1OFIA

Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
309
structure length
299
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure and Reactivity of an Asymmetric Complex between Hslv and I-Domain Deleted Hslu, a Prokaryotic Homolog of the Eukaryotic Proteasome
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 84
structure length 299
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ofiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ofiA01
1E9DA 1CJVC 1P3JA 2QG6A 1L4UA 4DCSA 5HR5A 2OILA 4URUR 4A2WA 2O8EA 1A4RA 2N46A 2OCBA 2P67A 4PC7A 1JR3D 4W9MC 4F4CA 4TT3A 3W8RA 4RZXA 4CW7A 1S1MA 621PA 4OHXA 4C7OB 1BYIA 1GP2A 3A58B 3KXLA 4ZDJA 1X8LA 4HB2A 4GP6A 2LWIA 2OUKA 1D2MA 2RHMA 2GKSA 2B8TA 1S1CA 3A36A 4NYJR 2YOHA 4QG7A 3TGPA 3EC1A 4ACAA 1P9RA 1Z6AA 3QEJA 1HQCA 1T0HB 3I8SA 4M21A 4G5RA 4M1MA 2WWFA 1J90A 2VL7A 3RC8A 1ZVQA 3ZVMA 2ZRDA 2ZSAA 1LB1B 1E9CA 2QY9A 4NYIR 1HT2E 4QGAA 1AA9A 2HCJB 4RD3A 4TLDA 1HYQA 3EZ6A 4EPRA 5EP4A 3I8XA 4EPWA 4DB2A 1E32A 4LJ7A 3W3ZB 3A6PC 3MLEA 3REFA 1QRAA 4MGKR 3TUJC 1R0XA 2G6BA 3FOZA 2W6IA 2IYZA 5JEDA 4EJSA 4HLUC 3TSWA 4DLXA 1ZMXA 5FPKA 2C96A 2DBYA 1JNYA 3E2IA 4O2LA 2DPXA 4UJ5A 4AG5A 4BLTA 4ZIRA 2QNRA 2WKRA 1G18A 4EQ6A 4PO8A 1R0ZA 3NWJA 4KLZA 4QM7A 2IYTA 3IIKA 1Q21A 3K0CA 3FE2A 4PPNA 2WAXA 3UPUA 1CJTC 1G1MA 3CRQA 2EW1A 3EZ9A 5FI0B 2IW3A 2J59A 2IYRA 2WJYA 3A1TA 4QNMA 3M0EA 2VF8A 3FYHA 2CL0X 1VYTA 1ZNWA 4RCZA 1CR0A 4ZV4A 4QHSA 4W5HA 4G5OA 1Q22A 5FR2A 3GMTA 2ZYVX 4JYBA 4ON9A 2QRNA 4URZR 4DKXA 1XPRA 2DZOB 2I4IA 2C98A 5TVKA 4LRTA 2WJGA 2CDNA 1UAAA 4BFVA 3IIMA 5JMTA 4EKDA 2KSQA 1YVDA 2F9LA 2XX3A 4PAQA 1G3QA 1X1SA 2Z4SA 2XZLA 3A1VA 4IEEA 1IN6A 1X3SA 1EFUA 3LBIA 4RKFA 3QF4A 2O8DA 2JAQA 3GLFE 4EAQA 2CHGA 3UG6A 4CDGA 2B6HA 4YMWA 1FX0A 3NBYC 3W90A 4DBLC 1E96A 5TB5A 4MUBA 1KO5A 5KNBA 2VO1A 2AL7A 4M4SA 4BRUA 3GLFB 2PEYA 2ZRJA 3FHOA 2HF9A 5FBVB 4B71A 3MSXA 2ZITA 4DSUA 2PMKA 4AYWA 3LNCA 2O8CB 3WNDA 2QSYA 2G83A 1G3UA 3GEIA 3T1QA 5JS7A 3DO6A 1E4YA 1E3MA 3WNBA 2QROA 1CULC 1IBRA 1Z22A 2RB4A 4PSVA 2C5LA 1MO3A 4YMUA 4LZZA 2EFEB 3ZD6A 3ZIAD 5BYKA 1TAGA 5EXTA 2J87A 4UNNA 1G4AE 4PC2A 2AR7A 3VHLB 1BMFD 1TPZA 4E07A 4M1KA 1WBBA 3ASZA 1NP6A 2OFOA 3AGPA 1ANKA 3BC1A 1DS6A 4TLAA 4G0NA 3LA6A 2XNDD 1GOTA 3B5JA 3NXSA 4XTCS 3GCGA 3IIJA 3LO5A 1FTSA 1UBCA 1KO8A 2X8AA 4R2HA 1DAIA 2WSSD 1WE2A 3RRMA 2FSHA 1VIYA 3SOPA 2YWFA 1DTSA 4JL6A 1GUAA 4KYUA 5FUXA 3RHFA 1KGDA 1ZD9A 4RFVA 3THWA 4XTRA 2IS4A 1KO7A 3CZQA 2O8BB 3AJIB 3TQFA 4HI0E 1P6XA 4QJ3A 1CU1A 1ZM9A 3LD9A 4PC3A 1S2MA 1ZD1A 4JT2A 4TLBA 3QENA 5F9FA 3RNLA 5B30A 1E6CA 2OAQ1 2ZJ5A 3EZ7A 4C0SA 5CYOA 4B3FX 4TMWA 4PZYA 1KAGA 2QT0A 4Q48A 4UQOA 5GVRA 4I1UA 2C99A 4WAUA 1NBME 4C7OA 4AKEA 1ZINA 4WA7A 3MHVC 5B64A 4ZI3A 2Q21A 2ZRHA 4A8JC 1KI3A 1G17A 4DCTA 1P73A 3THOA 1S96A 2BBOA 1OXUA 3OFND 4KCGA 1E9EA 2DCUA 1GDDA 4U5XA 1KSHA 4PZZA 5SZIA 2C2HA 3A37A 3Q5EA 1JALA 1W0JD 4B33A 3DEFA 3BGWA 3PUWA 3PITA 1ESNA 4M22A 4C0LA 5K8UA 1C1YA 3IO5A 3CUEF 4OJKA 2QP4A 4EPTA 3N70A 3PUYA 4D0NA 1N6RA 3M6AA 4OI1A 4IOLA 3QE0A 1U0LA 3K0FA 2GRJA 4LV6A 5JSZB 2JJ2D 3WMGA 3J81k 2ZSDA 5D3MB 2DWOA 5DIFA 1HTWA 2QZ4A 3ICEA 4PFSA 5IRCD 5F9HA 4AIIA 1U99A 3VMFA 3M1IA 2D7CA 3CWQA 4R2IA 1AGPA 4HLDA 3HR8A 3ZIAA 1Z6YA 4DRZA 3EA5A 1KY2A 1N2CE 2ZYUX 4AWXA 2W6JD 4V03A 1Z06A 4ASUD 4QHYA 4L9SA 2IX3A 1GL6A 2ZS8A 1VYUA 2EFHB 2B8WA 4PSKA 2EWVA 1B0UA 4OQNA 5E7JA 1PVOA 4MGIR 5EUMA 3SN6A 5M04A 2XNDA 3G0HA 4B2IA 3BK7A 3JZMA 2EWWA 2A7QA 4JVSB 4LCBA 1SHKA 2Z43A 4JLDA 3GLGB 4Q1CA 3KTAB 2GAOA 4B35A 1OPXA 4K46A 2QA5A 2WSSA 4NCIA 4TMKA 2F1HA 3UMSA 2VTKA 3CNOA 4UKDA 4D2IA 2WV9A 2IS2A 3W6OA 4A6XA 1SVKA 2H5EA 4Y0AA 1Z6TA 4AKHA 5AUPB 3FKSD 1KO1A 5JI3E 221PA 3IHLA 3F5FA 1Q44A 1G7RA 2BMEA 3C41J 1JJVA 3OHMA 5AJYA 1KNXA 4JLKA 3U3MA 2Z0MA 2GJ8A 3WYAA 2V6ZM 1UEIA 1E1QD 1E0AA 3HDTA 4A0GA 2VA8A 3QIAA 4HLCA 1T8TA 3ZQ6A 1ZRHA 2NTYC 4TMVA 3B9PA 3B1YA 1RVDA 2XOKD 5FR1A 1NBMD 4DC9A 1OKKA 3AF4A 1Q3HA 4X8OA 4TZ6A 4HUTA 1RFLA 3NEYA 4ABYA 1XCMA 2GZAA 1LF5A 1YR7A 3MJRA 4OK5A 5KTYA 2CE7A 3CX7A 1NG9A 2QL6A 4KHZA 3WYGA 5FH9A 1QG2A 1QZXA 3CRRA 2IF2A 4Q1FA 2B7BA 4NYJQ 1NVVQ 4CIDA 1MO6A 3NH9A 3KJIA 1GNRA 3FWYA 3GLFA 2FX3A 2BKUA 1W2GA 4E09A 2JLVA 3K9HA 2SHKA 3CF0A 2KBFA 2P0EA 3E70C 4G01B 3VX4A 3NIBA 2ZQ5A 4P32A 4PC1A 4RD2A 1N6PA 2FFAA 2O8CA 4NYIQ 4G3XA 1J7KA 3N2EA 5LPNA 1VCIA 2A2ZA 3LXXA 1A2KC 3C5HA 3KKPA 1LF0A 2JJ2A 1XRJA 2H1LA 3QY0A 3VU9B 4BRWA 1IAQA 2ZUDA 4RZ2A 3QPUA 3ASYA 2WJJA 1KJYA 3LX8A 5EXPA 4EIWA 1TNDA 1XTSA 2QEQA 3WNCA 1MRNA 3K70C 2GETA 3AKEA 4HZUB 5E4FA 1ZP6A 3KKNA 2GCNA 1RYHA 3OIWA 4NE2A 4F4IA 4AI6A 2PH1A 1E98A 3QKRB 2W6JA 4A8JB 4GDFA 2XGJA 2BJVA 2F3TA 4E22A 5DN6A 5DI9A 5C1BA 4BFXA 1OIWA 2VH5R 3B1WA 2NZ8A 3DMNA 4MUAA 4LC1A 1FL9A 3T15A 4LX0A 2IEZA 4LHXA 1XZQA 2RGBA 421PA 2AKYA 2QUZA 3ZD7A 2YOGA 2QAJA 3TVDA 2O8BA 4KSCA 2A5JA 1HE8B 2BOVA 1Z5ZA 2DY1A 5LB4A 4FWIB 2VP2A 4URXR 1CR1A 1VCNA 1Y3AA 1MRSA 1SZPA 1OB5A 2DR3A 3FKSA 4IDQA 1YHNA 3AP2A 5EUQB 5JECA 1EXMA 4LYJA 4JT4A 3SJAA 3T06B 4FMBB 4GBMA 1OH5A 1XTQA 4OHVA 4WZBE 1RRCA 2HCBA 1Q57A 5FTLA 4G5SA 1KI6B 2HF8A 