 2HYIC 4FWHA 3QKTA 1SXJC 1DBSA 5L3QB 3WYGA 3QF4A 2QMUA 1JR6A 3KJEA 3I5YA 3K0CC 2ZAOA 3B60A 4HYYA 1NI3A 3PEUA 3FMOB 3QKRB 4DCUA 1ZD9A 3AP2A 4Q7JB 4AC9A 1GILA 3CONA 1VIYA 1U81A 4PC6A 2QPOA 1QHSA 2XSZA 3HYTA 4QJ5A 2PEYA 2AKYA 1PVOA 3IBGA 4GZMA 1K5GA 4PSAA 1Y63A 2ZR0A 1FW6A 2PZFA 4WA7A 4UNRA 2MMCA 3KW6A 4YQFA 5GJBA 2QMHA 2GAAA 2B7CA 5KSYA 2OM2A 2NO7A 2WVJA 5FI1B 3HPQA 1QVRA 1LFDB 1E6CA 2DHRA 1S1CA 3WYAA 1AZTA 5IK2A 5C2JB 4MYHA 1DELA 2F9LA 2X8AA 4LJ7A 4L15A 2IYUA 3DPUA 1VYUA 3H0KA 4CW7A 2XZOA 4PC2A 3TJZA 4HB0A 4US1R 3OE7D 4WZ6A 5FBRB 2NMVA 2R65A 1VCMA 4AK9A 1S8FA 2B92A 4TYNA 3ZVNA 221PA 1E2DA 4GITA 3CR8A 3ICEA 1X8KA 3SHWA 4AWXA 4DC9A 3ZVRA 2XX3A 4LYHA 3SQXA 5FBWB 3PUZA 1U9IC 2GVZC 1GKIA 2IYVA 1NKTA 2QROA 4B3XA 1EWRA 2JJ2A 2YVUA 2GXAA 2Q0HA 3QXJA 1N3BA 2YJTD 2G9NA 2RKOA 4AG6A 1NRJB 4EPYA 1YZNA 4YMTA 5JSZB 2WM9B 3P4YA 3SFVA 3LDAA 4NONA 1WF3A 4BFVA 4IXMA 4ESVA 2KI5A 3PFIA 1IONA 3J81k 2ZRNA 2IHBA 4I1UA 4OJQA 4OQNA 4C4PA 3EG5A 5L3QA 1TU3A 1FUUA 4FXPA 3I73A 1TEVA 4BLTA 4M1TA 4LPKA 2QTVB 3BRWD 1ZD1A 2A7QA 2VP5A 2VSXA 4C0LA 2WWWA 1E94E 5EXXA 4TLAA 3ONWA 1UEJA 5BN3A 2CLSA 2EYUA 2HCJB 1P7CA 3DKPA 3RLFA 1TF5A 4URXR 2QMEA 2DWOA 2ZJZA 1EESA 1E32A 2ZI4A 1W4AA 5AJWA 5EUQB 4B75A 1KSHA 3K0FB 3LO5A 2O5VA 3AKYA 4Q1CA 5LD2B 4ZDIA 3EIQA 1YZKA 3KZ1E 3NKVA 1V5WA 2O8BB 1KMHB 5CJPA 1TMKA 5EZ6B 1Q1EA 2VLIA 2ORWA 1GIAA 3A4MA 4O0MA 5GADl 1AM4D 4NCJA 421PA 4PTLA 5C4MA 4Q4LA 2CEAA 1SULA 4DB4A 2VP0A 3MGCA 3EPLA 2GBLA 1Z0DA 1NSFA 2DZOB 4Z8YA 2IT1A 2ZRFA 3PG5A 4EFLA 2WPDA 3PVSA 5EP1A 4Q47A 1RYFA 2ZVPX 3K09A 2NOAA 4Q7MB 3OAAD 2C95A 1KNQA 5SZHB 1KGDA 2EWWA 1N25A 3LWNA 2FPLA 2QUZA 1FUKA 3KUCA 4IJMA 4NPHA 3SFZA 1GKYA 1COWD 1YZQA 2ONKA 2ZRCA 3C15C 4FMCB 5J47A 3GLGB 1EFHA 1N5LA 4MKGA 3HWSA 3LX5A 1GDDA 1XFAA 3QG5A 4JZKA 1G9XA 2NGRA 3SI7A 4CGZA 1NY5A 3W8NA 1F60A 1QZXA 2IYSA 2GJSA 1IY0A 1YR6A 1JAHA 4QGFA 5JJKA 1G18A 3OZXA 5JJIA 2E1RA 3DO6A 3MWLA 1E2PA 5F9FA 1EFUA 1F48A 1KAGA 2V55B 4M1YA 2JCSA 2CK3A 3AVVA 1E96A 3IO5A 4LRTA 1KK3A 5FPYA 1Z6TA 5B64A 3VAAA 3I5XA 2OESA 3PR1A 4BECA 4A2PA 1RW4A 3CNNA 4RSGA 4JBWA 4HZIA 1G8HA 3RS4A 1UDXA 1N2CE 2IXFA 4DDVA 3CNOA 1YZGA 1T5IA 4RY2A 1E98A 2H5EA 2ZI6A 4M1OA 3CUEF 5CDFA 4V02A 3V9PA 2XZLA 3WNCA 4WW0A 3TR5A 4BUJA 4ERNA 2ZE6A 3K9HA 3P26A 2BEKA 3I72A 3K0FA 2VH5R 1P72A 3GJ6A 4C2UA 4LJAA 1OB5A 2BJVA 3KQHA 2O8BA 1AQYA 1KMHA 4V03A 2FWRA 5FUVA 2DVWB 2WAXA 3SR0A 1II8A 1E2IA 2GJ9A 4BEBA 4QM7A 3NG1A 4RD1A 2X19A 1Z47A 4URYR 1Z83A 4ILEA 2RGBA 1DTSA 1MO5A 3OHMA 5B2ZA 3GJ7A 4BPBA 4U02A 3T1QA 2GCOB 1W5SA 1XRJA 5FTMA 4OQFA 5FOTA 3U61B 2NPIA 4Q9IA 3KQKA 4TMTA 5FL7A 4HAYA 5FI0B 1CLUA 3I8XA 3SYNA 5B58C 2ZPTX 1M7GA 2CE2X 4GPTA 4QM6A 5JFGA 2BM1A 4MUBA 1CRPA 1E1RD 4B73A 1XF9A 4NH0A 2HLDA 2IF2A 3TUZC 3FB4A 4TLBA 4R71A 1GITA 2QRZA 3PENA 3GLGA 1KAOA 5K8LA 4E22A 4QGGA 2DPXA 2Z83A 2OLKA 1N6RA 1U8ZA 3T1VA 1GVNB 1T6NA 3RVBA 1X8LA 5K8IA 2GVDC 3VKGA 4NKRA 1FQKA 4FCTA 3BH6A 4XSHA 4EPWA 3QEOA 4Q9HA 5JWRA 1Z07A 3A58B 1N6LA 2BBSA 1F5NA 1O87A 2WSSA 4CZ2A 4TLDA 4MRVA 1E9AA 2J7PD 1EFTA 4NBSA 2EFEB 1DVRA 1KO4A 1GG2A 2V7QD 3P1JA 1G5RA 2W0MA 3BWDD 3IBYA 3DL0A 2RGAA 4BGDA 3QOFA 1DAFA 1EX7A 3BFXA 1T3LA 1N5IA 3BH0A 2REBA 5DSZA 4US0R 5LB4A 5TARA 4QNRA 1GL6A 1HA3A 4A2QA 3RWMB 4JVNA 4A4DA 3W5JA 1NMZA 4TYPA 3SJZA 2WJYA 3SE0A 1H8ED 3G0HA 4K46A 3ZZ0A 4MYUA 3OEED 1WRBA 3X1XA 4KAXA 2WJJA 3AF4A 2FFHA 1XZPA 4EPRA 4GT1A 1AGPA 2OFOA 3KQNA 2GJ8A 1S9DA 3TUJC 4M4SA 3CPHA 1M7HA 1BKDR 1XD9A 1KZ7B 2QTHA 1FP7A 3D31A 4URUR 3NHBA 3VMFA 2WJIA 4EFMA 3LW8A 2IYLD 3M6AA 3KDSE 4NTZA 4TTPA 1OKKD 2VF8A 1QHIA 2GCOA 3GEIA 1II0A 2C03A 3D6TB 3C16C 4UKDA 4GMXA 2VSOA 3KB1A 4NYJQ 4PZZA 4WXRA 1BO6A 1GRNA 3MLEA 5C1BA 3TRFA 1CP2A 2PBRA 2MSCB 4LX0A 4JLVA 3T12A 3TW8B 4OL0A 5HKKD 2VYFA 4LV6A 4BZPA 1MO6A 3AVYA 3GEEA 4FCVA 4ZCLA 2QE7A 1NLFA 2IW3A 2JASA 4R9UC 3N70A 3U2QA 3LA6A 4KLZA 4JL5A 2Y8EA 2QTFA 4DZZA 1MOZA 1UADA 8OHMA 2B8TA 4KVAA 4US2R 1AS0A 4LJ9A 2CDNA 3FGNA 2ZRMA 3GJXC 2F3TA 2ZRHA 4A15A 3SJBA 2ZR9A 2KSQA 4JLJA 2IS4A 2C8VA 4AURA 2RB4A 3EC2A 2QSZA 2ERXA 2I1QA 5FOVA 5CJ2A 3KB2A 4RD2A 4OBEA 1JB1A 5A4JA 