1OFIA

Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
309
structure length
299
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure and Reactivity of an Asymmetric Complex between Hslv and I-Domain Deleted Hslu, a Prokaryotic Homolog of the Eukaryotic Proteasome
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 84
structure length 299
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ofiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ofiA01
3WP0A 4DLSA 3FB4A 3NXSA 3UMRA 1QRAA 1NY6A 3KB1A 5TY0A 1E99A 3U3OA 2V55B 1M34E 4Q66C 1ZJ6A 5KO2A 3I4LA 1NIPA 3IDQA 1U98A 1SVOA 4Z54A 2PH1A 3R7WB 3GP8A 4B74A 1WRBA 4P32A 1IN5A 2XB2A 1CLUA 4KV9A 3T1OA 1RZ3A 4LUCA 1UDXA 3SFZA 1A2BA 2AD5A 3X1XA 1XD8A 1SULA 1EK0A 4PZLA 2B7CA 1GL9B 4UKDA 4QHYA 2NZ8A 3IHWA 2VSFA 1P2VA 1CR2A 2VQSA 3JVUA 1JAHA 3RS3A 1R5OA 3AKDA 1GILA 3B8HA 1I2MA 4DCSA 2PCJA 5EP1A 5CLQA 4G5GA 1C4OA 5EXSA 2FE4A 2J46A 2J7KA 2WPDA 3Q9LA 1P72A 5FBRB 4TMKA 3I1FA 5C4GB 1SKQA 1LF0A 4A2QA 2QE7D 1X8KA 4Q18A 3KDSE 2A9KA 2BBWA 3BK7A 3HYTA 1G7SA 3GLFA 3BB4A 1TF2A 4OKSA 2PMKA 2C9OA 2RGGA 1IY2A 2ORWA 1FUKA 1QDEA 4OHVA 4M9SA 1KI3A 1QHIA 3GLIA 3BOSA 3QUSA 4BEBA 3TSZA 3GLGB 1DVRA 1XXHB 1WCV1 2O8EB 4HUQA 1EXMA 1CR4A 2VP2A 4CEHB 1DEKA 4HAVA 1OV4A 3EZ9A 4B48A 1OLOA 1NMXA 5B30A 5C46F 2OAP1 1FTNA 4M9ZA 4TL6A 5GJVC 4IOJA 2G83A 4FWIB 4NE2A 2C8VA 5GJWC 3EWAA 1NN1A 4WOPA 2NO7A 1I4TD 1ZM2A 3DEFA 5H68A 3SQXA 1HQCA 4WVFA 2PEYA 3LXXA 3NHAA 3Q5DA 4Q03A 2ZJOA 3CRRA 4LHXA 2WSSA 4BRUA 4B2IA 2OFXA 1XCMA 1ZVQA 4FCVA 1KO5A 1R2QA 1SQ5A 1U94A 2FSGA 2RAPA 1W5TA 1II0A 1S8FA 1FQJA 4BZXA 2Z6VA 2YOHA 3FMPB 5JMTA 5BN5A 5CJ2A 4AURA 3W3AA 5AJVB 5LB4A 1FZQA 1E96A 5E3HA 4YMTA 2X2EA 4QBHA 1U99A 2H92A 5IK2A 4A0FA 3R8CA 3THXA 1S9DA 2CLDX 3RSLA 4DSTA 1GUAA 4AD8A 1T8UA 4L4UA 4OJKA 2HEIA 4P0TA 1SKYE 1VTKA 3LBHA 3T61A 4DCTA 3GJ0A 1T9HA 4FMDB 5HKKA 3KJHA 4OQXA 2R62A 5G3YA 5GADl 1GM5A 2YC2C 4L9SA 4QHSA 3AKEA 4JVLA 3ND8A 3M6AA 1TADA 3A1WA 2VA8A 2RHDA 4RCYA 4LOAA 1R0ZA 4D25A 4MYCA 4I1UA 4AYTA 3LH5A 3EZ6A 3U3RA 3FE2A 1WP9A 3BH7A 4U5XA 4LJ6A 4US1R 1KSHA 3K70B 4PAQA 4DIEA 2VPPA 1X37A 2ZYWX 4A6PA 1A5TA 4HLDA 2RGXA 4XVUA 1I2DA 2YWGA 2R44A 4JLKA 3X1ZA 5C4MA 4C3ZA 2IUSA 1NY5A 2QNRA 3DZ8A 3LRPA 2IYRA 5B58C 1P6XA 3HPQA 4LX0A 1MABA 2BBSA 2CJWA 2UZIR 1AGRA 2RB4A 1KSGA 5GVSA 2RGEA 2XTNA 3F0TA 3KXIA 2QAGC 2ZSEA 4RKEA 5CK4A 2CXXA 3D6TB 4B47A 3EXAA 3WNBA 4C0QC 3QIAA 1IXSB 4D81A 1S4QA 2VHCA 3FFBA 1VG8A 4LV6A 3FKSA 1WBBA 1ZRHA 3I61A 2DWZB 4KLNA 4PPQA 5L3QB 4IXMA 2EFHB 1AS0A 3ZS9A 1YKSA 4M0LA 1SGWA 2NTYC 3EPLA 3BFXA 3B85A 5FL7D 4HUTA 5EZ6B 2JEOA 4FINA 1XCGB 4HI0E 2FA9A 3VNVA 2VH5R 2JJ8A 4UJ3A 4NZYA 4M1OA 1FW6A 3LLMA 2JATA 1W47A 2ZITA 4RZ3A 1GAJA 3TR5A 1W0KA 2CVHA 5AUNB 2GEVA 1DO2A 2WM9B 2W83A 1GRNA 3PXGA 2H7VA 1E3MA 2CHGA 1XTKA 2IYTA 2BCJQ 2QPOA 2WKQA 5JS7A 4UXIA 1TL7C 2V9PA 1G21E 1E2DA 1NKSA 1ZNYA 2FX3A 1XNJA 2QA5A 4G5RA 4J0QA 5G3ZA 1F5NA 1L4YA 3L82B 1AZSC 3B1XA 2ZR7A 5JJKA 4JLAA 3NIBA 1XD2B 3PUZA 5B64A 5KYKA 3R8FA 1ZMXA 3HR8A 3VR5A 3U4QB 3C16C 4M1WA 1KO4A 3MSXA 4L16A 2DFKB 1HT1E 2JGNA 1AIPA 2GK6A 1E79A 1Q3TA 4V0OA 4JLBA 4A8JA 3ADDA 4LBVA 4TT3A 4LV5B 1HT2E 2ZJ8A 2OT3B 1Z22A 3PUXA 2IW3A 3RHFA 3UPUA 4PSKA 3RWMB 1H8ED 5DISB 1E4VA 3QKSA 2ZSDA 2A30A 3QVVA 3MWJA 1OKKD 4BFWA 3T5GA 2V1UA 2GWHA 3NEYA 4EPYA 4F38A 2C95A 2DYKA 2IK8A 2ZRAA 2FPMA 5JI3E 2X8AA 1T6NA 5EXXA 4N3NA 1OB5A 4C7OB 1YZKA 3MMPA 2D06A 2K5UA 3B60A 3QBTA 3DPUA 1AZTA 1E0JA 2IXEA 4TLBA 4BFXA 2R6GA 1JALA 1LV7A 1LNZA 1A4RA 3SC3A 3K0FA 4GPTA 1W2HA 5DI3A 4UNQA 4MKHA 2JLSA 3BFKA 2RH5A 5HTKA 4AYXA 3DMNA 2EFDB 4LDJA 3QSYA 3ZD6A 4H9GA 3S1AA 1EFUA 3PIRA 1YU9A 4WW0A 1GWNA 3W34A 5JBQA 5LPNA 3MWKA 4XTCS 3SZRA 1MH1A 2GJ8A 4D6PA 1DBSA 2H8KA 2VEDA 2QMUA 4DDVA 4D2IA 5C1BA 2YJTD 3CBQA 5CK5A 2VHQA 2XXAA 4Q4AB 3BH0A 4YXWA 5FOVA 1OJLA 1T3LA 2HYIC 1Q21A 2VHJA 3AVPA 4ZKEA 1C1YA 1RJ9B 2VHTA 1N6KA 3FVQA 1K8RA 1KNXA 2JJ2A 3JVVA 4I1OA 4Q9IA 4I81A 1CIPA 3BFVA 3B9PA 3PFIA 2ATXA 5IDVA 4CZ2A 4PSAA 1F60A 4E5UA 4P31A 1N5IA 2PZGA 2GJ9A 1G4AE 1F2TA 2F43A 4H1VA 2IYWA 1JQJC 2Q21A 1N6HA 1PJRA 3LBIA 1CJUC 3IHLA 4TMWA 1N0UA 2KBEA 1SXJA 1DG1G 3K53A 3UATA 1W2GA 1X8JA 3A4LA 3LVQE 5JS8A 4GI7A 3IKJA 3SJAA 1VG9B 4TYQA 3GMTA 2QBYB 1NBMD 3AGQA 4FCTA 4Z8XA 2CL6X 1W49A 3EC2A 4LJ8A 2W58A 3MJRA 4LC0A 2FFAA 1E1QD 4MYTA 3U7FB 1DAIA 4X8HA 1US8B 5DGXA 4EKDA 2ZRJA 5E7IA 1UKEA 3CF2A 4B3CA 1VG0B 1N6IA 4V0ME 1E2IA 3ETLA 4DDUA 1ZNXA 1YVDA 1OFIA 2Z0MA 2EFGA 4DDTA 1M7BA 1GRRA 3AKCA 4MGZR 2PX3A 1D6JA 4Q1DA 2HT6A 5LD2C 4AY2A 3VKWA 4QC2A 4YLGA 3CIOA 3SJZA 4W5HA 1R5NA 1W46A 4YMUA 3M0EA 2AFIE 2C5LA 4PC2A 4PHHA 2XSZA 2PZFA 4GRAA 4TTQA 3DL0A 4XWAA 5CLLA 4CDGA 2ZYVX 1S2MA 2C78A 1OXVA 3PEYA 4D4JA 2NMVA 3THWB 2IWHA 4MRRA 3HWSA 3RYTC 1W36C 1RE0A 1NVUQ 3OE7A 4HEJA 2W2TA 1XJQA 1YHNA 1OXUA 3OIUA 4P4UA 4TZ6A 3R20A 5FI1B 1KI7A 3SU8A 4A8JC 1TUEA 2QAGB 1FMLA 4LBZA 4FWTA 3EPKA 1PLKA 1T5IA 2LCFA 4HSEA 4U7DA 1NNEA 1YR7A 1JR6A 1N5KA 1ZM4A 4V0KA 1H8HA 5KDDA 5JEDA 4JT4A 2NG1A 3L8ZA 1JQLB 2IS1A 2D3WA 2IHYA 1GOTA 2YC4C 4KYIB 3VMFA 1E9SA 3RANA 3B7GA 2D7CA 3MLEA 