2PBRA 4TTPA 1SXJE 3T1VA 4TYYA 2IUTA 1E2NA 2XTZA 1FP7A 4XD7A 5FFMA 3QG1A 2RGNA 2YC2C 4CF7A 3CW2A 5K8IA 4LBVA 4GP7A 2CXXA 3ND9A 1M74A 1UKVY 1Z0KA 2AX4A 1GRNA 2HEIA 1EFRD 4OHYA 2NGRA 1R6BX 1ZNXA 3KDSE 3CZPA 1GNPA 1XX6A 2XJ4A 3JZAA 2A5DA 3NBXX 2IXEA 3NG1A 1NNEA 3H1TA 5C2JB 2OXRA 4BFSA 3HU1A 3W34A 5JSZA 3U61B 1QZMA 1W0KD 4XH9B 5FPHA 5TY0A 4GT1A 1VIAA 4TMXA 2F1JA 5D3MA 1UKEA 1E2HA 2PX3A 4RZUA 4RSGA 1PLLA 2G3YA 2WM9B 3LFUA 1AKYA 2DFTA 4JMPA 2IA5A 2IHYA 1JR6A 4N0EA 3Q9LA 3CKLA 1CBUA 2EQBA 1CRPA 2ZS7A 1OSNA 2KRKA 4GOXA 3DM9B 4BECA 4I1SA 3SJCA 2C9CA 2OE2A 1ZC3A 2DVWB 4F91B 1UDXA 1VYVA 1QHXA 2YHSA 4LV8B 2RGXA 3PV0A 5B2ZA 2BMJA 3GLIE 3F0TA 5L3VA 1IY0A 1S4QA 1P9WA 1E0JA 2FH5B 2ECKA 2FWRA 3GLGA 2ZYWX 3IQWA 4C0BA 2OEPA 4DSNA 4C3ZA 2P2LA 3KTAA 1CJMA 1M8PA 2IBMA 2WMNB 1ZYUA 3GLIB 3BXZA 1DEKA 4MKFA 5FUVA 2YKGA 4YMVA 1VG0B 1G7SA 4GPTA 1JXOA 2FSIA 3SJZA 2RGEA 4JVLA 1Z0DA 3EW9A 1KK0A 1VG1A 1GVNB 1N5IA 3IBGA 3KZ1E 4JLMA 4C0HA 1TF2A 4Q1BA 3PEVA 5A5GA 2J0SA 3ADCA 3QJYA 3Q85A 4M1YA 3T12A 3VR5A 1E9RA 1KK2A 2VSOA 1ZNZA 2ODEA 1OFHA 4FN5A 3UG7A 2RHDA 3MCAA 3PENA 4FMDB 5KDDA 5KSYA 1WBDA 1R8QA 2WWHA 1DO2A 1SXJD 3AP1A 2IT1A 4MYCA 3WHLA 5ELXA 3LV8A 5CK4A 4CZ2A 1E0KA 2UKDA 4JKYA 4DEYA 3R8CA 3CH4B 4OYHA 5FPYA 1W4AA 5FUYA 4HAWA 2WSMA 3I4LA 4M53A 1CJUC 2ANCA 1EFRA 2GF9A 3B85A 1N6KA 3IEUA 1NKTA 3DOEA 1NN0A 5AUNB 5CDFE 5K8LA 4DLRA 3MWLA 1Q12A 3MRSA 2HT6A 4HYYA 1A1VA 4C0QC 521PA 1GFIA 3U44B 1Q3TA 4LYAA 3SNHA 2LCFA 2CLSA 1W0KA 4LY6A 1XWIA 1G21E 2WIBA 3EG5A 4IVQA 2D4HA 3RWOA 1WA5A 2ZE8A 4Y0VA 4DHEA 2GZHA 3N5CA 1JB1A 2R6CA 4Q03A 2XZOA 1OB2A 1MO5A 4DEXA 4HZUA 1K8RA 5FOUA 5D3QA 5J40A 1QG4A 3B1ZA 1F5NA 4WXRA 3QKRA 3WRXC 3CBQA 3BH7A 3BB4A 4YDHB 4ZDWA 1W5SA 1NMZA 1ZBDA 3RAPR 4BFYA 2P5SA 2Q9CA 1VG9B 4JIMA 1AZSC 3K9GA 5CK5A 3KQNA 1DVRA 1XF9A 4BEJA 4UXJA 4PANA 1D8TA 3W5JA 3AVYA 5JRZA 2A5FA 1N6NA 2BBTA 4GZMA 3T35A 3TAHA 1KDOA 3A1WA 2ORIA 3AVOA 3CX6A 3UXMA 2V6JA 3VFDA 2R9VA 2V7QD 3IGFA 2O8DB 4KU4A 2CK3D 2BC9A 4HB4A 2PJRA 2O0JA 3P20A 4HAVA 3NC1C 4KI0A 4KLNA 1V5WA 2ZJ2A 4ERNA 4URVR 3I1FA 3T5DA 2H16A 1YR8A 4JKIA 2FF7A 1ELOA 4LOAA 3T1OA 4D4LA 5H70A 5BWMA 1EWRA 5FUWA 3AVPA 2BM0A 1KI6A 1YZNA 4TLEA 1KO4A 2JATA 2QGZA 3CF2A 3ETLA 4Q9KA 2HV8A 4Q00A 3KKMA 4U02A 4A3VB 4Q1DA 1XXHE 4LJ4A 3NEJA 5L3RA 3T61A 1RKBA 1II9A 2XEXA 3BB1A 1TU3A 1SXJA 4D4JA 3U4QB 2L0XA 4DLYA 2FFBA 1P2VA 3LVQE 4TL8A 3QXHA 1FZQA 4UJ3A 3P32A 4W5JA 1XXHB 1IXZA 2VP9A 5BN4A 1I2DA 2YVUA 2ZANA 3HU2A 3BIFA 1DPFA 3GQBA 3TE6A 4Z54A 2QENA 3EWAA 2X2EA 3OIVA 2W2XA 5DYGA 4A92A 4C4PA 4Q9IA 1T6NA 4HSEA 2F1RA 3CNLA 3H2YA 5JWRA 5E7IA 4PAOA 2FN4A 1G291 2FMXA 5BXQC 1KSFX 3OESA 1CJKC 4KFUA 4M0LA 5SZKB 5IT5A 3P27A 5FL7D 4Q5IA 2MSDB 2R6FA 1UKZA 3LH5A 3QXXA 2H17A 4JLOA 1G3MA 1MABB 1JPNA 1Q1ZA 2GTPA 3HYTA 3ONWA 4RD6A 1KIMA 4KAXA 1DAKA 2W00A 4IDHA 4IHQA 1IOZA 1J70A 1G8FA 2QSZA 2PX0A 4O3MA 2IYUA 2KWIA 2XAUA 1WP9A 4QFMA 2A5GA 1Z07A 2XB4A 1T0JB 4HB3A 3R9IA 2WPDD 4ESVA 1LY1A 3K9NA 4DSOA 3RC3A 3FDIA 1AJEA 1CP2A 2CE2X 2O0HA 1IN7A 1JJ7A 1TF7A 5BQ5A 2IYYA 3KFVA 5P21A 3GLIA 2ZI3A 1IONA 4DDTA 5JJLA 1NVVR 2CMKA 1JQJC 3R7WB 1XPOA 2JIZD 1YR9A 4C0JA 1PZNA 1U8ZA 1GZSA 3AV0B 3CPJB 2J1LA 2V7QA 2IS6A 3QVUA 2CK3A 1JEDA 2QPOA 5AUOB 3U7HB 3F3YA 1NMYA 3K53A 4RZ3A 5HZHA 2PT7A 3EA0A 2O0KA 4M9QA 2ZVQX 3I62A 1G41A 2VHJA 3TUZC 3BB3A 5L8VA 1OIVA 3A8TA 4NBSA 2D62A 5J4YA 2QI9C 3K0FB 1DARA 3RWMB 3KQKA 5F98A 3MUFA 4CEHA 1UFQA 4WZ6A 4JSYA 5IF9A 3FTQA 1Z8FA 3C4JA 1R0WA 3BAFA 2WAYA 2DYKA 1RW4A 3LQRA 2QPAA 2O5VA 3FVQA 2ZI6A 4KITB 3PJRA 1W47A 3BOSA 3C15C 5HCNA 1NY5A 4D25A 4JJKA 3R20A 2WWYA 5G3ZA 1FOEB 2RGNC 2V4ZA 2AD1A 4BUJA 1W2HA 1XMIA 4QJ5A 4R9UC 5KYKA 5JWOA 1RRPA 2JDIA 3CPHA 4Z8XA 3U44A 4FD2A 1W46A 2P3SA 2YC4C 4B6EA 3DM5A 1N6LA 4C2UA 1R5NA 4G1UC 4JLNA 5CDFA 1OXSC 2VBCA 1Z2CA 2J0UB 1KMHB 4RD1A 1E2LA 2HLDA 1JBKA 2HUPA 4PX9A 4WBSA 1FUKA 5GVSA 4OHWA 3AKYA 4PQYA 3KXIA 4IOMA 2CJWB 3GJ6A 1G8GA 2KE5A 4CEIB 4DUGD 3TSOA 4FMDF 2X19A 1E94E 1ZCBA 1COWA 1TEVA 2FU5C 3AVQA 5FTNA 1P9NA 5A0FA 2F9MA 2ZUCA 4GITA 1JR3A 2QAGB 3WMFA 1FNMA 1M7BA 1DG1G 3IUYA 4PQRA 1F60A 2WPDA 2OHFA 4A1FA 2FZLA 2CL7X 8OHMA 4TL7A 3BJIC 3QVVA 3RS3A 1ZU5A 3WY9A 2C03A 5E7MA 1N6HA 3IILA 1E9BA 2ZR9A 4B73A 2W0MA 4D4MA 4D0LB 4ZKDA 1T9HA 3L43A 2JIZA 1X37A 2GXSA 4HAXA 3ZH9B 1KZGB 1OYYA 2WICA 4V0OA 3GEEA 3WYFA 1HEIA 2ODWA 2W2TA 1KKLA 2Q3MA 2RCNA 4R98A 1EGAA 4KODA 1BYUA 2IYLD 3Q3JB 3UATA 4A2PA 4A9AA 4BWYA 1NSTA 2CBZA 3LX5A 2GK7A 4P4UA 2WZQA 3QXSA 3HPQA 3W6NA 4NPHA 1OT3A 2Z5FA 1K6MA 2CCJA 1DAEA 3F8TA 3AUXA 1PJRA 3GFOA 1G8PA 1KAOA 2ZR0A 3U4QA 2ZRLA 1TADA 4D80A 4DLUA 3SYLA 4LRWA 2VPPA 1G5RA 2LKCA 5E3HA 5L3QA 5F3WB 4Q7JB 4ZDKA 5EE0A 1XXHA 1D2NA 3UMFA 3L0OA 4WZAE 2ZE6A 2ZSEA 4L15A 1SGWA 4NYMR 4H9GA 1X1RA 4FCWA 4Q7LA 3RRYA 5KUTA 3LDAA 1XD2B 4MGYR 1EX6A 1KZ7B 3TW4A 4F92B 3IEVA 4AKGA 1NN3A 3L0IB 4LI0A 1OLOA 2V54A 3X1ZA 1ZC4A 1YE8A 1II0A 5J47A 1SKYE 2B92A 3QKUA 4JLVA 1ZIOA 4ZCLA 3RS0A 1MABA 4QBFA 4ACBA 1BH2A 2ZYTX 4BQSA 1HQYE 2PLFA 4C0KA 4DWJA 4P33A 3TJZA 1JI0A 2RGGA 1Q0UA 4M1SA 2GEVA 4DUGA 3DZDA 5TV2A 4XSGA 4DLSA 1XJCA 3RSLA 2IF0A 