3IILA 1NBMD 3EZ9A 3GPLA 1XCMA 3CPEA 2HJGA 2Q9AA 4PAQA 2NQ2C 1WB9A 4XOIA 1CS4C 5FTJA 3ETLA 2XTNA 1Q22A 4Q01A 1MABB 2RAPA 1J8YF 4I1OA 1NBME 4GP6A 1VCOA 2WWYA 3ZGXA 4K81B 4D4KA 4OKSA 4JIMA 4TSFD 3TW4A 1U0LA 3AEZA 4RKFA 2F3RA 4A9AA 4UNQA 1FPMA 2XB4A 3S1AA 2XOKA 1ZUNB 1G4UR 4JL8A 2IWHA 5KHOC 3A1SA 3CF6R 4CYMA 1UBEA 2G1JA 2BBTA 3R8FA 1KOFA 1E2HA 1E1QD 4A8JC 1C1KA 2KRKA 1UPTA 2ZREA 5JCPA 2DR3A 4YLGA 3LLMA 5CYPA 2ZJYA 4IOMA 1GNRA 5SZIA 4ZI2A 2DWQA 1RC8A 2UZ3A 3KJHA 2QA5A 4BZQA 3GJ3A 5JMTA 5KYKA 1XD2A 2XNSA 2KB0A 1OIWA 3T15A 3B82A 2V1UA 4B43A 4AYXA 4JLPA 5JZVA 1DAKA 2AXPA 2ZS8A 2FA9A 2IUTA 4NCKA 2C77A 3DKVA 4FIDA 2P6RA 4HLUA 4V0ME 2OSBA 2JLVA 2ODWA 3DDCA 4QL3A 3MD0A 1XXHB 1IXRC 3IQXA 3FHTA 1OYWA 2G6BA 1ZCBA 4PQYA 3OIUA 2LCFA 4MDFA 2H8KA 2D74A 2CL0X 4Q5IA 1Z08A 1KYIA 3CX8A 3PITA 1L4UA 5JEEA 2J5XA 3KKOA 1XP8A 4TQ9A 1S3SA 3U3OA 3EC1A 1KI8A 2CNWA 4IFEA 4WOPA 4QKQA 3PEVA 2GEVA 3LD9A 1GTVA 2C99A 2WKPA 1XEFA 1HTWA 4C0QC 2F1JA 4TL7A 3IGFA 3CIOA 2IYYA 3U7HB 2C98A 4A6XA 2JDIA 3BIFA 1ZU5A 1G16A 4HLDA 3X1DA 4HAXA 3AGPA 4PXAA 2NPFA 4DLVA 1MABA 4I99A 1VHLA 1Z6YA 2J45A 4HB3A 1E79D 1YZUA 2VIIA 1D9ZA 4DLXA 1XTKA 4NCIA 2G0TA 4Q66C 3G82C 4BFTA 1KI9A 4DEXA 1ZAKA 2ZSBA 1LW7A 1ZP6A 3EZ2A 1KO5A 4IDQA 4MYCA 1EWQA 3O8DA 4RZUA 1LB1B 3RS2A 1FX0B 4URVR 3V4FA 5FOUA 3PV0A 3JVVA 1I2MA 1KTVA 2AD5A 3BORA 4LBZA 3RC8A 2ZI9A 5DO9A 1Q57A 2IC5A 2CVHA 1W4BA 1S9HA 2IEZA 1A1VA 3GLIE 3IPYA 5FTLA 3E70C 1BH2A 4Q9JA 1OIXA 4Z1MA 4C3ZA 3L0SA 4C9BA 5L8VA 2O8EB 4KFUA 5J4KA 1SVWA 2Q3MA 2QAJA 3KX2A 5G3ZA 2OCYC 3DZ8A 1LY1A 3W90A 3FKSA 5EP3A 1OFHA 2GZDA 3AF2A 1CEEA 4ASUA 4ABYA 1G1MA 4B44A 4AI6A 4TN1A 1XXHA 2BMJA 4DSTA 1ZNXA 1VECA 3RRZA 3LH5A 4LHXA 2VHCA 5FTNA 2HT6A 3CRVA 2AFIE 4B76A 1E4VA 1E9FA 2P6NA 2GF9A 1G3QA 2WJHA 2QEQA 3CX6A 2PX0A 1HURA 6Q21A 2GXQA 3RSOA 3IIJA 2XSZD 1IY1A 4V0LA 1PLJA 1M8PA 3ADDA 3TSZA 4D26A 3NH6A 2VHUA 2D2FA 2IA5A 2EQBA 3P27A 3B1ZA 4P4SB 4Z8XA 1T3HA 4HUQB 3RRNA 4QHSA 2F6RA 5DN6D 4B2IA 1V43A 3CZPA 4HLCA 4BZXA 4G1UC 5FFMA 4BE7B 4TMKA 3AVPA 3KL4A 4TT3A 2QI9C 5IK2D 2J7KA 3I4LA 3ND9A 4B6FA 4DHEA 2RGDA 1E9CA 1ESNA 2BBWA 2YWGA 2OHFA 4NL4H 1F2TB 4LK2A 2CJWB 2VP6A 3Q5DA 3U3RA 4HDOB 3LX8A 2NO0A 1W36B 1B0UA 1WBBA 1WXQA 5AJZA 1PUIA 2WICA 4XWOA 5ELXA 1KDOA 2JLWA 1OLOA 4B2LA 1XPUA 5JS8A 3B6EA 1FNNA 2OFWA 4S35A 1I4LD 1FX0A 4ZCIA 3SJAA 1Z22A 5JWOA 2D7DA 4Y0AA 2WSMA 2J87A 3EPHA 1SVLA 2JJ2D 5EE5B 2FSHA 2OBNA 2PL3A 4R2IA 2J0UB 5BYJA 3EPKA 1WE2A 2PZGA 2ZTSA 1VG1A 4WAUA 5E7IA 4BLPA 4EPVA 2RH5A 2ZJ2A 2O8EA 1XTSA 1SZPA 2FPKA 2HXYA 3OEHA 2EU8A 2FE4A 1SKYE 3K9GA 4Q4HB 5FBVB 1E0KA 1RIFA 3EARA 3FVQA 2VL7A 4D0LB 2FH5B 3QY0A 1KJZA 1Q1ZA 1QDEA 1BIFA 2N42A 3VR3A 5EXPA 2AKAB 2OXCA 1E2JA 3FTQA 3PUXA 3QF4B 3AKEA 1Z2AA 4GOJA 3Q8XB 1U94A 4ZO4A 3CH4B 5KDLA 3B85A 4KVGA 4L9WA 4AKGA 5M04A 3LRPA 3O47A 1T8TA 3WMFA 2PJRA 3UG7A 4AKHA 4FMBB 4EKDA 2ZRLA 1QG4A 2XXAB 3GFOA 4KSCA 4BFUA 1U0JA 2XEXA 4P4SA 4HUQA 4LHVA 4A0GA 1U2RA 3A8TA 3I32A 3K53A 3RRYA 621PA 4GFDA 2IS1A 2KBEA 4Q03A 3QVUA 3K1JA 2ZE7A 1F2TA 3SEAA 3ASZA 2CJWA 4IDHA 3QKSB 2IYRA 1R5BA 3Q5EA 2GDJA 2PZEA 2WPDD 1S4QA 2JAQA 2RHMA 3SNHA 4CVNA 1OXSC 5AUQA 2J1LA 3SC3A 1UJ2A 2W6ID 3BC1A 4DDWA 1OXUA 4JYBA 5HR5A 2V9PA 1W1WA 1CR2A 1M1YE 4EPTA 3T06B 4CEIB 4QNMA 1R0XA 4QBGB 4KSBA 1E9RA 5F98A 2V3CC 2WTUA 1T3SA 5J40A 5KNCA 4FI3C 2RGGA 4BFXA 5IT5A 2J0UA 4MRRA 4NU0A 4P4UA 4WXPA 1UM8A 2NZJA 4H1VA 2ZEJA 3C8UA 4Q4AB 5GJCA 3CLVA 3LQQA 3WYFA 4Q4HA 3SU8A 4A0RA 3SQWA 1JXMA 4PHFA 2RGNA 4YC7A 1NG1A 3R20A 1DPFA 4FWDA 5FUXA 1YJ5A 1G5PA 1HE1C 5IHPA 4QG7A 3K9LA 3MWKA 1N6IA 3NVAA 4NYJR 4KV9A 4A0FA 4CT4B 4GOXA 2PH1A 1ZNWA 1NMYA 2GA8A 2VTKA 1GM5A 1MRSA 1MT0A 4LZZA 1H65A 4HSEA 1YHNA 1N6HA 1VYVA 3RC3A 3BE4A 2A5DA 3AKCA 2XXAA 5ANRB 3TQFA 2VHQA 5CDFE 4UNSA 2FF7A 3BBPA 2ODBA 4QFMA 4Q19A 2MSDB 5C18A 4RD3A 4AYTA 5BN4A 2Z0MA 3EZFA 4IEIA 3OIWA 2YINC 2R6AA 2BKEA 2ZE8A 1YR9A 4DIEA 1YVDA 1NIJA 2IS6A 2ZYUX 3QKSA 4NYIQ 1ZVQA 4C0HA 4C0KA 4PQRA 1AGRA 1CJMA 5FL7D 3VR5A 2IK8A 2GCPA 1P9RA 2ZRAA 4PPGA 4TLCA 1A4RA 1E2QA 4CEIA 1F3OA 4LBWA 2DCUA 2Z5FA 2EFDB 4KI0A 2RHDA 3Q7PA 3SDZA 4L16A 1X86B 