1OFIA

Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
309
structure length
299
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKDVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure and Reactivity of an Asymmetric Complex between Hslv and I-Domain Deleted Hslu, a Prokaryotic Homolog of the Eukaryotic Proteasome
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 84
structure length 299
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ofiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ofiA01
3CX6A 4OHVA 4BQSA 1DS6A 3EAQA 3ADCA 1QVAA 4H9GA 1NRJB 1P3JA 2P2LA 2ZREA 4CEIA 2XNDA 1DG1G 1ELOA 3QNUA 5BN4A 4LJ7A 2QAGC 3T1OA 3G5UA 1QHXA 5DSZA 1YJ5A 3VX3A 1CEEA 3TQCA 1A2BA 4AKGA 3K53A 3R9IA 5EE3A 3CR7A 2REBA 1T91A 2AKAB 5CK4A 1UKVY 2ZJYA 1E4VA 3MFYA 4JLDA 3ZD6A 2QMEA 4RZ3A 3IEVA 3MD0A 4FCVA 4HB2A 4RKFA 1KDOA 5BYJA 2R2AA 5SZKB 1TUIA 4B33A 2OT3B 4UNPA 3SYNA 3GJ5A 4OI0A 4RFSA 2AK2A 2IEYA 4HLUA 1R2QA 4GSYA 1V43A 4WAUA 2VLIA 1TEXA 1XCGB 3SJCA 3PEYA 1KKMA 2OUKA 4BGDA 3PCRB 2LCFA 1F2UB 3ASYA 2ONKA 3U6KA 3ZS9A 3D8BA 3Q85A 2WZQA 4M8NE 2WMNB 1Z0AA 4JS0A 4NKRA 4HI0E 3MLEA 3HU1A 4MH0R 5BN3A 4DIEA 1GM5A 1TF5A 2F3TA 5AJWA 2G88A 5GVRA 2EFDB 2OLJA 1G19A 2R6DA 2JLVA 5DO9A 4G01B 2FX3A 2ZI7A 3U3KA 5H8WA 1II8A 4MKGA 1TAGA 2VIIA 4V02A 4A0HA 1LF0A 2WJIA 3PFIA 3UG6A 1P9WA 4A2QA 1F48A 4M1MA 5AJYA 3WNDA 2CK3A 3LAWA 3CX7A 2CNWA 3IO5A 5B2ZA 1KSGA 2E1RA 3MGCA 3B5JA 1HUQA 4IOLA 4DLYA 1LNZA 1QDEA 2J0VA 3GJ6A 2OXCA 1E2KA 5J5CA 2CMKA 1T3SA 1Z0KA 2AD1A 2IWHA 4BLQA 4F91B 5KU1A 3CB4A 4WBSA 4Q9JA 1NJFA 1XMIA 1FNMA 4DSNA 1KIMA 1KK0A 3THXB 2PL3A 1KMHA 3K8YA 2NZ8A 2YOGA 3CRMA 3KZ1E 2JJ1D 1UBEA 3OIVA 1OB5A 3P26A 1WDTA 2ERYA 1VCMA 3Q7PA 2F1IA 2H1LA 4C4PA 621PA 1P4SA 1BS1A 3E70C 1KSFX 1MABB 3SDZA 4B73A 3I92A 2R6AA 3AVPA 4M9XA 2XOKA 5JWOA 1Z3IX 3I4LA 3QKSA 3TQFA 4HAWA 5FTJA 4QGGA 3AVOA 1GRQA 3W5IA 5IK2D 1E1QA 3CBQA 4ZI3A 4PX9A 3AVXA 3RC3A 4GZLA 3DKPA 3BJIC 2B21A 3SBEA 4NE2A 2WWGA 3RWMB 1NVMA 2VPPA 5JWHA 2AXNA 3K0CC 4KODA 1KSHA 3DVLA 1U0HC 5E7JA 2ANCA 2IYVA 1XXHB 2KSQA 4D4MA 4DLVA 2C2HA 2V8OA 4Z8YA 4NH0A 5HR5A 2O8EA 2EQBA 3TMKA 5JLJA 4QHYA 1TPZA 3ZS8A 1Z0DA 1E2JA 1P6XA 2GBLC 4V03A 1E6CA 2P6RA 3BS4A 3M6AA 3ADBA 2JLWA 1DAFA 5TARA 4RZ2A 3LDAA 4LY6A 1NLYA 4GMDA 4C7OA 1EFCA 1OYYA 4BECA 1II9A 1EG7A 1KJWA 1XMSA 1CXZA 4P4SB 2PH1A 4LJ8A 3QUSA 4Q1EA 4Y0VA 1N6KA 3OEED 2PX0A 4FWTA 1N0VC 5IRCD 1MH1A 4PQFA 1OIXA 2XXAA 1OPXA 1QHNA 4JMPA 4OHWA 4F7WA 4PC1A 1UBFA 2V3CC 3L82B 1FUUA 3CZQA 2JDID 2QM7A 2WWWA 4JLKA 4TLBA 2DBYA 4OBEA 2EVWX 2XTZA 2D7CA 1G6OA 5HE8A 1PV4A 2D3WA 3UATA 2A5GA 2R62A 4OQLA 2XZOA 2WMOB 3ZVMA 2PZGA 1AQUA 3LV8A 5AJZA 4Q9HA 3T1TA 2O8BB 3ICEA 4URUR 3UKDA 4BRWA 2CHQA 2VP6A 4NYJR 3LXRA 4G5QA 1GNRA 3QSYA 4X8LA 1E4YA 3K0AB 3A1WA 2QP3A 3CH4B 4UNNA 5AK0A 4ERNA 4QM7A 2KE5A 3U7EB 3LQRA 5HKKA 1SVSA 1MV5A 2ZE8A 4URYR 1SXJA 1R8SA 4HUTA 1XB2A 4FMDB 1F6BA 2GEVA 4V0LA 3EG5A 3MUFA 2GA8A 2D74A 4B35A 2HF8A 2QRNA 1F2TB 3GJ8A 3DPUA 3ZGXA 4YMUA 1G16A 3W8NA 5JWRA 2WAYA 1G291 2AHOA 2CCGA 4LHWA 1W4BA 4MGZR 1H65A 3AKEA 4AIIA 2VP9A 3HR8A 1CULC 1XMJA 3U7GA 2ZR9A 2O8DA 2ZI6A 2QN6A 1JPJA 2MSEB 1ZYUA 2KWIA 5DN6A 4CIDA 2FMXA 1D9ZA 1IONA 2C04A 2NIPA 4CF7A 4NHOA 3ZQJA 4HLCA 4OYHA 2QE7D 5F2EA 2ZM5A 4LBYA 2VYFA 1E3MA 4XH9B 3BB4A 2G1KA 4JVMA 1NG9A 2IK8A 3QKRB 4Q47A 2OCBA 3K9LA 2JLQA 1NBME 1DVRA 4AKIA 3A1UA 2WIAA 2W6ID 5FL3A 1G5TA 3M1IA 1UFQA 5AR1A 1KGDA 4ZCLA 4JYCA 5CIWA 1Z8FA 1TU4A 1DARA 1RRGA 2FE4A 1XU4A 3IKJA 4HATA 4Q1FA 3VKHA 5JCPA 3K1JA 4Q4LA 5E7IA 4Q1AA 5JMTA 2GXUA 2SHKA 3RS0A 2RGEA 4WW0A 2AFIE 4XVRA 3L8YA 1FMJA 2VQSA 3AVQA 1KZ7B 5KSZA 1GIAA 1EWQA 2QMOA 2VHUA 5CIQA 1RFLA 2F6RA 3HU3A 1VPLA 5KDOA 3LX5A 4MYTA 3C14C 1J8MF 2WOJA 3PXGA 3CW2A 2QA5A 1IXZA 4HB4A 4IOMA 3Q5EA 4FI3C 4Q02A 4B74A 1W36D 1SVWA 2ZAOA 4FINA 4ABYA 2VHJA 4IFEA 4PTLA 4PO8A 3CM0A 2PT7A 4TYNA 4LHZA 3GQBA 2H5EA 1MRSA 4GP6A 2QGNA 4RSGA 3ZYCA 5FL7A 2PMDA 1P2TA 3QVUA 3BORA 3KXLA 4IOJA 5JS7A 3A8TA 3QOFA 4Q1CA 3SNHA 5LPNA 1E2EA 3IQXA 2XTNA 4L15A 1MO5A 4G5OA 3DMDA 2ZRJA 4TL9A 4TMWA 5DGXA 3AF2A 4KFTA 1Q20A 2W6JA 2FPKA 3AP2A 4P4TA 3W6OA 3VLFB 2GXQA 2I4IA 4OK6A 5JJLA 3UWOA 4Z54A 3K0CA 3K0SA 1T4GA 5DH9A 3IGFA 3MWJA 2OFWA 1MRNA 2RB4A 2N42A 1L4UA 1NF3A 1ZM7A 4WZAE 4C2TA 3LXXA 1OHHD 4BLRA 2VTKA 1XPRA 1EESA 4EQ6B 1ZD8A 4LX0A 4PXAA 3H1TA 4ACAA 1YHNA 2JLSA 4E07A 3QIAA 1E9BA 4X8OA 1ONBA 2OM2A 4BFUA 4MRPA 3THWB 1F2UA 1S0UA 2QM8A 3P27A 3QJYA 3FDIA 4A6XA 1X3SA 3UPUA 1YZUA 5DIFA 4LJ4A 4IDHA 5C2JB 4YMWA 4URWR 3DMNA 2HEIA 1YQTA 4E03A 4YMTA 3B9PA 4A92A 1UEJA 1K6MA 2WICA 4I1OA 1Q44A 1XTIA 4LV5B 5FI0B 4TMXA 4DLRA 1C9KA 3RSLA 4LRTA 5TVKA 2Q21A 2CHVA 1FPMA 1W2GA 1E79A 2JEOA 2MSDB 3D31A 2ODEA 1P7CA 4Q19A 5AUOB 5JEDA 2F9MA 5K8IA 2X2EA 5KHOC 1SKYE 3NEJA 2XNSA 3EIHA 3R7WB 2FFBA 4A6PA 5DYIA 4XWKA 5ELXA 4Q7LA 4AG5A 4ITRC 4FWGA 2P0EA 5TDHA 4V0KA 3F3YA 3NDPA 2OXRA 3ZDQA 2R8RA 4CW7A 1XMVA 3W6PA 2PLFA 3KB1A 1E2IA 4LPKA 2Z5FA 3N2IA 4M1WA 4OK3A 4NZYA 1KNXA 3RABA 1AS3A 4FCWA 3WRXC 1KO7A 2FFQA 2J5XA 4RD2A 1E0SA 3DL0A 2XNDD 1KK1A 3E5HA 4BLTA 3X2SA 3THXA 5G53C 2NPIA 