3G5UA 3H4MA 2RKOA 5G53C 2BVNA 2H8KA 4JL8A 2MSEB 5JJIA 1NN5A 4FIDA 4LHVA 1Z6GA 1KKMA 4JBWA 4M8NE 4B43A 4D26A 1EFTA 1T8UA 3R7WA 4LJ9A 2OZEA 3DDCA 3ZLJA 2BWJA 2WIAA 1XMSA 4BASA 2IS1A 5EXXA 2AXPA 2GF0A 2OT3B 1AN0A 3IPXA 2OG2A 4Q4JB 2DB3A 2IWHA 1IN8A 2P6RA 5CJ2A 2FOLA 5DLQC 4MKHA 4V0KA 1E0SA 4FWHA 2ZJAA 1R7RA 5AJXA 3EPJA 2VF7A 2RMKA 2AD5A 4M9XA 1E2QA 4LJ5A 1G3RA 4JBYA 5TXGA 5GJBA 5DH9A 1M7HA 4A2QA 1I4DD 1A82A 4IJMA 3HU3A 2XITA 1PLKA 1HT1E 5FOWA 4Q18A 2OCPA 3VX3A 4MYTA 1E2MA 2ZE5A 3BE4A 3DHWC 1FTNA 1Q1BA 3U7GA 5EE5B 3ZVLA 1P7CA 1D9ZA 1DBSA 3VR2A 4BFWA 5KNDA 3I5YA 2QP3A 5KU1A 1BMFA 4UNSA 2QU8A 4YLGA 4ZO4A 3IKJA 2NIPA 1XB2A 5JZVA 2Q6TA 1SXJC 2GXQA 1UBFA 3VKGA 5CIQA 4IXNA 3UIEA 4H1UA 3GJ0A 4U00A 5C46F 3B82A 3QNUA 3ZZ0A 3QKSA 2KJQA 4QGGA 2NG1A 2J0UA 3Q7PA 4X8HA 1KMHA 4WIAA 1NLFA 4DLZA 3FMIA 3KL4A 1N5KA 2QQEA 1D2EA 1US8B 1HY3A 3AEZA 4ITRC 4X8MA 1OJLA 1OXXK 2CJWA 3SQWA 2AHOA 4CEIA 4Q66C 2WJHA 2IUSA 1J8YF 2QMHA 3VAAA 4DLVA 3P1JA 3B1VA 3S1AA 5BN3A 2ZM5A 4HB0A 1H8HD 3U6BA 1KK1A 2CLDX 4FMCF 4Z51A 4H1VA 4JLAA 2W58A 2QAGA 2I3BA 1KI8A 5EP2A 1FQKA 4NCNA 2AWNA 1NLYA 2LKDA 2J9RA 4DDWA 3RVBA 1Z3IX 4LHZA 2NPIA 5SZHB 1FUUA 3WMEA 3NBFA 2HDNB 4LWZA 1IHUA 1W7AA 2GZDA 2F1IA 3DZ8A 3OFNA 3SJBA 2I1VB 4QM6A 2PL3A 3FMOB 3FPAA 4WXPA 4M1TA 3UWKA 3GPLA 3IDQA 2H57A 3ADBA 4GMDA 1N0UA 2OESA 3ND8A 5DSZA 2J7KA 1W0JA 2R62A 1KMQA 1NL3A 3CR7A 3LW8A 5DHAA 4CRWB 4Q9HA 1XEFA 2ZTSA 4JLBA 5JFGA 4ZCMA 4POAA 5JHHB 4OI2A 2CHQA 3P4YA 3B1XA 3NHAA 1ZAKA 4E5UA 2IL1A 2HXYA 3KKOA 4DCNA 2PCJA 1F6BA 3UMRA 1KOFA 4L4UA 1UDWA 1VHLA 1N3BA 1SVSA 4BFUA 1IJEA 3QXCA 3SU8A 3OE7D 2RGCA 2D3WA 2GCPA 4NDZA 4P4SB 1T5LA 1KHTA 4KBGA 4LYHA 2EFCB 1E2EA 2RGAA 3MWYW 4ARZB 1T5IA 821PA 3PIRA 2OLKA 4G5QA 4JSTA 4ASUA 1XD2A 2ZRGA 2J3EA 3ECCA 2QMUA 2GCOB 4O25A 4A15A 1VDZA 1ZM2A 1KJWA 1AM4D 2R2AA 3K0SA 1XEWY 4GMXA 1NJFA 4QHTA 1U9IA 4WOPA 1IY2A 4LYFA 2F3RA 2GBLA 2WOOA 4LV5B 3B78A 2CCGA 3MWKA 4RD4A 3LY5A 1WF3A 3AVVA 1U2RA 2DWPA 1S9HA 2ZVPX 4MYUA 5FBLB 2XTNA 2GJ9A 4WVFA 4D6PA 1H8HA 4NCJA 3KQLA 4KVAA 4NCKA 4US1R 4N3NA 3VNUA 3AVTA 4I4LA 4R71A 3VR4A 5DE3A 1E1QA 2V8OA 1W4CA 1Z6XA 1E69A 1X8KA 2PJZA 4LPKA 2XOKA 1EFCA 1NBMA 1YZQA 2YWGA 4RD0A 1G6OA 2ZJOA 2GWHA 1YRBA 4TLCA 3THYB 2JLQA 4LC0A 1SXJB 4I1VA 4IOJA 2Y8EA 5EZ5A 2BBSA 2ZJYA 4Q4JA 1N0WA 5H68A 3X2SA 3L2OB 4LJ6A 3PG5A 3TRFA 3AVWA 2ERXA 3GFPA 1YZKA 3CONA 3AF0A 3X1YA 1UKYA 2J5XA 3VR3A 4DCVA 5KSPA 2R6DA 1JECA 3L8YA 1FQJA 1SULA 4OL0A 1OFTA 1P4SA 4GI7A 2J0VA 4A82A 1CIPA 1WXQA 2IYSA 2GDJA 3TVTA 1G64A 3Q7QA 4OQLA 5JEEA 2GK6A 4NCHA 4K81B 1GWNA 5KDLA 1QDEA 1XCPA 5EXSA 3ZGXA 1M34E 3RRZA 2BCJQ 3ZQJA 1DOAA 4S2EA 5IDVA 2V3CC 4KFSA 1SVWA 1T3HA 3WP1B 3R8FA 1UM8A 1H65A 3OE7A 4RFSB 5IK2D 3CO5A 4PHGA 4KSBA 2JLUA 4KBFA 1RC8A 2BEJA 1G19A 1GRQA 4PC6A 2TMKA 4PPQA 1NIPA 1DADA 4NYMQ 5B58C 1CEEA 2YV5A 2O8FB 2A3RA 2ASEA 2VSXA 2JJ1D 5KPDA 1ZIPA 4LJAA 3CPEA 4QBGB 2JLWA 1C9KA 2NO7A 2FEOA 1JXMA 1E9SA 4D82A 3A1SA 4GOJA 4BZXA 2ONKA 1T3LA 1Z2AA 2NQ2C 1E99A 2NZJA 1US8A 1GKIA 3EZFA 4M9SA 1P61B 4RVCA 3REGA 4B48A 1KI7A 2B21A 4KFTA 4KVGA 3EC2A 4AURA 1M2OB 2JEOA 3QUSA 1F48A 1NG1A 1E2IA 3VLFB 2IYXA 3RYTC 2IUUA 5E95A 1E2FA 5HPYB 4XWKA 1Z08A 3TBKA 4Q1EA 1LVGA 1NMXA 4KXFB 1SVIA 1IXRC 3O47A 2Z6VA 3CF6R 3PR1A 2W83A 4NONA 4IRUB 4IVPA 2ONJA 2CVFA 1LV7A 1ONBA 4D0GA 1DAGA 1VCMA 4RJLA 121PA 3Q8XB 4N1AA 2WJVA 1NVUQ 2FEMA 4CEHB 4Q9LA 4JBXA 1R5OA 3BD9A 4MYHA 4IW3B 1AGRA 1M7GA 4XOIA 3RANA 1W4BA 2A5YB 4A0RA 2NMVA 2FFHA 2OLJA 2QE7D 3D6TB 1VKJA 3HPRA 4YC7A 4Q02A 4E03A 2QBYB 1I4TD 4B2PA 3PUVA 1U0JA 2GA8A 4UNQA 2YZ2A 1IY1A 2G0TA 2ZI4A 1GKYA 4QGHA 4DLWA 1W36D 3FHTA 5GJWC 1XTKA 3U2QA 2J46A 1NI3A 1IN5A 3BFKA 4A6PA 2OO7A 1AIPA 4BGDA 3M4YA 3W3AA 4A0HA 2VIIA 3VTKA 3DKVA 4IOKA 3I61A 3H84A 1QHGA 1OYWA 1QHIA 1XNJA 5FPTA 2KBEA 4MA4A 3U5ZB 1YZGA 3CNNA 1HH4A 1OXVA 1DAFA 1VPLA 1OFUX 1RJ9A 2X77A 3DVLA 4P4SA 4C2TA 4B3GA 4ARZA 1ZM3A 4BZQA 3WBJA 1B23P 4FW9A 2YNMA 2XXAA 2DWQA 1YU9A 4QBHA 1K5GA 5GJVC 3O8BA 4JYCA 1CR2A 4Z8YA 1TUEA 1YJ5A 3RDPA 5FTKA 1S3GA 1L4YA 3CRVA 5C18A 2CVHA 2GCOA 1TL7C 1RIFA 5A4JA 1UBEA 4I99A 4AG6A 3SC3A 2BBWA 2PLRA 3QPWA 1RRGA 3TUIC 4F4JA 1CTQA 2N42A 2ZRFA 2HXSA 2CHVA 3QBTA 4FI3C 4HDCA 2EYQA 1QHNA 4PHHA 1QHYA 2ZRCA 3FFBA 1KNQA 3W6PA 4OK3A 4B44A 3FB4A 3N2IA 1M1YE 1H8ED 3C8UA 4B32A 1MH1A 4OJQA 5FOTA 3OIUA 3KQUA 2C9OA 5EQTA 2ZRKA 4HAUA 5F2EA 2HT1A 4PPGA 1G8HA 3TR5A 2ZI7A 3B2EA 5LD2C 5G41A 4D4KA 4HZIA 1E9FA 2C04A 3EPHA 1OW3B 1I2MA 1KTVA 2C8VA 5JCZA 1R10A 3K0EA 4MQBA 1ZUHA 3L8ZA 5AK0A 3X1WA 3U60B 1G20E 3KJHA 3ADKA 1J2JA 2C9YA 3D31A 4PSAA 2ZUBA 2FPKA 1QVAA 3THYA 1QVRA 1NF3A 1OF1A 1TX4B 1KYIA 1YR6A 5AWFC 2MMCA 1QBKC 2QAGC 2EVWX 4B75A 2YWEA 5TDHA 1O3YA 2ZIAA 2IK8A 3TLXA 5L3QB 5AR1A 1T3SA 3MJHA 3GJ7A 2QE7A 2AK2A 2AKAB 2PZGA 4JL5A 1GL7A 2PEZA 3CR8A 1YZLA 2VHCA 2JCSA 3FMPB 4B3XA 4HLQB 2VP5A 4UNPA 4LK2A 4LBZA 2D7DA 2GJKA 2VP6A 2H18A 3ZJYA 4IFBA 4O2RA 4DSTA 3U7FB 3RS2A 3W5IA 3A4LA 2WMOB 3CH5A 3I72A 4K8OA 5CM8B 2JLXA 3TSZA 1YKSA 3NC0C 2R6AA 3KKQA 1I4LD 1GTVA 5CLQA 4RFSA 4AD8A 2F6RA 4KYIB 4IXMA 4Q4HB 4DT1A 4CGZA 3V4FA 3KB1A 