3L43A 3UANA 4EJSA 4JLNA 3D3QA 1XJQA 1C4OA 4KO8A 2OG2A 4FMDB 3WRXC 5LB2A 2P0EA 1XTIA 3LW7A 3RANA 2ZQ5A 3W6NA 1WBDA 1SGWA 2RGXA 1ESMA 2ZSEA 3QG1A 2FSGA 2OCBA 4Q4AA 1N6NA 4DSUA 4DUGA 3U4QB 5FPSA 3GLGE 4P0TA 4BQSA 4TMZA 5TB5A 4LC0A 2WSSD 2XTZA 2H1LA 1U8YA 1JPJA 5AJXA 3WMGA 1GUAA 3LNCA 1H8HD 4M22A 1ZBDA 4ITRC 2PT5A 3QE0A 3IUYA 1OXXK 2XB2A 2AK3A 3PQCA 3EX7C 1R0ZA 3AP3A 3GJ8A 4OK3A 1ODFA 4HI0E 1DO0A 1JJ7A 1ZM4A 3NEJA 5CIQA 1YZTA 4KJZA 4LGMA 5AUOB 1E9BA 5D3QA 3QSYA 2JATA 1R10A 4MGZR 4GOKA 3ZIAA 2YNMA 3T61A 4DCSA 2FDCA 1W7AA 4Q7LA 1MV5A 2VEDA 1FTSA 1NVVQ 3R9XA 2WWGA 3U3KA 1R5OA 1KO7A 1KNXA 1JPNA 4HAZA 1II8B 1MO3A 2V4ZA 2OO7A 2ZRGA 4KU4A 2VHJA 2C5LA 3AM1A 2TMKA 2KWIA 2Q9BA 3LQRA 4D4LA 2BOVA 1D2MA 2QT0A 4OQLA 4Q48A 4EPXA 3T5GA 1S3GA 1A2KC 4DCVA 3DMNA 2R6CA 1R7RA 5JS7A 4EAQA 3W9YA 4DRZA 2HF8A 2CHVA 2VQSA 2BHRA 1EX6A 1OFTA 1OXTA 2ZYTX 3K0CA 5FPHA 1HQYE 4AG5A 1HT1E 3T1OA 2QE7D 2FSFA 3R8CA 1OXVA 1G3MA 5F2EA 3QBVA 4TL6A 4Q1BA 4RFSB 1TUEA 2C2HA 4BFZA 1WCV1 1MO4A 3DOEA 3AVXA 2AL7A 4BFWA 3RAPR 3P4XA 4B34A 3U4QA 4B3GA 3X1YA 1TAGA 1UBCA 2QM8A 1D5CA 1SVIA 2LKCA 5A0FA 5CB6A 1T0HB 4LJ4A 3AP1A 3D7MA 5TY0A 2GRJA 2R6GA 4JVLA 3TUIC 2QBYA 1U90A 5AJYA 5E7JA 3RNLA 2IS2A 3H86A 3SYKA 3Q85A 1OB2A 2F1RA 721PA 1E9SA 3T35A 3TSOA 3MJRA 4FWGA 1E2GA 3OESA 3DM9B 3RS3A 3F0TA 2GF0A 1Q3TA 3AJIB 3THOA 1IJEA 3U6KA 3L0PA 2OZEA 4Q18A 1UFQA 5EE0A 3X1ZA 3K9NA 2BMDA 1E9DA 1G21E 3EWSA 4X8LA 2QQ0A 3Q3JB 3SN6A 5E3HA 3CF0A 1KI1A 2IHYA 3CWZA 4HB4A 1U9IA 2K5UA 4TQAA 5KU1A 4F4IA 1SQ5A 2H57A 1GFIA 3VX4A 1BOFA 2AFHE 3AQ4A 1ZRHA 2G77B 3BXZA 3R7WB 2W6JA 4LI0A 2DZNB 2SHKA 2HT1A 2D3WA 5KOYA 4HZUB 1MR3F 2YWHA 2GETA 2O52A 1GSIA 4JLBA 3BAFA 4ACAA 4ZPXA 1JEEA 3B1VA 4D80A 2E87A 1RRPA 1VG0B 3VR4A 1KKLA 5AWFC 2WWFA 3BH7A 1OF1A 2OAP1 1IQPA 2ZUCA 4KFTA 5TDHA 3SJCA 1XJCA 4XWKA 5CIWA 1CTQA 4GI7A 2BKUA 4PQFA 3Q72A 2ZRDA 5EJEA 3LVRE 2ZXUA 1JALA 2H17A 4TYWA 1Q44A 1VTKA 1P2SA 4RFSA 5DE3A 3ZVMA 1FFHA 1M74A 5E4FA 5TV2A 1XMVA 1T4GA 1XTRA 2KJQA 4IKEA 4KYUA 4D0GA 4JSYA 1W0KA 4B3DA 4GSYA 4M1WA 3THXB 3TVDA 2GHIA 4RZXA 4CRWB 5HZKA 1L2TA 4LV5B 3GFTA 2CNWD 4ZDJA 3VNVA 1D8TA 2F7SA 4C0JA 4UXJA 5EXSA 3NXSA 3LVQE 2J0SA 5EZ5A 3AB3A 1JI0A 3HU3A 1Z3IX 1UKYA 4M1KA 1ZMXA 1CJVC 4JT2A 2CCJA 1GAJA 1QVAA 3OIVA 4FN5A 3VHXA 5C46F 3IIMA 1U99A 3UK6A 4JKIA 1DAIA 4PC3A 1W2GA 4XH9B 4BLOA 4R7ZA 4JMPA 2FZ4A 4JL6A 4OK6A 4YMWA 3Q9LA 2PCJA 4OQXA 521PA 4OJKA 821PA 3NHAA 1HE8B 5JLJA 3S1AB 3VKHA 1NVXQ 3QPVA 1X3SA 2H7VA 3M4YA 3ADBA 4OHYA 3R7WA 1OE0A 1DE0A 1P9WA 2OFXA 2RMKA 2WWXA 3C7KA 3O8BA 1WQ1R 1N6OA 4FMDF 4KFRA 4LBYA 4P3YA 3WP1B 4BASA 5JRZA 1NP6A 2LKDA 2XITA 1Q1QA 1AQUA 3FFAA 4HZUA 2FMXA 2XTMA 4QGAA 2X2FA 2AHOA 4P33A 4TMXA 4Z1MD 5DIFA 4FINA 2WWHA 1I4DD 2QPTA 4DSOA 1PUJA 5H70A 1G4AE 1XD2B 4B32A 5HE8A 5KNDA 3BB4A 1OIVA 4ON9A 3U7EB 1MRNA 4YDSA 3FKSD 1F6BA 1G41A 1W49A 2OCPA 4D4MA 4YMVA 1TADA 1IM2A 1F2UB 4PO1A 2I3BA 4YDHB 2C78A 3UMSA 1LNZA 4G0NA 2CHGA 3I61A 3U44A 1P3JA 2HEIA 2KBFA 1N5JA 1W0JA 3K0AB 2FG5A 3RWOA 2F1HA 2W2TA 3B78A 3NDPA 3DOFA 3AUYA 4JLDA 2DBYA 1X8JA 4OK5A 4IW3B 4KBGA 1ETUA 2AK2A 1TEXA 2DFTA 2IUUA 1ZM2A 2PT7A 3FPAA 4UXHA 3THXA 1Y3AA 3UWKA 4JN6A 5FOWA 2O0JA 1JQJC 4I1VA 3AVTA 2XZPA 1KDTA 4XTCS 4OHZA 3VLFB 4ARZB 3ZS9A 5BW8A 1G7TA 1UBGA 2GTPA 5IF9A 1E0JA 1L8QA 1B23P 1CJUC 4Q4JB 1K8RA 4XJXA 3ZZUA 1AS3A 4JBXA 1G3UA 1ONBA 4CDGA 4LHWA 1ZIPA 3F3YA 2XGJA 3MCAA 4YXWA 4JVMA 1UBFA 1YR8A 3H4MA 2REOA 1Z6XA 1T5LA 5IRCD 4A1FA 3RS0A 3B9PA 1J90A 3MWYW 1MKYA 4LUCA 3LXRA 3IKJA 1M34E 4DB2A 3CB4A 2ATVA 4RZ3A 2NZ8A 4HLQB 2FN4A 4ACBA 3CNLA 4FMCF 4JJKA 3QF7A 3KQLA 1IXZA 4IVPA 1HY3A 3IIKA 3PUWA 4AD8A 4P32A 3SS8A 5FH9A 2P5SA 2YOFA 4B3FX 3OEHD 1NVUQ 1GZSA 2GKSA 4RKEA 4Z54A 2O8FB 1XCGB 5HPYB 4IVRA 1JJVA 3LY5A 4KCGA 3TLXA 2W58A 1BMFA 2ZJBA 3ZQJA 3ADCA 2QT1A 1F2UA 4PHTA 2IL1A 5FR1A 5UKDA 3EZ7A 2ZAMA 3K0AA 4LY6A 3AH8A 4NYIR 4TMWA 2J41A 4LJ6A 4DLUA 1WMSA 2CHQA 3IHWA 3AVOA 3I1FA 5GVRA 2D2EA 2DWPA 2Q3FA 1P62B 4F91B 1KO1A 1G6HA 2BCGY 5LPNA 4M2LA 3D8BA 1RPZA 4Z51A 2OBLA 3REFA 1GKUB 1KI3A 2BDTA 1EXMA 2MSEB 2ORVA 4JLMA 3SBDA 4A8JB 1N6PA 4IRUB 3NWJA 1DAMA 