4M8NE 3EA0A 2BIFA 2CCJA 1A2KC 4W5JA 1E94E 2ZROA 4IFEA 2F7SA 2OBLA 4WZ6A 4GP7A 2HXSA 1OXTA 2A78A 4Q1AA 3C5CA 5FBLB 2IUUA 1OH7A 1WBDA 4KLZA 2FU5C 3P27A 3ONWA 5JWHA 4QKQA 2XZPA 3KB2A 1XZPA 4FIDA 1U9IA 3U6BA 1XJ0A 2KBFA 1B23P 3GJ5A 1GKYA 1JAIA 3EZ7A 1T8TA 4EPRA 3OESA 3F8TA 2A5YB 3WHLA 4DSOA 5FFMA 3G0HA 4Y0VA 3BIFA 4L5BA 1G17A 4MH0R 221PA 3O8BA 3W5JA 4BFZA 4G5OA 1HA3A 2ZRFA 3SN6A 1DAHA 1N0VC 1VIYA 2GEDA 2WSMA 3GLFB 4HB2A 4MKFA 4NYIR 2C04A 3KFVA 1EGAA 1Z47A 4LYFA 4QG7A 3DM5A 3I8XA 3GLIB 4PXAA 4C0KA 4KCGA 4OBEA 2V8OA 1J8MF 5FH9A 4FMBB 4HUQB 4B73A 3R9WA 4IEIA 3C7KA 3K70D 1ZM7A 121PA 4BLTA 2REOA 2H18A 1XZQA 1AKEA 2Q3HA 2CLCX 1NLZA 1N6NA 4D0GA 2V54A 1UBCA 4NYMR 5JHHB 3OIVA 1AS2A 2BC9A 1K5GA 1FNMA 1UADA 1IXZA 4LI0A 4KBGA 4LRSA 2FMXA 1HV8A 4K81B 3AGPA 4JBYA 3TGPA 1G5RA 1ZW6A 1ELOA 2KSQA 1XF9A 3U7HB 2E9SA 2ZE5A 5BW8A 3AP2A 2QP3A 2JDIA 3ZVMA 2C98A 3PV0A 1FNNA 2FSIA 3LA6A 4TQAA 3EIHA 3EASA 1JR3D 5DO9A 4E09A 3THXB 1FOEB 3AVXA 3WBKA 1DELA 2MMGA 1E9BA 1YJ5A 3NH9A 4PZYA 5JWRA 4ZCMA 1XTSA 2GKSA 3IO3A 4IVRA 3N5CA 1TU4A 1U90A 2HF9A 3R9XA 4JL5A 5E4FA 3K09A 2ZE6A 4NKRA 1KO8A 1U8AA 2QRZA 4XSGA 5CDFE 3TRFA 1NVMA 1NLYA 4C0HA 3PEWA 5EP2A 3QEOA 3TAHA 3VR6A 4DB2A 3KUCA 4M4SA 1KDRA 2VIIA 5HCIA 1R10A 4G3XA 2QMOA 1BS1A 2BM0A 4ZIRA 1FFHA 5P21A 2C99A 1BH2A 1KYIA 1XEWX 2HJVA 4BGDA 1GP2A 2ZRPA 2YKGA 2AKYA 3SNHA 3TUZC 4AWXA 1GG2A 1XDBA 3I73A 1R8QA 3E1SA 1P3JA 1Z06A 4LCBA 4IVPA 4LJAA 1YZLA 2WJYA 1IN6A 3ZZ0A 5FBVB 1OIWA 1ZYUA 3GJ4A 2CJWB 3D3QA 1QVRA 1EFHA 1R0WA 4YC7A 2WWGA 3THOA 2AL7A 2VHUA 4AK9A 2ORVA 2W2VA 3MAAC 3ZZTA 4YMVA 2QT1A 4KBFA 2ODWA 4NHOA 2HLDA 1RVDA 1WF3A 2GF0A 5DYGA 1VYUA 2W0SA 4HAYA 621PA 1ETUA 3KUDA 3WNDA 4QBFA 3CR8A 1P61B 3CZQA 3OEEA 1IXRC 4V0MA 4UNRA 2A2ZA 3REFA 4OK3A 1G19A 3OAAD 4B3FX 3FDIA 3ICEA 4R98A 3EAQA 3Q7QA 4NYJQ 4RZXA 1IBRA 1OF1A 4DSNA 4FN5A 3SFVA 3ZVNA 4CEJA 2J87A 3QY0A 2F1IA 5EE5B 2ZS7A 1GL6A 5DN6D 5AK0A 5FUWA 1AM4D 1PLLA 1PUIA 2I1QA 5SZJA 1U9IC 5LD2B 4LWZA 4M1KA 1R8SA 3PUVA 2DBYA 4JLPA 2DZOB 2JIZD 3P20A 4G01B 2CK3A 2O8CA 1E9CA 1Z0DA 1E98A 1L4UA 4XVRA 721PA 1ZNWA 2GDJA 5FL3A 3EX7C 1S9HA 5BWMA 1W4AA 1Z5ZA 1P60A 3ZDQA 2GAAA 2YV5A 4FW9A 3OEHA 5FOWA 2G0NA 1W36B 2VP0A 4OK6A 3H84A 3CNNA 1ZD1A 2NO9A 4O0MA 5CIWA 4A8JB 1TU3A 3TKLA 5K8IA 2ZJ2A 4Q9JA 5BYJA 4JMPA 5JZVA 4FD2A 2XJ9A 1KMHA 4ACBA 3O47A 1YQTA 2OG2A 3VTKA 4AYWA 3U61B 2BBOA 4JLMA 3QKSB 1G7CA 3PQCA 4UXJA 3RAPR 4N0DA 1ZCAA 3EW9A 4ZDKA 4OL0A 5LDDC 3OF5A 1PZNA 1NKTA 3U3JA 4RD4A 3AKYA 3AB3A 2ZRHA 4Z8YA 4QL3A 3NDPA 1JXOA 2G77B 2HCBA 2IYLD 3CRQA 4PO9A 4Q48A 3T1TA 1XPRA 2PT5A 3IILA 4MRSA 1DADA 2O0JA 3C5HA 1FP6A 5F98A 3RLFA 4A36A 4A2WA 3K0FB 4LJ7A 1FPMA 1M7GA 4OI4A 1Z07A 5ELXA 4B6EA 5DI3B 2J45A 3T06B 4XWOA 2I3BA 3LO5A 1AKYA 2G6BA 5CJPA 3TQCA 1ZD8A 3WMGA 3S1AB 2QE7A 4QJ5A 3PVSA 4PPGA 2VF7A 1M74A 1LFDB 1Z6YA 4EQ6B 4PFSA 4TYWA 1Q1QA 3SYLA 4B2LA 3VR4A 2N1BA 4IEEA 2XXAB 2OFOA 1UEJA 3CF6R 2YWFA 1L7VC 2ZI4A 2GBLA 5B57C 1AQUA 4A1FA 1ESNA 4BLRA 4PO1A 4UQOA 1G64A 2OCYC 1W0JA 2CMKA 4NDZA 5DE3A 4F4IA 4HB0A 4FWHA 1T0HB 1HY3A 4ACAA 3VHLB 1G18A 1JPJA 4ITRC 2WV9A 3FWYA 2NPFA 4KVGA 4M21A 4WBSA 3KQLA 4ESHA 1F2TB 2A3RA 2F43B 3A6PC 5KSPA 2D74A 4C0JA 3IUYA 3TSOA 5KSYA 1KI9A 3NG1A 1XMJA 2FJUA 3BGWA 4GMXA 5E7MA 4ARZA 4QNRA 4EPWA 4EFLA 1KI2A 1NRJB 3GEIA 2RKOA 4R2HA 1G5PA 4QOSA 2DB3A 5F9HA 4DBLC 2CCKA 2ZIAA 1WA5A 2FWRA 4OQMA 5JHGB 2PZEA 5E95A 5K8TA 2CL0X 4US2R 3PUYA 1GITA 4G5QA 2W6JD 3RRNA 1NBME 4IFBA 1NJGA 1ANKA 1X3SA 3QI2A 3GLHE 4LJYA 3T1QA 1II8B 4OHWA 4HDCA 3NBZC 1QBKC 1SKYB 2J0UB 1N6OA 4QGFA 5FUYA 3GJ3A 4QJ3A 2ZREA 2QAJA 1Z6XA 2F1HA 3NC1C 4FCWA 2OCPA 3FOZA 1SZPA 1XTIA 2BOVA 3U7EB 4DLWA 1TQ4A 5C2JB 5FTJA 1ZIOA 5CDFA 2RGCA 4W7SA 3GEEA 4HAWA 1VMAA 1NF3A 4C9BA 1P2UA 4DWJA 4S35A 1SXJE 4TMTA 1NN3A 5M04A 2R2AA 1T5LA 3HJNA 1N0WA 4TTPA 4OHZA 1OHHD 1RRGA 3CRMA 4NL4H 3U3KA 1TQDA 3W6OA 4Q7JB 5FBWB 1P7CA 2VSOA 5F2EA 4E22A 2QP4A 521PA 3KQKA 1NLFA 3NHBA 1GZSA 1NVVR 1KJZA 3U60B 3LWNA 1XTQA 2D7DA 3KXLA 1E2PA 4YDHB 3MWLA 3CR7A 3QF4A 2IYSA 3H0KA 4HATA 2MSEB 4JSTA 5FR2A 4IW3B 1RIFA 2XJ4A 3C15C 1QHNA 2DFTA 1KAGA 2QU8A 1E2KA 4OQNA 4MRPA 2ZQ5A 2YWHA 3TR0A 3O8CA 4XH9B 4B71A 2HF8A 1IY0A 4LBYA 3U5ZB 4U00A 4B3DA 3UG6A 1UBGA 2XNDD 2ZUCA 4BE7B 3FTQA 2QORA 2ZSBA 2MMCA 2YVUA 4P33A 1D2EA 4XVQA 3ZZUA 3RRYA 2C9YA 1KI6A 1UDWA 5FL7A 2O8BA 1E9DA 3MHVC 4K8OA 1QVAA 1OFTA 2V6IA 5HCNA 5AWFC 5BXQC 2NO0A 2WTUA 1P2SA 3FPAA 4RVCA 1G20E 1TUIA 1VYTA 2XNSA 3B1ZA 4G5SA 2ZRLA 1KY2A 2R6DA 3RS2A 1GL7A 4MITA 5AJYA 5KDLA 4X8OA 1EFRD 1E1RD 2WJIA 2YINC 3MRSA 5HKKD 3UANA 3KL4A 3TJZA 3I5YA 3ZVLA 2FGJA 1IN8A 2BVNA 4TYPA 4A6XA 2JLXA 1KAOA 3LVRE 1YR6A 2IXGA 1QF9A 3NWJA 3AF0A 4PHFA 4LJ5A 1CULC 2OBMA 2HXYA 2WWYA 4V02A 2GBLC 2ZEJA 2PJRA 2C77A 3ND9A 1GKUB 1COWD 2J59A 5JLJA 1E9AA 2ZRKA 2F9LA 1X6VA 2IYQA 4O2LA 2XZOA 4PC1A 1YRAA 4Q1EA 3NH6A 3K0CA 2HT1A 1H8EA 2J9RA 3IIKA 2WKPA 3FGNA 2PLRA 3W3ZB 4ZI2A 3CF0A 1OKKA 1HQYE 1FMJA 1ODFA 3A37A 1TF5A 2ZJ5A 1X86B 4KAXA 4PHTA 2YWEA 1RYFA 3WRXC 3X1YA 1W4RA 3X2SA 1BO6A 3ZIAD 1N6LA 2W0MA 3MJHA 5HZKA 2WAXA 3TMKA 3WRYC 1XCPA 3UMFA 2DVWB 2QPTA 