3UG7A 2IS2A 1JEDA 4LC0A 1CR4A 1E99A 5EE0A 2UZIR 4F4CA 1IXRC 3K70D 2ZRAA 5CJ2A 2ZSFA 5FTKA 5FPTA 3RLFA 3VKGA 1T5IA 1TX4B 2XB2A 3JZMA 1HT1E 5DHFA 3T35A 1BIFA 4FWDA 4DSUA 1K5DA 2VHQA 4LV8B 4Q1DA 4MGIR 1MABA 1S96A 1L7VC 4PPGA 2DPXA 1R7RA 1EK0A 2YNMA 1M2OB 2QPAA 1LFDB 3C4JA 1NN5A 2BMDA 1JXMA 3BK7A 1OXSC 1ZCBA 4A0FA 3SE0A 3PG5A 2A7QA 2OCAA 1CU1A 1BOFA 4JSYA 3L0OA 3IBYA 5EP4A 1R5NA 2CHGA 8OHMA 2J87A 1OT3A 3A4LA 2F3RA 3R9XA 2HYDA 3L8ZA 1SVLA 1XXHA 5JFGA 3U2QA 1OFIA 1IJFA 1Q0UA 2VP5A 2ZJ2A 4Q00A 3AKCA 3T61A 4B47A 2OCPA 4CVNA 1AKYA 2AD5A 1LB1B 3FMOB 3EPLA 2QBYB 4BRUA 4QGHA 3KKOA 4QM6A 4KXFB 1S3SA 1C1KA 4NYIQ 2YOHA 3AKYA 1Z0FA 3VTKA 1X8JA 5FH9A 2ZTSA 2ERXA 1M34E 1OJLA 2Q3FA 4PZZA 5FOXA 1SVKA 1VYVA 3H86A 1XTKA 2CK3D 1XNJA 4P4SA 4BE7B 2IHYA 4QGFA 2PEYA 3KJGA 1KI8A 2YHSA 3THYB 5F98A 4D0NA 1KSJA 4JIMA 3RAPR 2BBWA 3VR1A 4B34A 2RCNA 4DKXA 3K0EA 4DT1B 5EQTA 3EIEA 3K09A 5BQ5A 2ONJA 2YWGA 1P72A 1TQ4A 4KVGA 3ZVLA 4UJ3A 1ZM4A 2H92A 2FZ4A 5SZJA 3PUVA 1G8GA 1NKSA 4P4UA 1NKTA 4PANA 4EJSB 3AVVA 1S9DA 1VIAA 1VDZA 5K8UA 1PZNA 1BMFD 4FIDA 1CBUA 1ZAKA 4QOSA 2RGAA 2Q9AA 1TNDA 1BYIA 2ZRNA 3M4YA 5EP3A 3EPHA 2W0MA 2O8BA 4OQMA 6Q21A 5H70A 1NMXA 3GMTA 1NVXQ 5H68A 1U2RA 4GPTA 4WXRA 3B85A 2B6HA 4DDWA 2NGRA 2QQ0A 1D2EA 4KVAA 2JJ2D 1HURA 3AEZA 3B82A 3K0AA 5CB6A 2A5FA 2OAQ1 2G9NA 4JL8A 1G4AE 3CH5A 1M7BA 3P32A 2GCOB 3PITA 2BM1A 2XOKD 3Q7QA 4Q4AB 5C46F 2G83A 4GNKA 5GJCA 5FPKA 4C9BA 4R98A 3QVVA 4TMTA 4JLBA 2IXGA 3NH6A 5J4KA 1F2TA 2CVFA 2BKUA 1E1QD 1E2HA 1E96A 5J4VA 1RRFA 3ZZUA 1I4TD 4NYJQ 4NYMQ 2ZQ5A 3FPAA 1YR9A 2OG2A 1MO6A 1N6NA 4Q66C 2G77B 4JLNA 4L5BA 2HJVA 1VTKA 1HTWA 1ZCAA 4S35A 3D7MA 4BFXA 1XTQA 2D4HA 2GESA 4LHVA 4DLXA 4TT3A 3VR6A 3QXSA 2FPLA 1DAHA 2WAXA 3UK6A 4B2PA 3K0FB 2YJTD 1EFUA 4X8MA 5FI1B 3KUCA 1P75A 3TKLA 3D6TB 4DLTA 2CCKA 3HDTA 4M22A 2IUTA 4PSVA 1Z07A 2Z4SA 1NN0A 1GL6A 1RJ9B 2N1BA 3QKRA 2FPMA 4HDQB 1VYUA 4PZYA 1YVDA 3TR5A 4KYUA 2HT6A 2WWXA 3OFNA 4JVNA 4P3YA 4DCVA 3BFVA 4QXAA 3GLIE 2FDCA 1Z6AA 2W83A 4WVFA 2QUZA 2WKQA 2B92A 1HT2E 3KFXA 1T0HB 2QORA 2IXEA 2OE2A 2OHFA 4GFDA 2BJVA 1U99A 4N3NA 2QAGB 1GTVA 4B75A 2GDJA 4OK5A 2E9SA 4JJZA 3KDSE 1XJ0A 721PA 2GRJA 4R71A 4D25A 1IN5A 1N6RA 4OJQA 5FOVA 3AB3A 2GJ9A 5CB8A 4NL4H 3W5JA 1GL9B 4C3ZA 4O2LA 1YR7A 3PUYA 4PSKA 821PA 4XVUA 5HTKA 3EC1A 2AX4A 5FTLA 2Z0MA 5IF9A 3SHWA 5HKKD 3IIKA 3A36A 1SXJD 1AGRA 1R0XA 2YVUA 3D3QA 2AKYA 4HEJA 4EJSC 1KTVA 1SKQA 1FW6A 2OLKA 1L4YA 5C1BA 3DO6A 4Q9LA 3UMRA 4OQNA 1ZW6A 3OIYA 1YZNA 3DOFA 2GAAA 3FGNA 4TL8A 3L43A 3X1DA 4FCTA 4BFZA 1WBBA 1R0ZA 2NO9A 4EQ6A 1W2HA 3NBFA 3W6NA 2F7SA 4W5HA 1JQJC 1SHKA 1T8TA 5DN6D 3THWA 1NVVR 2FSHA 2XJ9A 5FR1A 3U7FB 4URVR 1JPNA 2OESA 3NEYA 1XRJA 4B3DA 3GJ7A 4O3MA 1NLZA 1H8EA 3VFDA 3KJIA 3PIRA 2YC2C 1RKBA 4BZQA 4C0JA 2YKGA 3MCAA 3TUJC 3OEHD 5EUMA 1N5IA 2Z43A 4B6EA 5BW8A 3BB3A 4U7DA 1JB1A 1OH6A 1IY2A 5KO2A 2V9PA 3CIOA 4KI0A 1QRAA 1NIJA 4DB2A 4QKQA 4OHYA 1E94E 4M21A 5LBIA 1OXXK 4UJ5A 2ZRLA 3U61B 4D0GA 4DCTA 2NO6A 1CJTC 4RZUA 4US1R 3R7WA 1ZNYA 3TSOA 4FD2A 5JSZB 3NDBB 4PAOA 2OSBA 3GLGB 3W90A 5G41A 4M1TA 5B64A 1CTQA 3KFVA 4C0QC 3O47A 1CRQA 2QT1A 3N2EA 1JXOA 2H7VA 5CJPA 2JIZA 5E95A 3WYGA 2O8FB 4OL0A 4LBWA 5EE1A 5FOSA 3TAHA 4ESHA 1XEXB 1ZD1A 4Q9IA 1HE1C 2QZ4A 1TQDA 4OQFA 4JBXA 4KJZA 1Y3AA 5FL7D 3T15A 1A5TA 4OHZA 1Z5ZA 3QEOA 4AWXA 4QHTA 2BIFA 2YWHA 2J7PA 4U00A 2YC4C 4IEEA 2I1QA 2W6JD 2GZDA 3ZVNA 1G21E 4TLAA 4ARZB 2PCLA 4XTRA 3UWKA 3OIUA 4A1FA 5CK5A 3CRW1 3UMFA 3IHWA 5FTNA 1ANKA 1WF3A 1YZLA 5EZ5A 5LD2B 1J99A 1YZKA 2BBSA 3NHAA 3A1VA 1II0A 4B6FA 3NBYC 4B71A 2WKRA 2ZS8A 1M7HA 1PLLA 4PAMA 4DHEA 4KCGA 2ZRFA 4PQYA 4OI1A 1XTSA 2H8KA 3HR7A 1VG0B 4GP7A 2PZEA 3W9YA 2DFTA 3B1ZA 3HYRA 4F92B 1VCNA 5AWFC 3NBXX 2C9OA 2ZSDA 3AVWA 1XPUA 4NPHA 2QBYA 1UBCA 2OAP1 1QHIA 1E79D 4FW9A 3FHOA 3RRYA 3LY5A 4ZIRB 2EYQA 2ZR7A 4LRWA 1VMAA 1E2MA 4JLPA 1KO8A 1GSIA 3CRVA 4QBFA 1HYQA 2WVJA 1G20E 1OW3B 1ZUIA 1ZP6A 3BFKA 1U9IA 3QF4B 1ETUA 1Q1BA 1CIPA 3THYA 4EIWA 3AVYA 3FWYA 1EXMA 4LBZA 4PC6A 1KKLA 4DLUA 4IDPA 1OF1A 1NSTA 5JI3E 1CR1A 4DT1A 3DM9B 4DWJA 1OSNA 4Q01A 2VSXA 2XEXA 5HPYB 3BERA 3W3ZB 2RAPA 2ZANA 3TW8B 2NO0A 2XGJA 1X8LA 4W5JA 2WWHA 3ZH9B 5AJVB 2V7QD 2ZE5A 1FFHA 2ZRGA 3QXJA 1NLFA 4TWZA 4A0GA 4EJSA 4Q03A 5L3QB 2JASA 2QTVB 4A3VB 2EYUA 3CNNA 4GBMA 1J90A 3QPVA 3BH7A 1LW7A 4XIGS 2H17A 3SJBA 1T8UA 4A36A 3JVVA 1OE0A 5JZVA 5KNDA 3K9HA 1JAHA 4ILEA 5FUVA 4E22A 2WIBA 2HV8A 2EW1A 1COWD 1LS6A 1CF4A 1JQLB 2GCOA 2GTPA 3SBDA 3SJZA 4Q4AA 4EUNA 3AKDA 2UVQA 2JCSA 5KNBA 3IDQA 4C0LA 1FQKA 3EWSA 3U3RA 1DTSA 2A30A 3KQKA 3SHFA 1KI7A 1ZUNB 4PHGA 3BFXA 4NYIR 2WSSD 2ZRBA 4BPBA 3T5GA 3VR5A 2O52A 4WZBE 3LQQA 2I3BA 2ECKA 5K8LA 1AA9A 5FFMA 2CE2X 5A0FA 2DWQA 3NHBA 5KOYA 1XDBA 4TMKA 4B3BA 5EXTA 4LJAA 2UKDA 3LW8A 3AF3A 4HAYA 2CL6X 3W8RA 5CYPA 5KSOA 3KKNA 1WB9A 5LD2C 4WZ6A 3FOZA 2IX3A 3BH6A 5AUNB 3TRFA 2HLDA 2ZROA 2G1JA 3KKMA 2AR7A 1P9RA 3K0FA 1JECA 1E2GA 3LRPA 4W5WA 3AM1A 4LRSA 2BEKA 3LH5A 4NP6A 1RJ9A 4ZCMA 2OCYC 1FL9A 3QBVA 4YONB 4JSTA 1WQ1R 1P2SA 2P6UA 4PPQA 4DJTA 2DB3A 2QMHA 1DAGA 4L9SA 4BFWA 1EFRA 1MR3F 3EPKA 2OFXA 3U7HB 4U5XA 2FU5C 