1GNPA 3I62A 2GZHA 4FW9A 3VFDA 2N1BA 3LAWA 4IEEA 1YU9A 1Z06A 4ARZA 4D82A 2ZU0C 2ZRKA 4MGKR 4A3VB 4X8OA 1JEDA 2J3EA 3WBJA 1OHHD 1QHNA 1X6VA 4Q4JA 1Z29A 5CYOA 4R98A 1XEWY 1KJWA 3B1YA 1MH1A 3EAQA 2JJ8A 4N3NA 4PPQA 2W2VA 3NC1C 2EVWX 5DNYB 2GCNA 2BCJQ 5P21A 1W36D 5HE9A 2OV2A 3K70D 5FL3A 3MAAC 5JHHB 2PX3A 1LTQA 1W4CA 1XMIA 5K8UA 2V1XA 2JIZA 3C4JA 3N2EA 4NYMQ 5H8WA 1I4TD 2J46A 3W8RA 2OAQ1 3FMPB 3BB1A 3KJGA 3BERA 3EZ6A 4PR0A 2OCAA 2ZJ8A 4KXFB 2WIAA 4UJ3A 1FL9A 1E0AA 1W47A 3K0SA 2UVQA 5JJLA 1P4SA 2QU8A 1C9KA 1X1RA 1NVVR 4QOSA 3TAUA 1RRGA 3RHFA 3TK1A 3IEVA 2O8FA 1GNQA 1IBRA 1U98A 3L8ZA 4JVSB 2O8DB 3L2OB 3OFND 3UKDA 2DB3A 1VG9B 2ZIAA 5J5CA 2AN9A 1W4RA 4LSGA 5DI9A 2ZS9A 2B21A 3NC0C 4K8OA 1KIMA 1QZMA 1R2QA 3NBZC 5FBQB 3LXXA 3W5IA 4F4JA 1VCNA 4BFYA 5DI3A 2QL6A 3MMPA 4XSGA 1SVKA 5B57C 3QI2A 3AGQA 4LBVA 4JBYA 3AUXA 1SHKA 2QSYA 3KXIA 4AKEA 4TYYA 4A8JA 3CW2A 1J7KA 4M9XA 1J2JA 1ZNZA 2JLSA 4Q00A 3BFVA 4CF7A 2ZE5A 2YWFA 1G3IA 4N0DA 2OLJA 3GMTA 4XVQA 2O8CA 1KKMA 4PZYA 4IFBA 3VX3A 2W00A 4D0NA 2VA8A 3K70C 2BMEA 4JSTA 4RD4A 3TAHA 3L8YA 1TU4A 1TTTA 1CXZA 5L3VA 4YMSA 3UIEA 1WA5A 1HT2E 2A78A 1XZQA 4V0NA 1EK0A 3QNUA 5CLLA 3PXGA 4CEJB 4Q9LA 2ZRBA 2DFNA 3GLFB 1OYYA 4RFVA 3RS7A 1SKQA 1A82A 1T91A 2ZUDA 5BQ5A 4NZYA 2HV8A 3FWYA 1TNDA 4AIIA 2W0SA 3MSXA 4D6PA 1Q1BA 1M2OB 5SZJA 2GJAA 3FFBA 4LYJA 3OIYA 2J0QA 4BWYA 4JLOA 4GRAA 5L3RA 5JI3E 4QHTA 1UKZA 3KKNA 2FGJA 5CM8B 4W5JA 2R44A 2ERYA 4DUGD 5G40A 2DY1A 2H18A 2ZI7A 3KFXA 1KDPA 4TSFA 1OPXA 1Z0JA 2BM0A 2FFAA 2ONJA 2O8DA 2QP9X 1II9A 2F9MA 2X77A 2GK7A 5AUNB 1KY3A 2BVNA 1D9XA 4S2EA 2JA1A 1M6NA 2CLCX 1XEXB 2QRNA 4OI2A 5BN5A 3W6OA 1N0WA 3BD9A 2JJ1A 4HAUA 2AR7A 3R9WA 1FNMA 4B2PA 4L9SA 4V0OA 3ADKA 3KKQA 2QAGB 4A2WA 3RDPA 3E5HA 1CKEA 3EIEA 1FQJA 3O8RA 1OFIA 1YQTA 4R2HA 3EXAA 4QGHA 3ZIAD 4EFNA 3MFYA 3GFPA 4V0MA 4BLRA 3RRMA 1Z5ZA 1PLKA 2JLZA 2WWIA 3GJ5A 3W34A 2DYKA 5JI2E 2FU5C 1BYUA 2QZ4A 1VIAA 4TQUS 4B71A 1G5TA 2XJ4A 3N5CA 1Z0AA 4O25A 3IO3A 1VCIA 1ZYUA 1NIPA 4GZLA 5JCZA 4QBFA 3CH5A 121PA 2QPAA 1K6MA 3FYHA 1R0YA 3SBEA 4B47A 4UJ5A 1P2VA 4L5BA 4CEJA 1AA9A 4RJLA 1TPZA 4M9ZA 2EFHB 4HB2A 4YONB 2XNDA 3BK7A 2PCLA 3NEYA 3TKLA 3GLFA 2IYTA 4BFSA 3MWJA 4LV8B 3TR0A 3FMFA 4A92A 5CK5A 4TTQA 1G6OA 1NLYA 5AUPB 1Z0FA 5EE1A 3UG6A 4LWZA 5FPTA 4CEHB 1GWNA 5EUMA 2G83A 1HYQA 5FUYA 3AF3A 1ZUHA 3TQCA 4MGYR 2P6UA 4EJSB 1ZM3A 1L7VC 4QJ4A 2Q3HA 3SZRA 1AKYA 2QP4A 3VU9B 3AVQA 1ZIOA 4XVRA 4M53A 2QY9A 3K0EA 2ANBA 4MYTA 5DHAA 2QN6A 2ZITA 3B1XA 1KI2A 4Q1EA 4U7DA 1NJGA 3QKUA 4MA4A 3KJIA 2A3RA 1DG1G 2CK3D 5EE3A 4AKIA 3TVTA 3CX7A 2D62A 1U0HC 4OHVA 2ZJ5A 1RJ9B 1XEXA 3GLIA 3CBQA 3FOZA 2ASEA 5GVSA 2V6IA 4PC1A 4C2TA 2ZRIA 1NVWQ 2JLYA 5AJVB 1D2NA 2A5FA 3HJNA 4NP6A 3CKLA 2Z6VA 4M21A 2ZVQX 2DWZB 2QAGA 3TH5A 5KTYA 4WBSA 1XTJA 2QNRA 3QUSA 3KQUA 2QGZA 1JR3A 3ZVLA
chains in the Genus database with same CATH superfamily
5KYNA 1GDHA 1A5AB 2P2ZA 2BT4A 2IXBA 3DTYA 1NX6A 1A7JA 4KQFA 5CK4A 2R45A 5KO2A 1FNDA 5FXMA 1PT6A 2OWDA 4RESA 2B8WA 1Q15A 1CC1S 3CS3A 2NO6A 1TZKA 3HR8A 3FMIA 5TT0A 3L6EA 4ZYZA 2F5NA 2RGEA 2VQFM 1PWXA 3H5WA 2HF2A 4TTVA 2F43A 3QVVA 4C04A 1QDLB 4K0RA 3ONNA 1LVHA 2WWTA 3M4JA 1VMAA 3TWLA 5CM2Z 1PJBA 1RBZA 3SS7X 3GQBA 4M0LA 2FJPA 5LD2C 3NANA 1JSZA 1ZM7A 3RVLA 4N18A 4HH4A 3BZUA 2ECQA 3BS4A 3EF0A 3DSRA 2VHEA 2I4RA 3G2IA 4QXAA 2G67A 3FDFA 4OXXA 3OKAA 1ZMOA 4GWGA 4YYZA 1VHQA 3FMVA 1PUXA 4L5AA 4JGGA 1IHDA 4W9NA 3DDZX 3CFYA 3WRYC 3O38A 2X8WA 2XQKA 4TVOA 3A27A 5DFAA 3HH8A 3W5BA 2QVYX 3NIBA 5H82A 4DLWA 3I9MA 5KVQA 1W34A 1A95A 4AUEA 1MQSA 1B43A 2DXIA 1D2EA 1YASA 2QUAA 2YWDA 4O3MA 3FVRA 2HMWA 2PTHA 1NFRA 4WCFA 5LQKA 3E23A 3KHKA 1Q0HA 5JROA 4BRWA 2J7OA 4XDHA 5FADA 1H2EA 3SVLA 1M6WA 3VQTA 9GPBA 3HR7A 3HGTA 4LJRA 5BQPA 1SY7A 4F4UA 3PYXA 2FPUA 1ZO8A 2WQZA 4B33A 2E5FA 3EMKA 5HOEA 1X87A 3W3AA 3KOUA 2ZJ3A 2HL6A 3MCTA 1JG3A 4ZI3A 3GVCA 1ZU4A 3ZEIA 3G5UA 3OPYA 1YWGO 5DP2A 3DGFC 4EO9A 1SUCA 2BGNA 10MHA 2F67A 2VAVA 2CWWA 3LP5A 3V00A 5CW2A 1X92A 1R0KA 3QWHA 2HUPA 4JJGA 1WBJB 5JMPA 3AEKB 5KAMA 4M9UA 5E7QA 3FHCB 5JPCA 1BSVA 1FJGB 3QXCA 3O4HA 3RUAA 2YWEA 3NHZA 4FFBA 2LH0A 