4D82A 2ORIA 1RRFA 4B44A 4TLEA 3KJGA 3I62A 1TQ6A 5CB6A 4GZMA 4HYYA 2ZI5A 4F93B 1TQ2A 1DPFA 3QPVA 3QG1A 2QROA 3LQRA 2OESA 2ATVA 4LHYA 2QGZA 1Q12A 4ZI3A 1R6BX 4FMCF 5EXPA 4B35A 1P4SA 1QZXA 3A1TA 2ZUDA 3K0EA 1XTRA 2WWHA 1L8QA 1LVGA 1JR3E 1W44A 3CONA 4Z1MD 1XMSA 4LK2A 3VNUA 4IOKA 4KU4A 3QPUA 3A1SA 4Q5IA 4YMSA 1KO1A 4R7ZA 3MD0A 3RRMA 1NG1A 2CLSA 3E2IA 3QKTA 1KDPA 2QGNA 3CO5A 1U0HC 2VO1A 2NIPA 1CP2A 3A58B 4LGMA 1Z6GA 2QM8A 2BHRA 3ZD7A 1LY1A 3QE0A 2Q9BA 2O0KA 4BWYA 4Q4HA 2XX3A 1VCMA 3AP1A 4QXAA 3R9IA 1GNQA 3Q8XB 2PBRA 3PITA 4AIIA 4AKIA 1TAGA 3BS4A 5JRJA 5CM9C 1O3YA 2E87A 4ZIRB 3AV0B 4NH0A 4PQFA 4DUGA 1Y63A 4JVNA 5JCPA 3SHWA 5KNDA 3SYKA 1YZGA 1Z6AA 5GVRA 1MKYA 1X1SA 2CDNA 3P1JA 4URXR 5KNCA 1ESMA 1QZMA 4PO8A 1UFQA 3C14C 4EFMA 5FTKA 3LW7A 2OV2A 4BLPA 4KHZA 4F91B 4URWR 1G41A 4CT4B 3RC8A 4TT3D 1U0LA 2BDTA 2NGRA 2KJQA 4CGZA 3LQQA 4B76A 3CX6A 3LNCA 3H4MA 5G40A 1DS6A 1Q3HA 4JIMA 1NBMA 4ASUD 1T0JB 1Z0FA 4D4LA 4QHTA 4GDFA 4TZ0A 2IF2A 4IDHA 3I32A 4DT1A 1SHKA 3GLHA 3KJIA 3T5DA 3U6KA 5CITA 3QKRA 4M1MA 3P32A 2XEXA 1GNRA 1XEWY 2R6CA 2IWRA 2PCLA 4HZUA 3CPHA 2R65A 4UNPA 3I8SA 1H65A 3THYA 1HEIA 3SI7A 1ZM9A 4LC1A 4DLZA 1KKMA 5SZIA 1UKZA 4CEJB 1Q1EA 4JLJA 1Z0IA 2IA5A 3IGFA 4KFTA 5EP3A 1GFIA 1E9FA 4NCNA 1UAAA 3D8BA 2Q3FA 4JBXA 2XAUA 2FPLA 4LZZA 2C96A 4IXNA 4GOKA 2DFNA 2SHKA 2EWWA 3HYRA 5DNYB 2O8CB 5LB2A 2GVDC 1WE2A 4R71A 1W7AA 2ZRCA 1VG1A 4BEJA 4EAQA 3W90A 1FP7A 1NG9A 3TNFA 2FNAA 2BJVA 3BERA 2IYUA 1YZUA 2GAOA 4IOLA 3W6PA 1BOFA 5J5CA 3VU9A 4CEHA 1CBUA 2JJ2D 3B6EA 1M1YE 2KE5A 4TMZA 5D3QA 2QUZA 2PEZA 1KHTA 2ECKA 4MRNA 5A4JA 4RCZA 2B8TA 4DXAA 2ZRNA 1J90A 4FI3C 2EYUA 4GT1A 1RYHA 2BWJA 1KMHB 2QSYA 4IDPA 1MO4A 3LXRA 3K0CC 4B33A 4LJ9A 2ZYUX 5KSZA 4QBGB 2IYYA 1KMQA 2B92A 3ADCA 2DY1A 2GEUA 4GBMA 4PZZA 4XD7D 1E0KA 2QP9X 1P9NA 4HAUA 4TSFD 1P62B 4PQRA 4ZDJA 4YQFA 1TF7A 1IOZA 2G3YA 4GOXA 2HV8A 2ZSAA 2GF9A 1OIVA 3IEVA 5AJWA 5KPDA 3QJYA 2OCBA 2RCNA 3BC1A 3CH4B 1G3QA 1SHZA 1W4CA 2BV3A 2G1JA 1KTVA 3LBNA 5D3MB 4B34A 2EFEB 2BMJA 2IYVA 3FHTA 1NP6A 1ZUHA 5C18A 2O0HA 3BORA 2AX4A 2ZU6A 3VAAA 2AWNA 2DWPA 1Y3AA 1CJMA 3NKVA 5K8LA 1VHTA 1G8YA 1PVOA 2IBMA 2NPIA 1YZQA 4KJZA 1GVNB 2H16A 2V1XA 2IUTA 2FG5A 4ON9A 1QHSA 1Z63A 2CL7X 1EG7A 4KFRA 3IQXA 3LD9A 1BMFD 4Q1FA 1BYIA 1CJTC 1MO6A 3QNUA 4JJZA 4JSYA 4K46A 4QGHA 3SJBA 4ZV4A 5BQ5A 1E2EA 2EW1A 3HU2A 4LYHA 2RMKA 3E5HA 3AF3A 3TUIC 2FOLA 1X8LA 4KI0A 2D4HA 4LPKA 1OT3A 1G6OA 1EFCA 2JAQA 1UKYA 1E69A 3ZQJA 4RD3A 2KB0A 4MDEA 2ZSFA 2P65A 1KNQA 3CX7A 2WKRA 2NZJA 3AF2A 1QHHA 2GJSA 3EWSA 1HURA 1DE0A 1N6PA 1V5WA 3B13B 4PTLA 2W00A 2Z83A 3CWQA 3VQTA 3ZLJA 2GCOA 1CRQA 5EE9A 5H8WA 2TMKA 2BBTA 2QG6A 1XU4A 4B6FA 3WYGA 2F6RA 4GMDA 2IC5A 4CYMA 4UXHA 1RW4A 3K9LA 1YR9A 2WOOA 3A1VA 3DOEA 2ONKA 4TYYA 1I4DD 3T15A 1DO0A 4D26A 3KQUA 2C2HA 3HP1A 2FFHA 4JVMA 1SVIA 2VF8A 4ZO4A 2P5SA 3TLXA 1N6RA 4BECA 2AK3A 5L3QA 5BN3A 4CVNA 1YRBA 2R9VA 2YYZA 4BFYA 4BLQA 5KNBA 2GJKA 3QBVA 3N2EA 5HZHA 1JR3A 2F9MA 1Z2CA 3LW8A 3TVDA 4LHZA 3WHKA 2WWXA 2JJ1D 3HU3A 3PCRB 3B1YA 4L8GA 2ZRDA 2OLKA 1VCOA 5L3RA 2OXCA 3EIQA 3SOPA 3D31A 2YNMA 4LBWA 4NYJR 3SBDA 4DLVA 1QG4A 1SXJC 1EESA 4EPVA 2BMDA 4W9MC 3ECCA 4WZAE 2W6ID 2DWOA 1CR1A 1T4GA 3PEVA 3B9QA 4Q1CA 5LBIA 1G8GA 2I1VB 3CLVA 4BFTA 3ICQB 4PQYA 2FV8A 1BYUA 1HUQA 4H1UA 1MRSA 3Q7PA 4TMVA 2GK7A 3N2IA 4DCNA 5FPKA 1M7HA 3KKOA 5L3SA 2V7QD 3SR0A 3EC1A 3W9YA 4OQLA 1HE1C 2GHIA 3CB4A 5FPTA 4M53A 3ZVRA 2BCGY 1C9KA 3SE0A 1IY1A 1D5CA 3QF4B 4NBSA 2GETA 3DOFA 3QXSA 5DYIA 4EDHA 2J7PD 4MGYR 1N5JA 2D2EA 4OHYA 2O52A 4I1VA 3KTAA 2ZM5A 2AHOA 5KPJA 5EE1A 4DZZA 1S3GA 1D9ZA 1KI8A 5CYPA 3VR3A 3SHFA 4E03A 1RKBA 1DAFA 1DAMA 1G7RA 1XEFA 5JECA 2WWFA 2ZE8A 1NVXQ 2ZI7A 5DIFA 4MKGA 3BRWD 5HPYB 2PJZA 1XRJA 3E70C 3LX5A 1KI6B 2O8BB 4HB3A 3G82C 4QBIA 3NBYC 2PLFA 3GFPA 5FI0B 1XJCA 1E2FA 5KOYA 5UKDA 3BJIC 4Q4LA 2VP5A 2VRWA 1LB1B 1MABB 4A0RA 1NIJA 1E6CA 2A5JA 2DWQA 4JBWA 5DN6A 3NVAA 2WOJA 5FOXA 3TVTA 1S1MA 2ANBA 2MSDB 4ILEA 2G9NA 2WHXA 4Y0AA 2O8FA 2X2FA 3W6NA 4LPSA 1D9XA 1FQKA 4CIDA 2N46A 1RRPA 3K1JA 2AXPA 1WB9A 2O5VA 1XWIA 2WMNB 2JIZA 3UXMA 4PPNA 3AEZA 2GCPA 2X77A 2DR3A 4HAZA 1E2JA 4N0EA 1KK0A 1XX6A 5L3VA 3LAWA 3OFND 2NOAA 2OM2A 1AN0A 2VP4A 4EJSA 3CRW1 3SBEA 3UWOA 1JBKA 1P9WA 3PENA 3IQWA 3KXKA 4AKEA 4D0NA 4TYNA 4FMDF 1NN5A 4LRWA 1UEIA 5FPYA 2Q9CA 4CEIA 1GRQA 3RRZA 2YHSA 2D62A 4DLRA 3BXZA 5TMPA 1RPZA 3K70C 2EYQA 1X1RA 4BLOA 1XPUA 2JLRA 4MGKR 4TL7A 3TQFA 1E9RA 4C4PA 5FTNA 1ZU4A 2IYXA 2BMFA 3DKPA 1KZ7B 4M9QA 4NYMQ 3B1WA 3WBJA 4B43A 5A5GA 4DB4A 3W5IA 3AUYA 1MT0A 2WJJA 3SEAA 1NMYA 2EVWX 2ZJBA 3EZ2A 1CXZA 2RGBA 2PMDA 2ODBA 2W2XA 4ZDIA 3H2YA 2XOKD 2ONJA 2X19A 4ZPXA 2GESA 5DI9A 2FEOA 4RKFA 1QHGA 3MGCA 3RS7A 2FFQA 4PR0A 4TQ9A 1VCNA 1JJ7A 1Z3IX 2ZAMA 4II7A 3NDBB 3VKGA 2JLYA 3F5FA 4GL2A 1OE0A 4KO8A 2ZE7A 5EUQB 3L0PA 4C30A 2AR7A 5CIQA 3OEED 2IL1A 4O3MA 2NQ2C 3ADKA 4ERNA 3AVUA 2ZJZA 3ADBA 1SVWA 2ZI3A 3I5XA 4B3BA 2ZRBA 4JL6A 1AJEA 1MV5A 4D4KA 2RHMA 1MOZA 1PLJA 5FTLA 1JI0A 1OPXA 2VL7A 2QM7A 3QPWA 2PL3A 4X8LA 3VR1A 4CRWB 1CF4A 1K6MA 3OIWA 3KQHA 2Q6TA 4Q4HB 1R7RA 1F48A 5TV2A 4DKXA 3X1DA 