1OGJA

Ferredoxin:nadp+ reductase mutant with leu 263 replaced by pro (l263p)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
molecule tags Oxidoreductase
source organism Anabaena sp. (strain pcc 7119)
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity
pubmed doi rcsb
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ogjA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ogjA02
3CCMB 4RD6A 1G7TA 1FNBA 1B2RA 1TTTA 4Y9UA 5H59A 1KK1A 5TV2A 3G4SB 2C77A 3ZZUA 1YJWB 4RD3A 1QG0A 1KRHA 5FA6A 3SJZA 5THXA 2BSAA 1A8PA 1QH0A 2BM0A 1N0UA 3QFCA 1BX0A 1BX1A 3CCVB 4N3GA 1QVFB 1IB0A 2EFGA 4P3YA 1E63A 1E62A 2BGIA 1EP3B 1KTVA 3LO8A 2YWGA 2XNJA 1YIJB 5GV7A 1JNYA 4Y7CA 3OJWA 3JQRA 3W2HA 3AVTA 2PLFA 2OTLB 4RD0A 1N0VC 1KQSB 4YAFA 2QDXA 2GPJA 3VMFA 4Y9RA 1K8AD 2YWHA 1K73D 1OB5A 3VO2A 4RD2A 2QEXB 3WNCA 3J81k 3WY9A 1HA3A 1QFJA 3ZZ0A 2AHOA 3CRZA 1KK2A 2CNDA 3AGPA 4IW3B 1VQPB 2NPFA 3CCUB 1OGJA 3FJOA 3CB4A 4WQMA 4B44A 4PC3A 1ZM4A 3WBKA 1VQNB 3CCEB 3AGQA 1QGYA 1DG1G 2VNJA 5DSZA 4J0QA 1I7PA 2BMWA 3WXMA 4TMWA 1ZM2A 1AIPA 1IJFA 2B7BA 3QFRA 4RD4A 3ZZTA 4FK8A 1FDRA 1H42A 2VNHA 2QTZA 1GR1A 3CC4B 2OK8A 3PENA 4NCNA 1SKQA 3B8HA 1QGZA 2ZITA 1TLLA 4MYUA 3P26A 3AVWA 1OGIA 3OZUA 1J9ZA 2VZLA 3CD6B 5H5JA 1EXMA 2BN4A 4ZV4A 2RC6A 4P6VF 3W2EA 2BM1A 4G5GA 2OK7A 3CPWB 1W35A 1VQ6B 3ES9A 3OJXA 2EIXA 4TMTA 4B3XA 2C78A 1KC8D 1KK3A 1BJKA 1F60A 2BGJA 4C0SA 4LC0A 1DARA 1B23P 1K9MD 3P27A 4EH1A 1ZM3A 3ZC3A 1ELOA 1YJ9B 4G1VA 1D2EA 1QFZA 2XEXA 4M1KA 3MCAA 4PC2A 1G7RA 1S72B 1JB9A 1GAQA 3B82A 4PC6A 1Q82D 1G7SA 5HXBA 1H85A 2PIAA 1VQ4B 1D1NA 4ACAA 3WYAA 4M0LA 4TN1A 4UAJA 4TMVA 3LRXA 1YJNB 1XE1A 4C43A 4AF6A 1DDGA 1QUEA 2DEUA 5KSWB 2BVNA 2FX3A 2BV3A 1Q86D 4ZGQB 3WNDA 3CCSB 1EFCA 4HE5A 3B78A 3CCLB 3CCJB 4RJLA 2J7KA 2BF4A 1JA0A 4DQLA 3CC2B 1WDTA 1FRQA 3W2GA 1FNMA 2DERA 3I56B 1YI2B 1EWYA 2D74A 2E1RA 3OZWA 1UMKA 4R71A 1EFTA 1E64A 3WBJA 1DDIA 2VYQA 2R6HA 1GAWA 1EP2B 1QUFA 1QVGB 1G7CA 4K1XA 1OB2A 3JQQA 3ZBTA 4H9GA 1YITB 3MHPA 4ZCMA 3G6EB 2VNIA 4F7DA 1CNFA 2DETA 3MMPA 4AF7A 3FPKA 2QMUA 3VO1A 2HMAA 3W2FA 3W5UA 1D8TA 1VQLB 3QFTA 1F20A 4YAUA 1KD1D 4YAOA 5AN9A 1M1KD 3VNUA 1ZUNB 2B5OA 4YAWA 3CCRB 4ZCIA 3U6BA 3U2QA 2YWFA 3A1FA 4TMZA 4B43A 1R5OA 1KJZA 3CCQB 4G1BA 3AVVA 1GJRA 3QSYA 4M2LA 4MYTA 3E20A 1W2BB 1S0UA 4LBZA 2BPOA 3W2IA 1M90D 4Q7JB 4RD1A 4QHYA 1EP1B 4FN5A 1N8RD 4B48A 3OW2B 1GVHA 3W5VA 1IJEA 2YWEA 4LBYA 4AC9A 2HCJB 1VQ9B 1JA1A 3OZVA 1KK0A 1TVCA 2VNKA 4B4DA 3CMAB 3LVBA 1FNDA 4N3NA 1FRNA 4HE6A 3CMEB 