4DJDC 2ZK7A 4HAOA 3BRWA 5DHFA 1MOPA 1JDZA 4PIPA 4TYQA 4H0CA 2O1SA 3IJEB 3PKIA 4YGYA 4XWAA 3OF3A 3KV3O 1XQ6A 5KPJA 4L5CA 2HNAA 3GEBA 4DCTA 2UZIR 2EFJA 1IFYA 1E3LA 3ZY3A 1Q0SA 4HAVA 4B6OA 3VC3A 1YJAA 2ZTDA 5TRTA 3EXHA 1COWA 3I2YX 4GPZA 5EZSA 1KK1A 4B3SM 4V0KA 3AXTA 1KAMA 1T0PA 3I58A 1N8NA 1FS5A 3AV0B 1OH8A 1C7FA 3ZW9A 2BSQA 4RXTA 4ALNA 1NXSA 5IKOA 3AIIA 1QF6A 1Q91A 3PRYA 4ZOLB 4MJXA 2ASVA 3PFFA 4CETA 3QHQA 1RP7A 3MBKA 1X7WB 4YP5A 3DM5A 4KR2A 4DCMA 5KYWB 4W7HA 4GKKM 4B3HA 2QL9A 4EGAA 2C4KA 5HIIA 3GNQA 2XW6A 5DOVA 4EHLA 4UNPA 1YE3A 4H1HA 1IY2A 3COSA 3TRHA 2VAPA 2EATA 4DMRA 2J3MA 4EUFA 1G8YA 1E2EA 1JWBB 4BHTA 1R6AA 5EHZA 5FPKA 2Y76A 4DBLC 1KI6B 4GI5A 1M8FA 3G02A 1EFCA 1H8EA 5GJWC 2XTJA 5JH7B 3EHEA 1AHNA 4G0VA 3MT0A 4DR6M 3WGIA 1IXKA 4KIWA 2EKFA 5HDQA 3GLTA 1NSTA 3LXUX 2AYYA 1ZR2A 4ZYXA 1JR3E 3GAAA 2J7NA 3M1AA 1HM5A 3GFVA 5DCWA 4LRWA 5J43A 2IU3A 3W5SA 1M75A 2DWMA 3C5CA 1P6XA 4XLLA 3TZBA 1EYZA 1SCNE 3LKVA 1NW3A 1LF5A 2EF0A 5D5HA 2NSJA 3S3TA 1KEKA 4GPAA 3I04A 4WGFA 1GCIA 5GIPE 5EI5A 3I64A 4KLNA 1YFKA 2J9RA 3HO8A 5LMNB 5IC6A 3DDWA 2FSVA 2NQ8C 4DLYA 3Q88A 3CA8A 1L6IA 1W35A 1P29A 1WDTA 1PO7A 2FN7A 4G0YA 1IEXA 1QANA 1BXKA 5BNTA 5FA5A 1GFWA 4EARA 4EKEA 1NNEA 1GJTA 4J0HA 5DHRA 2NSHA 3MGGA 1NVEA 5AHOA 4KQIA 4LJ5A 2QUJA 4Q1FA 3HADA 2DF8A 13PKA 3W8DA 1J8FA 3IHPA 1OWOA 5KQMA 1WD5A 2I99A 4NG5A 2V65A 3BRCA 5GV7A 2WKQA 3U7GA 4C89A 3RSLA 3JR7A 3V55A 5D8DA 2AT1A 3INTA 4KNVA 2Z56A 5HG0A 2VZEA 5HW0A 1VDZA 3W6UA 3ZH9B 3KE8A 1N2IA 5EHQA 3USES 4IBDA 3AJ9A 3UB2A 3UXMA 5EE9A 3REQA 3OFNA 2FZVA 2H5LA 2RC6A 1DBSA 1YSYA 5TE9A 4QFDA 1Z16A 4PBSA 1KYYA 4IO1A 3EQZA 5D00A 3ER6A 4YQFA 3HJFA 5FI1B 2WVJA 2VJDA 4IO0A 2NV0A 2B3TA 4EG5A 5MFZA 1VYUA 1WXGA 3NTXA 4HB0A 4L8RC 4TYNA 1MG0A 1CUDA 5C8YB 5FBWB 1GKIA 2QROA 4IS3A 3UVEA 3K15A 4UOEA 3GK3A 1VGQA 3QIVA 4KYTA 2Y0CA 2QX4A 1X1BA 1QO0D 1WF3A 2OLEA 1JR2A 4OLAA 2ID4A 4OJQA 1AT1A 2F2TA 3AHCA 3I73A 1R6XA 4Y7DA 5BN3A 2IYFA 1FP2A 2DWOA 3N3AC 4MCIA 3EIQA 1TMKA 3GCDA 5GADl 1POWA 4V38A 5DU2A 3U62A 1K9VF 3PNOA 1XCBA 1PL0A 1BMDA 2B9EA 2KZUA 2HA6A 4D9BA 2CWBA 1ZJZA 2AN3A 3JQ7A 4PNPA 3VDRA 3GLRA 1NOIA 1D0VA 1YVEI 4EB6A 3M5DA 4JZKA 5F9MA 4EA9A 1H0SA 4O4IA 5JV5A 3D7NA 3IVXA 1KAGA 3N0TA 2PT6A 3O84A 3V1YA 3I5XA 1TD1A 3JRWA 5G1PA 4RM3A 3OFJA 5IMSA 5KNBH 3DTNA 4RIFA 4G1EB 2GVNA 4TLLB 1RYZA 4V02A 2X15A 5CXQA 1C3VA 4HYTA 3KQHA 2AS0A 2G40A 3EZXA 5BSWA 5JNSA 1W5SA 4O1MA 2QRVA 2OOSA 4X20A 2GUWA 4QZVA 2ZPTX 4MUBA 1N1MA 4NH0A 4ZC1A 3PENA 1YJBA 4AJOA 2Z83A 1U8ZA 2HHLA 1FQKA 1T35A 3A58B 4B5LA 4B40A 1F5NA 2CV2A 1KS9A 1GL3A 1E9AA 3VR6D 2DP4E 3DL0A 2CNKA 3QOFA 2BFFB 4I50F 4LSZA 5TARA 3HBJA 1VJ5A 1ILEA 3X1XA 3PFNA 3N8KA 3ORRA 2F48A 2H4WA 3LUGA 4NHEA 4M4SA 4EG7A 3HFRA 5K6AC 4TTPA 1OKKD 3CLTD 2OYCA 3DXFA 1I7NA 4IHJA 3C16C 1CHDA 4GMXA 2BTQB 2RAUA 5C1BA 3UJNA 4JLVA 3TVYA 1AXGA 1HG1A 3SYRA 2Z6AA 1DGGA 5E0KB 4JL5A 4DZZA 5E2AA 1UADA 1AS0A 3RYFB 2RHCA 4HDKB 3NOVA 1K2WA 3KK0A 3EC2A 2BN4A 2I1QA 2DLNA 1REQB 3D3JA 2WRZA 1WB9A 3RTBA 3C98A 4RZQA 1OTRA 4RKFA 2GARA 1MAUA 2C9MA 1TJPB 4AMGA 4Q3BA 2PMBA 1E1QD 4YALA 5F7ZA 3KYJB 4YLGA 4DAOA 2QA5A 5IJ9A 2WSEF 1XD2A 4B3IA 4BY9E 5DULA 4NXMM 2PBFA 3TOZA 4TUYF 4NCKA 4UU8A 1I2ZA 3E3OA 3U4MA 2CUTA 4DM7A 2O2EA 5LZ5A 4KV7A 2ODWA 4QL3A 5LQCA 2FZGA 2G6BA 4W8GA 2ZTCA 4QICA 1QAQA 3ZE1B 1KYIA 3BDVA 4DTCA 3DBIA 1XEFA 2F1JA 5JRDS 4YUAA 1ZH4A 2OBYA 2ALJA 3E27A 4DLVA 4PXAA 2NPFA 2WW8A 4ZOQI 5KOHA 1HLDA 4BP8A 3OD5A 4GH5A 3OZIA 1EWQA 1EUDA 1PX2A 1FX0B 1KYXA 4ZYTA 3L04A 4IRMA 1B1CA 1OXBB 4QXQA 4TWJA 1I2MA 1L4BA 1UQRA 1MW8X 1BH2A 1OIXA 4Z1MA 3D8NA 2FQYA 1A5BB 4FFDA 1G1MA 4PZ9A 3BTSA 2A9OA 3M4XA 2W8ZA 2HSWA 2PX0A 4AMYA 1IE3A 1PLJA 1R5LA 2WIJA 2BMAA 2ZWVA 2P9QA 1BS9A 3SIPA 3IE0A 4R31A 3C24A 4MIOA 1LSJA 2CJPA 4D9MA 3KVYA 2CJWB 2BCEA 1QZ3A 3CVXA 3DTVD 1RBQA 3KLPX 2FY8A 4DR3M 4XWOA 3EQ7A 5ECYA 1Z22A 2D7DA 3WBFA 1Q0PA 2QXUA 2FUEA 1OYOA 4R2IA 1YUNA 2ZTSA 3DC2A 2RH5A 3LTEA 1F8YA 5JFTA 1B8NA 1Z5NA 1XAIA 1E0KA 3F5QA 1VJ0A 1H3FA 2FH5B 4RTMA 1A9ZA 6PFKA 1E2JA 1DJNA 4XOUA 2GAJA 4OV6B 3C1OA 1JAZA 1XI2A 3S7TA 3UG7A 4J29A 3FNBA 4P4SA 2JRCA 1CT9A 