3AVYA 1ZINA 3KJEA 3U3MA 4F4CA 5EQTA 3CW2A 3NBXX 3THWA 3GJ6A 4EIWA 1GNPA 2CNWD 3GFOA 4O25A 4C0BA 1WXQA 4FWGA 4RJLA 4IDNA 4Q02A 3WMFA 3JZMA 2B21A 2Z5FA 3GJXC 4ZKDA 2F55A 5EXTA 1ZBDA 4NONA 5DH9A 2I4IA 4RZ2A 4Q7LA 3IBGA 3G5UA 3K09C 5FPHA 3QXHA 4Q9KA 3WMEA 2OE2A 4DJTA 5JEEA 4A92A 3GCGA 4WA7A 5FOSA 4B32A 4IJMA 4AG6A 5J4HA 4XIGS 3M1IA 1KGDA 2F1RA 5AUQA 5GJBA 3NC0C 2W6JA 3HPRA 2CHVA 2QSZA 1GKIA 2QQEA 2QTVB 2ZJYA 1M2OB 2ASEA 5JWOA 4DT1B 3GLHB 1SVLA 4LSGA 3FHOA 4YDSA 3QKRB 1F3OA 4RFSA 5TB5A 3EIEA 1FL9A 4QGAA 1EWQA 2ZVPX 3KKMA 2HJGA 4HZUB 2IHBA 5DLQC 3L8YA 3UK6A 1G3UA 4PC3A 1OYWA 5EP4A 3THYB 3V4FA 1SVKA 4XWKA 5KU1A 1S3SA 4Q9HA 2O8DA 2WZQA 3L0IB 2WWIA 5FUXA 2P3SA 1NN0A 4F7WA 4JT2A 1SXJB 2WWWA 3UKDA 3Q3JB 1UPTA 1D2NA 2QPAA 2QEQA 4AI6A 2F1JA 5AR1A 2R8RA 5IT5A 1ZCBA 5HR5A 4RD2A 2REBA 1OHHA 4WZBE 3BB3A 4P4SA 3MCAA 1T3HA 2DCUA 2GCNA 4A0GA 5AJXA 1XP8A 3IPXA 1OXSC 4QGGA 2BJWA 4BRWA 4JJKA 4DRZA 5G41A 4D0LB 2G0TA 3IO5A 2XB4A 4PAOA 1WQ1R 1AK2A 4YONB 2GRJA 4Q19A 4EJSC 5F9FA 1DAEA 1G8HA 4WAUA 4PHGA 3CWZA 4LJ4A 3NTUA 2PT7A 1NJFA 2KWIA 1JXMA 1N5LA 2BM1A 2P67A 3ZQ6A 3QEJA 3DDCA 3QG5A 4WIAA 3AP3A 3VU9B 4IHQA 1IQPA 1W0JD 2PX0A 4HDQB 2WPDD 3AVTA 1SVMA 2JLWA 2J0VA 2E1RA 2OZEA 5JFGA 4OI1A 5HE9A 5KSOA 3TK1A 1Q1BA 4DLYA 3AM1A 2XNDA 3LX8A 1Q22A 1R0XA 3MUFA 4DLUA 4GITA 1U8YA 1XD9A 4M9XA 2XTZA 3AH8A 4S2EA 4UNNA 5IF9A 1KO7A 2ZRIA 2Q3MA 1VKJA 1JB1A 3DKVA 4KSCA 3T12A 1XBTA 3GLGE 1KIMA 1XXHE 1OH8A 2XITA 3U44A 1YZNA 3FFAA 2VYFA 1CRPA 4JL8A 2J41A 3O8DA 4OQFA 4B75A 1P2TA 3TH5A 1IONA 4KVAA 5J4YA 1G4UR 1S96A 5FOUA 1NMZA 1TX4B 3V9PA 2QQ0A 1CS4C 1SVSA 1UKVY 4QJ4A 4RD6A 4A15A 3K0AA 4JKIA 4M1TA 3B2EA 1LF5A 1S1CA 4IVQA 1EFRA 1E1RA 1J2JA 4IDOA 4QFMA 4JN6A 2H1LA 2B6HA 4Q4JA 1FX0A 2X1VA 3KKNA 1KK1A 3F3YA 2P0EA 2ZVQX 3KW6A 2WSSD 5SZKB 3KQNA 2V6ZM 4XSHA 1IJEA 4G1UC 4C0LA 1Q0UA 2GA8A 5L8VA 3AVQA 3UG7A 2OLJA 4D4MA 2OBNA 5JJIA 4B3GA 4PX9A 4X8MA 2J3EA 1COWA 2AFHE 2F3RA 5EUMA 4KITB 1KI1A 3QOFA 2EFCB 3ASYA 1RRCA 1VDZA 5IK2D 1R4AA 2ZUBA 3TUJC 3PEUA 1LS6A 1J8YF 3V4RA 3W8RA 4ESVA 4DCVA 5AUOB 1ZC3A 1E32A 3K0SA 5TARA 4DEXA 1OIXA 1QHHB 2BEKA 2ZR0A 4LHVA 4PSVA 2ZPTX 1N2CE 4OYHA 2A7QA 3HDTA 3ZIAA 3I3SR 3U7GA 2GCOB 2QMHA 1K5DA 4TLAA 1D2MA 4AKGA 3T35A 5TXGA 1KDTA 4DLXA 4DVGA 3FMIA 3MFYA 3A4MA 3EG5A 1CJKC 4RSGA 2IYZA 4TTRA 4O2RA 4CT5A 2FF7A 1OH5A 3MG9A 4C2UA 3FMFA 2Z43A 1XEXA 4MQBA 1ZUIA 4OI2A 2B7BA 4BZPA 3P4YA 3GEHA 4BQSA 1BKDR 2H57A 1L2TA 1KJYA 1KJWA 1T3SA 4TLCA 4OK5A 3V00A 4Z1MA 3GFTA 5JSZA 3PJRA 3VFDA 3AVWA 4Q9LA 2DPXA 1U81A 1AGPA 1E4YA 1W1WA 4TQUS 3SYNA 4GNKA 4URZR 1EWRA 5FBQB 2LWIA 5J40A 2FDCA 2ZTSA 4TMXA 4DEYA 2WAYA 1IN4A 3FKSD 4L9WA 3TIFA 3BAFA 1G6HA 1R5BA 4HLCA 2QTFA 1T91A 4NCHA 6Q21A 5IRCD 2OSBA 1CEEA 2GXSA 4FWDA 2Z4SA 1NVVQ 2A5DA 4TL9A 2R6AA 5TDHA 2CBZA 5L3SB 3ZH9B 4A0HA 1P5ZB 1C1KA 2IT1A 2L0XA 2J1LA 1F2UA 1G16A 1ZM3A 1GIAA 3WNCA 5AUPB 4OHXA 3CPJB 3Q85A 1Z2AA 2WIBA 2DZNB 3U2QA 1W0KD 2CHQA 1S0UA 2IXFA 2LKCA 4URVR 4QNMA 3SDZA 1DG3A 4F4JA 2BMEA 4NU0A 4LV8B 4LYJA 1FTSA 3KTAB 4GFDA 2R6FA 3RS4A 4ASUA 4F92B 3AVVA 3AVOA 1MO3A 1G5TA 3K9HA 3EPJA 5EE3A 4MYUA 3PG5A 4EFNA 1Z83A 1ZUNB 1W36D 1D8TA 2QT0A 4PC6A 4HLUA 4QM6A 1TPZA 1Z28A 4JVSB 4CF7A 4MUAA 1JJVA 1OXXK 4RZUA 4W5WA 1KI4A 1G3RA 1E79D 1ZAKA 3VHXA 3D7MA 1HH4A 2GZAA 2IEYA 3CZPA 3A36A 3ZJYA 3K9GA 4P3YA 3BD9A 3TAUA 3W8NA 4JYCA 2ZETA 1QHXA 2IS2A 2O8FB 4MA4A 1ONBA 2IS6A 3KKQA 2OCAA 2WVJA 3R7WA 3VX3A 2ZS8A 1OB2A 1G3IA 3I92A 3N70A 3DZDA 4ZCIA 1E1QA 4EQ6A 3BWDD 5DHAA 2J0SA 2FH5B 3C4JA 4IOMA 4JZKA 3DVLA 5H70A 2ODNA 1E0SA 4WXPA 4GOJA 1W5SA 4C0AC 4DLTA 2JLVA 4EJSB 2XTMA 2EWVA 3GPLA 2C03A 8OHMA 3A1UA 4KFUA 2Y8EA 4BFSA 5DSZA 4CEIB 2XZLA 5FUVA 4PANA 3OIYA 3KFXA 4WXRA 1Z0JA 4DUGD 2KI5A 4Q7MB 3EPHA 3LV8A 3REGA 1IHUA 4QRHA 5FOTA 4AC9A 1AQYA 3AF4A 4XD7A 4L15A 3A4NA 4TSFA 4DHEA 3UIEA 2BEJA 2OHFA 4G0NA 2GILA 3B78A 1ZC4A 3B5JA 1EFTA 3FHCB 4YXWD 3IBYA 4MYHA 2FSFA 3VX4A 4NCJA 3GLGA 4V0LA 1KDOA 1XXHA 3QXJA 4ZCLA 2REXB 2O8EA 1TEXA 2FGKA 3OZXA 3QQ5A 3FYHA 2HCJB 3LDAA 2UZ3A 3RWOA 3ZYCA 1JPNA 2IF0A 5KUTA 2IS4A 1B0UA 4A3VB 2QI9C 4DC9A 2IX3A 1XPOA 3BH6A 3QXXA 1EX7A 3RS0A 1II8A 5IHPA 2EU8A 1NSFA 2C9CA 1HYQA 2ANCA 4IKEA 2J0UA 5J4LA 1E2NA 3CH5A 4BFUA 2GZHA 3IIMA 821PA 2HUPA 4DDWA 1A82A 3DHWC 4A82A 2OAQ1 1NI3A 1HE8B 2YOFA 1E2HA 3GJ8A 1BMFA 3CX8A 4RY2A 1SXJD 4JLVA 4GSYA 3VR2A 1PV4A 1ZNZA 1TNDA 3VLFB 2VBCA 3Q72A 4I99A 4B2PA 3OHMA 4NMMA 1CJVC 1ZP6A 2A5GA 2V4ZA 1KK2A 5SZHB 3PR1A 3IEUA 2AN9A 1OW3B 1KY3A 3CKLA 1JEDA 3GQBA 3M4YA 1DARA 1ZIPA 2OILA 3QVUA 4UNSA 4KYUA 4A2PA 4B3XA 1J7KA 1HTWA 1MO5A 4IRUB 4Q00A 1O87A 2OEPA 2F3TA 4HZIA 1A7JA 1LS1A 1YE8A 3NEJA 4KFSA 5BN4A 5K8UA 1NSTA 2D2FA 4PC7A 2OO7A 1OYYA 2B8WA 1E2QA 1Q44A 2P6NA 1Q57A 3P4XA 3DO6A 2XSZD 3A8TA 3QXCA 4ABYA 5GJCA 4EUNA 2WBLC 1Z0AA 4TN1A 3K9NA 4BASA 2JASA 5CM8B 5KDOA 2Q9AA 4FXPA 5G53C 2NO6A 3QKUA 1TTTA 3WY9A 4RFSB 1UM8A 3RDPA 1R0YA 2JCSA 2JJ1A 4HLUC 4NCIA 4GZLA 3OE7D 3Q5EA 1LW7A 3P26A 1G3MA 3TW8B 4BUJA 1Z6TA 3RVBA 2OFWA 3BB1A 1TEVA 2CCGA 2GNOA 4ARZB 2O8DB 5H1YA 4FMCB 2AWOA 2ODEA 1RC8A 1DAGA 2W6IA 3RS5A 2JLUA 2P6UA 4US0R 