3AVYA 3W5HA 4ZCLA 4QFMA 1NJID 5GV8A 2X3UA 2RC5A 4YHBA 3V76A 1QGAA 3CW2A 4DQKA 5JBQA 1YHQB 1VQ8B 1NDHA 1W87A 4NBSA 1QX4A 4ACBA 2QN6A 3JQPA 1BQEA 1VQMB 4PC7A 1Q7YD 2QTLA 3I1FA 1VQOB 1TUIA 4PC1A 1EFUA 3QE2A 4LBWA 4YALA 1JJ2B 3CXCB 4B47A 1VQ7B 1U2RA 3ZBUA 1SM4A 1VQKB 4LBVA 2DCUA 1CQXA 1R5NA 1VQ5B 4ZGNB 4PGOA 3AVUA 4M53A 3AVXA 4TMXA 1XB2A 3U6KA 3E1YE 4U9UA 1R5BA 3LYUA 3VNVA 1W34A 2QA4B 3QFSA 4M4SA 4RCZA 3CC7B 2PMDA 5TR9A 1QFYA 2HDNB 2DY1A 4FWTA 3WNBA 2GQFA 4BPRA 5EMNA 2XNCA 1Q81D 2B7CA 1CNEA 3I55B 2OTJB 5TY0A 1GO2A 4RCYA 2CRVA 3G71B 1ZM9A 1FNCA 1AMOA
chains in the Genus database with same CATH superfamily
4CG2A 1TKCA 1UOOA 2Q2VA 2WHEA 1JR3E 3E03A 3SZOA 2J31A 2EL7A 3KJGA 4GYWA 4IRXA 4CZ2A 4WEOA 3QYAA 1XRPA 4PV7A 5BOSB 3ESCA 2L18A 4Q37A 3P20A 2NUAA 3TRJA 2O0MA 4D9HA 2H4XA 4YI3A 2AZXA 4ZT4A 1Z18A 1F2UB 2FFJA 3PYLA 4CTOA 5KTKA 1ODSA 2IS6A 4Y9UA 4PWZA 1L7AA 4F97A 1KERA 1T0PA 4IWYA 4BNDA 1D9ZA 5IFKA 1F5SA 2YJ6A 3AFMA 4TKVA 2REXB 4P7KA 1XNGA 4HMQA 3FF4A 5F2NA 4U7HA 3UY4A 3QW4B 1U7DA 3QU4A 3ONYA 2YYZA 2J3JA 3WB9A 5GTDA 3DXFA 4H15A 3IODA 2C9DA 4MVXA 4P4NA 1FJXA 3GL9A 3NDPA 1CVLA 4DWVA 3LY9A 3USES 5DM1A 4D8XA 5IG2A 5JDCC 2OQRA 2P6UA 1PDVA 3CN7A 1E2QA 2J0VA 2QD3A 3ZZ1A 4P4UA 2BFDA 1HQCA 2I3DA 3DDOA 1N5JA 4TZ0A 1GZ3A 3NPAA 1Y34E 1W0KD 3KQOA 3SDSA 2H4WA 3GD7A 3OSZA 4NE9A 5D3MB 1OV4A 5LC1A 2JJQA 1QNFA 2P1ZA 4TRJA 1HBJA 3TBHA 1O6FA 2B5VA 2LTAA 2VKQA 4KAJA 2R79A 2OA0A 4R3NA 3DLAA 4CMBA 3UMVA 2MHCA 1UQRA 1WV0A 3BWYA 1QC5B 3CX8A 1IB0A 2H4HA 3GLGE 3WYNA 3E4DA 1R4MB 4F1JA 3PNVA 4Y30A 2F00A 1HXHA 2EZ9A 4LF9B 4G0NA 4FXOA 4XLLA 4ZVUA 3UJBA 3EDOA 3ENVA 3AOGA 5DM0A 3ZWOA 2IXBA 3IUSA 3OJWA 4PGAA 2BGMA 1XTBA 5FQNA 4Y6SA 4AMYA 5IUNC 4KH1A 4P5EA 2AUTA 4F60A 1ABBA 2I2CA 4P7BA 2ORYA 2XSZA 1E1NA 3DMYA 3JYLA 4TKZA 1XEXA 5K0EA 1IUKA 2ET6A 1PLLA 1XU7A 2GARA 3CCFA 2X9VA 5IUKC 3LMKA 4P7FA 2RH5A 5HZBA 1R74A 3ZWYA 4E7PA 4BOYA 2VAXA 3DCNA 1YHYA 1V1MA 2UUCB 4PF1A 1DOAA 4Y6RA 1KEKA 2GPJA 1T2AA 4ZTUB 1H1LB 3P9CA 4H1VA 5AVKA 1VI6A 1NVBA 2CEAA 1U8ZA 3D6NB 3A4YA 1PEDA 3VMFA 3K5HA 2AL7A 4HDNA 3X1YA 4JJGA 5D5HA 3KZOA 3UXEA 1C0PA 3GJYA 1TYDE 4MX8A 4B0PA 1VBMA 1KO1A 1ZSVA 3UK6A 3C3EA 1VA4A 2R1VA 4G5YA 4K9SA 5IC6A 1KK2A 2QR2A 2WA1A 3HE3A 1MV5A 4OYLA 3DNMA 3A7EA 3T38A 4AY5A 2Z6QA 1TKBA 4WHMA 3WQBA 3NE5B 3I8OA 4PZYA 3W4KA 4KKSA 3CNNA 4I7EA 3BC1A 1SD1A 3S29A 2WT8A 5A4FS 2FQQA 1DDOA 3EXEA 4E88A 3BHIA 2CK3A 1DBPA 1GRVA 1BCRB 2P2ZA 3K35A 3ND7A 4CM1A 3D6UA 3KJZA 4INOA 2AQHA 4DWJA 2MTBA 3NETA 4BLSA 1TZJA 