4BEBA 1U8YA 1GRRA 4EFNA 3ZVNA 2BIFA 4LBWA 1KI9A 2IYQA 5AUQA 1XBTA 1HV8A 3NHBA 3T5GA 2O8FA 3FHCB 1XMJA 1F2TB 4TQ9A 2KB0A 2JLYA 4LDJA 4BFTA 4A36A 3IQXA 4Q4AA 4BPBA 2Z4RA 5KHOC 5JBQA 3I73A 3TK1A 5EP1A 1TQ2A 4CEJB 3NVAA 5JJKA 5KSOA 1HE1C 2GJSA 3B9QA 2NO6A 2QPTA 4TTRA 5C4GB 3MGCA 1TTTA 5FTJA 1H8EA 4F7WA 5DYIA 2ZJZA 3UANA 4KJZA 2G0NA 2BEKA 2PMDA 1U9IC 1AZTA 2FGJA 2WWGA 4O0MA 4US2R 3V00A 3GJ8A 2GBLC 3EZ2A 5EE3A 2GHIA 3B7GA 4QXAA 1W49A 1G7TA 5B57C 3SBEA 3EIEA 1CR4A 4XWOA 2NPFA 1JEEA 1OHHD 1E2GA 1AS0A 3RS7A 4DJTA 5LDDC 2X2FA 4FMCB 1OH8A 2VHQA 3VR1A 1Z47A 4OQXA 3EWSA 4Q9JA 2QTVB 1DAHA 1X8JA 2FSGA 1NLZA 3SHFA 3B8HA 3RS5A 3AUYA 2HYIC 3AP3A 5BYJA 1WMSA 2W0SA 2R8RA 2VSFA 2YWHA 2QBYA 2ZXUA 1J99A 5HTKA 3RRNA 3T34A 1LFDB 4N0DA 1DELA 1FW6A 2YYZA 4NL4H 3UK6A 1RZ3A 1YQTA 4BZPA 5JS8A 1OXTA 2BHRA 2REBA 5JLJA 4GOKA 2OBLA 4LJYA 1ZU4A 3BFXA 2BM1A 3ZDQA 3ZVRA 5KO2A 3U3OA 5DO9A 2WKQA 3QKSB 2WOJA 2ZETA 2BDTA 3MFYA 4NP6A 1NN1A 5FI1B 5LD2B 2VEDA 1G3IA 1YRAA 2X1VA 2FDCA 4PO9A 3KXKA 2V1XA 2FA9A 5H1YA 1IXSB 1EFHA 5FL7A 2ZS9A 3SFVA 2ODBA 3HWSA 3C14C 3S1AB 5J4VA 3U6KA 5UKDA 2ANBA 3WP0A 1CKEA 2OAP1 4GL2A 1V43A 4R7ZA 2R65A 2DWZB 1E9AA 1GITA 2ZREA 4NKRA 5FPSA 4EFMA 2Z83A 1G16A 1Z0JA 2QT1A 4BLQA 4JVNA 4OI0A 1A7JA 3QF7A 3L82B 4OHZA 4YQFA 3PEWA 3KW6A 4YONB 2J0QA 1E2DA 5FOXA 3SHWA 3E1SA 5L3SB 3B6EA 3GD7A 4HAYA 1Z29A 1N5JA 4FINA 4MRSA 1PV4A 1SQ5A 5C4MA 2ZSFA 2GEDA 3B60A 4KO8A 1CRQA 2AFIE 4LRSA 2Q3FA 3VQTA 1S9DA 3ZS9A 1NJGA 2VLIA 4L5BA 4W7SA 1ESMA 2ZU6A 4V02A 3G82C 3NH6A 3AVXA 1KI2A 3OZXA 1J8MF 1AS2A 2QGNA 4FXPA 2IWRA 4DVGA 5HCIA 2P6UA 5J4LA 3AM1A 1VECA 3QQ5A 4V0ME 1GG2A 4ILEA 4ZCIA 1FFHA 1G9XA 4M9ZA 1S8FA 3HR7A 3EIQA 3PUXA 4Q7KA 4C30A 5JHGB 1U98A 1P75A 1OHHA 3QBVA 5FL3A 1KSGA 4TWZA 2QM8A 1Q1EA 1JPJA 3VKWA 4HUQA 2UVQA 3BWDD 3FFAA 1JQLB 2FPLA 3GLHE 4M2LA 4S35A 1G5PA 4V0LA 3SE0A 4J0QA 2XSZD 3X1DA 2R44A 3LBNA 1TQDA 3CLVA 1TF5A 4NH0A 4V0NA 4F93B 1VHTA 1TEXA 4B2LA 5FTMA 2EFGA 2VYFA 1MT0A 3GLHB 4HAZA 3TQCA 2AN9A 2B7CA 2RAPA 2J41A 721PA 3AH8A 4C0AC 4DCUA 4YMSA 1G4UR 5FOVA 3WXMA 1NSFA 2QP9X 1XCGB 5BW8A 3TR0A 4IDPA 1VTKA 3A4NA 4Q47A 4FCVA 4TQUS 4A0FA 2JLSA 1Q20A 3OIYA 4OK6A 3SDZA 1P72A 3LAWA 2VP4A 3KFXA 4B3BA 4PQFA 5TMPA 5AJWA 5CB8A 4BLPA 4US0R 1II8B 3FMFA 4QBIA 3PFIA 3TMKA 4L16A 4QL3A 4BLOA 2VHTA 2WJIA 3V9PA 1Z63A 4Q4HA 4GZLA 2QTHA 1SKYB 3FGNA 1ZM4A 2R6GA 3AQ4A 3LLUA 2WVJA 3SEAA 2ZI5A 3AKCA 4X8LA 5DI3B 1F2TA 5TARA 4TYWA 3B13B 2MMGA 1N0VC 1W44A 2F43B 2ZRNA 4OBEA 1X86B 4G5GA 3BERA 4EUNA 4UXHA 2CEAA 1HA3A 4PTLA 2V55B 1NIJA 4B76A 4IDOA 4CEJA 1IN4A 1A5TA 1KJZA 3BS4A 1YZTA 3W8NA 2V9PA 3I92A 3DL0A 1AS3A 2PZFA 1G6HA 3PEYA 1QHHB 1MR3F 2OFWA 4M1WA 2N1BA 2F7SA 2GESA 2QQ0A 1UJ2A 2BKEA 1GKUB 3BH0A 1T4GA 2IEYA 3BRWD 4KFRA 2ZE7A 1OKKD 3AVUA 5FBRB 5LB2A 4C9BA 1TMKA 2GILA 2JA1A 4I1OA 2A9KA 1EX7A 3LW7A 3TW8B 3L0PA 4EFLA 3THXB 2FGKA 1U81A 3EASA 1UBGA 3VR6A 4YDSA 3QSYA 4Z1MD 4CYMA 4BE7B 4NU0A 3K1JA 5CJPA 2V6IA 5H8WA 2JASA 4IEIA 4TYNA 1PUIA 3ICQB 3RS4A 2XSZA 4LJ8A 2AXNA 1KI4A 1G5TA 3I32A 3LXRA 1Y63A 4TYPA 2ZSBA 3MWJA 4QRHA 1K5DA 2GVDC 2J45A 3VNVA 4P3YA 4AYXA 4I81A 2PT5A 3P26A 2BMFA 3KUCA 4JZKA 2CCKA 4W5WA 3MAAC 3R9XA 2IXFA 1XD9A 1KY3A 1XJQA 1Z0AA 3UWOA 2ZEJA 5CB6A 4MDEA 1CS4C 1CLUA 2FZ4A 1Z83A 1ZUNB 1LNZA 1VCOA 5FBWB 2OXCA 2K5UA 1P2UA 3T1TA 1W36C 2GXAA 5DN6D 3GLGE 4B47A 2P6NA 1FNNA 2DHRA 2D06A 4L8GA 3AF2A 5AJVB 3AF1A 4TL6A 3U3JA 4ESHA 2OCAA 5GJCA 1OH7A 2W2VA 3CRW1 3I5XA 2D2FA 2CLCX 2A78A 4LHYA 1YZUA 3C7KA 4AC9A 2NO9A 4MDFA 1WRBA 4D81A 5DISB 2CNWD 1SKQA 1RRFA 2I1QA 2G1KA 3OEHD 5L3SA 1XDBA 2A30A 2FJUA 5KDOA 2DZNB 3CM0A 2ZU0C 1L8QA 2QORA 3MD0A 3R9WA 3Q72A 3L0SA 5KSZA 3PCRB 1WB9A 2AWOA 1XD8A 5EP3A 4TMZA 1IJFA 1R4AA 4TN1A 4URYR 4MITA 1QHSA 6Q21A 2ATXA 4XSHA 4PXAA 1AKEA 2HJVA 4NHOA 3EARA 4XD7D 3QI2A 1OIXA 4DZZA 3U3KA 1O87A 1ZUIA 1E79D 1LS6A 1M6NA 1UEJA 5ANRB 2OCYC 4LBYA 5EJEA 2IHBA 4FCTA 1DO0A 3D8BA 1G8YA 1JAHA 2PZEA 4OQFA 4RKEA 1EWQA 4WW0A 4V0MA 3QEOA 1HURA 2G88A 4Z1MA 4ZKEA 2P5TB 5K8TA 4JLPA 3K09A 1S3SA 2F55A 4MKIA 2ZAMA 2D2EA 2C78A 2QRZA 3HP1A 1BIFA 1RJ9B 2GNOA 1VMAA 2WBLC 4HDOB 4TL9A 1EG7A 3GLHA 2J7PD 2XXAB 4PO1A 1CF4A 1EESA 1XPUA 2WHXA 3TNFA 2AK3A 1OE0A 2OBNA 4NZYA 4DDUA 1S0UA 4DLTA 1VG8A 2GXUA 4IKEA 1NVWQ 1XZPA 4AY2A 1R5BA 4ZDIA 2QMOA 1SVOA 3OAAD 2E1RA 4RCYA 2YJTD 1D6JA 1ZJ6A 1MOZA 2NO0A 1XJ0A 4JN6A 1II8A 4LPSA 5KPJA 3EPKA 3ADDA 5JRJA 1P62B 5KNCA 4II7A 1CXZA 1TQ4A 3GP8A 3EAQA 3O8DA 4B6FA 3DOFA 3TH5A 1XTJA 2WWWA 2BV3A 2JGNA 4EJSC 2XB2A 2ZPTX 3A4MA 4AYTA 4PHTA 1SVMA 3ZZTA 5DI3A 3ZS8A 2ATVA 1QF9A 2XTMA 3MG9A 4XJXA 4Q1AA 3SQXA 2C95A 2F43A 4XWAA 1NRJB 4QGFA 4B3CA 4QOSA 1WQ1R 1GILA 1KI1A 1KDRA 2CNWA 4HEJA 2XZPA 3TKLA 3D3QA 2ORVA 2VHUA 4EDHA 3OEHA 3KJEA 3K0CC 2ZRAA 3Q5DA 1QHHA 3W9YA 5FBQB 3SYNA 3H0KA 2FNAA 4OQMA 4ZI2A 2QMEA 3V4RA 4B34A 4BLSA 4TQAA 1IQPA 2NOAA 4XIGS 1E2KA 2O52A 4MRPA 5CYPA 2DFNA 1U94A 2QM7A 4HLUA 4MKGA 1BOFA 4JJZA 4QNRA 2GEUA 4RY2A 1DE0A 2EU8A 2RH5A 1XEWX 3JVVA 3QPVA 4MRNA 3KJGA 3GJ4A 4LSGA 4EPXA 1HUQA 5DGXA 4AKIA 1L2TA 2IC5A 4MGZR 2ZI9A 3THXA 1W36B 3HYRA 2REOA 1TUIA 3ZYCA 1UPTA 