4C0SA 3CNLA 5AJZA 1H8HD 1KOFA 5FR1A 1CKEA 3QF7A 3TW4A 3SQWA 3WYFA 1CR0A 1KKLA 3FMOB 4P4SB 4C2TA 4MDFA 2J5XA 3BBPA 2ERXA 4MUBA 3CM0A 2VP9A 2VTKA 2V7QA 4BFVA 2AK2A 2VLIA 2YZ2A 4M2LA 2QMEA 2OUKA 2UVQA 3KZ1E 4BPBA 1N3BA 1TMKA 4NCKA 4PAMA 1EX6A 3JZAA 3PUWA 5EJEA 4MRVA 2FSHA 4JLNA 3RSOA 2FZ4A 3AQ4A 5ANRB 1JEEA 1GSIA 2J7PA 1QHYA 4Q1BA 4URUR 4A4DA 1YZTA 2WICA 1AS3A 3L43A 2P6RA 1XMVA 1RFLA 2XGJA 2FZLA 2CVFA 1VECA 2QN6A 2OXRA 3IPYA 4M1SA 5EE0A 4HLQB 4ZDWA 1A1VA 1Q1ZA 3WXMA 2JLQA 3TE6A 1BIFA 1CU1A 1I4LD 2FEMA 3GD7A 2Z4RA 4N1AA 2RGNA 3IIJA 2VP6A 3LLUA 1XD2A 3GLFE 2P2LA 1IN7A 1Z29A 1P75A 3U4QA 1V43A 1E9EA 3MWYW 1J99A 5KTYA 3C8UA 4AKHA 2ZANA 2ZYTX 3CUEF 3K8YA 3GLIE 5JJLA 1DTSA 2FFBA 2P5TB 2GZDA 5DHFA 4EPTA 1MRNA 1UBEA 3RC3A 2ZI6A 4TWZA 4JKYA 3U44B 1OH6A 3VKHA 3AJIB 4LHWA 2WMOB 2N42A 2GXUA 3CPEA 1E2LA 1II9A 4LRTA 1G8FA 5TVKA 5BYKA 2ZI9A 1U0JA 4JS0A 5JI2E 1OFHA 2H17A 3L0SA 4JLDA 3X1WA 4R9UC 3C41J 2UKDA 1NL3A 5CB8A 3K0AB 3T1VA 1U2RA 2A5FA 5F3WB 4LY6A 2V3CC 1P73A 1Q20A 3H1TA 4R2IA 4Q4JB 2JA1A 4UJ5A 1FX0B 4M1YA 2FPKA 1UF9A 4C7OA 3O8RA 3OAAA 1QG2A 2IEZA 3ZS8A 3CRVA 3FKQA 3OFNA 5HE8A 4KODA 1KK3A 1YR8A 4I1SA 2JLZA 2BKEA 4RFVA 4Q7KA 1UJ2A 1ZD9A 2ZU0C 4RD1A 2JDID 4TL8A 3B82A 3UMSA 4BLSA 1J70A 2CEAA 4NP6A 1JNYA 1LTQA 1IM2A 1GTVA 2RGDA 1PUJA 2GJAA 1WMSA 3B1VA 2QTHA 2YOGA 3BE4A 1W4BA 1KSJA 3ZGXA 2HDNB 1N25A 2DFLA 2G88A 2EQBA 1VHLA 1E0AA 4NYIQ 4D80A 2GVZC 2CE7A 4Q4AA 3AUXA 5J47A 2KRKA 1E2GA 1XFAA 2WJVA 2ZRMA 4AG5A 1VIAA 2GTPA 2VSXA 1AA9A 4LYAA 4Q21A 4XOIA 3CNOA 4BZQA 4QM7A 2CE2X 2XOKA 2ZRGA 1RJ9A 3T34A 1FUUA 3HR7A 5FTMA 3L2OB 4JYBA 2AKAB 1Z0KA 3WP1B 4DIDA 4JLOA 2AD1A 5CYOA 1XMIA 1XEXB 3RABA 3SS8A 3KKPA 2Q0HA 4OI0A 1MR3F 1DOAA 1VYVA 1W48A 3LFUA 2G1KA 4Q47A 4DCUA 1G8PA 3H86A 5B2ZA 3TSWA 1Z8FA 4EPXA 1XTJA 2NO1A 1P9RA 5J4KA 4NPHA 421PA 5J4VA 4U02A 5KHOC 5JSZB 4P4TA 1G9XA 1JECA 1OFUX 4PPFA 2QZ4A 3EZFA 4E07A 1F6BA 4V03A 2V6JA 3SJCA 2QBYA 2ZAOA 1U8ZA 3DM9B 5FPSA 1NVWQ 1IJFA 4IDQA 1KSFX 1DAKA 2HLDD 4MGIR 3UWKA 1VPLA 1VCIA 2GXQA 1G1MA 1US8A 5JRZA 1G291 2WJGA 2QENA 2CNWA 2ZS9A 3QENA 3L0OA 2RGAA 3WYAA 1M6NA 4KXFB 5JCZA 4OJQA 2H5EA 2MSCB 4YMWA 1G7TA 1M8PA 4XTRA 1F2UB 3EARA 3TBKA 2QY9A 1WDTA 2ZJAA 3GJ7A 4HB4A 4DSUA 2ZXUA 4GP6A 3KX2A 1E2MA 3I72A 2LKDA 4XJXA 1KZGB 4Q01A 3AF1A 4M22A 4Z51A 4A9AA 4HDOB 2CK3D 2DHRA 1XB2A 4I4LA 4HAXA 1GDDA 5E7JA 3NBFA 2RGNC 3RNLA 3J81k 4URYR 1UBFA 2AXNA 1CTQA 2BKUA 2WJHA 5A0FA 2J0QA 1OSNA 1Z08A 2ERYA 1ZU5A 3DMDA 4RD0A 3OEHD 3EA5A 3HU1A 2FN4A 4V0NA 2QRNA 5D3MA 2ZR9A 4MKIA 4TLDA 2QAGA 2WIAA 1IAQA 3ASZA 5EZ5A 4KSBA 2HYDA 4POAA 3LY5A 4NTZA 2GXAA 2QL6A 4CW7A
chains in the Genus database with same CATH superfamily
4PONA 4FGKA 1GA6A 1LDNA 3I01A 4QA9A 4DUPA 5T4EA 2Z30A 3LSTA 4P36A 4X9XA 4PS0A 3NTLA 3SXUA 5EL0A 1UMDA 1ISMA 2H2IA 3I9FA 3WAKA 1A5AB 3DAGA 3LQ4A 1XALA 2QVLA 2P11A 1X80A 1HC7A 2M6LA 5E38A 2BBWA 2PMKA 2C9OA 1DV1A 4YJ2A 1DDOA 4OSPA 1YB6A 4KRXA 3QRWA 2C8VA 5GJWC 3S5JA 3C2QA 4IBOA 4Q03A 1JAZA 4FCVA 1H6UA 4BCDA 1W5TA 3BMOA 3NBKA 4YJFA 4XD2A 4LDZA 5LA6B 3GQBB 1C9EA 3VDUA 1QTRA 2ZG6A 4EZIA 2CZCA 2WWVD 1A4XA 4L5JA 5JXGA 3N5KA 4M46A 4I1PA 2HNBA 3KOWA 2X6RA 4LWPA 1GNTA 3AESA 4RLFA 4NMLA 1QUSA 4IDCA 3LT0A 5F9MA 1JIIA 4US1R 3DOAA 4YRCA 2VPPA 3ZW7A 2YWGA 4QQFA 5B58C 5ES4B 4BXOB 4EKNB 3AFNA 2VHXA 4C7JA 4I0WB 3ZWYA 4C0QC 3DFFA 4EDFA 1EFKA 4U9HS 1SCAA 3ZS9A 3S29A 3BFXA 2YCLA 1RI1A 4FCCA 1XCGB 2VH5R 4NZYA 4PBSA 2JATA 2XQIA 1A9RA 2CVHA 4N01A 4GUDA 1YJQA 2EKBA 1LWNA 2WA2A 4J0QA 5D85A 2JS7A 2FEKA 4CV1A 1SOMA 4EG4A 3KLOA 3K4QA 1ZN9A 1ZPDA 4YV7A 1KYXA 1PT7A 1RM3A 2WU0A 3L0DA 4TWRA 3N3AC 2NVUA 2YXEA 3IAS6 1YHZA 2ZRAA 2B78A 3CSUA 5F7JA 2PX8A 2WIDA 4TLBA 3IP5A 2PX2A 5CNMA 4D98A 1ZOLA 4GO1A 4H9GA 1T9ZA 5LPNA 1YU9A 3NRCA 1EXDA 4FBMA 4D41A 4J3NA 1GN9A 3B1JA 4UTPA 4ZQCB 3QBDA 4B87A 4PG7A 1M2JA 3WIUA 4YV0A 3F4KA 1GQ2A 3E4CA 1RQLA 5F52A 4IBDA 1XRSB 3ZVKA 1Z6QA 1L7OA 1KU6A 3IKJA 3NHPA 1Y7TA 2V4UA 3VR5H 1HKHA 4BVKA 1T2VA 3I6QA 2ZRJA 1DRKA 3I45A 1VG0B 4GM4A 3PQ7A 5DBFA 3DBIA 3ETLA 5EQDA 1LJUA 4DDUA 3LUKA 5JYDA 1Y6GA 1NC3A 3CLTC 1D6JA 4WKBA 5IBCA 1GLNA 3C3WA 4YMUA 3JR7A 2ZYVX 3LNTA 1OXVA 4GX5A 3THWB 1ZGGA 2I1LA 1ZX1A 2C2WA 1V6CA 2VDLB 3L6DA 2F5SA 2YWRA 1PS9A 3IAXA 2MYPA 5ICMA 3C39A 2QD5A 3KJZA 3B7GA 3EGDB 2IDKA 3L6CA 4IG4A 2A78A 1V4NA 4BP1A 4WN9B 3R4CA 3ZDBA 2P4SA 4PGHA 1FYWA 4HH3C 4C87A 5KOJB 3AMVA 1DO8A 2O7QA 2ZRFA 3DVAB 3SN6A 4DYHA 5ITSA 1U2SA 4DV4M 3EGEA 4CMHA 5DBOA 4B73A 4UMFA 5CVDA 3K70D 4COKA 4MB0A 1XZQA 2XRYA 1J07A 2Q2EB 1WBJB 3URMA 2H48A 3D2AA 1TKCA 4C6RA 3F7TA 4A91A 3BSYA 3OE5A 3C0KA 2V59A 1SD1A 1UADA 3UHJA 3TD6A 4KBGA 4YWHA 2QU7A 4MO2A 3BWBA 4Y2UA 3UAWA 1YSCA 2FUNB 1YSYA 4TQAA 5SY4A 2Z2JA 4E09A 3A1FA 3PKZA 3AVXA 4DYDA 3NH9A 1XTSA 4LMRA 2ZE6A 1FW8A 3REQA 3ZCUA 4LF7M 2AMFA 2DAKA 2G1PA 1VE6A 2FUCA 3L4BA 4G3XA 3D6JA 1UT8A 4U1RA 5P21A 3GXOA 1YB5A 2ZRPA 1GG2A 3MF4A 1Z06A 1ZMTA 1DT3A 1PNTA 3D3QA 5CRIA 1EFHA 3BE8A 5K0EA 3MAAC 4BIMA 3LHDA 4BJ1A 3RKRA 2CUZA 1TYAE 1ETUA 2LIPA 4WL0A 1IXRC 4DV4B 2BELA 4B5KA 2H9YA 3OUTA 3HYNA 1KYTA 5G4KA 4CEJA 4ZEWA 1PL0A 5SZJA 1F4LA 