3R5SA 1HYGA 2QP3A 1BOFA 1X87A 3P45A 5AOAA 2O8NA 4NKRA 3K2IA 4RBNA 2ZBFA 5CD9A 1Y48E 4EVRA 1DOZA 1TM5E 4IDDA 1R8YA 4RHTA 4JXXA 1HF3A 1M1ZA 3DWEX 4TVKA 4A16A 5AI0A 1TC1A 4QVJA 5EPUA 5BNFA 1XTRA 3RUIA 1J1UA 2FR0A 1Z83A 1RZRD 2DR2A 2RSLA 1A04A 1KGSA 2QX4A 2HLHA 2B7BA 1FDIA 3LHSA 3RFCA 2IWRA 3RHTA 3I0ZA 2UVDA 3L46A 1Z6TA 3SR0A 1A5BB 4DF3A 1E58A 4TS1A 4TKLA 3OU2A 3UATA 5EQTA 2ZYRA 2XGSA 3FDFA 2VCYA 1DAGA 1O77A 5JHHB 1CY0A 5IT4A 2CLHB 1HEUA 1U3FA 1RBMA 3WMEA 2IYZA 1KOGA 3RCBA 5C4MA 1Q6YA 1XTQA 1PJ5A 1UD6A 3TQIA 1T9KA 4OO3A 1TLLA 3PA1A 5J47A 2LXNA 2A3RA 4MDEA 2CL0X 3EUEA 1QTRA 3BSSA 3NXSA 4UNIA 2JI9A 3UF0A 3DFFA 4IIDA 1QG4A 3I01M 2PUEA 5DNYB 5DVZA 3WO0A 4CDMA 2QTAA 3UMMA 1SKYB 4D5EA 2XDWA 4MINA 2CFTA 2QZ9A 1GTRA 2I54A 3H8WA 3OEED 3VGJA 1C2TA 1N92A 1XK6A 2G1UA 2X0NA 3MJFA 3NHMA 4DARA 4A73A 1VCNA 3EMBA 1X7HA 4EENA 1YULA 3FFXA 1JFRA 4TYMA 4F2WA 3BCFA 1V11A 5J2UA 3P0FA 2RHWA 3R0VA 1I3NA 1MB3A 1U0HC 1OWLA 1ZI8A 2G71A 4WWHA 1UPUA 3WOHA 3KK0A 3UXYA 4GPEA 4IDEA 1G2IA 1XA4A 1DBQA 4X5OA 4C3OB 3AFHA 3ILVA 1KK3A 3LBYA 4OL0A 1GFIA 3QVKA 2LGJA 1X8LA 4O4JA 3K9FC 3ELYA 4XWYA 1O4WA 1B23P 3LBNA 1BU8A 1WW8A 3WTBA 4DZTA 3CJQA 3TEMA 2QPAA 3B1ZA 2HK8A 5J4KA 3SJUA 4RTJA 4G56A 2GK3A 5A71A 1T5SA 4J91A 3WFZA 4L5CA 4QXOA 2WJHA 3O2JA 1IJKA 2C8VA 3WE7A 5C1OA 2UYYA 2Z5VA 5TF0A 2DQYA 3FX2A 2CXNA 3GVLA 2AN5A 1JILA 2MCFA 1ZJWA 5BV7A 4YCAA 1Z4JA 1USVA 3GQBB 1WHSB 3I45A 3ZYCA 1GNSA 1WJGA 4PC6A 1JJAA 3EEBA 4JJ8A 4JH0A 5DFAA 4ZT3A 4JI3B 1H85A 2OB2A 1EFPA 2ZRDA 4RIGA 4RX1A 5E7MA 3L7NA 3NBKA 5A6VA 5IVDA 4NBKA 2OYSA 5LDHA 2IHNA 4U6SA 5FPKA 1BGXT 2C3YA 3SVTA 5F7XA 1IZ8A 2YVUA 1O89A 1U63A 1WUYA 5AVJA 4PNPA 5BNWA 1T9GS 3K16A 2WT9A 5F1YA 2ZTLA 2FFQA 2IYEA 3O6VA 1NIJA 2BLNA 2WIFA 3DEKA 4OKNA 1M2JA 2Y0BA 3V3KA 1TFUA 4AF6A 3MGKA 2WB4A 4HJXA 4HNAA 4JDPA 1CC1S 1J20A 1GZ4A 4IV5A 3DEIA 4HC4A 1CEYA 1GL7A 4GAEA 1W19A 5CLHA 4A1FA 2C2HA 3RGGA 3GBPA 5JHGB 2NPIA 4L51A 4XEHA 4F4JA 5EFOA 3VSCA 1NTRA 3G8DA 3QF4B 2CXQA 3GBVA 1ZAYA 1ZU4A 4BMYA 4NICA 1KYZA 3ROEA 2YZKA 4HE5A 4RF2A 3CVUA 4FILA 2YFYA 4BB9A 2BRUC 1PK9A 1CY4A 1CUGA 1L8LA 1U1DA 3RTBA 3WGHA 1J2EA 1DQRA 4FCCA 4ZEXA 4YXWA 3IHTA 4V2UA 3GGGA 3WIUA 4BFXA 3UUWA 2WZDA 3DDCA 2RKWA 1XDSA 3O8QB 2ECOA 1YI2B 5FXMA 4CG1A 4QFBA 2JGKA 5DK4A 1DB3A 5EVJA 3ZJ5A 2D8AA 3S55A 3KXDA 2BONA 2XMSA 2H52A 1YU9A 2QL9A 3QLTA 3O31A 2SKEA 4YV7A 4TVSA 1DDIA 3OETA 3EIWA 5CPFA 4QE3A 1ST3A 2W2KA 1H66A 3G8BA 1RI3A 4F3NA 5CH3A 4XYBA 3I6IA 1WL8A 3OUTA 4YROA 3M0EA 4H3VA 4KQ9A 3H3FA 3MYRA 