5CIYA 3VYSB 3MK31 3QVUA 1HZZC 3ASZA 5G4KA 4DR4B 4WOJA 4XQCA 2K6BA 1OXUA 5HR5A 1W1WA 7CATA 5F98A 1QGED 2DWLA 3DE3X 5KO3A 5JNUA 2ZBRA 3D8HA 1F8FA 1I51A 3VVLA 3LQQA 1DXYA 3LT4A 4XEUA 3WYFA 4ESOA 1ADYA 4Q4HA 3SU8A 5EKDA 4AT1A 1M5TA 3HB0A 3JR4A 2OQ2A 1SEVA 3FPFA 2QD1A 2CUNA 1M2VA 1U4OA 5KJFA 4KV9A 1IOVA 2PH1A 1MQ8B 2AXEA 1TF0B 1WZCA 3TW0A 3LUAA 5CCBA 2A8YA 3OTIA 5LWQA 2IE0A 2AFRA 3KZCA 3EZFA 4O4LA 2YINC 3OCYA 2O59A 4C0KA 1XKLA 2UDPA 4F04A 2ZZKA 1PJIA 2DCUA 3DZHA 4EJSA 1ULUA 2IGBA 3PA6A 1ZA1A 4J1SA 3U4QB 3E8SA 1RXEA 2I66A 4OP2A 2AJBA 3G7UA 2R7LA 3LNCA 4FYYA 3RK1A 1W94A 2B1RA 1A4XA 1R10A 4DCSA 5J2TA 1JF8A 1U7DA 2JGLA 1C3LA 1EWKA 4FC7A 2AFVA 4NFSA 2WVAA 2Q9BA 4CM8A 1QK5A 3C58A 1TAQA 1GNLA 3WQSB 2VT7A 3P9QA 1QBGA 2VJMA 1Q83A 1I3LA 4ZRDA 3OQ6A 4O02B 4AO6A 4CUZA 1GZHB 4XJSA 4BFWA 2QX8A 4FGKA 1EBFA 4WKGA 3ISTA 2I62A 3TUIC 5F1PA 5DM2A 1HGXA 2EP8A 3AJIB 3FPHA 3BF8A 4QNNA 2OHHA 3NVDA 3NTVA 1O6FA 1RYBA 2VHXA 3T5BA 3QEKA 1ZMTA 1FTQA 1L4LA 4FGLA 3R7WB 3WLEA 3CVJA 3KVRA 3WGVA 1T6ZA 5HSGA 5AW0A 1ISPA 2YHBA 3KZNA 1LSUA 2QUBA 2HO4A 1KWGA 2GQ0A 2D54A 4L7QA 3SJCA 5K20A 1JDTA 1CUIA 1VTKA 2R18A 1W25A 3HU5A 4JSYA 4B3DA 1EE9A 3M3DA 4M1WA 3THXB 1G42A 3ZZMA 4MM3B 3K0HA 4C7JA 1WMFA 1K2VN 5JANA 4XQ0A 2CVOA 4FN5A 1FYDA 4PC3A 4TV9B 2IHKA 4NF2A 1RP1A 3C7DB 3L6BA 3NHAA 5IZCC 2IPXA 4RLHA 5CFOA 1YCDA 1OE0A 2WWXA 5IUKC 4BV9A 4P3YA 4HZUA 3GPCA 4QGAA 3JWHA 1WHCA 5DIFA 2QPTA 3NFRA 4NS4A 2CNBA 4ENSA 4XDGA 2CHGA 2PVSA 3VYUB 4FZRA 4CKBB 3PXBA 1TEXA 4FJ1A 4JN6A 4LYDA 2L4FA 1JQJC 3GVPA 4NU5A 3L7NA 1SCUB 2WT4A 4Q3EA 5LP6B 1JH9A 2OGTA 4JBXA 2SCUB 2V3VA 3V97A 3PTLA 1UBFA 1XAHA 5AVJA 2C9ZA 4C3OB 1N7IA 1X1QA 3U6PA 2CD7A 3FNHA 2Q1WA 3QF7A 3S40A 1ISSA 3FOBA 5D3KA 4AD8A 4OHUA 3QYBA 1OQAA 4V0SA 2XRYA 4RDHA 1NVUQ 4MS1A 5HPYB 1PR2A 4WECA 4HEQA 5C8VA 4LJ6A 4HNSA 4X1IB 2CHQA 1Y4AE 2I7XA 1BCRB 1X7ZB 2WDZA 2WK1A 2OBLA 1EXMA 3CRNA 1WIVA 3B53X 3FPSA 3HN2A 2P68A 1Z06A 4H3KB 3B1KA 4AFNA 3QW2A 1X6VA 1QHNA 3FE3A 3H4VA 4N3NA 4E15A 3PNPA 1MVNA 1K27A 4X45A 2HC9A 4JYMA 4IIGA 2RJNA 1E5QA 4UFNA 4YP6A 3KQUA 2ZJ8A 1T5OA 1CUSA 6NULA 1W47A 4R54A 3WSVA 3JQAD 3DYIA 5LZ9A 4TOIA 1DB3A 2VZ8A 3V1NA 4D41A 2OV1A 2FW9A 2V9CA 3KFUG 3ELWA 3RSZA 2QDXA 3O31A 2G9ZA 3AGQA 4A8JA 2GK3A 2WJAA 2ZE5A 3R3YA 2Y66A 3K20A 2GNAA 1KORA 3GUZA 1HT2E 1XZQA 3I45A 3OTOM 2F3SA 3D3NA 3OQ1A 1LBSA 1WOYA 3WZLA 1AQJA 1O57A 1YB1A 2VDUE 2H9YA 2PS0A 1LLFA 2YW2A 3KOZE 5GWXA 4OHRA 5KX5B 2YCLA 4ZI7A 3FJOA 3LWZA 2X77A 3FIUA 4BKOA 4HNGA 4S2EA 3MJDA 1KXJA 3LJKA 4YQEA 4DUYB 4AX4A 4B2PA 3GY0A 2UZ1A 3GFPA 4L3VA 3K1TA 3NAMA 3WISA 2XJ4A 3N5CA 3AI3A 1T0IA 2RHTA 2YBEA 2Y77A 3UOGA 2MROB 3EJ6A 5CURA 1J0DA 1K6MA 2MH8A 1VI6A 4B47A 2CFSA 2C7QA 2H1HA 1SXGA 2LCQA 1NXQA 3GQ4A 1JX6A 2FW1A 5EE1A 3LCJA 4QYXA 3T6KA 4KE6A 3RJZA 3SZRA 3EK2A 1GR0A 2YRFA 1DOZA 2CK3D 5B3KA 3WIBA 5JS1A 1NP3A 3GLIA 3FOZA 2R5WA 3G2NA 8AT1A 3HWWA 4WZZA 2ZVQX 2DWZB 1YKFA 3X2FA 1Q21A 1TLLA 2K0BX 4RW0A 1P5ZB 1Q0UA 4CLRB 2H2AA 3CTPA 3DXYA 5AKJA 3EBPA 1U7TA 4EX6A 4NR0A 3V6MA 1PN3A 3B3QA 3IMEA 4M7WA 4W5WA 1M0EA 2OB2A 5AK6A 4KPEC 4LZWA 3MK6A 4H1TA 5HIAA 5C1PA 1SG0A 3PC8A 1E0DA 3A0UA 2NXCA 3V34A 3FTNA 3C5EA 2KHZA 3GQ3A 4KPYA 4HRVA 4CI9A 5C4GB 4WRRA 5EJFA 5LJIA 1NL3A 4CF6A 4ZAWA 3ZDQA 4MHTA 4CBVA 3NDBB 1EE1A 2YHIB 1VEKA 4FHFA 2O7RA 4LF9M 2HW8A 3D1JA 2Y4OA 3P9CA 3EWAA 4MLDA 1XQXA 1LQUA 3K96A 3TLEA 2IYWA 2V7UA 1JIUA 4C30A 3SDBA 4OX9M 4MAAA 3CZ9A 4FCCA 1LLQA 3K73O 2H5JA 4FKBA 2OUKA 1NP7A 1YQDA 3KJQA 4BXOB 4KO4S 3PGXA 4PLCA 3IP3A 4LCJA 1F6DA 1FFDA 3KKEA 3FROA 3D6MA 1RRKA 3QEJA 5AW2A 2UUBB 2XOKD 4RELA 1XVUA 2PS1A 4BP3A 5BUCA 1KSGA 2D8MA 3VR4H 3DMDA 1Z18A 2QLJA 3WQQA 3FVWA 4UULA 4JV5B 4XPIB 1NQ5A 3UWOA 2DVMA 1VPDA 1BMFD 5JY6A 4F97A 4RK0A 4J9VA 2UXBB 1NJSA 2B0JA 4K5QA 4JT4A 2YXPX 1N33B 4ZKEA 2GX6A 5C7LO 4F38A 3U3JA 5C4IA 1ZOPA 1G17A 5K3OA 4IKPA 3E3LA 4KKVA 1LI7A 1UPXA 2B30A 5DM70 1UMBB 2JCXA 1FTNA 2WMNB 3VJMA 4KJXA 4ZVLA 5ICCA 2QM7A 3RS5A 2MGWA 4M6WB 4I66A 3IPRA 4G8DA 1X77A 2IEGA 1E1NA 1TB4A 3LI2A 1ZJ4A 2IPNA 2VDNB 2VF4X 1ZJ6A 2XGMA 4DQUA 5IDVA 1S8AA 1P4JA 2BWJA 3IEUA 4QFCA 3ZZNA 3AM3A 