3RK0A 1AKUA 1FRQA 3C48A 4JD5A 2OBBA 3KYDA 1ZNWA 3H3JA 1Z5ZA 1MORA 4UMEA 4Q0MA 3RO7A 2UUAM 4J0EA 4GU5A 3H84A 3T6KA 8GPBA 3FPBA 3PC6A 4AW9A 4JMPA 1SU6A 3HGTA 3WLEA 1M34B 1ODSA 3GG9A 4R4JA 4B2YA 2QQ5A 1PUXA 1BW9B 1RKXA 4BO4A 3AKYA 1SD2A 4EYOA 3L9XA 4LF7B 4B81A 1MC8A 4RELA 4FK8A 4KP7A 2CDCA 1LBIA 3BFJA 3K0FB 3GU3A 1ONNA 4HTFB 4ZEVA 5CJPA 1X7WB 3FVVA 3Q3CA 1Y3CE 3STTA 1L7VC 2ZI4A 2I33A 2CD7A 4AJ2A 1XTTA 3NVKI 1W0JA 3CN9A 4F4IA 1C0EA 2BWEA 2X9NA 3VUEA 4FWHA 3C85A 3DDNA 1G18A 4ITRC 5ESWA 1NUAA 3C9PA 1F2TB 4OH7A 2AFVA 2FJUA 1QRTA 1T6BY 3WWYA 1R0RE 5JH7B 3FPCA 1WDMA 5FSWA 1JJBA 4OHWA 1MC1A 2H7XA 2UUAB 3D1JA 2QX9A 1SZPA 3R7AA 2QZ9A 2VDWA 1FP2A 4F12A 4X54A 3T4UA 1JA0A 1PR3A 1YGPA 1UWKA 3C98A 5B6PA 4JP8A 2Q3CA 1GU0A 1GLGA 3IDOA 4BB0A 3OTOM 1L5QA 3FDXA 3LWNA 1SCIA 4YDHB 1EK5A 4E13A 2FI1A 5J2TA 2VTVA 2V3VA 2I3GA 2P6MA 5FL7A 1Y6ZA 5CLGA 4K8OA 4MW2A 2OQ4A 1Q84A 3EEQA 5F64A 2BZ0A 1FDRA 3HXOA 2ES4A 1VYTA 3WISA 3L6OO 3D0OA 3CUWA 4H0FA 2WJIA 4R16A 1B73A 3L1KA 1SIUA 4HMOA 3OICA 5JE8A 1JX6A 2BZ1A 3RYIB 1E9AA 2F9LA 3MK6A 3HLYA 5B1HA 1E8MA 2XZOA 1YRAA 4KO1S 1T3TA 2H4XA 4OJTA 3A9UA 1RYFA 4FR2A 3FPJA 5LU8A 3UMFA 1TCBA 1QP0A 2QXUA 4QOIA 4JA2A 3OTOB 3D6FA 1QZXA 4LC9A 1XTRA 3G1WA 4Q5IA 3C6XA 5B55A 2C4UA 3QKTA 3JU3A 3SMSA 1CP2A 4MGEA 3UAXA 4BWYA 1YJBA 2E55A 1WSBA 1VP9A 3IP1A 3M4JA 1YQWA 3RC9A 4CKBA 2B3DA 5KU7A 2QTLA 2O14A 1R00A 2O1SA 4EFMA 3PHIA 4MTLA 4FZ3A 4X7MA 4ETWA 1V95A 3D3JA 4GDFA 2JD0A 3CGWA 3KJIA 3U6KA 1RWQA 1Y37A 2R6CA 3Q2IA 2NU8A 1MJHA 2CW5A 1BA3A 1VKNA 1MGPA 4ZTBA 5AKXA 1Z2NX 5IG2A 3P97A 2MDTA 2F4NA 2BL4A 1KJ9A 3P9NA 1PL7A 4WKCA 4R71A 4NCBA 1CDEA 1FYVA 1N0IA 1PNRA 5I5GA 1J2UA 2VDOB 2QLJA 4CQJA 2E21A 4YPOA 3U6PA 5L4SA 2BWJA 1NBIA 4WKOA 2B92A 3ADCA 4HH0A 4G5HA 3N74A 4L5IA 3FWZA 3REOA 1ZV1A 2VDBB 4FI3F 4UM9D 2GF9A 5COAA 1KOLA 5EPOA 2HCRA 3BC1A 2ZYSA 1SHZA 3AI3A 5F3RA 4CCWA 5C18A 4PZDA 4Y2RA 1G8YA 1SHJA 1FMCA 1P8JA 1SO8A 2NAFA 3TLBA 3ZBUA 5IAGA 3G0OA 1EG7A 2HSGA 5LXTF 2HHLA 2BFFB 3I4YA 3LDHA 2ODAA 3L1HA 2FOLA 1PEDA 1V48A 4CM4B 3HBNA 2AOTA 3OWHA 4AX8A 4J1TA 5CYGA 3GHYA 1RW4A 4JNCA 3A1VA 2X9QA 5LFAA 4D26A 3OMWA 4DC0A 1MEEA 4MQLA 1UQRA 3TVDA 2UXDM 2CXQA 1PZXA 4WTOA 4AQ7A 1YDFA 3VO2A 3GOQA 2Y9MB 2VCYA 2C4WA 2PUVA 3HB7A 3PFWO 1N7IA 4LSZA 3Q7PA 1PRYA 5FPKA 4Y9DA 4HN4B 2IP2A 2DAMA 1EP9A 1BHQ1 2D2EA 4OHYA 1X74A 1L1TA 5COBA 1GO2A 1J9EA 4RF5A 3SZLA 3VR3A 4JXKA 4F6RB 5AVKA 1XRJA 3LX5A 4JXJA 1QRDA 3GFPA 5C8YF 2GKGA 5FWYB 1E6CA 2A5JA 2WINI 2MSDB 1U2ZA 4LVOA 1V11B 3UWMA 4CIDA 4D3FA 5JS2A 3JSAA 1FNCA 2EZ9A 2X7XA 4D3DA 2VUHB 4ZOQI 2H1CA 3SBEA 1M9NA 1P9WA 1WG8A 2PY6A 4LA4A 4CEIA 1GRQA 4DLRA 2VNIA 1RPZA 4MGKR 2UXDB 4HNVA 2CKDA 2WSEF 2WMDA 2AW3A 2ZJBA 4UCXA 4J1TC 1A5SB 5ERXA 5DI9A 2AZTA 4RKFA 4FOLA 3LX4A 2BFBA 1RADA 4BQIA 1L5SA 5JCJD 4XR9A 3L0PA 1V34A 3ADKA 3AZPA 2P1ZA 3H5LA 5G0SA 4LTNA 4K05A 4OUKX 4ZP1A 4JUFA 4RIIA 3DC7A 2B2NA 1Z45A 1BX0A 4EIWA 2WNHA 2WZJA 3GFOA 3VKUA 3GVIA 1EHYA 3BTSA 3JZMA 5EXTA 2YZMA 2X4IA 1X1AA 4B82A 3TBFA 5DM0A 1FSFA 5EMKA 1U5BB 1NW6A 1P31A 1H6BA 1F3OA 2NUAA 5GPBA 3KKMA 2EF1A 1FFGA 3QLVA 1QH9A 4JT2A 2B99A 1MEJA 1FFEA 3IJ5A 3QSGA 5AJXA 5CR9A 3LA8A 3FFTA 3TZHA 3II6X 4B45A 1PD1A 3QEMB 1GD1O 1KC1A 4HDQB 3K94A 2OZEA 3NS7A 5JFGA 3AJRA 3QLJA 4GITA 4KAFA 3AH8A 4K0KM 1DIOB 1CIVA 1PR5A 2CLMB 2C0QA 4O1IA 5DM4A 4WCVA 4GW3A 3L1IA 2NZWA 3LY8A 2GPTA 4B85A 1IONA 4QVKA 4RD6A 2QE6A 3HKEB 3TO5A 2GEKA 4IVQA 1EI9A 4G8CA 4BNYA 2V6ZM 1W6RA 4C0LA 4P16A 3EDMA 3GDOA 5JJIA 1NLUA 3QOFA 3ZDYB 2WM8A 2A1UA 1E32A 3U4MA 5FKJA 4I4TF 3TFOA 3MFYA 2AMJA 4RPIA 1OH5A 4C2UA 2RG7A 4KX3A 4GYWA 1KJYA 2P9GA 5FWNA 2IIVA 2YICA 1QNLA 3DTVB 3RYCB 3WQHA 4RTSA 1QQTA 4I6EA 4CCAA 3VFDA 5JZOA 3EJ6A 4DQKA 4EJFA 1D1QA 4IYRA 3QLVC 3NVMB 1AV7A 3TEJA 3WLHA 3FKSD 5LMNM 2IYEA 3S3TA 2CEKA 4TL9A 4K0KB 5HIAA 3AUUA 3RIYA 2JGKA 1DG3A 4D45A 1GZVA 2H2WA 3IPCA 1M67A 1L5MA 3IKLA 2E3JA 4LIPD 1E79D 2G06A 2B4AA 1GGVA 2V6MA 5KYXB 3KHTA 2WVJA 4F1JA 2A7XA 3GEGA 1E1QA 2Z7JA 4EYGA 1Z26A 3MINB 3SQMA 3NAQA 4UQPA 3GMSA 5I7AA 4KFUA 2PFKA 4ZAZA 3HU5A 3KQPA 4H4EA 2L82A 1K6JA 5REQB 3AF4A 4YPFA 2VQFM 2BEJA 2OHFA 4BMOB 1T3ZA 3CJRA 3R7LA 4ZCPA 4G0VA 4YLYA 1WOMA 5IWAM 5LMNB 3EMKA 5DX8A 5LYJF 3MQFA 2HUPA 2I4TA 3NT4A 3PGJA 1FFBA 1YRHA 4L2IA 2YOFA 4P22A 1V7QA 4J76A 4LQLA 4I99A 1SHUX 4HDNB 4CQMB 1ZD5A 1OW3B 3PQ8A 3K0HA 3EZYA 1VRVA 3QVUA 4A2PA 3RJ9A 4KR3A 4BB5A 1SHLA 4MV6A 1CYEA 4S04A 1A7UA 4HZIA 4YP6A 2J7OA 5KVSA 4EGQA 4GE3A 1NATA 4IR7A 1XO1A 4MX8A 1UAYA 1X7DA 2JASA 3WGIA 1DQSA 4NNJA 3WGVA 4S24A 1MPTA 1L7DA 2I6XA 2AF4C 3OA0A 4AMVA 1IXSA 4BL5A 4C5BA 4GL4A 3HXKA 3D8SA 3VYUB 2PWBA 3WLTA 4GBJA 1Q3KA 2VQFB 2DG2A 4MQMA 3CM0A 5BSTA 3IXQA 2AK2A 4ZVMA 2O8NA 2C0CA 1CF2O 5EJEA 4MRVA 2FSHA 5IWAB 4Q1BA 5TLSA 4TV9A 3N59A 1YDWA 2Q8NA 5ITZA 2NYVA 1VECA 1A1VA 3GA5A 5JCOA 5L7YA 1I4LD 1J09A 1KP3A 1EAMA 2D2VA 2XV1A 3U7IA 3JYOA 4LHWA 2G25A 4DG8A 2OVFA 4CTMA 1MA3A 1A3CA 4R9UC 3G85A 3GP1A 5JPIA 4NSOB 2P7HA 5F3WB 2ZATA 3H1TA 1FX0B 3GDWA 5DRYA 3RBZA 1QG2A 1MG0A 2GN6A 3VH2A 2JDID 1PUJA 1PT8A 3K2EA 4EB6A 4D80A 2E4WA 3ECAA 2XKAA 2QPLA 1RJ9A 3B6KA 