1AQYA 4YMVA 4F4IA 2F1RA 2KJQA 2Q9CA 5UKDA 3Q9LA 4E5UA 1R6BX 1KNQA 4F93B 1ZD9A 3NXSA 2VO1A 2J0UB 3LVQE 1R4AA 1GKIA 1TQ6A 3JVUA 1FOEB 2QAGA 3O8BA 3QKTA 4A8JC 1XTJA 3U3OA 5FBWB 1R5OA 4LYFA 5J40A 1U8ZA 1DE0A 4WA7A 2GXSA 2V55B 2FFAA 2YINC 1ZMXA 5L3SB 4NYMR 3ZD7A 4KFUA 1A1VA 3FKSD 2XJ4A 4C0AC 4D4LA 2P67A 3MHVC 3FMFA 5BXQC 2PBRA 1BKDR 1G41A 4DC9A 1WBDA 5KSPA 3QXXA 4YDHB 3I61A 3C16C 1X1RA 2WHXA 1Q57A 4A4DA 5P21A 3A1SA 3B60A 4WIAA 2MMCA 2OV2A 1E1RA 2RH5A 3LBNA 4X8HA 2IEZA 4RD3A 1IJEA 1PVOA 4TLDA 1ODFA 1W5SA 5FTMA 1PJRA 3TW4A 4J0QA 4DB4A 4MYCA 4D6PA 1MO4A 3ETLA 4RCZA 1ZINA 4G1UC 4B32A 2EU8A 4IHQA 4ACBA 4CGZA 1KK2A 2R6GA 4PR0A 4JLAA 4TT3D 1XD2B 1XFAA 4BFSA 2ZI4A 1DAMA 1N25A 1RYHA 2PT5A 1Z2CA 2VEDA 4KU4A 3B7GA 4LYHA 1JJVA 1E9RA 2QNRA 4M1OA 4TSFD 1R8QA 2R6FA 2IT1A 4C0HA 2XZLA 2NPFA 1L8QA 1IXSB 2FJUA 1I4DD 5FOWA 5EP1A 1G3UA 4B2LA 5EJEA 1Z06A 1KJYA 3AF1A 1GKUB 3MWLA 4C0BA 1UDXA 1W0KA 5L3RA 4TTPA 4FWIB 1JR3A 4DEYA 3C5HA 3SQWA 4DUGA 1NVVQ 3CONA 2F9LA 2ZJAA 2XSZA 4K8OA 3CRQA 3PEVA 3WXMA 3GLFA 4D2IA 3DZ8A 5JSZA 3OESA 2BMEA 4LK2A 4FWHA 1US8B 4F4JA 3MJRA 5C18A 3GLGA 1QHSA 4R2HA 2KI5A 3FKQA 2W58A 4BFTA 2RGXA 3DDCA 4UXHA 2B7CA 1ZC3A 1ZM2A 4HLQB 5FBRB 1XEWX 1TU3A 3K9NA 2O8FA 4ZDIA 4LJ6A 2TMKA 4DXAA 2DVWB 2FSIA 1DO2A 2JATA 1O3YA 4ZDWA 1U98A 1XEXA 3GJ0A 4JBYA 2VF8A 3G82C 5J4YA 1H8HA 1PLJA 4GL2A 2OFOA 3WRYC 4Q4HB 2C95A 2ZYVX 4TZ0A 4Z8XA 3KJHA 4ESVA 1GNQA 4URZR 2RHDA 2IYXA 4LCBA 2XZPA 5KSYA 1CJKC 1JALA 4IDQA 3CWZA 1Z0JA 5FBLB 1LV7A 5AJXA 3BWDD 1JNYA 4ARZA 2C9YA 3EA5A 4HUQB 3RS7A 3GD7A 2Q0HA 1W36B 1VHLA 4Q18A 5CLLA 4W9MC 4MGKR 2VSFA 3KQHA 3PEUA 1ZU5A 2WWIA 1CKEA 1IHUA 1QG4A 1X1SA 1VG1A 3CZPA 5DYGA 1N6PA 1Z6GA 4LJYA 3WYFA 5CM8B 4PQRA 2GBLA 2X77A 4IXMA 4P0TA 1FTSA 2Z4RA 1CS4C 1H8ED 1OFTA 4JL6A 4LHYA 1DAKA 1HV8A 1Q1EA 2HJGA 3TLXA 5CITA 1CJMA 1SVMA 3AGPA 3EASA 1G3QA 4KV9A 3V00A 1DPFA 3OAAA 2WJHA 3FMPB 3HJNA 4H1UA 4K81B 1SXJE 4ZIRA 2QTFA 1Z28A 3BGWA 5E7MA 1AM4D 4NMMA 4C0SA 3KTAB 4MGYR 3OIWA 2ZJ8A 4TMVA 4LZZA 3N5CA 1G3MA 4B43A 1R0WA 2GVZC 3K9GA 4TYQA 4URXR 3QF4A 2DHRA 2W0SA 3TUIC 1G18A 1O87A 3Q8XB 1GDDA 4NTZA 3LVRE 4D81A 2X19A 3BD9A 4GZMA 4MITA 3RSOA 1VCIA 5D3MB 1TQ2A 2JIZD 2ZSAA 4RVCA 3E2IA 4PSAA 4HAUA 4P32A 2C5LA 4HSEA 3FTQA 1P60A 3FE2A 2ZJZA 4MYHA 2GEDA 2JLUA 4D26A 2D2FA 3RS3A 1IM2A 2IYLD 5L3QA 5CM9C 3REFA 2GJ8A 3HPQA 1FQJA 1P73A 3CO5A 2O0KA 2J7PD 3FB4A 4V0MA 4N0EA 4LSGA 5JS8A 3IPYA 3AUXA 1FMLA 4PC2A 3V4FA 2E87A 5HZHA 1Z29A 4YDSA 1JR3E 3U5ZB 1J8YF 1N6LA 1KY3A 3AJIB 1ZVQA 3SYKA 5A5GA 4RD0A 3DHWC 2CVHA 3VX4A 1YZGA 4KBFA 2QPOA 4FXPA 1S8FA 3C7KA 3CF0A 3GLFE 2B7BA 1Z2AA 4LOAA 4AYXA 2NMVA 4NDZA 3SOPA 1FUKA 1G64A 4RD1A 4AKEA 3A58B 4LV6A 4LGMA 3WP0A 3ZZ0A 1PUJA 4C2UA 1U8AA 3IILA 1G7SA 3ND8A 1FZQA 4BFYA 3K70B 2JJ1A 4GITA 2ZAMA 3MSXA 3ICQB 1NY6A 4NCKA 4LJ9A 1W36C 3BOSA 4D0LB 2OO7A 3C41J 1I2DA 1G17A 1K5GA 4O25A 1LTQA 1XEFA 4QJ4A 1RC8A 3GFTA 1YR8A 1G5PA 2VP0A 3OE7A 4ZV4A 5DE3A 1DO0A 1ZUHA 3EZFA 4L8GA 3Q72A 2ZITA 1E9SA 1XEWY 1ZJ6A 4KSBA 3WMFA 3EPJA 2ORIA 1RIFA 2O8CB 4EPYA 1L2TA 1QZXA 2GJAA 2EFEB 3KW6A 2WBLC 2CNWD 3BH0A 4LWZA 1X37A 2QP9X 5HCNA 2DWPA 3B1YA 1SULA 2C8VA 4Z51A 4TL6A 1GL7A 2C9CA 2GETA 2J0UA 3RRMA 1G3IA 1U0JA 2G0NA 2VA8A 2A78A 2QU8A 1C1YA 1UBGA 2G6BA 4DCUA 2GHIA 5B30A 4H1VA 3NKVA 4EDHA 1E0KA 2IUSA 2D7DA 4JBWA 4M1KA 1R10A 4DEXA 1VHTA 1W4RA 3SJAA 4CEJB 1FX0B 1RE0A 4M9QA 2PMKA 2ZPTX 1W44A 5GJVC 2BKEA 4BUJA 5L3SA 2LWIA 3OEEA 3VU9B 1WXQA 5C4GB 2BBOA 1M74A 2K5UA 3GFPA 2HXSA 1WCV1 1WP9A 2LKCA 4AYWA 2IS1A 2DR3A 2REXB 1E32A 2D06A 1UKZA 4NBSA 4CEHB 1ESMA 1JI0A 3L0SA 3NWJA 4UKDA 4QGAA 1JBKA 3WBJA 1Z6XA 3SFVA 3CLVA 3RS4A 3ADDA 4BZXA 2V1XA 1GZSA 4JT2A 2YYZA 1B23P 1OB2A 1IBRA 1E2NA 3U4QB 1OH7A 4MKIA 4IDOA 2A3RA 3TK1A 1W0JA 3H0KA 2IYYA 4M53A 5JI2E 3RANA 3WY9A 5JHHB 2V54A 1OH8A 1EX6A 1T5LA 1DAEA 3A37A 4ON9A 1E2LA 3B78A 2BC9A 5TY0A 3GLHB 4POAA 2PEZA 4DLZA 4EKDA 2HLDD 2CLCX 1XD2A 4JL5A 5BWMA 1E9DA 4UXIA 3ZLJA 4EPVA 5G3ZA 4NCHA 4DCNA 3LNCA 4XD7A 4II7A 3K70C 1BH2A 2WJYA 3VNVA 3UIEA 4PHTA 5EXSA 1EFRD 5EXXA 1ZM9A 5KDDA 2A5DA 2AFHE 5KPDA 5FOTA 1ZIOA 1ZNXA 4HLUC 3VNUA 1HH4A 1E2DA 2ANBA 2KB0A 4F38A 4M9SA 4OJKA 5FBQB 1OKKA 2ZRHA 3BE4A 1E9FA 2HXYA 3QXCA 4TQ9A 4US0R 2RGNC 4O0MA 2ZSEA 2C98A 3T1VA 2F55A 4HZUB 2QL6A 2ZRDA 1CJUC 1G4UR 1US8A 3GJXC 5SZIA 1G7RA 1GFIA 3QBTA 4M1SA 4DIDA 3WHLA 2Q3HA 4QG7A 5D3QA 3RVBA 1G5RA 1XXHE 1QBKC 1Q12A 1DAIA 2QQEA 1NJGA 2ORWA 3MAAC 4XVQA 2BWJA 2H18A 4LC1A 4Z1MA 2P5SA 1KAGA 3F8TA 5KPJA 1GP2A 3RS5A 1OXUA 3GCGA 1PLKA 1S1MA 4IRUB 2GF9A 4Q4HA 4NU0A 2P5TB 5G3YA 4XWOA 1HE8B 1N5LA 1S4QA 4CDGA 4PC7A 1M8PA 2I1VB 1F5NA 2J59A 1G8YA 2HYIC 3TVTA 2JLXA 4HUQA 4ZO4A 3EW9A 4TL7A 4DVGA 1EX7A 3X1ZA 4DSTA 2IS4A 1CJVC 2JA1A 4OHXA 2F1JA 1Z6YA 2ZE7A 3QF7A 2J41A 3U60B 1F3OA 2Z83A 2ZI3A 4B3XA 3NVAA 2FFHA 3WP1B 3I1FA 4I1SA 2VSOA 2OZEA 3KKPA 3GEEA 2GJSA 4US2R 2ZRCA 1Z22A 3MRSA 2BM0A 3AGQA 3UXMA 3A4MA 3AQ4A 2XTMA 4HAVA 5AUQA 3AVUA 2QTHA 4IW3B 4LPSA 221PA 2NG1A 1XZPA 4U02A 5DNYB 3HWSA 1GITA 4DZZA 4MKHA 1XJCA 4EFLA 3R8CA 1NVUQ 3T1QA 4JKYA 2CXXA 1W0KD 1KI1A 2WKPA 3NG1A 1JR3D 3IHLA 4JYBA 