2IYVA 4Q19A 5G3YA 1E79A 1E1RD 2Q0HA 3O8CA 3KQHA 2G1JA 1F3OA 1F2UB 1GL9B 3RLFA 2G77B 4HATA 1NKSA 4A4DA 1NY6A 2IXGA 3OF5A 4TSFD 1BO6A 3OEED 1ZNYA 2ORWA 4GFDA 3GJ3A 3E5HA 1R8SA 3DKPA 4DT1B 1GSIA 2J7PA 2FE4A 1P60A 3KX2A 3RSOA 2OSBA 2GJAA 2ZJ8A 2ZRPA 1RYFA 1ZCAA 3IHWA 1JAIA 5CM9C 3QXJA 1N6OA 3GJ5A 1EK0A 3IO3A 4Q4AB 1GNQA 1RE0A 3OAAA 1XTIA 3K0AB 3LRPA 4TZ0A 2ZRMA 5CIWA 5EE1A 2G9NA 3CRMA 5AJZA 1ZD8A 2WTUA 3VKHA 3EX7C 3BFVA 3LLMA 1E2PA 1XEXB 3PVSA 2XJ9A 2ZRBA 2O8EB 1WDTA 3LBHA 2BMDA 3O8RA 5DNYB 2QN6A 3LWNA 2Q9AA 4IDNA 5HKKD 5HE9A 3QG5A 4XVRA 1RPZA 3WHKA 3EIHA 4FWDA 2BCGY 3QKTA 1Q1QA 3RABA 1G7CA 5J4KA 1X6VA 4ZPXA 4NMMA 4YXWD 1NVXQ 5CLLA 1UADA 4CT5A 1GAJA 2H7VA 3GFTA 2VRWA 4AK9A 4OKSA 2JLZA 1FPMA 3SZRA 4LGMA 3U3RA 4B3DA 3CB4A 4PHFA 5DHFA 3X1XA 2HJGA 5J5CA 2VQSA 1U0HC 2FG5A 2REXB 1D5CA 5BN5A 1KDPA 5JI2E 3PEUA 4NTZA 4PAMA 4XVQA 4Q21A 4GRAA 3C5CA 2YINC 4QC2A 3JVUA 5J4HA 3UKDA 3CIOA 3K70B 4L9WA 1Z0FA 1BKDR 1T91A 1TU4A 1XMVA 4TYQA 2OFXA 2XNSA 3SS8A 4PR0A 2AFHE 1LW7A 4JLJA 3PUZA 2V1UA 1FMJA 3PQCA 3CX8A 4UNRA 3LVRE 4EJSB 4KV9A 1KSJA 3SYKA 1ODFA 3SBDA 3NTUA 1W48A 1E1RA 5LBIA 5JWHA 1ETUA 5HE8A 5EZ6B 1C4OA 4FWGA 2NO1A 4ZIRB 3C16C 4P4TA 1C1KA 4IFEA 5SZJA 1MO4A 1XTRA 4EQ6B 2FPMA 4TTQA 1AK2A 1P2TA 2E87A 2ZRIA 3KB2A 2E9SA 5G40A 2JLRA 4TSFA 3OEEA 5IK2A 1FP6A 1AQUA 3GEHA 3VU9A 1PUJA 1P5ZB 2YOFA 2FV8A 3AB3A 4DIEA 3WRYC 2JJ1A 1LS1A 3ZZUA 4DB4A 3VHXA 4M1OA 2D74A 2HYDA 1IM2A 2CL6X 1E2JA 1MKYA 1U8AA 2ZAOA 1JR3E 1XU4A 2RGDA 4JS0A 2H92A 3U7EB 3NBZC 4TT3D 4A8JA 2BJWA 4FWTA 4BLRA 2FSFA 1NVMA 4YMTA 1N6IA 4PZLA 1OH6A 2OV2A 3P4XA 4QKQA 2WWXA 1MV5A 3K9LA 4JVMA 4DIDA 5HKKA 1DG3A 2ZR7A 3I3SR 1PLJA 3IPYA 2ZJBA 4MH0R 5KOYA 5CITA 1OV4A 1ZM7A 2OM2A 4MRVA 2WWIA 5JCPA 2ERYA 3A1UA 2Q3HA 2ZROA 3QF4B 1BS1A 3GJXC 4EPVA 5EE9A 1XFAA 3BH6A 4GNKA 4YXWA 4P0TA 1FX0B 3DMDA 3BORA 1UF9A 4B74A 3DPUA 4F38A 4Q01A 4HUQB 2JJ8A 2QTFA 1TQ6A 3PXGA 2Q9BA 2UZ3A 4CVNA 3BBPA 1FMLA 3MMPA 1GIAA 3SR0A 3K8YA 3K70D 4DXAA 4UXIA 3NDBB 2DFKB 1R2QA 1ZW6A 2FFQA 4PPFA 1XP8A 3QOFA 2PCLA 1N5LA 2C77A 4TMTA 3HJNA 3CWZA 3AGQA 1SVLA 4CT4B 2VP0A 1U90A 2WKPA 4MRRA 1E4VA 5IHPA 1R0YA 2GAAA 1SHZA 2MSCB 2W6ID 4Q7MB 4QJ4A 1A2BA 4IVRA 3D7MA 3NDPA 3TAUA 1GM5A 3AF3A 2EYUA 4GSYA 1AQYA 1LTQA 2GVZC 1W1WA 4U7DA 4URWR 1L7VC 1Z0IA 1F2UA 2OBMA 3FKQA 3SI7A 2DFLA 1W5TA 4BFZA 1P2SA 1Z28A 3TIFA 4EPYA 1WCV1 2JDID 5HZKA 2P65A 4Q4LA 3KUDA 2KI5A 3WBKA 1W4RA 3AKDA 4LHWA 2UZIR 5GADl 4XVUA 3EXAA 3SFZA 3K09C 2HLDD 2ODNA 2IYWA 3H86A 4LUCA 3EPLA 3LQQA 3THWB 1DAMA 4DDVA 3K0AA 1KDTA 5FOSA 1N25A 4OI4A 1KK3A 2EFDB 1OFIA 1D9XA 3IBYA 3NKVA 1COWD 4HDQB 4P31A 1XEXA
chains in the Genus database with same CATH superfamily
1ND5A 2YFKA 2PLAA 2KHZA 3WGNA 1SCUA 1PZXA 2B8TA 1Z6AA 3GJZA 2RDMA 4H3VA 4G5RA 2W2PA 4EUFA 2PUBA 2PGOA 3C39A 7MHTA 4RD3A 2Z7JA 4X6XA 1HYQA 4HQFA 3GPCA 2NTEA 1TO6A 3QX8A 2IYZA 2MWMA 3V7UA 1RJGA 2GVNA 1A5ZA 2GHTA 4O2LA 4IHAA 5MN6A 1L7NA 4PO8A 1TD9A 1O95C 3MYRA 4K5QA 3IIKA 1Q21A 1EI9A 2EW1A 1JQKA 2J59A 3AFGA 3BF7A 4MV7A 3M83A 1QOZA 4EG5A 4U3JB 1PD1A 3ZK7A 5ALZA 3ZOKA 2PQMA 1MEEA 3JYLA 4EG7A 4Z9XA 3ZPXA 5JAIA 2RBKA 4TV8A 4TKZA 2PGDA 2PR2A 2QSFX 4I36A 1VYHA 5GWXA 2GQFA 4LZZA 4UATA 3ZIAD 4ZEOA 1G4AE 4KKXB 5IT0A 4E31A 1ANKA 3D4NA 3GCGA 5ITUA 2VJOA 3VISA 3E2MA 1UBCA 4DIOA 3S55A 4R6WA 4B87A 4XTRA 3RIHA 1ZM9A 4RWEA 4TLBA 4YRBA 4RK5A 2V7XA 1L1RA 4UQOA 2C99A 2GZSA 3B53X 3WXBA 1KI3A 1YL7A 3GGCA 3THOA 3LA8A 4H0CA 3K0KA 1OXMA 4A5OA 2C2HA 1E3DA 3P7MA 3ZBPA 3LQFA 4Y2RA 2WHPB 2XHEA 1C1YA 3CPSA 2F3SA 5CXQA 5TMEA 5CT9A 4KQCA 4R2IA 5ALSA 2XNJA 1J25A 3OF2A 2H0QA 1OXBB 5DTMA 2QN3A 1WEHA 4JVSB 1WPXA 4CUJA 2YFHA 5SYAA 1JG6A 2D1SA 3W2EA 4WHMA 3U37A 4X1YB 1G7RA 5HDQA 2R1TA 4JLKA 1GPJA 1FDUA 4TMVA 3DAFA 1RFLA 2HLHA 3L02A 3WIVA 5FH9A 5F5NA 3WDMA 1O94A 2JY7A 3LUPA 1LTMA 1K0FA 1XIVA 1VE6A 3GRAA 2EV9A 5J9FA 3UYKA 3KSXA 5IABA 4BZZA 2GETA 5HHTA 4XVCA 1T9ZA 5LXTB 3EXIB 2YN2A 3G9UA 1IK4A 4Z99A 2APLA 2FI1A 4M0UA 5F7ZA 3RUHA 3ELDA 2WTNA 3K6SB 3I52A 2H1CA 1FDSA 1MENA 1XTQA 2L6OA 3PD1A 3DAGA 3QG1A 3K4HA 4IBCA 4FX5A 3IT1A 3HJUA 3T9BA 2IZ6A 4RC9A 3H1TA 2OXRA 5K3FA 2SKCA 2QI9F 1I5EA 1OZFA 5A6SB 2FEPA 4XWTA 3BHNA 2I2AA 2TYSB 1REQB 4N0EA 5AHXA 2PV0A 4QEDA 1QORA 4I1SA 3RUEA 3UOWA 2XKAA 2X0EA 1P9WA 2FH5B 3GLGA 2OEPA 4IYRA 4YYEA 5IUKC 3NRCA 2RD2A 2DJIA 3QVOA 1VPWA 1JDJA 5KKNB 4JLMA 4M1YA 3T12A 4J3FA 1E9RA 1ZNZA 2I67A 1O57A 1PCXA 1N5MA 2B4TO 3WHLA 1BG6A 1RTKA 4OFWA 2ZUEA 1RD4A 1KFCB 1N6KA 3IEUA 1NKTA 5KHLB 2E85A 5JAPA 2VOEA 521PA 4D5EA 2VP3A 3SNHA 2YHBA 1XWIA 1P7YA 1YGYA 3RWOA 2VC2B 4JJAA 2PIAA 1YIAA 3WNQA 1LPPA 4Y6SA 1D7AA 3GPUA 4JIMA 4M89A 3T7RA 2FPUA 4JCCA 3SNKA 4LDZA 4PRYA 4XDHA 4D4LA 4LNHA 3AJAA 2JATA 2QGZA 4ZANA 3URKA 4B3SB 1HETA 2YFQA 4Q1DA 5KOHA 3NEJA 2GK4A 2JC3A 2AF4C 3IDOA 2HQBA 4L8YA 4RTNA 1HNNA 1HYGA 2UYQA 3RADC 2OHOA 4O4LF 4KN5A 2MJ5B 4HSEA 4R2JA 1I1NA 1JKIA 2NU9B 2P79A 1XZMA 5E7IA 2UUBM 1W0CA 3GT0A 2Y21A 4Y9UA 4CKWA 1GGEA 1KIMA 2GPTA 5GINE 4KAXA 1DAKA 1P4RA 4UTPA 1VI5A 2KWIA 3ANLA 4QVGA 2A5GA 4PEVA 4R5HA 2VWPA 1TF7A 4I8OA 4LFBB 3C3BA 6ADHA 3DMYA 5FLYA 1OKSA 4Q6WA 