2Q4TA 1I13A 4D46A 4P5DA 4M1MA 5KSZA 3LNTA 3OUZA 3U60B 4EW1A 5HKBA 3DMHA 3ZY6A 4FIZA 1AK2A 3QAUA 3ZJ4A 1VE3A 3D3WB 4QYWA 1BE8A 3EVZA 4TMVA 4WVFA 3U3ZA 1WJGA 2HDWA 5U9CA 6ADHA 2X5NA 4DG8A 3AHIA 3I8SA 4L50A 1L5MA 2HR1A 2Q29A 3TSCA 1JSCA 3DNMA 4MUAA 3RFWA 1YQXA 1X80B 3DUFA 5IFKA 4Q1AA 1ZVMA 1JAIA 3LRXA 3ITEA 3R6GA 1G5FA 2H2DA 4RULA 1CRLA 2RHJA 3PKZA 2OOBA 1WUJS 1E1RA 1A8QA 2EZ8A 2J8ZA 1ZMVA 4D5EA 1PR1A 4JOBA 4AN4A 4L4UA 4LYAA 3PFBA 1I2AA 2YYZA 2O25A 2WZQA 2RGWA 4CMIB 3PJRA 3EDRA 3PIIA 2FMHA 1V9CA 3H04A 3T5CA 2V7XA 2Q62A 3I01M 4ZOLA 4G3XA 1XKTA 4ITUA 3DLHA 1X7WA 2Z1NA 5D5QA 3V1KA 4K9NA 4RV9A 5IPFA 4Y7CA 2W93A 4WE3A 2PUTA 1L1EA 5HKKA 1IOZA 4LDZA 5ITWA 2BW0A 4PAOA 1PYGA 2W6NA 1PGOA 1ZVKA 1N34M 4EL5A 1PRBA 4O29A 4DA0A 5DX0A 2I7VA 5L3SB 1DGQA 1KI6A 1PCXA 4ZQCB 4V2IA 1HWYA 2KNVA 4MV6A 4XEHA 3CRRA 2WAYA 5AW8A 5LDDC 3RYCA 5JH7A 2NO1A 3SZ3A 1RWBA 3K71B 1SC1A 3RBXA 2M6KA 3ZCTA 2C04A 4IUDS 5JNWA 3RU3A 1KFJB 4MMYB 4GKJM 1Q1GA 4PEVA 1EFRD 3W2HA 4ZZ3A 4PVDA 2I9KA 2W98A 5AI9A 2OB1A 1JWAB 4CQMD 3DKRA 3SP1A 4BBPA 2CUZA 1AN9A 1WZEA 5A4AA 4MS3B 2GBCA 1KL7A 5JVDF 1SXJE 4TKMA 2FMFA 1CG6A 5BRAA 1IIRA 2HIMA 4NV0A 2CDAA 4OQMA 3SSOA 3THRA 5AVVA 3ZNPA 4CMAA 1OBVA 4YRBA 2JGNA 1E79A 3DTVB 1DOAA 1A8PA 4Z4CA 3UQYS 2VCYA 5E1OA 1SKYB 3PIDA 3BE8A 5AK0A 3P2MA 1VJGA 2DUNA 3UYKA 3PE6A 4RORA 4B80A 1HE2A 1H05A 3OM1A 3B60A 4E4YA 4MCAA 3TXAA 3VVMA 3IV7A 4YAGA 1F4IA 4OGFA 1ZXLA 3KW6A 2OM2A 1SU7A 3FOAA 1S1CA 4QDXA 1DELA 2EGUA 3ZW7A 1XHLA 4A5OA 1TW3A 2WZDA 4FGZA 3H0KA 4OJTA 2YDYA 3GUVA 4Y6QA 5FBRB 2OC9A 3H42B 1T0BA 3ZVRA 3L4JA 3SQXA 1KZYC 4WNAB 3WLTA 2RKOA 3DMTC 3FBGA 2B5VA 1XZLA 4EPYA 1YZNA 1J7JA 4URFA 3DEJA 1EFUB 4ESVA 4E12A 5TPZA 2QN8A 4DJFC 1KFEB 1NHWA 1UPAA 2PV7A 2QTVB 1YQGA 3DV9A 4CUJA 5JQGF 3TB6A 3DWGA 3A3NA 4BDTA 4COOA 4JI0M 3K9PA 4WKNA 2O2SA 2NP7A 3T3IA 2B61A 4MSUA 4F5WA 4AZFA 4Q7MB 5IWAB 5SZHB 5A6VA 1IEVA 4DPKA 3L7YA 1IY9A 3IYLW 2FEAA 3ELBA 3QA9A 3QG5A 1ZJYA 1NY5A 1N1GA 1T9KA 4MVJM 3MWLA 1JG6A 2NU7B 4MUJA 2HSDA 2XF8A 2H2FA 3OZAA 3MJ5A 1YO6A 3HA2A 5HKLA 5CDSA 3K9HA 3FTPA 2WUGA 5FJIA 4KDFA 3DBRB 1HKHA 4L1KA 4J2TA 3FSGA 3RGPA 4Q39A 2FWRA 1TGYA 2GJ9A 4QM7A 3HDQA 1Z83A 3UMBA 3BT7A 1GLGA 3WYEA 3OQMA 4NATA 1OA1A 1WHTB 1KOGA 4R81A 2BFCA 3C4VA 4QM6A 4PYRA 4BKUA 4LAFA 4Y18A 2HLDA 1KAOA 4E22A 3S0JA 4AROA 5K8IA 3G2QA 3NGLA 5LUBA 4KWCA 1IULA 1USGA 4BVLA 4NBSA 3TQQA 3ED5A 2P3QA 1G21B 5BPHA 1EX7A 1VXRA 3AIOA 1MB2A 1PQ4A 4HHEA 1ISRA 2FN3A 1D07A 3PWTA 5B6PA 4XFKA 1WB5A 1LV8A 4C6TB 4HVCA 3UXEA 1T3TA 4DV7M 4Q3KA 1U80A 3KB1A 4NSOB 3RHZA 2XA1A 2DTEA 4LX0A 3V9AA 4E4TA 1L1QA 3DWEX 2YJNA 4GYWA 5THXA 4HDNA 1P6QA 1LSOA 2J33A 1Z5GA 1XNHA 1IK6A 2KSQA 3GP3A 3IMFA 4EZEA 4G0OA 1FE8A 3ZPXA 2ERXA 3K9FC 1QXSA 4KN8A 1JB1A 3I53A 4MW9A 1P2BA 5JDCC 3GLSA 4PAQA 1Z0ZA 4Q01A 2X9VA 1J8YF 3AEZA 2XB4A 2G1JA 2CMFA 4ISBA 1HKUA 5A2QS 2GRUA 3S2YA 1GUFA 4H4EA 3B2QA 1DAKA 1QPGA 2G71A 2PUVA 4B5KA 3A1EA 2OSBA 3T9EA 3RYFA 4GE3A 4QPJC 3A9SA 4YWHA 4GNRA 3V8PA 2CNWA 4M9RA 3ZE9A 1REQA 1J2TA 4XR9A 3SIWA 5FI3A 1V96A 1USKA 3ET5A 1ONSA 4YB8A 3VH2A 2SECE 3ANNA 1Z6YA 3M3HA 2XMGA 2L82A 1HSOA 3EQ2A 5B3JC 2BONA 3S5UA 1J49A 3HCFA 4HH0A 3SBXA 1Q57A 2IEZA 4E14A 5L8VA 5FNVF 4KG7A 1SVWA 1MG5A 4P4NA 3EVEA 2GZDA 1BWPA 1QTQA 4J3FA 4E5YA 1QTIA 2R5FA 3RRZA 3VR0A 3BMCB 1A9QA 1D8AA 3WE7A 2RK3A 2Z30A 1C3XA 1M8PA 5DW3A 3TSZA 3B1ZA 3P4UA 5KJCA 4QHSA 1VP9A 4MHOA 2D2VA 1RCTE 3QFTA 1VI2A 1GQYA 3EVGA 5LQDA 1ZK3A 5DNUA 3AC0A 3PFGA 3OX4A 3Q1KA 3Q5DA 2OQRA 1EZ4A 4G2NA 5JAIA 2B8NA 5ELXA 2G9UA 1L7RA 4QDZA 1FX0A 4N3BA 4Y6GB 5IVDA 1NQOA 2ZCUA 2WSMA 3HCWA 1Z2DA 3MJTA 4XRRA 3JQAB 2LWXA 4RPKA 4I8IA 1CVRA 1L1FA 3AJDA 4JYAM 5HFJA 1MDBA 2RG7A 1BIFA 3J27B 2H0AA 1PFWA 4P86A 5IG2A 3BDIA 1F17A 4LFAM 4J6FA 2RK4A 4RHXA 1T5DX 3SYMA 4AKHA 1YS7A 4H59A 4M49A 4OVKA 4DV6B 5ARBA 3RRYA 4NMWA 3E03A 5ELMA 2GWRA 3LUJA 2CJWA 1RAFA 4AICA 3OLVA 3O8QB 1ZN8A 2QTRA 1M1YE 1UR5A 2R47A 1KTIA 1C8LA 5J40A 2A9FA 1GTJ1 2I6QA 5JXIA 4UHCA 1GPYA 4W9NC 3W2EA 4QFBA 4PWYA 3HA7A 4RBNA 1LC3A 1KRXA 3DLPX 1DPFA 2XV1A 3G6KA 3FWZA 4C87A 1HEUA 4CDRA 1HE1C 1ZA2A 5EC8A 4JQOA 5BR8M 4LOIA 