4N0DA 4Q7JB 5JCZA 4JLOA 2VHTA 4DUGD 5C4MA 2Q6TA 2IL1A 4JLVA 2A5JA 2J46A 4I99A 3BB1A 2XSZD 3KTAA 4HAXA 5J4LA 3I72A 3IEUA 4QFMA 1XP8A 4ASUA 2V6IA 1E9CA 4IFBA 5JBQA 1Q21A 1GWNA 1OXVA 2J7KA 1FTNA 2MMGA 3Q3JB 4S2EA 3X1YA 1AIPA 5G40A 4CYMA 4M9ZA 4RKEA 2IC5A 4BEJA 4HAZA 4XJXA 3ZZTA 1DADA 4TYWA 2RMKA 5IDVA 5D3MA 3P4YA 3QKUA 5AUPB 5JJIA 3CPEA 3ZQ6A 4EPWA 2UZ3A 4AK9A 3MWKA 1J7KA 4NCNA 2FV8A 1H8HD 4LBVA 2FEOA 2JLRA 5LB4A 2GCPA 4TYPA 2YWEA 3CPHA 1M7GA 1WMSA 4UQOA 3VR4A 1ZRHA 2P6NA 3HYTA 3RRNA 3VHLB 4A2PA 1W7AA 3GP8A 2ZI5A 2IUUA 2R44A 1YE8A 3P1JA 4MRRA 4JT4A 2ZUBA 4Q48A 5DHAA 2DFLA 3DEFA 3O8RA 2Z6VA 4EPTA 1G8HA 1W4AA 4OQXA 2YZ2A 3NC0C 1OH5A 5B57C 1LF5A 2AXPA 4Q7MB 2ODBA 4MRSA 4DLSA 2HCBA 2NO1A 1AZSC 3IQWA 4NONA 4IJMA 2J45A 2WWFA 4UNRA 2F43B 3OAAD 4D80A 1YU9A 2QSZA 1P2UA 3PENA 3RC8A 3I73A 3MG9A 2FSFA 3IBGA 1SXJC 2RGNA 4LYJA 3THOA 4IXNA 2O8CA 1G8PA 2NOAA 4GRAA 1VYTA 1KOFA 2O5VA 2QT0A 1XCMA 5GJBA 4A8JB 1OIWA 5B58C 1N2CE 3EZ2A 1S9HA 4XWAA 1MO3A 5HE9A 2WJVA 4O2RA 1UAAA 4TLCA 2N46A 4AY2A 4TTRA 1NNEA 2ORVA 1GVNB 4RJLA 4KBGA 1U90A 4PHHA 5LDDC 1P9NA 1AS2A 2C03A 1VCOA 2D2EA 2H16A 1VG9B 2YWFA 2QG6A 2GZAA 3U44B 1N3BA 2Y8EA 1AK2A 1CR0A 3TE6A 1D2MA 3ADKA 1WE2A 4CZ2A 4CEJA 1FX0A 1LY1A 3JZAA 2WV9A 3R8FA 2ZRIA 4HLDA 4ZKDA 3N70A 1VKJA 3IUYA 3WYAA 3VU9A 421PA 1SQ5A 1P62B 1KI3A 2L0XA 5EE9A 1QHHB 1GRNA 2HF9A 3VAAA 2RHMA 4GT1A 5JRZA 4JLMA 1GKYA 3SQXA 1UDWA 3CNLA 2CCJA 4AKHA 1YR6A 2BHRA 3BAFA 1GAJA 3FYHA 1N0WA 4CEHA 3U3MA 2JLYA 4YXWA 3AVTA 1ZM3A 3BC1A 3ZIAA 4PPFA 3QEJA 3GEHA 4MUAA 5FUXA 1GILA 3U4QA 2A9KA 5EZ6B 2C99A 2RKOA 4L4UA 3IIMA 4Q4JB 4FMCF 4HB0A 4JVLA 4RD6A 1BMFA 1Q22A 3T06B 4YQFA 1KDPA 2GXAA 2QI9C 4YMSA 2JLZA 1XJQA 1NBMA 3I5YA 1NSFA 4A15A 2D62A 2IBMA 2JJ2A 2YV5A 5TB5A 3GLHA 5K8TA 1W46A 5F9FA 1AS0A 3WNCA 4QL3A 1HQCA 5J47A 2V6ZM 3GLIB 3LX8A 1AKEA 1K8RA 1T0JB 1Q1QA 3OE7D 1VIYA 3FHTA 1HA3A 2VHCA 1I4LD 3SS8A 4GOJA 1CRPA 5FUWA 1RW4A 1X86B 3RNLA 4D4JA 1E69A 4CT5A 3LW7A 1N6HA 4PHFA 3H4MA 2FG5A 4DBLC 2FZLA 5DI3B 1HQYE 3KJEA 2C77A 4XOIA 5DI9A 1CP2A 4IEIA 2CL7X 1UKEA 4KSCA 2VBCA 1KI4A 4QHSA 4NCJA 2GZHA 2IYUA 3R9WA 1DOAA 3CF2A 3FMIA 1QVRA 3RHFA 1Q1ZA 2BDTA 4LYAA 3SFZA 1TEVA 2CE7A 3KB2A 1FP7A 3SR0A 1SVIA 3EWAA 2FEMA 4HZUA 3TAUA 3AF4A 5FBVB 4HZIA 2V1UA 2IYQA 2DFNA 3VMFA 4LHXA 2VRWA 2BVNA 4I4LA 3TR0A 2GAOA 2XAUA 2RGBA 2PJRA 2V6JA 1M6NA 2AWOA 2ZUDA 3AH8A 1ZU4A 5BN5A 5FPSA 5JJKA 3QY0A 3LFUA 2AK3A 5H1YA 1YKSA 1KZGB 3KKQA 1DG3A 1NG1A 2NZJA 2VH5R 4TN1A 2XX3A 4UNSA 1M1YE 2JAQA 3EARA 3T34A 4QNRA 2ZE6A 3ASZA 2BMJA 3PUZA 4RFVA 2NO7A 4I1VA 3ND9A 2XITA 4C0KA 4KYIB 3HP1A 3KQNA 1D9XA 1KO1A 3DKVA 2ZU6A 2QY9A 3F0TA 1A2KC 1KAOA 1Z63A 2WPDA 1A82A 1W0JD 2QMUA 1CR2A 3BXZA 2IA5A 3QPWA 2PZFA 2CLSA 2J9RA 4Q9KA 2HUPA 1RRPA 1IN7A 2X2FA 1B0UA 1XZQA 4R7ZA 3B1XA 3RDPA 2CJWB 1ZNWA 3GJ3A 4DSOA 4MKFA 1N6IA 3RYTC 2CEAA 5CDFA 5TV2A 2MSCB 3DOEA 1RVDA 3VHXA 4L9WA 3PV0A 4IKEA 4XD7D 2OBLA 4G5SA 1EGAA 3SYLA 2HDNB 1J2JA 3ZJYA 2ZVPX 4TQAA 2IHBA 4P33A 4AC9A 4EFMA 1MOZA 3OFND 4RD4A 3AV0B 4M2LA 2YOFA 1P61B 2PCJA 3EXAA 2HCJB 3I32A 2WOOA 4JN6A 3FFAA 1OKKD 4AI6A 1D2NA 4BASA 3NIBA 2QENA 2ZJBA 4BEBA 3LO5A 1NVWQ 2ZU0C 2IYSA 1ZC4A 4P31A 5DISB 4A82A 4EPXA 3O8CA 3WMGA 2O0JA 3OEHA 5A4JA 3AF0A 3SU8A 3EC2A 4KITB 3GLHE 4QBHA 3ECCA 1D8TA 3OHMA 2IYRA 4Z1MD 2ZYTX 2BCGY 4MA4A 4PC3A 5L3VA 1D5CA 2ZR0A 1GUAA 3MJHA 1J70A 2GK6A 1IN6A 2RGDA 2CL0X 3S1AB 3KX2A 1AZTA 5M04A 3P4XA 1V5WA 2DZNB 1UADA 2OILA 4DDTA 4B3GA 4LDJA 1E98A 2EWWA 4BFVA 3L0IB 3QG1A 521PA 3EZ9A 2LKDA 3P20A 4PZLA 2W2VA 3I5XA 4A0RA 3QPUA 2ODWA 4KO8A 3NC1C 4KLNA 3OZXA 2ZXUA 4R2IA 2DZOB 5E4FA 3M0EA 3HPRA 2B8WA 3B9QA 3K09C 2BMFA 4BLPA 5IHPA 4ZKEA 3GPLA 3A4NA 3DM5A 2DYKA 4IVQA 5KDLA 2QAJA 4LUCA 2DWZB 1TF2A 3IPXA 3PR1A 3IO3A 3C15C 2GNOA 2CDNA 1N0UA 2IXFA 1NL3A 3T12A 1OFHA 5JRJA 3V4RA 4N1AA 1D6JA 2F43A 4FMBB 1C4OA 3LBHA 1G3RA 1YZTA 4GMXA 1XF9A 1T3HA 5TXGA 1NN1A 5EP2A 1R5BA 1KMQA 4B2IA 4L16A 3I8XA 1GOTA 4G5GA 1U94A 2G3YA 1GNPA 1JJ7A 1QHYA 1F60A 4XTCS 1KI2A 2WWYA 1HEIA 2F1HA 4GDFA 2PLRA 1XPOA 3WNBA 1G7TA 2ZETA 1S2MA 4MRNA 4PO1A 5FR2A 1T6NA 4ASUD 3CX8A 2A2ZA 4A8JA 1NMYA 1G9XA 1EWRA 3FFBA 1FNNA 1UPTA 4MRVA 5JECA 5F3WB 3TGPA 3PUWA 5IT5A 4AD8A 3EZ7A 3F5FA 5JHGB 3I8SA 4I81A 4EPRA 4IVPA 5EUQB 2JJ8A 1N6OA 2J3EA 3VR3A 4E09A 2KBEA 5CLQA 4C30A 3U44A 3Q5DA 5CDFE 4QC2A 2AWNA 2AN9A 3GFOA 5EXPA 3X1WA 1NI3A 2CLDX 4V0OA 1ZNZA 4JVSB 3DZDA 4B44A 4ZDJA 3B1VA 2XB4A 3UANA 4ZI2A 4MDFA 1E0AA 2QSYA 2BV3A 2EFGA 2B8TA 1KI6B 1QHHA 2ZI9A 2DWOA 1VG8A 4Q5IA 5BYKA 1KO4A 1MT0A 2GWHA 4EAQA 4PFSA 4MUBA 4D4KA 1IN4A 4KAXA 3CKLA 2IF0A 4KFRA 4QBIA 5L8VA 1TADA 2FOLA 2VF7A 3GLGE 4CEIB 2V7QA 2O0HA 4Q4JA 3RRZA 1N5KA 3TNFA 1S1CA 2BEJA 1JEEA 2FGJA 1AJEA 4JLJA 3MWYW 1ZBDA 4W7SA 2ZYWX 2PJZA 1ZIPA 3B6EA 4JKIA 4Y0AA 4CRWB 4JZKA 3TSWA 2ZJOA 4PAQA 3BRWD 4FN5A 4ZPXA 1HY3A 4IOKA 3QENA 1IOZA 2J0SA 5ANRB 5KTYA 1COWA 1BYUA 4RFSB 2ATXA 1XWIA 2ZEJA 3B2EA 3GLIA 5HCIA 1IQPA 1KDRA 1LVGA 1NP6A 1TL7C 1U0LA 2ZVQX 3EZ6A 3UMSA 4I1UA 3LLUA 1G6HA 1W47A 1E9EA 2CBZA 2P65A 2WSSA 1A7JA 5IK2A 3AUYA 4IVRA 3LA6A 1UJ2A 3H84A 5DI3A 1Q3HA 3TH5A 1JR6A 