3KSDO 1FVOA 5LLDA 4CG2A 5F4BA 2G8NA 4OP2A 1MOQA 1KORA 1Z8FA 2AXQA 3HN6A 2SCUA 2V4ZA 1RRPA 3PFCA 1T4DA 1S2DA 4MP6A 4MQFA 5CFMA 5GVSA 4Q4DA 4UPVA 3HHYA 1FTQA 1MAHA 1QR6A 4UASA 4C6TA 3DXXA 3DMTA 2DT8A 4MVYA 3PFNA 1PNOA 2C03A 2NYUA 5NLLA 3JYHA 1MB0A 3OPVA 1DKNA 4HAXA 1OZGA 5AVWA 2WM2A 3RSQA 3L6BA 4JI1B 4F3YA 2DHYA 4HNUA 5IH7A 3D2AA 1YAHA 4INAA 3OZEA 3ROMA 2GRAA 3P0FA 2EKFA 4Q7JB 5LN1A 2MOKA 5JZSA 2V7TA 3ZJVA 3IEVA 3E22A 2V54A 4MVXA 1ZC4A 1RM4A 4HR7A 1UWLA 1AZLA 1VLLA 2C0CA 4BGVA 3V8QA 4ZAWA 3A45A 2PLFA 2X8JB 4LOJA 3ZCUA 2QUJA 4KRYA 3FPJA 3DDCA 3LWBA 1D4ZA 4QSHA 1XZGA 2ZIGA 2F00A 4UULA 4WDQA 1ZO8A 3WQHA 2A88A 4F3TA 5KPTA 4CM4A 1KU0A 5LMUM 4DR5M 2VPWA 5KOIA 5HS6A 1K6XA 3VC3A 4EHFA 3P9RA 1SXJC 3RC9A 1N2CB 3PP8A 5T5QA 3IKLA 4O2AB 5LVAA 4KT0F 2FH0A 2FEXA 4QDXA 3V33A 1XL1A 4UCXA 1OJLA 1OXXK 4X94A 2CJWA 5T8KC 2FHPA 4DLVA 5JV5A 3OIGA 3MGGA 3QLTA 4QOJA 5ETJA 2W58A 4RHFA 4MP8A 2I3BA 4AICA 3IJ5A 4LHZA 4QM6A 1OBCA 4DZTA 4DA9A 4QAQA 1TM1E 3MWEB 4Q9HA 4X92A 4JLBA 1G8KA 4POAA 4OU5A 1NO1A 5L4NA 3PX3A 2VJLA 1H9BA 4X1OA 2IL1A 3COYA 3HA3A 3QNMA 5E7QA 4L4UA 1VHLA 3WHPA 5E3JA 1P0FA 2DT5A 1U11A 1V5GA 3KR9A 1XD2A 3ZE9A 2QMUA 4NSOB 2FUKA 1NJFA 4QHTA 4D42A 2HPAA 1XP5A 2GBLA 2OY0A 3MWKA 3PFBA 3RGPA 3CSDA 2AR0A 2G36A 2OHJA 4G8BA 1RI3A 1T5BA 4N3NA 2GPBA 1MX0A 2ZJOA 1YRBA 2VT2A 2AF3C 4I1VA 3RASA 3TRFA 1JDVA 1DKUA 1N1DA 4ZJZA 1KR2A 3E82A 1M1NB 2WU1A 1U0BB 4AZVA 5JEEA 1RLJA 4QFDA 4G9EA 2V3CC 2Q7OE 2C58A 1V33A 3SMSA 1XJ5A 1ETHA 4KBFA 1G19A 1UXKA 5LZ8A 2RI0A 2P9BA 4ZEMA 1ZIPA 5LP6F 4KUEA 1RLIA 4AJPA 3ZTWA 4FGWA 2X0FA 2QXUA 2X41A 2FEAA 4QG3A 1XQWA 2FZ5A 2QYOA 1SVIA 3RU2A 3I04M 1E6WA 3WKCA 1H3EA 4PF1A 1ORTA 3MB8A 1XVIA 4CEHB 4RJ2A 1WNTA 3S8YA 2OLJA 2LE0A 1MB4A 4IQFA 1NYRA 2VDPB 4KIUA 3KQOA 2HK8A 1TVCA 1OYWA 4MA4A 2JIPA 1DAFA 4HDNA 3GN1A 1H85A 3T8YA 3E84A 3JYPA 3HBFA 2I33A 2GHRA 2AJDA 3KHTA 4JI8M 3BD6A 3T7EA 2QV0A 4J2OA 4MYRA 2RH9B 2C1XA 3FB4A 3WLPA 2ZPUA 2GDZA 4QYIB 2OECA 1E9FA 3E5NA 5GV7A 3Q1KA 2FFRA 2L7HA 4QXQA 1XDUA 3KJHA 4CHTA 3ADKA 2UV8A 3CLHA 1QVRA 1TX4B 5ITRA 4IIJB 2EVWX 1KH3A 4XCVA 1H5QA 5IJZA 5TPWA 4QPCA 3PKZA 4MWBA 3KVOA 4XFDA 1UK6A 5JNUA 3HGMA 5DGCA 3FLBA 3FYCA 1QUEA 1N2XA 4K8OA 2AGVA 3OLVA 3WWZA 2FSUA 3NT2A 3V4FA 3QVTA 3HZRA 1ULZA 1F2TB 4BMDA 3ZHSA 3VZQA 3ZNQA 1N92A 4ND4A 3G9ZA 1M2OA 3L1KA 2BFCB 2ZJZA 3S1SA 1WOMA 2Q9UA 4O0MA 4YT4A 2WSBA 4RV5A 3AL2A 4KPFC 2YMMA 4XWOA 3VAYA 4FS3A 3RS7A 3OZTA 3M6XA 1B8VA 3B8HA 4F9FA 2PUWA 1BH6A 4BMZA 1DELA 1PDVA 3UK6A 2WHEA 5EL0A 3EDRA 4UBLA 4ITQA 3ZDQA 1RAGA 2YRWA 4QUGA 5HKAA 1BE0A 4CQMB 1EHCA 4BQPA 1DEHA 3V1MA 3MQ2A 2ZREA 2QT1A 4PSUA 4Y1RA 1OI7A 4UE6A 1UXHA 4KO8A 3TXXA 3ZS9A 4W7IA 1T9CA 5KNLA 4OLJA 1H6UA 4FYXA 2FCRA 1E89A 4W5NA 5HCIA 2NUPA 4B4KA 4J0CA 2AZXA 1RT9A 4O29A 4J0QA 2GPWA 4NV3A 4FLMA 1VSUA 3MTEA 2VPIA 5ALKA 5BMOA 1KVTA 1FS4A 1Y6GA 1P91A 721PA 4DMMA 4DA6A 3I2GA 1XCGB 3AHGA 2JLSA 1WCYA 1EB8A 3G2JA 4BL5A 1VLMA 1R9JA 5EJIA 1E62A 4GZLA 2FMTA 1SUPA 1N5OX 4M0FA 2V4MA 2FF5A 3D81A 1GJTA 4NZPA 1DMSA 2H0AA 1IRIA 3GGPA 4CL8A 3DL0A 1Z82A 2GESA 3GY0A 1IM8A 1KEZA 2BKEA 4K9QA 2G82A 4JXXA 4KFRA 2YW2A 2CNNA 2CLMB 1GZ6A 4I1OA 3HJRA 4MV3A 3ZNOA 1BEZA 2I2XB 3JCZA 1QVVA 2FQXA 4EMUA 3EW7A 3SKYA 1PUIA 4WH0A 1K5DA 1SK8A 2OB1A 1BU5A 2GYVA 1FYVA 2EZ4A 4K6OA 3E03A 4DBLE 3GLGE 4L8GA 2C94A 2YDYA 1UPAA 2PFSA 1PGJA 1S8NA 4D81A 1X7DA 1U9ZA 1JP7A 2V6MA 3DMGA 4LTMA 3TM5A 1UOPA 3MINA 4RYLA 4DUZB 2Q2WA 4G36A 4BKMA 4DJDC 1FLDA 2X0IA 3LNTA 6Q21A 1AKEA 3MPUA 4NHOA 1SD1A 2WIGA 3GBPA 2JA2A 4CF6A 3DWEX 3EVCA 1NA5A 1YH3A 1DWPA 4RKEA 1EWQA 1HURA 3WKBA 2BE9A 2C4NA 3U31A 1S0UA 1VLHA 1EUDB 1C30A 4IKEA 3AR6A 1SVOA 2YJTD 1U7PA 4F56A 1XJ0A 4LPSA 3ADDA 3RG2A 2E4YA 2JGNA 2XB2A 2LHCA 4JI4B 1ZUD1 2Y1FA 2ORVA 1H2AS 4EDHA 3HH8A 1T4CB 3KJEA 4B9EA 3K0CC 3ICOA 4I4TA 4P81A 1TT7A 4EPXA 1UK8A 1RZRA 2O0LA 1LRKA 5AKLA 4LZNA 3LKDA 1GL9B 4IXWA 4IZHA 4HATA 2WJPA 3EXEB 1GO5A 5C34B 5TNXA 3GMSA 4DT1B 1QGUB 1PR9A 1P60A 3IV9A 4MIEA 3IPRA 1JAIA 3PIIA 4JWTA 4NICA 3HVKA 1QS0A 1JSCA 4OHUA 2O8EB 2XCRB 3B7PA 3NI2A 2JJQA 3VO2A 2Q9AA 4CR8A 2P7IA 2BCGY 2B61A 5DGDA 1O5IA 2H7VA 2IH4A 5ITYA 3H11B 2JLZA 1YQGA 4WECA 2ZWOA 1U3CA 2COKA 1Z74A 3CIOA 2C59A 5IJ0B 1Z0FA 2OFXA 1NR5A 3A1EA 3UZUA 4DFDA 1I0IA 4GICA 4KV9A 2OV1A 1OVMA 3HNRA 3IPLA 3OM8A 5H5JA 2FW9A 3FTPA 1DDIA 4EQ6B 3N0TA 2XUHA 2Y9PB 3VH4A 4GZ5A 1P3Y1 3QVGA 3DLBA 1TH2A 1U31A 1P5ZB 5E9AA 1MKYA 4BX2A 4A8JA 3U0VA 1OV6A 4IG4A 4YAIA 1TB4A 3U80A 4FFBA 1ZOIA 2OSVA 4OEHA 3N28A 4F38A 3PNYA 4D96A 2FZCA 1DXYA 2Y4OA 2WNIA 3K8YA 1SQFA 1GPBA 1H0SA 4B8YA 1R0YA 3ZJ4A 4IVRA 1IVSA 1WWKA 4URWR 1L7VC 4IIXA 4EYKA 4MW5A 4Q4LA 3RAJA 4D4GA 3KQWA 4HNSA 3IP9A 2RIRA 4Y6RA 3RTGA 1YVUA 1FP4A 4LDPA 1R0RE 2LCIA 3RYIA 2XVXA 1N25A 1D9XA 3MPOA 4BGUA 4A2WA 1PV2A 3GQVA 2I6GA 1EUCA 3FBGA 3JR5A 3AW9A 1S1CA 13PKA 4ZJPA 3P5BA 5CDGA 1UR5A 3IX7A 3HA5A 2VL7A 3RC8A 1K8XB 3ZVMA 2JAOA 1BVSA 1PIWA 3ZHYA 3HXLA 2Z2XA 1Z4OA 3PQ4A 2HCJB 5LDHA 2YVAA 1QRAA 2ZGVA 1QP8A 4ENVA 4S1OA 1QG0A 2EW2A 4IQ8A 1JNYA 2Q1UA 4IWNA 3T9FA 4NCBA 4AG5A 1QDLB 2O1EA 4CLOB 3BMNB 4YCCA 1KOJA 3V80A 4TS1A 