4R1TA 1L1FA 4H9GA 4XEUA 3TL3A 2X0IA 1U2SA 1XYGA 1YNSA 4I5FA 2X19A 3QUBA 4MR9A 4PZ9A 5FYQA 1VDMA 4PN7A 5BR4A 1CYEA 1NZJA 1QHNA 1XLTC 3CXRA 3PJGA 1DX4A 1N8TA 4UNRA 4NAVA 2YXPX 3T15A 5KVVA 3B9QA 1MB2A 4WKCA 3BK1A 2W9XA 3D4IA 1UJ2A 4IGEA 1SOUA 3NORA 2YHBA 5JVDF 4KRXA 1PGJA 2AFRA 3HJUA 1E3DA 1Y82A 3WLRA 4FGJA 4TRNA 1JKMA 1F8GA 2P9YA 4TXJA 1GV1A 2LCQA 1W0KA 1D7OA 2HMAA 3DT8A 3KDAA 3OIUA 3DM5A 4MRNA 5TPZD 3MPUA 5KUTA 2PLRA 3MYYA 2ZJ5A 3OQ1A 3FLAA 4BX8A 1VSBA 1KP2A 1F20A 3ZV3A 4B4OA 4DYDA 2O3QA 4F93B 3WLIA 2Y0CA 1KO5A 4LFBB 1R4NA 4EHLA 3W6ZA 1J7KA 1NRWA 1XQXA 3ABQB 1RQRA 2FN3A 1DCMA 2YC2C 2BFDB 3JQAB 1H69A 3OM9A 3PIDA 4NWIA 5G41A 3WLMA 1I2BA 1SKAA 3IRUA 4K05A 5BN5A 3NQ41 1LC3A 2JLYA 2PH3A 2PSEA 4G63A 5ITWA 2VZ0A 1Z16A 2HJSA 1RKXA 1W85B 2WPNA 1V8BA 2WZBA 2ZSDA 5TT0A 1WVIA 1Y9EA 3LIPA 1Z6ZA 3IB3A 4M55A 5IXSA 2H4JA 3E7FA 3EASA 3I4LA 1M6HA 1J8VA 3NJRA 4GVLA 1TLTA 1UC5B 4Y2YA 4C30A 4AY4A 1MC5A 2FPMA 3P0HA 4B46A 4EX7A 4P54A 4B3BA 4GGMX 3H19A 3PC3A 5BSRA 3VZCA 4EHAA 1MOSA 2C57A 1SR8A 2EKDA 2WSIA 2QSYA 3DFMA 3ICPA 3KOWA 1PW5A 2A86A 3AZOA 2RAFA 4Y2PA 4M1TA 1O8CA 1Q1BA 1WQ1R 2X42A 5KVQA 5U4XA 4OF4A 4XWKA 1P2FA 2QJFA 4RK1A 3DZBA 3OSUA 1TW2A 4N39A 3FMOB 1XZHA 3EXHA 1G6HA 2Q9UA 4YH1A 4IFTA 1LH0A 4CR6A 2VRCA 1V6CA 3LC2O 4I8DA 4EMTA 3BXHA 4UMEA 3ECSA 5BQOA 3RFXA 4BVFA 2HFKA 5CVTA 3W5VA 2IS4A 2B0CA 1P5RA 3H5NA 2R5NA 5E6RB 4L4RA 2E37A 4BZWA 2MMCA 3GUZA 3I5MA 3LPCA 3ACBA 3PPXA 2QSJA 1T9CA 4OM7A 5L51A 1OOEA 1VCHA 4FCWA 4FYKA 4BB5A 2QHXA 4YCMA 3FOEC 4KV7A 1S6YA 5L7WA 5K7SA 4EGAA 2J09A 4GOKA 1PCXA 1RRKA 2P77A 2ZB2A 4IIGA 4IV0A 4OOVA 2IY8A 2X15A 3FWKA 3AVYA 4ZQEA 1G59A 3CUWA 2FUEA 3TD6A 1CEXA 1WVMA 4UHDA 5LPNA 1FW8A 4CF6A 2GPNA 2V9CA 1LRLA 2TMYA 2Y2VA 3ESYA 2FFRA 2M98A 3A3OA 1GUDA 2AVDA 4I3GA 4UUQA 5FPSA 4X62B 1S89A 1YB5A 4G9BA 2X3UA 3T9DA 4ER6A 3H7IA 3UVEA 4R2JA 4E5PA 1M2GA 3MOIA 4RKRA 3NVDA 2AI3A 1VKRA 5BN4B 4DLXA 1UAAA 1HUQA 3OF2A 1QGAA 2RGBA 3TK1A 2WIJA 3FLEA 4OQMA 1EGHA 2QU8A 4GMFA 5J4YA 2INGX 2QRNA 4EKNB 2OECA 3QEKA 2F3QA 4OJQA 2QORA 2G5PA 3EFEA 3N7TA 4RF4A 1L4FA 1F5NA 5LMZA 5FOSA 1RI2A 2WP8J 3UA4A 1C3OB 3ZI7A 4MW0A 4H7HA 1COZA 1CT9A 3OA0A 4ENWA 1PDOA 2BHRA 1KH2A 4HQOA 5EWJB 4YACA 1ATZA 3KXLA 2IX9A 1Z88A 3BERA 3WQZA 4OQNA 5I7UA 1C7QA 2VK2A 4JR2A 4FHZA 4JL8A 4E94A 1J56A 2FG7C 2GXSA 5FFMA 1L7EA 1YZGA 3DO6A 4MWGA 4HG2A 2JN9A 3I83A 3EIEA 4W1RA 2JD0A 1A8IA 3FWYA 1A4RA 2HGZA 3DLHA 1VMKA 4DUPA 2OQVA 3VOTA 1XCJA 4H6WA 1Z0AA 4S1NA 3WIEA 3ZE7A 3VHXB 4E1BA 3KQYA 3ZNPA 1JHAA 