1UM8A 2BCJQ 1QG2A 1SVOA 1UEIA 4TMZA 2FNAA 2FH5B 3B8HA 3KUDA 4MDEA 4HYYA 2FWRA 2GK7A 121PA 3C8UA 2FF7A 2BBTA 2J0QA 4AURA 3CPJB 4OKSA 1QZMA 1II8B 2RGCA 3RWOA 3WHKA 1KHTA 3KXIA 3BIFA 1KYIA 2IYWA 2DFKB 4DDUA 4BLSA 1OYWA 4Q1BA 1MKYA 2X8AA 1KI9A 2IYZA 2IS6A 1DBSA 3CRRA 5KNCA 1QF9A 4OI2A 3I62A 3TIFA 3CF6R 1RPZA 3LBIA 5FOUA 4R9UC 2G0TA 4FMDF 1E2QA 4PPNA 4UXJA 2ZRPA 4TYYA 4BZPA 4Q7KA 4AYTA 1P2VA 2V4ZA 2W2XA 1TF7A 1AN0A 1X6VA 4XSGA 1R0YA 5TMPA 1YRAA 3SI7A 4YXWD 5FPHA 4TZ6A 4TTQA 3ZIAD 2WM9B 4IDNA 4TLEA 2JDIA 3OF5A 4G3XA 3AP3A 2WTUA 1Z83A 5GVSA 2FGKA 2R6CA 4LI0A 4G0NA 1KMHB 1S3GA 5DLQC 3HU2A 2HT1A 2ZS9A 2GKSA 5KYKA 5CYOA 1IAQA 1LS1A 2GEUA 3LD9A 4XSHA 1NBMD 4AG6A 2NTYC 1U8YA 4BWYA 5KUTA 3L2OB 3QQ5A 4DRZA 3FKSA 2QGZA 3CNOA 4QNMA 2FSGA 2CJWA 1XD9A 1RYFA 3WBKA 1G8FA 2Q3MA 2ODNA 2W00A 1W49A 1Y63A 3QKSB 3QI2A 3ZVRA 2A5YB 1QHGA 4NCIA 4V0ME 2ZUCA 3CUEF 4KLZA 2EFHB 2FA9A 1Q3TA 3NBZC 4HDOB 4KFSA 3PQCA 1IN8A 3RS2A 4A9AA 1CLUA 2QPTA 1OV4A 1KK3A 2RGGA 4D82A 4ZDKA 4WXPA 3J81k 2X1VA 1W4CA 4MQBA 4QJ3A 4FMCB 2ASEA 4YLGA 1EFHA 2DCUA 1NIPA 4QJ5A 2FN4A 2O8EB 1XX6A 1FP6A 1NMZA 1TUEA 4GOKA 3VQTA 4UNQA 1GRRA 1KDTA 2H57A 2QE7A 1E0JA 3MMPA 4TSFA 3LWNA 4C7OB 1XBTA 2IF2A 2W6IA 4B3FX 3WMEA 5JEEA 3KQLA 2ZRKA 1Z08A 3LLMA 1IY1A 4OI4A 4ZCIA 1T3LA 4MYUA 3PEWA 1E2FA 2KBFA 3EIQA 1OLOA 5SZHB 3S1AA 2VL7A 2XXAB 3GEIA 3TBKA 2J1LA 3NH9A 1N5JA 4DDVA 1E9AA 1I2MA 2WSMA 2C96A 1WRBA 4M0LA 2VP2A 1X8KA 5GJWC 5LB2A 4A2WA 1TTTA 4QRHA 1E1RD 4M4SA 5FUYA 3VKWA 4DLWA 1XCPA 1Z47A 3CWQA 1GG2A 1U9IC 3PVSA 2IWRA 2ZRMA 4B48A 2WPDD 2WJJA 4RY2A 3U3JA 2W2TA 3G0HA 3SEAA 2R9VA 2ZIAA 4WOPA 3TSZA 5F9HA 2DY1A 2OBMA 2PX3A 2IYTA 4BLOA 3SC3A 1OXTA 3H2YA 4K46A 3KXKA 2KRKA 3CR8A 3TVDA 3EA0A 3X1XA 3AP1A 1SXJB 1DEKA 1G1MA 1T9HA 4LJ5A 2ATVA 3NTUA 3R20A 4Q21A 2EFCB 2REOA 3B1WA 3I3SR 3T5DA 4TQUS 1JAIA 2NQ2C 2VP4A 3E1SA 2Q9BA 5GADl 1WA5A 3VR2A 2BJWA 2GF0A 1SKYB 2QRZA 2P3SA 2AL7A 3KQUA 1Z6TA 4YC7A 4EFNA 3FHCB 3FVQA 3TJZA 1OHHA 2GJKA 5FPYA 1UF9A 3QXHA 4HB3A 1XTRA 4CT4B 4DCSA 2QEQA 2JGNA 2GVDC 1SGWA 2C78A 3KL4A 3EX7C 2O8DB 1KO5A 4RCYA 1YZQA 3GJ4A 3SZRA 2GCNA 1DELA 2BOVA 4JJKA 3U6BA 1NY5A 1BO6A 2EWVA 3PUXA 5HZKA 1EFTA 4KHZA 1XD8A 4RZXA 3PJRA 4PO9A 1G7CA 3SN6A 1KY2A 1RZ3A 1U81A 4B76A 1IY0A 1A4RA 3QG5A 2ZS7A 1OIVA 1NN3A 1KJZA 2WJGA 2IW3A 5EE5B 3BBPA 3W34A 1W5TA 1W48A 3L0PA 1PUIA 3A1TA 2QP4A 1YRBA 3W3AA 3REGA 2OBNA 4GI7A 4M1YA 2GILA 1AGPA 1SHZA 3V9PA 3GLFB 4B3CA 4QBGB 4V0NA 1W1WA 1Z0IA 2R65A 1RRCA 2ZJ5A 2ZYUX 1ESNA 1P5ZB 3QE0A 3C5CA 5E3HA 5J4HA 3B13B 3IIJA 3O8DA 2ZSBA 4HDCA 1KI6A 1TMKA 3TUZC 4GOXA 1UKYA 4G5RA 1E2PA 3ONWA 2OEPA 1VECA 2QROA 1SZPA 3A6PC 1OFUX
chains in the Genus database with same CATH superfamily
4RESA 1RYZA 4P36A 4LWQA 2ID4A 2V7UA 2REBA 3A6KA 2AKAB 1UKVY 1WKBA 1L4KA 3FLAA 4RFSA 1FX1A 3OLQA 4WAUA 4JFAA 1K6XA 3ZJUA 4FJ1A 3P4UA 4HI0E 1DCTA 3LP5A 3VM6A 4RK4A 4F2HA 1XRNA 2PANA 2KS6A 2V7VA 4DR4B 3IUQA 3HBFA 5DHPA 2HHHB 1Z25A 3VPSA 1Y8CA 2W71A 3H0CA 1VE5A 1GSOA 5LLDA 1U4NA 2EQ5A 4R6WA 3L0DA 1E2KA 5B4TA 1N57A 3BWXA 3F9RA 2JGJA 4PYLA 4EX6A 1KMHA 3K8YA 1OTRA 1Z75A 2AQ8A 4L02A 3QITA 2JJ1D 4YMGA 4FYXA 4Y2PA 3LCVB 1YIAA 1R37A 3NEPX 3Q7TA 5IJZA 1H2BA 1WCYA 3D3WB 3RC3A 4M1ZA 3LGXA 2C2HA 2EQBA 1K08A 4JJ7A 3QVMA 1TYBE 2P6RA 3BS4A 3PRJA 3LDAA 4DABA 2UYYA 4GMDA 1JL3A 1II9A 1DWUA 4P4SB 2BFCB 3OY2A 1Q50A 4FWTA 1DEOA 2LP4Y 1NR5A 3ZE1B 1JHMA 1OPXA 3GUUA 4OHWA 4NG5A 3UJ8A 1N32M 4JI7B 3OX3A 2IV2X 4GVPA 4MWTA 5FB3A 3D6AA 4DV7M 1FFYA 4JGIA 3RIMA 3VH3A 1GNRA 2F59A 3A1NA 4QUDA 2VH2A 1AQIA 4IZ6A 4ZGBA 4E15A 3UGQA 5FSWA 3EG5A 4YMUA 4NK5A 3AKEA 3HR8A 3U7GA 2QUJA 2XPCA 4CF7A 3JWGA 3VR6H 2ENUA 4NHOA 4HX9A 4AICA 3WAGA 2C7BA 1M8JA 1I94M 4LFAM 3BCUA 4Q4LA 2Q0QA 2P11A 1LWNA 2MT9A 1RPAA 2AXEA 1MIOB 2XYQA 4UM8B 3CW2A 3EBOA 1UZAA 4GL4A 4HNSA 2VQFM 3HQ4O 5GP1A 2QGNA 3R5SA 3BORA 5D85A 1XKLA 3A8TA 9LDBA 3VDRA 3FZEA 4G5OA 3DMDA 1P39A 3C6KA 4P4TA 2FW8A 3A27A 3K0SA 1ZM7A 4IDGA 2BCEA 3GRAA 3WGJA 3H1TA 4E07A 1D1PA 4OU7A 3JD1A 3KKKA 1SG6A 3AYXB 4AWBA 2YQZA 2ZB2A 4O4HB 4ZREA 3O7WA 3RSLA 3JAKB 4IEFB 3GELA 3V4LA 2HIMA 3TCKA 1PR0A 3NWBA 5K8IA 2NP7A 3JQ7B 3KSZO 3U09A 4QU0A 1MZVA 4PAWA 2G9RA 2XQGA 3CLKA 1ISFA 3RIYA 5EAIA 3DL0A 4B09A 3KUKA 3JQRA 5ALSA 2LRHA 4MVJH 4X93A 1YB4A 3GPDG 1A97A 1TX4B 3UFBA 1V39A 1VMEA 3IE0A 4ZOLB 3T1HM 2X8LA 1BOFA 1F14A 4O4IA 1ZVVA 1LDGA 2VPIA 4DVJA 1Q6YA 3FYSA 2QUHA 1UUFA 1KBZA 3SATA 4IV0A 4LFBM 2ERXA 4P7FA 3E8MA 1QO0A 1Q39A 3QVSA 2AW3A 1DJQA 5JISA 4WK0B 3WGNA 1XMOM 4L8WB 1UBSB 4DT1B 1UBOS 4NRWA 2QNBA 3D3KA 1VIAA 5B58C 1TNDA 3EPHA 2ZJ4A 5H70A 4EP1A 5CW1A 2A1UB 3I12A 2JJ2D 3I01M 1HURA 2DTXA 1XDDA 3UB4A 4R5MA 3QVVA 2WYUA 1XTPA 2QXYA 1QK5A 3CVUA 1BS9A 1V6AA 1JPVA 4X1YB 2H11A 4TGLA 2Z6UA 4XM1A 3RARA 2XMQA 4I1YA 1C7QA 1O1YA 4PSVA 2Z4SA 1XZ8A 3NANA 4JJGA 3TWLA 4H35A 1U8TA 1Z39A 5ALJA 2Q4RA 5K3DA 1HT2E 2QORA 3WWEA 3T3OA 3UUGA 2GRJA 4OJQA 2RGRA 4PSKA 3VYWA 4PBRA 2OOBA 2AZDA 4BP3A 1WIWA 5HZGA 1Z82A 2PLAA 5F4ZA 3SXUA 3BD6A 4EJSC 5FO1A 1XJ5A 5B6IA 3TOVA 3OIYA 1N2CA 3LHIA 4IXTA 1V3VA 3L9WA 3ONFA 2HA0A 3RIXA 4LGVA 3PWKA 1T2AA 3UHPA 4AY5A 