3L2OB 1C9JA 3FLEA 3KOWE 2VJOA 4M0DA 1NASA 4DJAA 2AI3A 4LECA 1P9RA 2FPOA 3STUA 1WVGA 2F3UA 1CY2A 4XCQA 2XGNA 1WUYA 3DM9B 2P7IA 3ZIUA 4LDNA 1MX0A 4ZT7A 2V6FA 2LD4A 5JRZA 4MJXA 1TJ5A 1VM6A 3SZ3A 4DSUA 1CFZA 3AV3A 2XEDA 5JYCA 3DZGA 2WNSA 3ZI7A 2LKDA 5KJ6A 1ZIYA 1XMOM 2JBWA 2WT9A 3LCCA 3A6EA 3J81k 2AXNA 2BKUA 1J8FA 2ZB7A 3ISVA 4R9NA 2HPAA 3PWSA 3TMAA 1A9XA 5AVOA 4RVDA 4CW7A 3WP0A 4DLSA 5TY0A 1L4FA 1CPYA 1T5OA 1UZMA 3IDQA 5LUAA 3R7WB 5EIAA 4JQZA 4BJ6A 3X1XA 4L74A 4EGCB 1SD5A 2CUKA 2XPCA 2FE4A 2J46A 4OMDA 3UZUA 2IDMA 1JDBC 2V7PA 1FUKA 4M9SA 4UNIA 3OOEA 1H2RS 1H3EA 1WCV1 1GCOA 4DMKA 4CEHB 1DEKA 3SLRA 3EZ9A 1FTNA 3DONA 2G83A 3KKZA 5F1KA 4UAVA 3EWAA 4BDSA 1CUAA 1KO5A 1MAUA 1QGZA 4C04A 2RIRA 3MVEA 4YP9A 3P2KA 1XMOB 3B7PA 4A0FA 4I1IA 4R51A 4OJKA 4KOEC 2LV8A 5CFPA 1LUAA 1T9HA 5E9WA 1PQPA 1N7JA 2Z5VA 5GADl 3C3BA 2Y1GA 2O23A 2BEVB 2O07A 4D25A 1T2EA 3VZPA 2Q5QA 3FE2A 5EJ5A 1F4PA 3VRHA 2X2OA 1J23A 3H9QA 1OCEA 4FT4A 4FNMA 2RGXA 1U9ZA 2WWRA 4C3ZA 2Z6AA 2UZIR 3F0TA 5H82A 1ORRA 4M89A 5EGNA 3WNBA 1BFUA 1IPEA 1BVSA 3RS8A 1PJ2A 5C35A 2EFHB 3FR8A 1SGWA 2NTYC 1WHTB 2E18A 4HUTA 2FA9A 3G0DA 3M7IA 1ZONA 2J9XB 1GPYA 5JD5A 1EXVA 2BFOA 3D6HA 1GAJA 4UBNA 4OXRA 3DUWA 3WGYA 2WMYA 4CJ6A 1PJJA 3W9BA 2ZJ4A 2WKQA 2JLCA 2XMRA 4WLNA 1WUTA 3KB6A 4H60A 4C0WA 3R8FA 1ZMXA 4C7VA 1JTEA 3RT9A 5IEJA 2C0PA 3UOWA 3UPUA 2X4GA 3QKSA 4KW7A 2ZSDA 4YJHA 2XCIA 5A3SA 4Q3LA 2V1UA 2XD9A 4UPDA 5A9TA 2X41A 2D06A 4PCAA 3F47A 5ELMA 1G98A 3C4VA 3FWKA 1UT6A 3W8EA 5EJ9A 2FTKE 1GWNA 2WILA 2H8KA 2Z1NA 2QMUA 1IUPA 3V76A 1C0IA 4ZQBA 1YV9A 3CKMA 5TMBA 5B1EA 1UJ5A 3C8DA 3PJGA 4WMLA 3AIOA 3ZTTA 4WNCA 1NUTA 1F60A 4YJ3B 2C7RA 1C7IA 4AQYM 3KPVA 4XYLA 3EXFB 3PQ2A 1PGNA 3SJAA 4ER5A 2QBYB 3AGQA 4EHIA 2OYCA 1GNLA 5EXEA 3UJBA 4DCCA 4LC0A 1DAIA 4X8HA 1UFKA 5DMXA 3O2NA 1M5TA 1QWOA 2V5UA 1K75A 2FN9A 4RQBA 4KUHA 1UXGA 4YLGA 2Q62A 3F6CA 4ND3A 2RGWA 2IHZA 5IC5A 1MC5A 4KQCA 3QOYA 3IT3A 2QIOA 2DWUA 3USCS 5BWLA 3T5CA 4GI5A 2A6PA 4KYIB 5AHOA 5DZSA 2QMZA 5TQVA 3ZDXB 1VL6A 4C5CA 2FZGA 3KT6A 5FBLB 3D0RA 4C3VA 1BWQA 2VYND 3I83A 4AQYB 1G21A 4WXEA 4BQPA 1N0VC 3GLFB 1IWBB 1EGAA 1D4ZA 4DDKA 1USGA 2V5AA 4KCGA 1QV6A 3DCYA 4BLTA 4TWIA 3ONFA 4HNSA 3E7DA 2F3QA 4DJ5X 4GYJA 4KR9A 1U04A 4ATNA 4AROA 2EG9A 4YRZA 2IUYA 1C1XB 2ZE5A 3ILSA 4KPEC 2JGDB 4FMPA 3NB0A 3THXB 3GFGA 2WTXA 1ESEA 2MMGA 1YJ5A 1XZ8A 1HYHA 4E32A 1VL8A 2FEPA 3H2IA 1KO8A 1U3CA 3KOUA 1NLYA 5IJ0A 1YE3A 5K0NA 3VC7A 1O5TA 3AIMA 5JT1A 4E5VA 5IM5A 1VJ5A 4BGDA 1R8QA 2BKVA 4LJAA 4S2UA 1SUCA 4QARA 4YC7A 2W2VA 1T4DA 2HMVA 2VTBB 4ANRA 4QBFA 3L9WA 4UNRA 2A2ZA 4G81A 3RVQA 1OF1A 2CXUA 4DRXB 4DMFA 1KHHA 5LQAA 4M0CA 5BMVF 1T8PA 1S9HA 1E66A 3ELDA 1WJGA 2J9FB 4FFDA 3LCUA 4RM2A 3LBYA 3T4PA 4YRIA 1KMHA 4BV9A 3R3VA 2CMFA 2NU9B 1OGIA 3P2EA 5FQOA 1GTJ1 1YDMA 2QG4A 3NDPA 2VZEA 4EG7A 3QUBA 4PO9A 1XPRA 3EH1A 3U3DA 1M7GA 3LO5A 1NW4A 3PVSA 5CDHA 1Z6YA 1J8DA 1UEJA 4I5IA 5I8ZA 1J6UA 1X94A 4MIOA 1K27A 4HFRA 2J3MA 2ADFA 3QFHA 2CMKA 4YRMA 5DE3A 3ICVA 2ZWVA 4XCXA 2WV9A 3TKAA 4EY6A 2D74A 4C0JA 4EVSA 4ZO6A 4X63A 2CL0X 1O4VA 3HCRA 3ASVA 1G5QA 5DHQA 1M1NA 3H83A 4KZKA 4FVMA 1DT5A 4OP3A 2WFAA 5C2JB 4S1PA 4S35A 1NN3A 2ATCA 3EF0A 2WG2A 1UPCA 2VSOA 4BHTA 5C8DA 1WHCA 3HVRA 4NAUA 1XKXA 1QHNA 2DFTA 1KZYC 4LJKA 3MXTA 3RIMA 4E11A 2ZSBA 1MQSA 3ENKA 3FDZA 4IWNA 1J0DA 1M1ZA 3GMIA 1ST2A 1P2SA 4C2AA 1BU5A 3MRSA 3CBGA 1K4KA 4BYGA 4C4YA 3G9TA 1ZI6A 1O97D 1QF9A 2NVOA 4AZ3A 5IBQA 1COWD 5HJ2A 3LY7A 1A97A 4KSYA 1QIKA 4ZYVA 1FXWA 3JD3A 1WW3A 3HUFA 3QPDA 2GOYA 1D2RA 2GM4A 2ZT5A 5CNJA 2WWHA 1L8QA 4IJ6A 3EPPA 3NUQA 3IE2A 3DOHA 4M98A 4ZI7B 2WG0A 3A1SA 3A6ZA 3ROTA 2EJVA 1QDLB 4RXUA 2H52A 5KAPA 4JGBA 1CS0B 2CSUA 3Q9SA 4DAEA 2GPYA 1EJBA 4XSVA 5ISMA 2JZNA 4CR8A 2C61A 1CRZA 3RV4A 3ZWVA 4AS2A 4IIYA 4P8RA 5I9TA 4CT4B 2OD7A 4EBFA 4OKIA 3LQQA 4PDIA 4V2IA 3RM3A 1RJFA 3IKTA 3N6RA 2E4ZA 2XEXA 4M0UA 1C4XA 4ZO7A 2HTFA 3ESBA 3DEYX 4M9RA 3PDIA 3V34A 2HJHA 1WULS 3ZNQA 3GBSA 3D7LA 1XZDA 1Q3BA 3FNEA 2IPMA 4UOEA 2C5SA 2EBFX 2BJVA 2WYHA 3VU9A 1LFAA 2JJ2D 3B6EA 1GUYA 1RAEA 4MRNA 3KELA 2BISA 1J90A 3UF0A 4ZEOA 4GT1A 1T43A 3TWKA 5HJ5A 4B33A 5ESXA 1NMQA 2LCIA 5KSZA 3PE3A 2GEUA 3BXHA 2GCGA 5HOQA 2G3YA 4GOXA 2QUHA 3L1UA 1ZD3A 1G0OA 1VSVA 1RXEA 3BZUA 5HUJA 1T35A 2IYVA 3KXEC 5FLYA 3ANLA 3IUMA 3QM1A 1GZDA 4MV0A 4MVJP 1T2AA 2I6QA 4CJXA 3P52A 2XDQB 1XDDA 3HN6A 2EW1A 3Q7SA 2R25B 1TRHA 4XKJA 3V3TA 1X8LA 3A1NA 2D4HA 3ZWCA 4QT4A 3K1AB 4B3JA 2NZJA 1AE1A 1V5WA 3AI7A 4GSLA 5KYWA 3H8VA 2BBTA 3VYVA 4B6FA 2POQX 1ENOA 1YR9A 1LA2A 3DOJA 3UTCA 4QUAA 4TXMA 1WZNA 3JYHA 3O7WA 2WI8A 4JJ6A 4Z5XA 5BN3A 1YRBA 2GBGA 1VGVA 1JLHA 5FAXA 1ZO8A 3NM4A 4CKWB 2ACVA 3FI0A 4ZAVA 4LBWA 1QR2A 2BMDA 2WJ3A 1CR1A 1T4GA 3LBFA 1IATA 3DQQA 3A45A 5CPFA 4DCNA 3V1UA 5E8RA 5ESRA 5EOVA 1C9KA 5BNIA 1D5CA 5EHNA 5CTJA 3LIPA 3T1HM 3M5DA 3R7FA 4YCSA 3G9ZA 4RY9A 4BEVA 5CDSA 5JECA 1TQHA 3N6XA 5KYNA 1XJCA 5CU7A 3RQIA 4FC7A 1JEJA 2JHPA 5AM1A 4FP9A 2UV8A 1JIUA 1M5UA 2ANBA 3UXMA 5LA6F 1N1MA 3TOSA 4F2WA 4N0EA 2PX6A 4OJYA 4D0NA 3WZ2A 1I0ZA 2BR4A 5DYNA 3Q11A 5FPYA 3CMMA 3BMCA 2GN1A 4YR9A 3SFTA 5FTNA 3WBJA 5I7FA 