1CR0A 1C7IA 3RIGA 2YH2A 1BE6A 4M98A 4CMEC 1A76A 5GZ6A 1IATA 2PU7A 4HX2A 3TQHA 2G1AA 5EJ2A 3BF8A 2Z4SA 4IEEA 4RKFA 4RMJA 3A9WA 3JXEA 4HXGA 2JF0A 3QGMA 1PEDA 4BGEA 1Q74A 5K0CA 5MGBA 1TIKA 5K05A 2J4FA 5TEWA 2O8CB 1XJWA 4ETIA 1E4YA 1E3LA 3URMA 3TL3A 3ZD6A 5IZCA 1SQGA 4LMPA 5KNDD 4Q0MA 4JJGA 3ROTA 3DYIA 4G0NA 3ILVA 5CLFA 3R3SA 4E5VA 1XQYA 2OQ2A 3LPNA 1PFGA 4Q05A 4P53A 1CU1A 1NVTA 1WPGA 3VYUB 3WGIA 4Q3AA 1U6IA 2HWUA 3E18A 2CNLA 3B1FA 4EKGA 2YICA 4WA7A 3MHVC 1GZ7A 1K88A 4ZI3A 2DQKA 4QASA 4EY4A 2ZRHA 2AOWA 4A6EA 4S12A 1OLSA 2BBOA 1E9EA 2P9HA 4JQOA 3Q12A 2JZOA 4GEWA 1PWEA 5K8CA 1W0JD 3HSYA 1E4EA 1V71A 1ZOPA 2XGSA 4P84A 4K26A 3GARA 4OI1A 3WMGA 2LBCA 1PNQA 3N3BC 2XLJA 4AIIA 4IP0A 3VMFA 2G67A 1B6GA 2UXCB 1AGPA 2EXXA 5LJLA 2WFZA 1KY2A 3RC1A 1WGNA 1EK2A 1PDWA 2IX3A 4GM4A 2D5LA 3BK1A 4OQNA 3PDIA 4WK4B 4E5PA 4ZOAA 3G0HA 2PLNA 3BK7A 1FRQA 4OG2A 1FJHA 1X7YB 2VDUE 3UXEA 4UKDA 3UMVA 2KS6A 3EXFA 4XXHA 5AUPB 2ADFA 3WIOA 2HGZA 5B4VA 3VK7A 3BHJA 5AKZA 4MUJA 4JCOA 3H5LA 2GJ8A 1LX6A 1DAPA 4U8GA 3X43A 1JHZA 4JI3M 1ZRHA 1HYEA 3B9PA 1OKKA 4RK1A 1N1MA 4U7JA 1XCMA 4OK5A 4YY3B 2QL6A 4D9JA 2FX3A 1V34A 2J3IA 2IYOA 5C81A 1K0UA 2A2ZA 4XRRA 3LXXA 1DC3A 4YVFA 2ZUDA 4DM4A 5EXPA 4EIWA 1TNDA 2ILTA 1MRNA 2ZATA 3ZQ4A 4BRSA 3O8NA 5DI9A 4WURA 1SA0B 1UIRA 5CJJA 3ORHA 2G5CA 1TFUA 2QAJA 4RY0A 1HE8B 1ZGBA 4B6QA 4A5SA 2VP2A 2QTRA 1CR1A 1JHMA 1RPJA 1SZPA 4J0IA 3RT1A 3AP2A 5EUQB 6LDHA 1Q57A 1VHWA 4XD7A 3AYZB 4REZA 1UPFA 1EFKA 3JQ9C 1M74A 4JA2A 1GRNA 4WZZA 3O83A 3H65A 3FH0A 5C5IA 4Z53A 3AB8A 1UKEA 4QTXA 1AKYA 2DC1A 2CMFA 4X0EA 4E5YA 2D1TA 3PTAA 3U9LA 2ZT8A 3I9OA 1IEQA 3QUQA 1TXGA 4E3ZA 2ZYWX 4UUBA 1OASA 2B4AA 2WA1A 3S5JA 2O48X 2PSJA 2CVOA 4TKUB 2VTBA 2AS0A 4ZQGA 1P2FA 1DIAA 5H02A 1GNLA 1E1DA 1E0KA 2UKDA 1GPKA 2I4OA 4OYLA 1K3XA 1YWGO 4GEGA 4MQUA 1CVLA 1Q83A 1DJPA 3VR5H 4CKBA 3CLUD 3NEPX 1D6NA 1VHJA 4NNPA 2YS7A 3OY2A 4RMHA 4KHPM 3N2KA 1O4VA 4C7XA 2QRUA 1XLTA 4JOSA 5KZMB 2GEFA 3BH7A 3D0RA 2D5BA 2Q9CA 4HMQA 1K8ZB 2WK1A 4LRTB 4LNUB 4DV6M 3SZUA 2O0JA 1LZKA 1V5WA 2ZJ2A 5EZYA 1XYGA 1U0SY 2CN1A 3QX7A 1NXTA 1WIWA 4S0XA 1P1HA 4Q1VA 2D1RA 1YZNA 4TLEA 2C2ZA 3MTIA 4TLMB 1KYWA 4W9RA 4LJRA 2QWXA 1JU3A 2ORYA 5A7HA 1ZD3A 3DV0A 3PXUA 4W5JA 2VP9A 3P9ZA 3CKKA 4F12A 1NM5C 1JEJA 2QZZA 5ILGA 4AMZA 3TL2A 5BXQC 3HRHA 1MQ9A 1TIPA 4UMEA 4BIMA 1Q1ZA 4WPGA 2IXBA 3BG5A 3DVAB 1J70A 1M2EA 2XAUA 4BE9A 3HLYA 1Z12A 3EGDB 2ALJA 4AXXA 1QNLA 4ETNA 1QQ7A 3W6ZA 5BQ5A 3KFVA 4DDTA 3R7WB 4FEYA 4C3VA 3F4BA 3F3YA 2E1PA 1SXGA 3QZUA 2VHJA 3H0EA 1OIVA 3CVJA 2KNVA 2D62A 4HNQA 5J4YA 2QI9C 4CTJA 2SKEA 3TLMA 1UFQA 4B45A 3C4JA 3BAZA 4Q7QA 5K0NA 3PJRA 1LBIA 1B6TA 1W47A 2EEZA 2EJUA 1A8QA 1JHAA 1FOEB 3FVRA 4HDSA 2FZWA 2Y27A 3SIXA 5EOVA 3PTLA 4YRCA 2I6TA 2IY7A 1TTQB 3Q0EA 3GO8A 4L95C 7MDHA 4OPMA 3GJ6A 3OQNA 1Z16A 4RX1A 3EEOA 3ES9A 4Y9RA 1XCOA 2V5VA 1FNMA 3HKCA 2FXVA 2OHFA 1F8XA 1KJJA 2XQKA 4D3SA 5AVJA 1J0DA 1Z4LA 3TGWA 1X37A 4JBLA 1WSAA 2RGUA 3PHHA 4QREA 4TV9F 5GKNA 3UT6A 2Y3IA 1GLVA 2WZQA 2Z6QA 3C85A 1R4GA 3VBCA 1K6MA 1DAEA 1Y9DA 1PJRA 4AW9A 3TZQA 3NMUF 3SYLA 2H4JA 4C3UA 2WEKA 3INRA 3HKEB 4L15A 2XBLA 2VJMB 3SZLA 3ZHXA 5I7VA 1NN3A 4K1XA 4YWJA 3L28A 3AM3A 1RWVA 3QUBA 1ZIOA 1T5DX 3DNFA 4ACBA 3H1GA 4LF5M 3WQSB 4C03A 5A9RA 2RGGA 4DPKA 5I9BA 1RR6A 1TZMA 4FM9A 3BXFA 4XSGA 3SDSA 1KBZA 4A73A 5K7SA 5PNTA 3EBPA 3U62A 4QYMA 1R74A 4BASA 4UTRA 1N4AA 2O23A 2J4DA 2HCFA 1P1JA 2AZMA 2ESRA 3U1VA 1M2GA 5TXGA 3R5XA 1HJPA 1U3TA 4MZXA 1ZCFA 4IJMA 4E5KA 1JSLA 4AS2A 3LUDA 2KLBA 4D97A 4H7PA 3HEMA 3F6CA 4QDOA 3HXQA 5E3IA 3GJ0A 3LF1A 1ZVJA 1MAAA 1NLFA 3NHKA 1ENZA 1Z5VA 3FBTA 2OK7A 1N5KA 4BLCA 3P5SA 2L17A 4KO1S 1MC8A 3B1VA 1C0KA 3S1AA 2NV6A 3EFEA 1T2NA 3SAJA 3AR4A 5IF3A 3N8NA 3FR7A 3FUTA 2WZBA 2AWNA 1VKNA 1U4OA 4MS3A 4NZOA 2QNJA 5SZHB 1IBMM 1IHUA 1KKUA 5BORA 3IPCA 2FK7A 3IDQA 4DQKA 5LFAA 3VR3D 2GBFA 2LW7A 4I9FA 4OSEA 1HK7A 4UHBA 4WXEA 4G1CA 4GWKA 3IB6A 2ID8A 3V46A 1KJNA 1P7PA 4YJ2A 1GQ2A 4IDDA 3AO0B 3MW8A 4EHKA 3BZWA 3ZWOA 3AQIA 3EIFA 4D3YA 3LO8A 1TAUA 2KYRA 4IDFA 4ASUA 2VDVE 4FUQA 2J08A 3CB2A 2IX9A 4BNIA 4MWCA 2X6TA 4J6EA 3T0GA 1NQOA 5D3KA 4IYJA 5FBLB 3BXEA 5HRCA 3ZV7A 4Q24A 4DQDA 4ZFNA 2FJPA 4MA0A 4BFCA 4QGSA 3EEIA 3L84A 3S2GA 3L2OB 4RZQA 4ENTA 2FR8A 2IHVA 5FLEX 2ZBFA 1G64A 1TZ2A 3OECA 1TK2A 3ZWDA 4KOAA 3K9OA 1DOAA 1TJ3A 3NNSA 1H65A 3VPCA 5CFZA 4KSBA 3MXOA 2ASEA 1L5SA 4QBGB 1GKIA 4R69A 3QUSA 1NG1A 4JI6B 1B3BA 5K0FA 1L4NA 4H59A 1E2FA 2WMYA 4JB3A 4WESA 3HUFA 4HS4A 1XE3A 4NFLA 4YRQA 1SBCA 2NU6B 1LV7A 4BN5A 4MVWA 5EQJB 3JAKB 1RHQA 1U2GC 2FPRA 4PZ9A 5JYEA 1F9EA 1U8CB 2A5YB 3E9CA 2NMVA 1X1CA 1SHLA 1VKJA 2I2CA 2GA8A 3SHVA 1PD0A 2CJYA 2ZB4A 3TO5A 1HRKA 3VZDA 3H5RA 3KYCB 2VNAA 1QHIA 5FPTA 4U6NA 1HL3A 1RJ9A 4OQQA 2WV7A 2XXAA 4Z4FA 2DWQA 1XCBA 1Z8HA 5FI3A 2EF0A 1S3GA 1KQ3A 2A8YA 1LXCA 3QPWA 1RRGA 2Y1DA 2CHVA 3IXMA 4C2AA 3O90A 4E2WA 4G5HA 4H6WA 4I9HA 4UCQA 3G8DA 3PIDA 2FFJA 3KQUA 4HAUA 2WM3A 2Z5VA 5G41A 3ZN2A 2G76A 4XB6B 2PA0A 2E37A 3U60B 3NBKA 3UTDA 3BA6A 3CF6E 3THYA 2CYCA 4HEOA 5FNZA 1M8JA 4HYEA 1NQXA 1C9MA 3ZXSA 4DEVA 3LPDA 5KYWB 2CYBA 3RNOA 4YREA 3E23A 4PLTA 