1KSFX 2VPQA 4UPEA 5JSFA 2JLWA 3SHQA 2Z5FA 5JAZA 4P3PA 1DQPA 1T3TA 3ZUGA 3SEQA 2DCUA 4MIYA 1R5NA 3KT6A 4KE6A 4GX0A 2XCLA 3T8YA 3WYGA 2VZ8A 1Y8RA 1EFKA 4FE4A 4IG4A 4RKFA 2PJDA 4BV2A 6YASA 2AOVA 1BW9B 2BFEB 1OIVA 2NUPB 3E9CA 1P72A 1JL3A 4S1WA 4UVHA 4I2NA 5E8JA 5ICSA 4I0WB 1Y4UA 3CZCA 3GNLA 1PZHA 4R0MA 3IMCA 5IJZA 3AI2A 5A02A 3UJ9A 4RSRA 1R5BA 4OYRA 3LP6A 4OU4A 4KR2A 4CEHB 3OT1B 3IBFA 1RHQA 2Y0PA 4V2IA 2DU8A 2O7SA 3HJNA 5AI6A 1P2VA 2E4XA 3TMKA 4FB4A 5JYBA 1W0CA 4RVDA 2DZDA 5HBGA 3S0JA 3OJOA 2HX1A 3HZRA 3SAJA 2WHYA 3PE3A 5AOBA 3PT9A 1GNVA 1TQ8A 3AVOA 3ZU4A 4DNPA 5F73A 4OBWA 3TCXB 1QFYA 2ES4A 2UYHA 1LRJA 2EYQA 1I3MA 4H0CA 4IXWA 1PWHA 4AKGA 2OD7A 4FHGA 2H1FA 4O33A 5F51A 2OLJA 2VHXA 1Y89A 3HXTA 1KIFA 2XNCA 1Q81D 4LXQA 4D3SA 2C03A 1ZA1A 3H1AA 3B3AA 5DT2A 2PGLA 4AN0A 3O83A 3DLBA 4YJFA 3CPJB 4CQNA 2HFJA 1Z7YA 2NU6A 1EZ4A 1GP2A 3FPCA 4U63A 4YP9A 2G72A 2GHTA 3CCMB 5BORA 5ILOA 3ZKWB 1EVEA 2O2GA 1Z6XA 1B7GO 3SNHA 2FW6A 4QTYA 3FGOA 1WD5A 5CVCA 1OFUA 2GLXA 1U7ZA 2C4NA 1VPVA 1T5TA 1X7ZA 2F1RA 4R9SA 5B4VA 4D98A 4X90A 5EE5B 5B55A 2GILA 2VQFB 1YE3A 5B6IA 1H2BA 2XMDA 1W0JA 3B48A 2XTJA 4U7FA 1IL0A 4GIBA 2FJ0A 1DT5A 3MS7A 2PRZA 3DP9A 4QPCA 2NSYA 1Z0JA 2HCRA 5EJAA 4A03A 2C77A 3ITNA 5HQ3B 5I4KA 4X85A 1BDBA 5HILA 3EDQA 4FLFA 5F1KA 4E0BA 4F4CA 4WVLA 4EA6A 2G7ZA 2G63A 2YVKA 4FX2A 1NFRA 1IN8A 4G5SA 4J6EA 4MDHA 5AKKA 5HIMA 1NT2A 2WAXA 2YJNA 2H48A 5BRJA 3PFHA 5L6LB 3K0CA 5I5GA 1ZUNA 4KP7A 4RLQA 4B71A 1PR2A 5F3WB 3CZ4A 1SUSA 4HDNB 4KW7A 4M1QA 1LPAB 2Z8XA 2IA5A 3A70A 3BK7A 4GUDA 4DNQA 5BOVA 3S1SA 5IDYA 4EQZA 1U90A 3O8DA 3L6CA 1SC9A 1HT0A 4ERXA 4O4LF 4RYDA 3IIMA 4H3SA 3MW8A 3U3OA 2DUWA 3HKDB 3KKLA 4CIBA 5HKKD 5ALFA 5TGTA 2PTHA 3DO5A 3RTAA 2AJDA 4BKPA 3L4BA 2D0PB 4CT4B 4D80A 3ET5A 4XWOA 2F64A 1XDUA 4YPFA 1PNTA 3RSQA 1I80A 1U98A 2B20A 4UBOA 2H07A 3NYRA 1R0XA 1DAPA 4N01A 1PGPA 4PR3A 4Q82A 1ESEA 4DCUA 4H6XA 3COYA 1CJCA 3MJCA 3N0VA 5EWMA 5FI3A 1CVRA 2VYVD 4D8TA 1BKDR 1I51A 2GYUA 1II9A 2I55A 4ZCSA 2WB2A 1BAPA 3AHHA 4D97A 1LI4A 1E8MA 1A5TA 1I1OA 1KVSA 3TX6A 2BI7A 3RRBA 1KDPA 4JLDA 4DNOA 2A59A 1E43A 1GFSA 5FAKA 2C54A 4FD3A 3RS5A 5KVCA 3ASQA 4CCYB 1WY7A 4FINA 4C2UA 1X77A 3THWA 2A35A 1M83A 5F12A 1U9CA 1DBIA 4Y9RA 1ZGCA 1CP2A 3MRVA 5DP1A 2WYRA 2B82A 2C88A 4OLFA 2HRZA 2QD2A 1H9AA 3TZCA 1ZD9A 2YJ5A 1EXNA 3S6JA 3T5AA 2BGTA 2C2OA 1HA3A 2VEDA 2VTBA 2RAVA 4MR7A 1KSJA 3KL4A 3ZXSA 1LJUA 4DJJA 2XMBA 2WKWA 5CVDA 1OIWA 1P3Y1 3KIPA 4DMHA 1FRVA 2B0JA 1DX6A 2B78A 4IO0A 2ENUA 1F4LA 3HO6A 4JB0A 4MICA 