3OX1A 5L45A 3FVWA 1O6CA 4DB2A 2ZRLA 3VDQA 3D54D 1HZZC 3PPVA 1QVWA 1QE5A 4M1TA 4PSCA 2VJCA 3ZY2A 1IZZA 1ZD1A 5IYZF 4OQFA 4JBXA 4KO3S 1R8YA 3QEOA 5E9AA 2F5OA 4AJJA 2AZ4A 4JHLA 5EVCA 4XTRA 4Y28F 1BEZA 3IHWA 1SOMA 1D5WA 3WGZA 1A8UA 1PLLA 4O8ZA 4CTJA 2PBFA 1FC0A 4OI1A 1VG0B 3TQQA 5C1OA 3MMNA 2CF5A 4QVGA 1VCNA 2OHXA 3GZTB 3FCCA 2W2KB 1FTYA 4NPHA 3JZDA 4J7UA 1V4BA 3MS7A 1GPH1 3FCOA 4EY3A 1EXMA 2FDRA 4CI0B 3JTMA 3QXJA 3MJDA 2QV7A 4QT0A 1DTWB 3ETEA 4JROA 2O48X 4YCCA 3CQ9A 4DM7A 3VZPA 3K9HA 5FUVA 3L1IA 2WINI 1COWD 3PCTA 5A9TA 1V9SA 2JVIA 3IDQA 2A30A 4J1SA 3BFXA 3OG9A 1N2GA 1R12A 4F86A 2VNHA 2XUHA 1KOLA 1Y9EA 3LW8A 2VOJA 2CL6X 1SEPA 3KVOA 3L07A 5EKUA 3QWAA 1QCCA 5LD2C 3BE5A 2DEUA 1ORDA 3DDZX 2AR7A 4ZOEA 1DQYA 1GTJ1 5CGZA 2A3NA 3AEQB 4AUKA 1FL9A 3QBVA 3RLIA 4C4OA 4U5XA 4EFKA 3FOEC 5EIAA 3Q9LA 4F93B 3KKLA 3GRCA 3TEFA 3FWKA 3U4GA 2YFKA 2JZCA 4WN9A 3A6FA 1ZCFA 3BSWA 4KFUA 3FKSD 3MHVC 2PBRA 4ZAXA 5IKXA 2R7MA 1T1IA 3R0IA 1Y8RB 3A1SA 1WMAA 4WIAA 1E1RA 2RH5A 4LE1A 3SZGA 3Q15C 4B3RM 1KYQA 3H5LA 4WKGA 5A06A 4X64M 3BXGA 2Q5IA 2OXIA 1N25A 5ESRA 3B7GA 3ECSA 4TSFD 1MX9A 2R6FA 3HB5X 4C0HA 3W9SA 2C7OA 1G3UA 5TT0A 2X4GA 5L3RA 2EHDA 1JR3A 4LY0A 2EJVA 5I7SA 1ZMTA 4D2IA 3DZ8A 4JOBA 2XB6A 3MLAA 4TV8F 1LPSA 1WZEA 3FKQA 1JAYA 3FTCA 3B3QA 4ZDIA 4LJ6A 2H48A 5CT6A 3FKEA 1GQ2A 4DRYA 2BGUA 2ISSD 4E94A 2RHDA 1MDBA 4NQZA 2CDCA 1FMFA 4J4HA 5HMLA 4MGKR 1ZU5A 2X42A 1TA4A 1QH9A 5DYGA 4J4BA 1OTYA 2X77A 4IXMA 3GA5A 2DERA 4P83A 4TSRA 4W7IA 5I9IA 4FOLA 4GPBA 5CITA 1HEYA 4L3VA 4GOLD 2RI6A 3R3WA 1QMPA 5E7MA 4B0PA 4D1YA 1EDBA 1G3MA 5LMUM 1GGVA 3A1EA 2DHRA 2W0SA 1FDSA 3LVRE 3FNQA 2JIZD 5H7XA 2ZJZA 3CN7A 2XCQA 1K2WA 1GZDA 3DE7X 4M3NA 2AI2A 1BE0A 3ZCPA 4LSGA 2PUVA 4TS3A 3V4FA 3TVYA 1EGVB 2V8BA 3VR0A 1KY3A 3D4LA 4RPLA 5BOSA 5I5GA 5AKJA 4BC1A 5JCXA 4LOAA 4Z1OA 2L19A 4DV6M 2NW6A 1DKQA 2H9AA 1LQUA 4ZCSA 1L3IA 2M6KA 1G7SA 3GWGA 3DFFA 2ZAMA 3C41J 5BRAA 3ZHTA 3FLMA 2IKSA 3U9LA 1JFFB 2IPNA 4OQPA 4ZK2A 3Q72A 2I2FA 1XEWY 4KSBA 4C7XA 2O8CB 4EKNB 1QVVA 3PDIA 1X37A 3TSYA 1LVHA 4M46A 4CGYB 1HT3A 2YWXA 4PG4A 1G3IA 3A9SA 3NKVA 2J3HA 1WXIA 3MS4A 2WNIA 4CM4A 1IMJA 2XT6A 2C8LA 1LLFA 2IS1A 5GONA 4B83A 4FZ3A 1W85A 4GX2A 4I5IA 3G49A 2Y71A 4EVIA 5JHHB 4BFLA 3DHVA 5TY0A 1Y3IA 2PEZA 3E18A 4BO1A 3GRVA 1LJ8A 3ZJVA 4UBJA 4YV7A 1MPTA 3D8RA 3O26A 4JUAA 3VNVA 4PHTA 1CZRA 1VA5A 5KPDA 3FFXA 2R8XA 1HH4A 1M33A 4F56A 4D9IA 1OKKA 2ZRHA 3X43A 3SIWA 5SZIA 3QBTA 4AJ4A 1NE2A 3VC2A 5EJIA 2HK9A 1G5RA 1ODSA 1NBWB 2ORWA 1PHRA 3LC1O 4BTVA 2B0CA 2P5SA 2YV1A 1G8YA 2HYIC 1MVOA 3TVTA 5IVPA 1JQKA 4YCJA 2QX6A 2X2PA 4P5DA 2XVZA 2JA1A 2WP0A 1BHO1 4I1SA 3GT3A 2X6QA 3BCRA 2Y0EA 2DQSA 1O95D 1U3FA 3HWSA 4MUIA 5AICA 3FUTA 3H1EA 1XNQB 1W0KD 4N0DA 4YCAA 2W8ZA 1QH8B 4LQDA 4UULA 1E9CA 1MB2A 4S2EA 2J4CA 4M98A 1YJQA 1CY6A 2WHRA 1K3FA 2F8TA 3AU9A 5JY6A 1XK6A 2H59A 2DULA 4DWVA 4UQOA 3S55A 3WJ7A 1D0IA 2OGUA 1IHDA 2HWJA 2ZUBA 5DHAA 3EVZA 3EIUA 1W4AA 1YHZA 1CNFA 4NNPA 1LF5A 3FSGA 4HQOA 1SUAA 1USKA 1NW6A 5K0GA 4UNRA 2F43B 2C9DA 1YU9A 1GSHA 1P3QQ 2UUBM 1WV0A 2LW7A 1V1RB 4RBNA 5AVOA 1B8PA 1N2CE 4Q3LA 4AF6A 1NQWA 2I5PO 1P9NA 2IP2A 3UHOA 2HU8A 5BUZA 1OXMA 2NYRA 1DT3A 3GUYA 2GPSA 4CR7A 2WHQA 4ESOA 4YAOA 3RRXA 1RWNA 1NM5C 4YDRA 3EGDB 4P2BA 2XF2A 1ISGA 2JNHA 5EQDA 2OAGA 1LTKA 4DV1M 2XCRB 4BVAA 1W46A 3AHCA 3DFZA 1U7OA 4BNWA 4YRGA 2DTEA 3WLFA 5JXJA 1YS7A 4ARBA 4RV5A 1TQHA 3DB2A 1Y6GA 3NZEA 1E69A 2C29D 3MC1A 3H4MA 2NTNA 4EKIA 1AU9A 1L5WA 5AK3A 3WYCA 4BU1A 3ON5A 2VRWA 2GPAA 2PJRA 4W9RA 3KXEC 2CVQA 4ETNA 3PICA 2CFRA 2XUJA 2JGLA 4HC4A 2LVBA 3NPAA 3R7NA 1CLEA 2PUCA 4KUEA 2TMYA 1UC9A 3I3OA 2NADA 1A2KC 3UAGA 1KAOA 1C80A 3FCAA 1QOZA 3QPWA 2XMPA 3NHMA 3TLYA 1Y3FE 1NF8A 4RTLA 5CBPA 4FBLA 4L9WA 4R8KA 2R1UA 3WL4A 4UHCA 2C58A 3H13A 5ALZA 1ZMBA 3D8HA 2QDKA 3I32A 4NH4A 2WFLB 3K6RA 4BASA 2QENA 4BEBA 3HZRA 3TI9A 3TLEA 2CJXA 4C4YA 4G81A 4DR1M 5K0BA 2GYWA 4UOZA 4Z1MD 4MA4A 1G21B 1O57A 4JFRA 1K9SA 2ZR0A 4PE5B 2OILA 3C7AA 3HKDA 2PSHA 1YBMA 2DFDA 4NIMA 1QWSA 4FU0A 1KRXA 4HNRA 1IBMB 3O91A 2P2SA 4ZKEA 1RMTA 3A3KA 2XA9A 1V35A 4DWWA 1LBQA 2OMKA 1C4OA 1XF9A 4BKQA 1XHFA 1WMDA 5DRYA 3SJUA 1KI2A 4M55A 4KPYA 1OTXA 3EPPA 4ASUD 1UPTA 1TGVA 1QRDA 1CQJB 1VSVA 2Y05A 1QWOA 4AD8A 3F73A 1GVNA 1XA4A 1AKUA 5E6SA 4AX4A 5AVZA 4MICA 3ILKA 1XTVA 2XI4A 4K9QA 4ZHQA 3VI3B 4ZDJA 3RAFC 1CUZA 2XMCA 3CXRA 2PUEA 4YR7A 3L6BA 5JFTA 2R4JA 2WQZA 4A0QA 1K4KA 2JH9A 2V7QA 5CP8A 2FGJA 4BX0A 4BJHB 3STYA 2GI4A 3DAFA 4JKIA 4RPJA 5KWIA 4FHDA 1YZVA 1P7VA 4MW6A 2AC2A 3T3PB 4MHSA 5KTYA 4F8YA 1KDRA 1NP6A 2ZVQX 3KHTA 2P65A 2MYTA 1NVTA 5EXDA 3HEMA 2OWDA 4D79A 1SVOA 2MR5A 3I4FA 1NMEA 3KUDA 1QP7A 2GK7A 2VNKA 1IM8A 4KGDA 1GGKA 1C3OB 4Q1BA 3LUJA 2O7QA 1L7RA 3TBFA 5CT4A 3HFRA 3FVVA 5G4KB 4Z6KA 2PS3A 5L4NA 3I83A 1VJ5A 3QQPA 4YXWD 4TTQA 5DN9A 2WTUA 2A0UA 1Q16A 4G41A 2G9ZA 2GM5A 4LDNA 4BVHA 3GCXA 3U16A 1MX1A 4R1LA 4H7HA 4CHTB 3CNOA 3QMMA 4QNMA 2B5VA 3FD9A 3B51X 3OKAA 3OTQA 4LWOA 4KFSA 1PZXA 5IXJA 4I7EA 5CVTA 1BVRA 1T8YA 3I30X 3T41A 5TNXA 1UZLA 2BNKA 4UNQA 3EQZA 2A1TS 4C7OB 4DPMA 1U11A 3VO8A 4H3HB 2QL9A 4UU7A 3KQLA 2WTBA 3BGSA 1ULUA 