2JIPA 1T2UA 1FEZA 4QAQA 2JJYA 1B3RA 3WLIA 4BMNA 2WM3A 3RE1A 5J23A 4KMRA 3H05A 5ALDA 4II7A 4GL2A 3F5FA 1Z5VA 3BZBA 4I08A 2Q5HA 2HA0A 5CIQA 2IL1A 3SVZA 4UHHA 3ROPA 2ZRBA 4DV1M 2BM8A 3T1HB 2ACKA 3CVXA 1A9QA 3QPWA 4YRRA 1CF4A 4PNZA 2APJA 2FHPA 1V37A 3B7QA 1ZINA 4YXFA 3C5EA 2CNWD 3LQFA 4FWGA 4IDNA 2AN4A 1PX0A 2I5PO 4TRJA 1NR5A 2D2IA 5DM2A 3H9GA 2H85A 2F9FA 1ZGHA 3CJQA 3FLAA 5AUQA 3GT4A 3V1LA 2R1TA 2CHVA 1GKIA 3H2SA 2NUTB 5B53A 1K98A 1EWQA 4W6QA 4DYVA 2J5QA 3TTWA 1CY4A 2O8DA 3UCEA 4WZAA 4DNPA 2QEQA 5HR5A 1V16B 2R1VA 4JP5A 4NRWA 2J4FA 3EFBA 3BX1A 4OQPA 8AT1A 1N8NA 1L9XA 3RTBA 3ORQA 4RPGA 4YAOA 4IM7A 1VLLA 4QDJA 2I2CA 3QEJA 3DDCA 3MBIA 1X39A 5LBUA 4DV1B 3LQKA 4S2EA 2NU7B 5IF9A 2FCRA 3UFXB 3ABQB 1UK9A 4ZCTA 5A4FS 4WUTA 2G3QA 1Q7BA 4BNDB 4F9GA 4HDSA 2C5GA 3HYCA 1KP2A 1YA8A 3AVQA 4A8TA 2OBNA 4R8LA 1O0SA 3WWCA 2F3RA 1Z17A 3F49S 2HQ1A 1KYZA 3V7NA 4NRVA 3TUJC 3PEUA 4KK4A 3DO5A 1K88A 5I7OA 2ORED 2QTRA 1T0BA 2CFCA 4P2BA 3G7NA 3U7GA 2C2XA 3D5EA 2X8BA 2VDMB 1ZZEA 4IIJB 2HB6A 4O2RA 3KHUA 4QFBA 1G2PA 5THQA 3GEHA 4C08A 3SMPA 4PYQA 3RTEA 4ZVLA 2WUVA 4LKRA 4F1KA 1TCVA 4F06A 2H1OA 2EC5A 2YJNA 4URZR 2QD1A 2IEDA 1RQRA 2WAYA 4M60A 5LYYA 1F38A 3RQSA 2A5DA 3BF8A 3R3XA 3R41A 3OWXA 5LQMA 2CFTA 4OHMA 4GC5A 2BKLA 1MJ5A 2Z57A 2WIBA 5K45A 2BGGA 3OH8A 4RK5A 4A23A 4QNMA 1H66A 2I2BA 3ITKA 1FTSA 4F92B 1Z35A 3OLWA 4YUAA 2Q5FA 4HLUA 3MWFA 3E21A 3W04A 4RZUA 4W5WA 1ZAKA 4GYKA 5CBPB 1QFZA 3TAUA 3L8DA 3EVZA 3OE1A 1EJ2A 5BW5A 1G3IA 2HWJA 2GT1A 2OG1A 4CDRA 1Z6ZA 4NK5A 2H54A 4IOMA 4EH1A 5F2NA 1EWYA 2DY0A 4M6WB 1LPSA 1JIVA 1H2XA 4NAHA 3G2MA 4QECA 2FMKA 4C5AA 2QUIA 3GRAA 4HF7A 1EFAA 5BYBA 3I4FA 6YASA 3AL0C 4MR7A 1PX2A 2GO7A 3M9XA 5I9MA 4YXWD 2AR0A 4B79A 1KDOA 1U2EA 2CV0A 1JDSA 3ZYCA 1JPNA 4A3VB 4OHOA 2QI9C 2WG1A 3CB2A 3OKPA 4MLDA 5IHPA 3IIMA 821PA 2JIRA 4AJPA 1DBWA 2OPBA 3EIXA 1SXJD 1BDBA 1C4WA 3VR2A 1ZNZA 3Q72A 4M9UA 2C7OA 1WEHA 2AE1A 1NF8A 3L0BA 5FNZA 3MEQA 1ZN2A 1J7KA 1DKNA 3K92A 1DKPA 3NT5A 1SIOA 2IEAA 5G0TA 3ACDA 4KC0A 4EB0A 4BASA 5BQFA 1ABFA 2HIGA 2H7CA 4OHFA 1R0YA 5EZYA 4HLUC 5ECYA 2C4HA 1KAQA 3F2VA 1X7HA 3HFSA 2VK8A 4MVJM 3NTRA 1BTOA 2VTKA 3U6LA 2GBPA 1CQPA 4ZEMA 4NCKA 2R5FA 3CX3A 2DKLA 5F77A 3AQ4A 1GSIA 4I9UA 4KGVA 4PLYA 1V8ZA 2R1ZA 2WB2A 3L43A 1HEUA 3DMFA 3IPYA 1ZAYA 3IA2A 1V7CA 2Z5GA 3L5KA 1OKSA 2FEMA 2Q4RA 4JROA 3SR4A 2AI1A 1XD2A 5TX7A 4B6PA 1ENYA 2XT9A 3ZHUA 3Q88A 2IUEA 3RTCA 3RC3A 5CCEA 3D3EA 3VKHA 1D4OA 1XG5A 2QRLA 1YR1A 3MTQA 2FS1A 5DXJA 5CB8A 3T3IA 5JH7F 2WC1A 1EH5A 4ZVKA 4OXIA 1KZ6A 3OZDA 5HE8A 3FKQA 2WHPB 2VAPA 3DNFA 2X13A 2NVBA 4TL8A 2VRBA 4RPLA 4OJNA 3ROKA 4BLSA 1IHPA 3ZCTA 2X0DA 4AY6A 4HS4A 1YNSA 4IS3A 4R84A 5B5SA 3GLKA 3TCKA 4MVCA 5KQSA 1TOAA 2ECQA 4JYBA 3PC7A 4CG2A 2GCEA 1PDOA 3O1IC 4EF5A 4KDEA 4M7WA 5F73A 3RABA 3SS8A 3EDQA 2G1KA 3NALA 1G8PA 4IO0A 3OC6A 2HBRA 2C07A 5I6DA 3G59A 4TROA 1AO0A 4X6XA 4BVLA 3ZCSA 1G9TA 1QV7A 1DAKA 1VPLA 4D57A 2ZS9A 2NO5A 3ZE6A 1F2UB 4BJHB 3ESAA 1BU8A 4XJXA 5EJ7A 3IMGA 4Z51A 4DDMA 4DPLA 2DHRA 4DLPA 3X1MA 3ADOA 3WTCA 3RNLA 4I6GA 3NHYA 4E70A 5A0FA 2Q5CA 3OOWA 2XT6A 4UDYX 4W82A 5HBRA 5K6AA 4MKIA 1H93A 3DCJA 3IX7A 1RPJA 1YVPA 1E99A 4MO9A 3LTNC 3LGXA 1POWA 2GMWA 1GQFA 4B8WA 3GDGA 1SULA 2IHNA 2C4MA 3IHWA 4B6GA 4TVBA 1P2VA 1GILA 2PCJA 2XGMA 3JZDA 4F8EA 3Q9LA 3I1FA 1NUSA 3IS3A 1DC7A 2HU7A 3KQTA 1IU9A 1J0BA 2XZTA 2ORWA 4OHVA 3A28A 2IPNA 4B31A 1WPRA 2VH1A 4NENB 1QK5A 3PNMA 3D8RA 1QP7A 4J7CA 4E6PA 3WA6A 3LXXA 1LSJA 3CRRA 2DZLA 1SQ5A 3TW0A 2H2FA 3QX7A 1DCMA 4BZXA 3NANA 5CHEA 5AJVB 4FWBA 4A8PA 5JARA 2AFHB 1ODTC 2P62A 2QVYX 5AQ1A 4P58A 2FR1A 2QHXA 3BDVA 1M8GA 2XW6A 2C7VA 3WB1A 5ADHA 4XARA 4IH9A 4QHSA 1CV2A 2P77A 2Y99A 3DZBA 4GICA 3U3RA 4COOA 2GK4A 4U5XA 1B42A 1GU1A 9MHTA 2Y1LA 4Z7NB 2ZYWX 5JAHA 1DV2A 5CEEA 1TDZA 5C4MA 1U7XA 4Z4HA 2MIIA 2PANA 1JTFA 2X3YA 1PVVA 3O0TA 4K9KA 5K6AC 1U1GA 2XTNA 3KXIA 1GTZA 4ENWA 3VC2A 1ZRHA 4LVUA 2DWZB 4XIJA 4E51A 4Z0TA 1IZ0A 1IB0A 1RQPA 2JEOA 1HE3A 2J5YA 1R9MA 2PU7A 3IAAA 5FP0A 1FJXA 3TR5A 3H2HA 5AKGA 3HKDA 1IEWA 1BKSB 1YC2A 1TL7C 1G21E 1NKSA 1UJBA 1XNJA 2EF0A 1JLRA 4UHCA 5JJKA 4PQGA 2WM2A 4DPMA 5EESA 3MSXA 1H0KA 2FK7A 5BORA 1MQ9A 2F67A 3UBTA 3V6MA 4KQFA 1ZSVA 2BEUA 4RF0A 3LMMA 3SD7A 4F38A 4C89A 4RVGA 2H0AA 3C3YA 3FZQA 2OMKA 3CZAA 3J80A 1CJBA 4YO8A 1R88A 1JHQA 4XLZA 2R6GA 1JALA 3DAYA 1BVYF 5KWVA 2AFRA 5DI3A 4MDYA 3W7BA 2VR1A 2HA6A 1XL1A 3S1AA 4LZWA 4RTPA 5DM70 1MH1A 4V1CB 3FDFA 4G9BA 1PV2A 5BV2P 3D4PA 2VHQA 3HO6A 2G67A 3A9RA 3H11A 3DH0A 3AOEA 1K8RA 4PVCA 3PFIA 1NFFA 4YCBA 3OPVA 2Q21A 1EVLA 4DBVO 1FSPA 4MB2A 4ZARA 1EZZA 3D6MA 4OXKA 1XMXA 2I3ZA 2FB9A 1NBMD 4FCTA 1JSRA 2EGGA 2C3OA 1M83A 4LJ8A 3BIWA 2JGRA 4G0UA 1AT1A 1DBPA 4I19A 5AP9A 3CLUD 3ZGNA 4KMOA 4MGZR 2OKGA 5ALWA 1LJ8A 3S2SA 1LRLA 2HT6A 2HWUA 3G6WA 1E3WB 5LQCA 2EW8A 3KQSA 4PHHA 1WUHS 4TTQA 5ITQA 5B3JA 3WQSB 3UT5A 4G25A 1Q15A 1XJQA 1YHNA 4TZ6A 2X0RA 5T3UA 1ZMUA 4G1VA 3TQOA 5JEDA 4U0KA 1DC3A 1S5PA 1JQLB 3HMKA 2L4EA 4QU9A 5JC8A 1KEPA 4U7WA 2CFSA 4RV5A 3TLCA 5HGXA 1OH7A 4UFNA 1SKBA 4QKQA 5FOQA 5JXHA 4N5LA 2FUKA 1K9VF 4BBPA 2CLIB 1TYBE 5FFMA 3EZXA 3H3XA