3HA2A 3IVCA 4QOHA 4BLPA 4Z49A 1JFTA 1SBCA 1T5IA 3C6KA 3O4FA 2ZS9A 3OLYA 3JU3A 4Q93A 5KNBH 4OB6A 4I9NA 1PT5A 2P6OA 1Z4NA 5K8IA 4L57A 1PT8A 2EQBA 4JCOA 3KLBA 4ROSA 5ANRB 4EGJA 2GD0A 3BDVA 3F49S 1MO2A 1VSUA 4OTZA 5KCZA 1LW6E 2RKBA 2B3DA 3B53X 2K2WA 4I5GA 2C31A 2QEQA 1IIBA 3ELWA 2IZ6A 3C24A 4HB3A 4MRPA 4DC1A 3R0JA 1XHEA 2W71A 3GVKA 1E96A 1H8HD 2DPLA 4C4ZA 3GRZA 4NABA 1T3ZA 1XZJA 3S28A 1IXYA 1N7GA 1IJFA 4RD4A 5HDBB 2WT4A 5CNJA 4EJSC 1NR7A 3Q9NA 4KGVA 1EVIA 4HR7A 4E2WA 3SEZA 1J06A 4AK9A 1FVXA 4FX5A 4INPA 4IHJB 3ZWNA 1ZXBA 4YJ2B 1UKCA 2XADA 2XUPA 4DIDA 4E6PA 4HQRA 3WWCA 4CDRA 1QP4A 1BQ3A 3MWJA 4IEIA 5JJIA 1BS2A 1D3AA 5GZ3A 5BQ5A 5B6PA 3WGIA 1USIA 4DV6B 3LX8A 2VQDA 3L0IB 3GAFA 4JLKA 2ZUSA 3AUYA 3LX4A 4KYTA 4QULA 4CFSA 1IHMA 4FMBB 3ONEA 1VGRA 1BS1A 1VYTA 5TQ2B 3CO5A 3NAQA 2R4QA 3BBPA 4IX9A 3V6MA 4A0RA 4B79A 4C5BA 2IH5A 1CF4A 2SBTA 3CZRA 3EHDA 3M6AA 3ECCA 2J3KA 3QG5A 4CKWB 5J1TB 1GTJ1 5I7VA 1RRVA 3DJYA 4DXDA 1CG6A 3RYCA 4GOLD 3VU8A 3SFTA 4OHWA 3E8XA 4CUKA 1HMPA 1ZD1A 2VBCA 2WF5A 1YCFA 1C3VA 5FNZA 2NN3C 2XD4A 2PUFA 1C4XA 2HHCA 4JVNA 4G8DA 4P84A 3JX9A 1T6YA 3O0TA 4L08A 4Q4HA 2RHDA 2X8BA 3D54D 3O3NB 3G0BA 4HO1X 4K9MA 2V3VA 4OMFG 4BNJA 4CMEA 1J09A 3EB9A 5BSHA 4G1EB 1M76A 3P27A 1Z2PX 3EUWA 2AIRA 4MS3A 4MVJD 4BV3A 3FDXA 3VC1A 3L82B 1DAMA 2G36A 3GEPA 1NMSA 3KQHA 4RCVA 3WRXC 1F38A 5BSMA 4EQ6B 2XEXA 1BVRA 1X2EA 4N0PA 2HV9A 5CB6A 3A2LA 4X8LA 3BZWA 1EXWA 3G59A 2C5GA 4N7JA 4R41A 1JB9A 4EA8A 2IP4A 1AC5A 3REGA 1DHRA 2NW6A 1MQ9A 4Q03A 3ZX5A 2R6R1 3R3WA 1EFLA 1R16A 5F64A 2C3PA 2HK6A 4JUAA 4A0GA 5LOVF 5HXBA 4WLOA 1MW8X 3RQIA 3HWRA 3PCRB 1HLDA 5ALMA 3SQNA 2JHGA 2WIBA 3NOXA 4ZO6A 5HJ7A 1J25A 3VKHA 4G81A 3FOFC 3PBKA 3KE9A 5IVKA 5JSQA 1UWLA 4X6LA 1UKAA 3AUAA 4TXHA 4OHYA 2GBGA 4UOEA 1WS6A 3HYNA 1SZJG 1ORVA 1DINA 3OEYA 3TOXA 3LDGA 1P5HA 4JD5A 4C0QC 1VBKA 2JANA 4GW3A 2FPPA 1Q6ZA 3D8RA 4P3NA 1V48A 4ZQGA 4NFLA 5JDCA 2Q4TA 1WMDA 5ES4B 2ZI3A 3LQQA 2QZSA 3QNWA 3T99A 3UYKA 3WHLA 4CLDA 4YMUA 4A8JB 4PAOA 2PS9A 1USWA 3HBMA 3AHDA 3OOWA 2BVNA 1WEHA 1YK1A 2FFBA 4FQ5A 4MEBA 3GUHA 3I6YA 4ZGQB 5LIPA 3QIVA 1LX7A 2K4MA 1JQJC 2IZ7A 2BKAA 3G0OA 4UKDA 2H5JA 2OMKA 3IDSA 2OSBA 3WGYA 5J2UF 4LRTB 2WP0A 3TIXB 2FPWA 3KHKA 4YK7A 5AM1A 2FPIA 1JA0A 4AJ4A 5KYVA 4C5AA 2C4WA 1Z33A 4XQCA 1RRGA 1Z8FA 1XXHA 4L7QA 1O7JA 3PIIA 1AK2A 4JIGA 1FNMA 1PK7A 3SJBA 4EPRA 1GZ6A 4EYGA 3I56B 4YT4A 2QD4A 2D00A 2HGSA 4W7IA 1NZFA 2E1RA 1JFSA 1IG3A 1RQNA 1R4NB 3EOZA 3M1AA 1JAYA 4FDUA 4MW6A 4PG6A 3A6PC 2HF7A 3JQAA 4B09A 1ZI6A 