4L02A 1VB5A 4NNOA 3C70A 1N6HA 2RH9B 1C3EA 4B3MB 4K28A 2ACKA 2FF7A 3W0FA 1KGSA 4OYRA 4K8RB 1WV1A 4NK5A 4WCFC 1VBNA 4QTUB 1PGNA 2V9ZA 3G13A 4YBZA 2R8XA 5I01A 4D96A 1QIFA 1KS2A 2EFDB 2B83A 2CGEA 3I9OA 4KN6A 1C4OA 4KO8A 2P0EA 3S81A 3THSA 1N6NA 1RZUA 3DZKA 2E48A 4K05A 3WYNA 3QE0A 1S01A 3AP3A 1WL8A 2GYUA 1E6MA 2FDCA 3Q2OA 2RKWA 4HWPA 3M9XA 2C5LA 2BF7A 3CISA 3UUFA 4HLNA 1A2KC 3PDJA 4C0XA 2X8JB 4WVLA 5IAAA 1ZLYA 2ZIFA 1SB9A 1WAMA 3RAPR 3U4QA 4BB9A 1A9PA 1TAGA 3PI6A 3D2AA 2LKCA 5A0FA 3DO5A 2MSWA 4LJ4A 1U90A 5ULLA 1OB2A 4TWBA 1F0YA 1NWHA 3QQPA 3X1ZA 4YCDA 2UYGA 3EWSA 4NBNA 3SN6A 3F96A 4JI7M 3LT5A 4RSMA 3ICCA 1CWUA 4L5IA 5LZ7A 4BNYA 1M83A 3O4JA 2DHQA 3EMVA 1UFOA 4YNBA 3BAFA 1U28A 4TVBA 3W1WA 4ROTA 3UH0A 2BKUA 5EMKA 2I6FA 2M6LA 2J5BA 3D59A 3EZYA 2IPMA 2KJQA 1NDHA 1DCMA 1R8XA 4L4RA 4HS9A 1O7JA 4C0JA 2J0SA 2B36A 4O5AA 4ML3A 1RFGE 1LXCA 4X64B 4DG5A 8ATCA 3O5AA 4W1QA 4JL6A 2W8BB 1W8DA 4OJKA 5TMDA 1I1QB 1NVXQ 3HK2A 2H7VA 3R7WA 3H9UA 2XGSA 5HCUA 2IEDA 4C05A 5I3CA 1UMKA 4A8TA 4BLVA 4UEWA 1H2BA 3W5DA 1MRNA 3FKSD 4UE3S 2ZQYA 1SM4A 3OQOA 4IIYA 1MRZA 3C8MA 4X24A 1AKRA 3V4PB 2PT7A 5KSWB 3THXA 1SUEA 2LIPA 5L8RF 2Q5CA 4P3PA 3ZS9A 1G7TA 1UBGA 4N6OA 1B2RA 2Q6IA 3ZLBA 4TV9A 3D9QX 1ONBA 1NT4A 4U2FA 3ZXXA 5AVWA 1WSAA 2FW7A 5A1TA 3D3KA 4L78A 3QVLA 3RRBA 3LXRA 2NT3A 4DWVA 4M98A 3CB4A 1J00A 3G1UA 4RZ3A 4LVNA 2JHAA 1PM5A 5F1KA 3KYDB 4CGYB 1UIRA 4EFKA 3SS8A 2P5SA 1FTWA 3OEHD 5LVAA 3OCUA 4GX1A 5CA1F 2OD7A 1OY1A 3VI4B 1ORDA 2J41A 1WMSA 3EEFA 4I5EA 1GQQA 3IA7A 3V32A 2BM9A 4JBNA 1NJ8A 3ZDCA 3NWJA 2N1BA 2QN7A 1RAIA 1V8ZA 1SCUA 4BUCA 1P1BA 3IUPA 4A3VB 4RQAA 2P1DA 4WKBA 2EVWX 2Z9CA 4ZRNA 4ZICA 3TIVA 3O0DA 2JB9A 2H54A 2V1XA 3R7LA 1XZJA 4NULA 4RVHA 2OGZA 1FL9A 3GDGA 3S8EA 2LHCA 2RB5A 2UVQA 2AH5A 1X1RA 4PLVA 4H7IA 3SX0A 3HB4X 4JBGA 2O1WA 3HCRA 4AZWA 3HDYA 4X1IA 1K6XA 7MHTA 1BCRA 1PT7A 2ZIZA 4FR2A 1TA4A 4AAYA 1QGUB 1ZNZA 4QDTA 2RHGB 1YK1A 4D0NA 5FWXB 3TAHA 1TTTA 2FK8A 4EKYA 2DFNA 3GLFB 3BKWA 2LRHA 3VR5D 1A82A 1D0KA 1FFXA 2HGZA 4CKCB 4U2KA 5D86A 2H4JA 1V6AA 1Q1AA 2Z1DA 3WLPA 4J43A 2FRVA 3RREA 1W5FA 2BKLA 2WSFF 4QYIB 4OP3A 2GS9A 2CY0A 4TSFA 4UZEA 4J91A 4BMVA 1KY3A 2O05A 5LZ2A 4JI4M 1U1EA 4J4HA 1I2CA 3ZHYA 4AP6A 1FU7A 2CLCX 1PNVA 4S0ZA 3VU3A 1UFRA 1L4EA 3WQBA 3M7GA 2O2HA 1I7SB 3ADKA 1C80A 1DAOA 1XDSA 1QE5A 1CKEA 1OFIA 3LPCA 2YNMD 1UOOA 2ARKA 1VE7A 3EZGA 5J5VA 4YAOA 3FCEA 3OC6A 4BTEA 4EL0A 3AETA 2PT9A 4R1TA 5DYWA 4L5BA 5EMHA 5KCMA 2XT6A 4KSYA 2JGAA 3LDGA 3AR2A 4AQYB 1IATA 1G2OA 1AKYA 2QP4A 5CT6A 5KX5A 3MC1A 1Z0SA 3BXPA 1DX4A 4DV0M 4YT8A 4RVNA 1CY2A 3KDPA 4ZEOA 2CB9A 3WL4A 4TZTA 2WT8A 1MF7A 1KDYA 4IYRA 2ZTVA 1XRRA 4BLCA 4UCQA 5TQ2B 4M21A 3TH5A 3UHFA 1TR8A 3DBHB 1A8SA 4OQZA 1XNQB 4C0BA 3B48A 1Q1NA 4NU8X 2VNIA 4LVUA 1WETA 2ZSAA 3EPJA 2Q7OE 2HWJA 2YOHA 3W7AA 4CQMB 1S2OA 4RTOA 1DARA 2OZPA 1VA4A 1TD9A 3Q3EA 3GG9A 4FGJA 4L8FA 2I3DA 2CE7A 5DN6A 2H1FA 1V48A 2VYQA 4U63A 5JDIA 4MQ4A 2I65A 1R88A 1PDOA 4LHZA 1JW9B 3H5IA 3OQPA 1S3FA 4TVKA 1USIA 3EGIA 1A88A 4LFBB 3VNUA 1RJEA 5DTJA 3THYB 1UDRA 5B7GA 1QP4A 1K5DA 3M0EA 4M0KA 4HF7A 4CLRA 2UVPB 4F6RB 2E0IA 4IMRA 3QKRA 4BYMA 4EGCB 4OO3A 3QPDA 4Q7JA 3S1LA 1TJ3A 3WY9A 1XD8A 1WUIS 4ZT5A 4RD6A 3MJCA 1FNSA 5E9AA 1S5PA 1O3YA 2AUTA 1WU8A 3KG2A 4X8HA 5AHRA 4RWEA 4J94A 5JD5A 3GP8A 4W9MC 3L1JA 2P78A 4LJ8A 4QGBA 3HY3A 3QLEA 4Z0PA 3W3ZB 3W8FA 4CI0B 3SEZA 3OIGA 3NWPA 5DM0A 2YHIA 4ZDKA 4PYLA 5JHGB 2NSDA 4RKUF 4X1KB 5FOSA 4QXPA 1I5OA 1JEYB 4KXLA 1SVMA 5AW3A 2NZUG 1U3CA 4DA9A 4RPIA 1GSAA 4NPAA 5E4TA 4RXUA 1R5NA 1RYMA 3L29A 3RVQA 1BHO1 1P5FA 3J80S 5BV7A 4BXOA 3OF2A 3ZCXA 1OVGA 3WL8A 3FNQA 3FYTA 3EGEA 2W6MA 2WHXA 4BLQA 4N1AA 3B89A 2JIZD 1C9MA 3OOHA 3OIDA 3ZK9A 1Z8FA 4XPIA 3ABOB 1X1DA 1B3BA 3MCUA 1O5OA 2JGIA 1DQSA 5BR1A 5ITTA 3J7TA 3R74A 4OXYA 4GRIA 4INPA 3HG7A 3M1LA 1YFJA 3D54D 3OJWA 1YACA 4QEZA 3AW8A 1IPEA 5K8JB 5F9HA 4BMZA 2PO7A 4OM7A 3E5NA 4ZZ2A 1UMBA 1YMQA 3LP6A 1CZRA 3PNSA 4JENA 2HIHA 1XK7A 3L8HA 4QELA 2QENA 3UMRA 3B1WA 2PZBA 4K9OA 3RYHB 1I4OA 1VHJA 2M9MA 4FGUA 2POQX 1WP9A 2KW5A 4JI5B 1IBKM 1EM6A 2XBMA 2FLVA 2YY5A 1M2KA 3ZTYA 4X3OA 4P3KA 2MCFA