4K86A 1BHSA 1NMSA 1JDPA 4G4SO 3FE3A 2GX6A 3VDRA 3PHLA 1FU8A 1ZNQO 3I42A 5D8DA 1GXSB 4MMXB 2BIFA 2EQAA 5AUQA 1XMJA 4L08A 3I04A 3VOSA 4B81A 3OZRA 9MHTA 3I73A 5JARA 4BTLA 1QCZA 4MUKA 2GJSA 3WO0A 3ZDBA 4KEAA 1DBIA 2D2IA 2VRCD 3COPA 3OCCA 4KJZA 1MPTA 4AJ2A 3SLRA 4AZTA 2BFWA 1JLSA 3B7GA 2AN3A 5I3CA 5B57C 3EIEA 1T8YA 2BEVB 4ES6A 5LDDC 1LUAA 2QTVB 1DAHA 2HSZA 2QOEA 5FUQA 5LP6C 5K2MA 2QF7A 2VZ8A 3MCTA 1BU8A 2WOJA 1ND6A 5F2KA 1U2SA 3GUCA 4O0LA 1EFLA 4NMHA 2GN4A 3QH4A 3K35A 1QMGA 1JB9A 1E9AA 3ZGZA 1Y6FA 1JG7A 5C4MA 2ZSFA 4IMRA 3WAGA 3I4CA 3ACCA 5A2GA 4W7SA 3NH6A 1PFKA 4FXPA 1L4FA 3SJ7A 2IYEA 3GZNB 3SIPA 1YDMA 3GJQA 4C87A 1XAJA 1JQLB 3X1DA 1OWMA 3CLVA 1TF5A 2Z58A 3L05A 2RAPA 3AH8A 4I3HA 3W7BA 2DMRA 3TWMA 4CIWA 2WLSA 4QFCA 2YJ3A 1XOIA 3TMKA 4QL3A 4EG0A 4JELA 4BUZA 3A32A 4ZAXA 3HP7A 3HMKA 4EUNA 4ER3A 1ABEA 1WKBA 4G0WA 1GQOA 1NQWA 3OOSA 4I6JA 3DMFA 2OFWA 2QQ0A 3T1YB 1PJ2A 4V24A 3BH0A 5CLJA 3G8CA 3UB3A 4KBYA 4GP9A 5DX8A 4M36A 4PGHA 3GUZA 2Y0TA 3U9SA 1UP4A 2ZJ6A 1EEXB 1QK3A 3LYLA 4EW6A 3R44A 4AY5A 3KUCA 2CKDA 1FVXA 1UMKA 2X5KO 3TLGB 3TZLA 3ZDXB 5KNCD 3LRXA 3RVDA 5AW8A 2W2QA 2P6NA 5GJCA 2W2VA 4ZO6A 3GDFA 1WRBA 2CNWD 4TSKA 3ZIUA 1RRFA 2OOSA 4G4GA 5FJJA 2QL5A 3T1HM 3IP7A 5BNZA 1WZNA 1MX5A 5DM2A 3HEBA 2ATXA 4BNDB 4LF9B 4EUKA 4TZKA 2HREA 2P30A 5H3CA 2DH5A 2V4UA 3QYJA 1SCIA 3G5LA 2KX7A 2ZAMA 2O2EA 4WXMA 4XDZA 3WNVA 2NVUA 1VMAA 5K0TA 4JB2A 1I7PA 3JY6A 2E1RA 1E3TA 1YK0A 2RHWA 4Y1EA 3EPKA 3DO5A 1B93A 5JRJA 2DAKA 2A14A 1M1XB 1SBTA 3RAFC 2GEBA 4RIHA 4HN4B 2OP1A 4Q1AA 1Q92A 4QGFA 1ODLA 5CHYA 3MOGA 4IR7A 1M3SA 4HEJA 5IEBA 4O1IA 3WKEA 1J2UA 1SNYA 2FMKA 1PR3A 3CU5A 5AHWA 5AVTA 2ISQA 2IC5A 2LVBA 4MGZR 2ZI9A 1Y5LA 3V32A 4G8CA 2N0SA 4HWGA 2IYFA 2FW0A 1FFEA 3KQPA 5JH7F 3R0JA 3HCEA 4BOYA 3KX2A 4I55B 3V1KA 4RIGA 1YDGA 5CFLA 3W2TA 2OZVA 4EJFA 2XEPA 4N3GA 4H15A 4GX2A 6GPBA 2QX7A 5CIWA 3VDMA 3LTNC 3EX7C 3ZW7A 5CAEB 1WDTA 5EPEA 3LWNA 2OKGA 3F7NA 4RJIA 2C88A 4ZPXA 3K1AA 3I9KA 4CT5A 4KR3A 1G5HA 2VKQA 5EWJB 1V3UA 3U3RA 4B3MM 4XM2A 5IW8A 2HU7A 3OWHA 1L5YA 2QJOA 3BXHA 2YXDA 4QPZA 3GD5A 4B9AA 4OX9Y 3BDVA 1WTAA 1GUYA 4PG7A 2V1UA 3VO9A 1KSJA 3SBDA 2P5TA 1E1RA 4HGPA 4DV2B 3N07A 4X6UA 5JXHA 2Q5QA 3G2QA 2W6PA 3H99A 4P4TA 1XTRA 3D7KA 1QE0A 3AESB 2LHGA 3ZHZA 1WLSA 3ZZUA 3ABSB 4YMHA 1ISIA 2H92A 1PI3A 3REOA 3NW9A 4YMTA 3JYNA 2G09A 2OV2A 4IZ6A 3I3SR 3ESYA 1I1OA 3WK4A 4P0TA 4TUWA 2RGYA 3ZCSA 4LMRA 4HUQB 5E9WA 1VJ5A 4C4YA 3RFCA 2FY8A 4IGFA 3QVMA 3DGFC 4DXAA 5AXCA 4N0QA 3CWZA 1JWLA 3LUGA 3DKIA 2DFLA 2VDWA 1P2SA 1Z28A 3DCNA 7GPBA 2AR9A 2YWJA 3HXTA 5CT5A 4QUHA 2FVYA 4B4OA 3EOAI 3HCAA 1QF6A 4DWVA 1HXHA 2BZGA 5JD5A 1RMTA 1YFZA 4KLRA 3AERB 5TC4A 5BV8A 1AGNA 3ZR4B 3CX3A 4IIBA 2B8NA 4RKUF 2XYPA 3Q7IA 3C5WP 1P9RA 2HH9A 4HQNA 4EL0A 2H4FA 5ARDA 5IARA 4B8ZA 4QECA 4YRAA 5LIRA 5EP4A 4BEVA 3V7WA 3IOCA 3F3MA 3W3ZB 2G6BA 3FOZA 2XDWA 1KPHA 3KALA 4PV7A 4LKRA 5KX5F 4UJ5A 3LDHA 3ABIA 4ZIRA 3OPQA 5JFTA 3NWJA 2QW8A 2WWTA 2AMVA 4GS5A 3NHFA 1CUAA 4LG2A 2IZ5A 2WAXA 3IAHA 4FYPA 2FUG1 1Y3CE 2ZBEA 1ZI8A 1MGOA 4ZV4A 2HRBA 1T0PA 1YBHA 5LQMA 1BD3A 1C1DA 1WDKA 4O4JF 2YXBA 2WJGA 4CKYA 3AEXA 3OCUA 2XZLA 3OQIA 1V39A 3PS9A 1R15A 3V8MA 4CR6A 5TB5A 2PUHA 1CIVA 3KAJA 2O25A 2H54A 2QSUA 3SDBA 1K97A 2UXBB 3EDOA 1EP2B 5JR3A 5EJGA 2DUWA 4JD5A 5JMPA 1KP9A 2AR7A 1BMFD 4JN6B 3BX1A 2OFOA 3QJ5A 3B5JA 1GTL1 4X65M 3P9SA 3BMCA 3ER9A 4L6AA 4LYEA 2YWFA 2HNAA 4NAUA 1NVBA 4JL6A 4RFVA 4RV9A 3IRVA 4HVCA 4GDMA 3PCTA 2OAQ1 4P83A 1D5WA 4B3FX 4DSAA 1U2EA 4AKEA 2D3TA 5ALLA 1ZH4A 3I9V1 1ZSNA 3EAFA 3RO7A 5I5GA 3Q9SA 4KYTA 4TPKA 1BCSB 1TO2E 2FP4B 3DEFA 1GUDA 4RF5A 1WMAA 3ESAA 1YS4A 4M22A 5TF4A 5E4JA 3OTIA 1X0XA 1TOAA 1U0LA 3DDZX 3FTEA 4BYGA 2NACA 1FUEA 3G7SA 5T57A 1BNCA 4R0VA 1A9YA 2A92A 3K5PA 3AHDA 4DRZA 2C1ZA 2J3MA 1O6GA 2CBXA 3FJOA 4WJKB 4MGIR 5M04A 3ZNNA 2EWWA 1QOPB 4G9GA 1C3OA 2QZSA 4LXTA 4B35A 4TMKA 3N2GB 1OLUB 2ST1A 2FX2A 4BO0A 2H7XA 3DFZA 3RI3A 1D2GA 1PVVA 5FB3A 3A70A 4UDOA 3SD7A 5JATA 4NJOA 1YKFA 3NTVA 2C57A 3KWJA 4FNOA 3X1KA 2MR6A 4CIDA 2A84A 4NYJQ 2X3FA 2C2GA 1TCUA 3EHEA 4OVKA 3SVTA 1X74A 1RBQA 4L5YA 4DR2M 4EEXA 3EXHA 2P9FA 1XRJA 2H1LA 3TW0A 3D8HA 2VQDA 3B2NA 1KJYA 4TTAA 4GXNA 1U9CA 2E82A 4L9AA 1UXIA 4UHFA 4NE2A 2FPXA 2REQB 2ZR8A 1WHTA 3ILXA 3IQEA 2GPYA 4BX0A 3USZA 2KMLA 1G5FA 2R7LA 1X0VA 2YOGA 3Q7TA 2X6RA 1T2VA 1U6KA 4D43A 3LWZA 2DR3A 1J20A 5IN4A 4GRIA 5CDUA 4GBMA 4XLTA 2XTZA 3S5UA 4CF7A 1IPEA 3KJZA 4AFNA 1T1EA 2QLNA 1LSOA 3DC2A 1QZZA 5TR9A 4FOLA 4OHYA 3CLRD 1E4OA 1QFJA 1RC1A 1JEYB 1JYSA 2EJVA 4PFKA 2R6HA 3RYHA 3LYUA 4YP7A 4RZUA 4RSGA 1UZLA 1LPBB 2DFTA 2AI3A 1XUOA 5IKXA 3Q9LA 3CKLA 1JQEA 3BQNB 2D5IA 2OCLA 1V11A 2VJDA 4IDEA 2QD4A 1WUJS 2YHSA 3SC4A 3PV0A 2E5WA 4LF7B 2B30A 4NR0A 4ZN6A 2R4UA 4ADSG 3ZEIA 3BXZA 4MKFA 2YKGA 1XT6A 1QP7A 1JXOA 2PV7A 1W5FA 1QPBA 3GV0A 4DTIA 3ZXYA 3F1KA 3PEVA 3VR5A 2D4AA 4Q3DA 2ZG6A 3PENA 2A9FA 1T2FA 1DO2A 3F5MA 5K6AC 5C37A 4P34A 1X7WA 2BPOA 5EMLA 1I7SB 4WVLA 3QHPA 4HAWA 4DLRA 1V3QE 2ZZMA 4Q9AA 2XZOA 1CUUA 3T4PA 1K8RA 4ALJA 5FOUA 1EA5A 2GK3A 5A71A 4E4TA 3A6EA 4M9CA 4GPAA 3KQNA 4GPIB 1VZ2A 2H2IA 3W5JA 3BXPA