1GUYA 3M1LA 4BZPA 1O5TA 1SHUX 2JVJA 2PX5A 3WBJA 1MB4A 4ZDKA 2VYQA 2DC1A 2Q50A 3OM0A 5CA0A 3P5SA 4K9KA 4S05A 5CB4B 1YDWA 2WUGA 4C76A 1QVGB 2JFZA 4G84A 4BNXA 3N3AC 5IU6A 1OPXA 1J8YF 4B3RB 5C8ZA 1PDWA 4GI7A 1K7EB 3NHBA 1K4YA 3V32A 3ZCQA 3BT7A 4M9UA 4WT7A 3RWMB 3C8HA 1KFBB 1EX1A 4EO4A 3TF5A 3QU7A 5I4CA 1RBQA 3LHDA 3BGIA 4FZRA 4YWHA 4JP5A 2Q6VA 2VNIA 1T6ZA 4I5DA 3WDKA 2H0RA 2O8CB 1N2JA 1QYRA 3RRNA 4G5HA 3D43A 4Y6PA 3AMVA 1LXCA 2XKAA 3HEMA 4PRYA 1H0KA 5DYWA 1Z7WA 1MVLA 4W8HA 4HSEA 3TTTA 1ECPA 1JS1X 1SRRA 2NWQA 3PQFA 4M54A 4AS2A 1BXGA 2XCUA 4DIUA 3N0RA 3PQ2A 5CVVA 1Z56C 3F7MA 4WFQA 3E22A 1F8YA 1V9SA 1GNLA 1M54A 3GJ5A 3E23A 4P93A 4FBMA 5AM0A 1L8OA 1UPCA 3TNLA 1KZHA 3VHQA 5DNUA 3MGCA 3BE6A 3AQIA 1C41A 4EZIA 4Z53A 1QHSA 1OJLA 1NYQA 1V5GA 2WYIA 2FN4A 2Z6UA 2XZTA 1C7FA 3GOHA 1MT0A 4XR6A 4Y67A 2B94A 5DASA 1SIUA 2VA8A 4IIHA 1I7DA 1HOTA 4PVDA 1N1GA 4JLAA 3ZHQA 3S81A 1KJZA 1XVUA 4C7MA 1IZ7A 1EVQA 5CCXA 4ALIA 4F3TA 1NXPA 3HKDA 2JGFA 3BREA 3LT4A 1XNHA 2IZOA 3NMUF 1MVNA 2LZ0A 3ANSA 4D44A 1C1YA 3MTGA 5EKXA 1A1SA 2XRFA 2P9QA 5ITZA 3AF5A 3FFBA 4DDHA 2FCRA 2HPAA 1RQ7A 3QBJA 1G5HA 1R6VA 1YLOA 2FPGB 3FOCA 4BMDA 2G8NA 2NP7A 4RVOA 2ZR7A 2PHZA 4OP7A 2IGBA 2VIIA 4BQFA 1X38A 3N2YA 3A2KA 3IVRA 3LBHA 4HUTA 4AAYA 4X20B 3P1JA 4MIOA 2J6HA 3PGXA 3CRRA 4X65B 3A4LA 1T5OA 1MCZA 1V16A 1BMFA 4U2EA 1RYHA 4R7GA 5JEDA 3N39C 3QEOA 2EFEB 3I37X 4KX5A 1XN1A 5AK6A 4I6JA 5EGSA 4UDNA 4BFLA 2W2VA 3NBXX 3T7TA 2WWGA 2XNKA 4HN4B 4ETWA 3V97A 4G36A 1QPBA 3EZ6A 2JAXA 5KQMA 4TTPA 2D3NA 4TS4A 4C4TA 1A9RA 3ER6A 4HH3C 3KYBA 2JEZA 3C7AA 5CGZA 2P5UA 3GA7A 5HZAA 4MKRA 4O4LA 2HWUA 3HNRA 2DJIA 4TVOA 1TO1E 2JIPA 3WC4A 3NANA 2ZBGA 3ORQA 4KQFA 1MQAA 1VMIA 1KETA 3I3OA 1FDTA 4LE0A 3UC9A 5IS2A 1W88B 1ISSA 4AECA 1EK6A 1XYYA 3PTAA 3HCAA 4MUKA 3HPRA 5BV8A 2NP6A 1CLUA 2E4AA 3EQ7A 1NJID 3MCWA 3OTWA 1X1RA 5K8CA 1I36A 4CF7A 3JWPA 3PZBA 4GBGA 1VL5A 3A4MA 5IKPA 4AIRA 3H9GA 3FZNA 4CV1A 2VTBB 1U5BA 2GZSA 3Q10A 4L27A 3EG9A 5LD2B 2GZDA 1RQGA 2PT7A 2YHSA 4HQLA 4N3BA 1PS0A 3NV7A 2OHFA 5JBQA 4G01B 4NHEA 5DHTA 1RLIA 4Q12A 3VKFA 3RJMA 2E3JA 1VSVA 3R4CA 3PWZA 5E2BA 3HJHA 4S1PA 3AHCA 4DDKA 5KTRA 3BOSA 3U5ZB 2HRBA 4ACBA 1TK9A 2VATA 3IERA 1NR5A 2WE7A 4X07A 2PUHA 1X19A 3DLCA 3PPWA 4R2IA 5JD3A 5JTTA 5K3BA 2V6FA 1U8FO 5BVHA 1A77A 1QP7A 4XORA 2D1QA 1F0YA 4LNHA 3JQPA 1YRAA 1RWXA 2EHJA 5CT6A 1Z0IA 2M2IA 1D7AA 2CN1A 2I7CA 1S8FA 4NECA 4Z1MA 2WFLA 4QWWA 3BWMA 2W6JD 5DN9A 3T7DA 3GZNA 3T7AA 1C1DB 3RBXA 1D2NA 1N6LA 1O9HA 1YV9A 3B9RA 4TLAA 2WD9A 