4NMHA 3EIQA 2J1LA 3NH9A 4JLSA 2R1VB 3S8EA 4KEAA 1TTTA 4DLWA 1COZA 2BMWA 1SIWA 4AU1A 2ZIAA 2Z04A 2PX3A 3VOAA 1GPAA 2BR4A 3RSZA 5DFAA 1YFLA 5TT1A 1DKMA 2HN9A 4JP5A 5IT5A 3LUAA 1BQ3A 4EW2A 1JGTA 1ZY2A 4DV3B 3FBWA 4GUAA 2QQGA 3Q0IA 3TNJA 5F7XA 2HB6A 1JKJA 4KHPM 2GCEA 4RCYA 1YZQA 4I1PA 1EWKA 1MVLA 4CV3A 3SN6A 1VMKA 1U81A 1PHPA 2Q2EB 3IE1A 3R6WA 4IJVA 3WKEA 1UWKA 4JI6M 3FKJA 3A6DA 3K1ZA 2JCGA 2RCYA 1DPGA 2ZYUX 3L4EA 2X9NA 1KI6A 4PLGA 1JYFA 1SU6A 4UFPA 5FHRA 4E3WA 3ADCA 4MINA 4CEIA 2XNDA 5BN4A 4OFWA 1OWPA 5T7BA 4I66A 3SMPA 1DBPA 4BMVA 5CA0B 3JD0A 3T8YA 1VXOA 3MD0A 1MJNA 3N59A 1RHKA 1SCUB 4TS4A 2XT9A 4LYEA 5KIAA 3UHFA 5E8JA 3KDAA 2HX1A 3ESAA 2VDJA 3QWFA 3ETHA 4CV2A 4BQRA 3T7KA 2LVQD 4FLMA 3R7BA 4MKGA 4A0HA 4MS1A 1ODLA 2CK3A 2QMQA 4F9TA 1HE4A 1R27A 5JZMA 2ZB3A 1HUQA 1J33A 1P8JA 1NKVA 4AUNA 3GRUA 4LJKA 1WPXA 4H7PA 1BROA 4ZXFA 4RTJA 5HQJA 5ITRA 2BGGA 2RK6A 4JI0B 1Z2EA 2XDQB 4RK0A 5BRJA 1H1LB 4YBZA 6REQA 3B53X 1W2WB 5JXIA 2ZAYA 3S5JA 4B73A 1ZK0A 5BORA 3I92A 3O4VA 1OCEA 1I1QB 5FAXA 4QGGA 4CIAA 2BMAA 2HADA 2B21A 1TYEB 3K0CC 3GQ5A 1U0HC 3I34X 2CJYA 3GLRA 4D7AA 2AJTA 5A5DA 3BXWA 2GBLC 2IY8A 2NYAA 5B12A 4CQMD 1ACMA 2Q8NA 3OQIA 2FVXA 2PH1A 2RRUA 4U9HS 3IRUA 3H5OA 1N6KA 1HNWB 2WUVA 4P3KA 1UFZA 1UJCA 4FDMA 4C3OB 2D2VA 3FYUC 3NT4A 1T0IA 3HFJA 4I5GA 1E64A 2XRZA 2ZTDA 3B6ZA 1OT5A 2EVWX 4MQ6A 4OQLA 2XZOA 3ZVMA 4Q9HA 3K9WA 2CN1A 2H2GA 2IVZA 2CHQA 3DBVO 5IULC 5DEOA 4Q9NA 4R8RA 1T6YA 2CFIA 1PP4A 4BRSA 1IU9A 1M2NA 1F2TB 2E4AA 1TKAA 1QM5A 2AEEA 5FJJA 3GFVA 4UHKA 1W75A 5ES3A 3TBHA 5KQGA 2WMYA 2X7XA 5FPQA 3OJEA 3IR6A 2X23A 3CX3A 4OSPA 3WWOA 3ZQJA 5REQB 1E3MA 4LBYA 3O92A 4KWTA 2WIAA 4DM4A 1NRXA 1JPUA 4JJFA 5I3CA 2XWBF 4Q1FA 2FPGB 1BWSA 3CLTD 3SD7A 2VUIB 1AUXA 4CM9A 3N74A 3EQ6A 4UVHA 1GIAA 2V0NA 4G1EB 5KEIA 1QMGA 1NUSA 2WOJA 3VJMA 4J91A 3RGWS 1UBMS 3KS9A 4FI3C 3S7ZA 2ALJA 1ISRA 3KZVA 4UCXA 2Z98A 3PXXA 1AXEA 1Q17A 4Q1CA 3JARA 3QKWA 3EDQA 5LR6A 3UWOA 1XAJA 4LZWA 2VXCA 1MRNA 4C2TA 2PYDA 1OHHD 1AGNA 3GPXA 2JLSA 4FGSA 4MRPA 1S0UA 4MR7A 2UXCB 2QTWB 2B2NA 4YMWA 1Z6PA 4KVZA 4G8BA 1UEJA 1XTIA 4LRTA 3TD2A 1L1ZA 1XU9A 2JH8A 3OSUA 1UXHA 2XA1A 5ELXA 4J7XA 4YT8A 3F3YA 2Z5FA 3LNTA 2OY0A 3RKSA 2DAEA 3WRXC 1KO7A 2J5XA 4RD2A 1KK1A 2FQWA 4FFOA 3UJCA 1U28A 3UG7A 5K3BA 1E99A 4F4CA 3K70D 1IUOA 5BUQA 5FTKA 1RQNA 1T5IA 2M98A 5IAGA 2I2WA 1N9GA 2IODA 3ZI0A 4FSHA 3KZMA 4RGQA 1SB9A 1A7AA 4YLYA 3SE0A 4F5ZA 1GARA 2A35A 1KH1A 4QUJA 1XXHA 1PUXA 4EB6A 2FEPA 1AKYA 3L9XA 2QXTA 3VTKA 1OAKA 2WKSA 3WQHA 4MROA 2PKRA 2O2EA 3ELUA 2E5WA 1A9YA 3K5IA 1ILWA 4G0QA 2YHSA 4D0NA 4ER5A 1AUOA 3E61A 1LGYA 1E60A 1TQ4A 4DV5B 1JHYA 3B5EA 5SZJA 3L0YA 1G8GA 1FE8A 1NKTA 3WB1A 1AIPC 3T99A 2RGAA 1BSVA 1VLZA 6Q21A 3K9OA 3OHSX 2V7GA 2OAQ1 2YBEA 4D41A 1CY8A 3TL2A 4Q4AB 1MOPA 2VFAA 1GG8A 3G1WA 3OU7A 4NBTA 2OZVA 3G1UA 4NC9A 1AK9A 1SOWA 3NJ4A 3TZEA 5FORA 2IOFK 4WLVA 2WM8A 1KQOA 4TLMB 4TT3A 1V1JA 3UK6A 1Z07A 4JGGA 1GL6A 2JJYA 1P4AA 2YRWA 4HDQB 2HT6A 4IBGA 4HADA 3K05A 2KNAA 1J1UA 2IUEA 3TDNA 2OE2A 4MGKE 3CLSC 4N3NA 1J1IA 2R4UA 4HFRA 4KXNA 1IN5A 2VPTA 2QL5A 3NKFA 1FUIA 4XVUA 2ZIXA 3JR4A 3QE2A 2V5UA 2Z3VA 4CM1A 2CFSA 4HEJA 5THXA 2OLKA 3UMRA 1G20A 4CI9A 5HIJA 1J9GA 1IJKA 3KSJA 1UMDB 2FSHA 1JPNA 1XRJA 2PS9A 3OEHD 5TMDA 3BB3A 2BGJA 4MSUA 4Z7NB 1IATA 2H00A 5EHQA 4OHYA 2Z56A 4M21A 1OXXK 4BJ6A 2ISQA 3TOSA 4KQJA 1RKVA 3W90A 3Q2OA 3RI3A 4KTVE 1JXOA 2JBWA 4GKVA 4X97A 3G9UA 1K0FA 4RE5A 4ESHA 4J7AA 1A5TA 1PNQA 3S8MA 3K1TA 1A7UA 4FYVA 4E2XA 4AQDA 1NQAO 2PCLA 3D8NA 1Q74A 5CK5A 1R4MA 4GSKA 1NDHA 2VYVA 5F5LA 3HDJA 1F6DA 1L5HA 1KZ9A 2ZSDA 2RGOA 1L5LA 4QYIA 2WSCF 4RTPA 1JVSA 2UXBM 4LRWA 2CNLA 3WE7A 1J5PA 3FWYA 1KKLA 1CR1A 3IP7A 7REQA 3PIIA 3NNNA 1ESEA 4COOA 4HXEB 4Q03A 4N49A 3QPVA 2DLNA 5DM0A 3HUEA 4MR8A 4B7UA 5AQ1A 1D7AA 5KHAA 2H2DA 1C2YA 3SJZA 3SBDA 1FQKA 2FHPA 3EWSA 3U3RA 5BSEA 4YRDA 1IEXA 4WZBE 1E61A 5EXTA 2P62A 5YASA 4LDQA 4GHAA 2YYSA 3WAJA 1FVFA 1VHDA 4YCBA 1F06A 3QJ5A 1M75A 3N7UA 1RJ9A 3UAYA 1E58A 2P6UA 4PPQA 4OVKA 4L9SA 1EFRA 2OFXA 3TO5A 3HGTA 2Q9CA 2Y67A 1UBJS 2VO1A 1YNSA 1VSBA 1R4AA 3SX0A 3LPLA 4IR7A 5ADHA 4F4DA 2VAPA 1M1UA 1YD7A 4UPVA 3AIKA 3KQPA 3QOWA 5L3SB 4MR9B 3VPHA 4PLPA 3OKFA 1XIVA 1BKDR 5E8RA 1MC5A 2J3KA 5HIAA 1X1RA 2I87A 4ZP1A 1TQ8A 4GPZA 4HVTA 4HWGA 1PJRA 5BSRA 2GLXA 3CW8X 4Y9SA 2PVSA 4DLKA 2ZI4A 3DFIA 5ADWA 1BFDA 1DQPA 4LF7M 1M6VB 1I4DD 1Z06A 1KJYA 4C0BA 1NT2A 4PIPA 2WTEA 3GRKA 3AHFA 1XNRM 2KHHA 2VH1A 3IQZA 1ZSYA 4F4JA 3G8AA 1X0XA 2M32A 3GT7A 4DRXB 2RGXA 3MTBA 1OBOA 2P9TA 2H9IA 4BVJA 1DO2A 4YI5A 5L7WA 4DG5A 4TZ0A 4PLFA 3TLGB 3RGSA 5CLFA 3BXEA 4JR2A 2C9YA 4YTEA 3TFQA 2FOIC 3ABIA 2DF8A 2JFFA 5CM8B 2WTXA 1W30A 4JL6A 1BHQ1 5K0JA 3RHZA 1Q1EA 4P4GA 3ABZA 1W4ZA 4Y1GA 1SVMA 1JHDA 3V00A 2PDAA 4LZLA 3L8GA 5ILGA 4MW7A 2VOEA 1GQYA 4EKGA 3CMCO 2HWWA 2ZJ8A 3DZGA 4TMVA 1V92A 1Z3CA 1XAGA 1JU4A 3PEFA 3H9UA 2C2WA 3TB6A 3WWPA 4NSRA 3K16A 2HA7A 3ZV7A 1FQJA 4OIMA 1Z7GA 4L3WA 3VR4H 4N3GA 1G64A 3E3LA 3QPDA 1TAQA 4TXJA 2LZ0A 3B1FA 4JUDX 2H7XA 4DR6M 2N75A 1K5GA 3OZUA 4UU8A 3GT4A 1M1YB 4MUJA 1QZXA 2GJAA 1MTZA 2HDOA 3NIGB 3AV3A 4DKJA 4HYQA 2J0UA 4KW7A 3ZK9A 4DCUA 2IUSA 4JBWA 2QX4A 1FX0B 1WXQA 1M74A 3ZBPA 1T4CA 5L95A 3H83A 1EH5A 4CEHB 3DR5A 1JI0A 1JG7A 3CLVA 4I5EA 2YYZA 4GPD1 3PUIA 2LE0A 1ITZA 1Y1PA 3USES 4MK4A 3T3GA 2X6TA 4POAA 3VAZA 1XD2A 4GXTA 4PDGA 2VWHA 4WKNA 3DEYX 4TKLA 2QDXA 1PTJC 3ZWDA 4V2UA 3BE8A 5EPEA 1QH0A 4RF4A 1J0EA 5DXFA 1SA0A 2WUEA 3T7AA 1EK6A 2VC2B 3UN1A 3BE4A 1I8TA 2GT1A 4NBLA 2M2IA 3VU0A 3T1VA 4RQAA 3JVIA 4KAJA 1KXZA 1XXHE 4GHWA 5FXMA 4LC1A 4RF2A 1G5IA 3BN3A 2B2CA 4L6IA 3P0JA 4XWOA 4JYMA 1XLTA 3IPAA 3H4IA 4U0KA 2IS4A 3GFRA 4L85A 4EI9A 1RE1A 3JRWA 2OZEA 4QXRA 2GJSA 5HJ2A 3FR8A 3MRSA 5G0VA 2J6IA 3O9VA 2O3JA 2PGLA 3ZWXA 1NNUC 4EFLA 3RKUA 2ZT5A 2QTRA 2IDZA 4PG5A 3IEUA 1FTNA 5BNWA 4OL9A 4TOIA 4W99A 2W98A 5DW0A 3CPEA 3ZQ6A 5L40A 3ESXA 3VVMA 1JMVA 1Q7EA 3WV4A 3K0HA 2PS1A 2UYGA 2XLCA 3HB7A 2P6NA 3ANTA 3RRNA 5KTKA 5GGXA 1FRFS 2JJMA 1GSAA 5LC1A 1ZH0A 3RV3A 1O2DA 4KQ1A 2J3DA 4EPTA 2C5FA 5JRDS 1U7WA 1RYNA 4L3OA 1SRRA 2JFXA 5KTRA 4ARCA 4BMZA 4F3CA 1VE7A 2MTBA 1AO0A 3CA8A 4PTZA 3GUVA 4OLJA 3SF8B 1R18A 2JFWA 2RGNA 1NNJA 4KDEA 3A98B 3B3AA 3V34A 1FS5A 2Y1EA 1TRKA 5EJ7A 3EUFA 4A8JB 1D4FA 4FBGA 1DRJA 4O2RA 1MBZA 4MEAA 3FY4A 3ZDEA 1CR0A 4S1PA 2NU8B 3AQIA 1S02A 2AYYA 4MP8A 3EVGA 3T5AA 1M0SA 2CGEA 4ZU3A 4LMAA 3WYAA 1L5YA 1NW8A 4HGYA 4GRDA 2CCJA 4K7JA 2BHRA 3RUPA 3GEHA 5FUXA 2H1RA 2ZFUA 3DPSA 4I50F 1EP2B 2IRWA 3FTDA 1Q22A 5AKZA 1DJNA 2BDEA 5EJAA 2V6ZM 1MC4A 4BKUA 1EWTA 1MB4A 1GO5A 2YBDA 1SURA 4ZU1X 4JC4A 3D7RA 5J2TA 4E6EA 5KPRA 2CL7X 2ZYIA 3L7CA 4CJXA 5D2CA 4RMHA 2HDHA 1J9ZA 3VMFA 4I4LA 1M6NA 4DAEA 1O6ZA 1DV1A 5DGDA 1RRMA 4CTMA 2JAQA 1OASA 2K4MA 1W94A 1XSEA 3QGMA 4EK9A 3LGSA 4Z3KA 3U60A 3N0TA 3FMGA 1YO6A 2VDVE 5KS2A 4U6SA 2OGTA 1QO7A 1J49A 3LOUA 2GSDA 1OREA 2GEKA 3GEGA 1PBNA 2EO2A 4TV9F 5EYPA 1I30A 3ZJYA 3GR6A 2DBZA 1T9AA 4JN6A 5TSDA 4BKOA 4DC1A 3INYA 1X7ZB 1H6UA 2G09A 3TTYA 3JQ8A 3TFOA 4YJGB 1T8PA 3I1IA 3VTZA 1D8TA 2P9CA 1O8BA 4TVOA 1TO1E 1XTUA 4QXQA 4W8OA 4QODA 4DS3A 3W8FA 1P74A 1PJTA 4LEIA 1MP0A 1XQXA 5HX7A 2J8ZA 4P82A 1E3DA 1YV9A 2RJ3A 5IHPA 2JFBA 2ODAA 4NZNA 3PTZA 4DSAA 3OFKA 1NZFA 5BRNA 4F8EA 1OFHA 2D5IA 4CDRA 5CNIA 3HCPA 3LBHA 3O31A 1NURA 3PX2A 1NN1A 3E27A 3V46A 3MQ2A 3I8XA 1U1DA 2NYVA 4GDFA 4MRNA 1T6NA 1YASA 4JLUA 3UF0A 4EPRA 1GJTA 3W2GA 4UM7A 1BCRA 3ODPA 3VR3A 3W3AH 4L8LA 1MJ5A 3JAMA 3UGJA 4RTKA 5IWAB 4B44A 4PRYA 2GVNA 4YAIA 1SXGA 1VG8A 3R5TA 3U17A 3RR2A 1ZIYA 4KAXA 5JS2A 3IP6A 2P4SA 5H3HA 4CNBA 5HFJA 1YL5A 2HSZA 3DBLB 4OXRA 5FWAA 2BEVA 1EFPB 2FHSA 1XWIA 3O8QA 3N07A 2JHAA 2CBZA 1J22A 4HJXA 5BN3B 2APJA 2GPJA 2J31A 5IC5A 4C7BA 1WJGA 1RJEA 2GCIA 5DIZA 4AKSA 3IDZA 1G9TA 2FUEA 3OJXA 4JD5A 1ISMA 5DT2A 4YHBA 4FMDF 4EATA 1WXFA 5KNDD 4TZ6A 2JDIA 3EDMA 4JQCA 2P9FA 2QUBA 3FNHA 3CH6A 3EUAA 4AF7A 2HT1A 2LGJA 2V45A 2FRVA 3DZJA 1B6GA 1UWCA 2KLBA 2H1SA 5KUTA 8ABPA 3L2OB 2LBCA 1E4OA 1I1NA 5FP0A 1R4ZA 2W00A 2ODNA 1PJ8A 1U1IA 3ZVRA 3ZV5A 2WFMA 3P5SA 4HPXB 3F6CA 5SY4A 4HDOB 3JQAB 1Q0TA 1L4GA 5E1BA 1LTMA 2P5YA 2DBRA 2X1VA 1W4CA 1F4IA 5JQGA 3E84A 3N7AA 3RTDA 1YMUA 1IB0A 3MMPA 2ZSKA 3G6WA 2W37A 2EGHA 4BY9E 1AXGA 1W76A 3KHSA 2XH9A 2P0AA 5SZHB 1E9VA 2REQB 4M1QA 3EAFA 1SVUA 5D7NA 5EJCA 2OYSA 3UV6A 1Z4NA 1DDOA 2ZRMA 5BWOA 2PL5A 1KFKB 3UTDA 4ZZ3A 1DGGA 2BFMA 5A62A 1RZUA 3H2YA 4K46A 3PKJA 3IHTA 4QG3A 2LXNA 1XB2B 4II3A 3VR2A 3M49A 4XGKA 3KFLA 4O2BF 2OO5C 2V59A 3EGWA 4EFNA 1BQEA 4TWBA 5D87A 2O3TA 5HZKA 2MR6A 4PYIA 1VRVA 2XKKA 3LRTA 4OKNA 3ETJA 1R6AA 4UBKA 3U37A 2P1ZA 5AO9A 3U6DA 1U6JA 1Z0IA 4LDAA 4BGVA 1RRCA 1I36A 4KUGA 3O8DA 3STXA 2AUTA 4LTDA 1VECA 1OVGA 2XMSA 4OHVA 4RLFA 2EARA 1NRJB 1P3JA 1Y1QA 3FNFA 3QNUA 4LJ7A 2DWLA 5BR4A 2QAGC 3OURA 2KA6B 3IKMB 4ZVQA 1CEEA 3TI7A 3IE2A 3W5SA 5JZ9A 2YDYA 2JBHA 4CLRB 4B33A 1V41E 1Q6ZA 3DLPX 2C94A 4GSYA 2XB9A 5J9FA 4IDBA 2HEGA 1CEXA 4QQKA 4LRUA 1U3WA 4TN5A 3K2QA 3ZS9A 5TMEA 4NKRA 3ZNPA 1KYVA 2FR8A 4GU5A 2JLBA 3LCUA 2CXQA 3HB9A 3QE9Y 3G8CA 2J0VA 1L7OA 3NATA 2V03A 3ZHQA 2V7EA 5JSFA 2PXCA 1QJCA 3CRMA 2C00A 1P6UA 2H08A 5A04A 5TQJA 2GNPA 3E70C 5JZOA 3GNTA 4JI5M 3GQ4A 1E1QA 3L7AA 3T3HA 5CT9A 2AXNA 4FCCA 2WT4A 5CVEA 4D4MA 3A70A 2JCXA 2V8OA 3OY7A 3IVRA 4UMVA 3TMKA 3ZS8A 2OB2A 4OFBA 2JLWA 1E1LA 4WY5A 1BXGA 1EG7A 3HKPA 3LG2A 1JDNA 4UDOA 3HVIA 2BFBB 1K8QA 4YRPA 4JMPA 4BNXA 3F47A 2V3CC 3I2YX 5CR9A 2A84A 3ZVKA 1A2OA 2CJPA 4DARA 1AQUA 4BRWA 4E5NA 3QSYA 2DY0A 4ERNA 1HYBA 1HFWA 3W2TA 3A42A 4RE6A 3MUFA 2GA8A 4JJ8A 2X4IA 3NUQA 4FX2A 2I91A 3EA4A 3PSAA 4B3MB 2QN6A 1M76A 1VI6A 4QPJC 4LI3X 4C89A 1J24A 2R3SA 1KEUA 4F2DA 4GM1A 3L4SO 4DQUA 5CA0F 1XU4A 3D43A 2F67A 1WDLA 1NBIA 2H0QA 1Q3BA 4TWJA 4BNDA 2HHAA 1RFLA 3LCCA 3AX6A 4F6LA 1SVWA 3PWSA 5BT8A 3IODA 2IPOA 4A10A 3ZC7B 3QVUA 4TMWA 5DGXA 1UPAA 1P5FA 3VLFB 4G2TA 3ACCA 1CRZA 2X0DA 1EJ6A 1HMYA 2ZPUA 4L72A 3F1KA 3LXXA 5LFAA 1Z5GA 4E4YA 3OA0A 1E9BA 4DV2B 3FDIA 5DIFA 3PFWO 3DDWA 4I14A 1ATIA 4UBOA 1LSSA 1PYOA 3HYSA 4N01A 3ZLTA 3GPPA 2WICA 2LTAA 1E79A 1VBNA 1YOVA 2NXNA 1C9EA 4KPFC 1XCJA 1AHIA 2YZKA 2UU9B 4XB6B 4GMFA 2FFBA 4G0OA 4CW7A 1E2IA 1AKTA 1BFUA 1U63A 4B0OA 5EZYA 4YRLA 3ONEA 2IS2A 1X8XA 1ML3A 3NV7A 5AKXA 3RLFA 2GTIA 1HT1E 5TJ9A 1RXEA <