1I5RA 3K0BA 4R5HA 2BIFA 4UTRA 5KYUB 1WLYA 3OOSA 1MIOB 1O54A 1QQ6A 3I32A 1H8EA 1DXOA 2AG8A 3IMKA 3LGXA 3ASPA 1FFAA 5CFZA 1TYCA 2I6QA 4G9GA 1XMQB 4C88A 1NU8A 4ZCPA 5GAJA 1I2ZA 3E05A 1M1NB 4PSCA 5A4AA 3D02A 4ZCTA 1FVOA 4HX5A 4YJ2A 2PJRA 1QMPA 4P08A 3E3NA 3UCFA 1FFYA 5L3QB 1T3LA 5LA6B 4B9EA 4EUSA 1G8AA 1VQ5B 1JEEA 3FETA 3MRSA 4C08A 2JEOA 3PNSA 1QYXA 1Q9SA 3C3CA 4GMHA 2FSVC 3KQMA 2KVOA 2G40A 4NK5A 4DSNA 4X1OA 1QVZA 1FSPA 3G2JA 1D6NA 1GYPA 1SIBE 5AM3A 3M5PA 3EISA 3OMXA 4FOSA 3RVOA 1PQYA 3HDJA 4QO8A 4G4IA 1YDMA 3HN2A 3IP3A 3OEHD 3R3HA 4NNOA 2I7TA 3GI1A 3IP8A 1XAIA 4C0AC 4DA4A 1H0HA 2CLIB 3CT6A 3BRCA 4DLNA 3ZDRA 1Z5VA 3W6NA 4KO4S 1C9DB 1AUOA 5AK5A 4CDNA 2O1SA 2F1LA 3KVYA 2IPNA 1ZFNA 4ZRDA 4ZVKA 1CRWG 1UFVA 4MW7A 4RTLA 4BO5A 4S04A 3WLLA 1KWGA 1HYHA 1U0LA 4NCKA 2ZAGA 3VM6A 1Y3HA 1QIKA 2Q4OA 2O3RA 3VPFA 2VDJA 5A89A 4EABA 4UM9B 4U2FA 1VG1A 2B7CA 1AK1A 3I55B 3F1KA 4ZO8A 4JB3A 5DS0A 1L4BA 1Z17A 3I28A 1GPJA 1E3SA 3HY4A 4Z1OA 1J23A 1PTJC 1VHJA 4XLHA 2A84A 4MB6A 3S44A 3B6JA 4M21A 3D1VA 3VC3A 4DPMA 5CDTA 2ZWAA 3NIFB 4UOZA 4POAA 1S2DA 2G9ZA 4NOKA 2Z09A 3UO8B 5BSWA 3FTEA 2LP4Y 4RD6A 3EQ8A 1RABA 4JL5A 4RGVA 5ECYA 1E3WB 3DVAB 3JYNA 3EWIA 2AXEA 2VK1A 1KAEA 2Z4SA 3R7WB 1NVKA 1B2RA 4RWEA 1TTTA 3ACCA 1XQYA 3WZLA 2HU8A 4IMPA 1PJTA 2ZZEA 4C3VA 2A0XA 4RQBA 3UMCA 1GZSA 4ZVQA 1W1IA 1SJ9A 3DL4A 1Z68A 3LHFA 4NNPA 4EIWA 4MI3A 1EX9A 3PEFA 4ZQHA 1A98A 1PS8A 2IZZA 3GFSA 3HLYA 4G37A 4JKYA 4NTZA 4UBIA 5ALZA 3RSLA 4DBLC 5F2KA 1E5QA 1E79A 2ZBQA 3IVXA 1NI3A 5LDGA 3RJ5A 3WMRA 3AH8A 4WW0A 3GLVA 3IHWA 3D6FA 3B6IA 2IHJA 2EV9A 2R1TA 3AHFA 7ADHA 4ZT2A 1DUSA 2H1CA 2ORVA 4ZANA 4P4SB 1YS9A 3UJNA 1BX1A 2B83A 2EDAA 3SOZA 2ZUVA 2MR6A 1ITZA 1TMOA 2VT2A 3Q41A 1DAIA 4HUQA 5IJAA 4AULA 3AFOA 3PUWA 4F06A 1U0BB 3ETDA 3QI2A 4LZOA 2AKEA 3E6AA 4HIZA 1C80A 4KX3A 4BVAA 3RVBA 3W78A 4ZVNA 1F48A 4KIWA 3DE0X 2G83A 2NACA 2DUMA 1W36C 4HRAA 3FZEA 3H9QA 1T2EA 1JSLA 1E2KA 5BSXA 4LE2A 2BELA 5JQWA 4EO9A 1W4RA 5JXIA 1G0NA 1S9DA 3GHYA 4QSMA 2QM0A 4DRXB 2H9YA 2YHAA 4F84A 2APJA 3JQ8B 4IQ0A 4TTRA 1KI2A 4M1EA 3KC2A 1IJBA 2JI7A 3RU3A 3ZNNA 5K6RA 2QRJA 3M4JA 5JDIA 5MF6A 3TWOA 4Q15A 3GIRA 3EQ2A 3KUDA 4IM7A 4Y6GB 4G5RA 2OPHA 3S8MA 3ZOKA 2FGJA 3R5JA 2Q28A 2B4KA 2M1ZA 4K9OA 2NO6A 2FE1A 3BIWA 2QUIA 4KXYA 5KX5B 2RD2A 4XKWA 2C8LA 3FUUA 6NULA 1RNLA 2GM5A 4XIIA 1P1RA 4INZA 1JG2A 5ULLA 2CXPA 2VDWB 1RPZA 4R8KA 3MJRA 1QIDA 3E5HA 1TJPB 1AG9A 4IIUA 2Q1XA 4TLEA 5H3HA 4DSUA 5IZCC 3W5IA 3Q5DA 2R11A 3ANNA 3DQZA 4ZMSA 3LI2A 1JU9A 2CBGA 3ZZ0A 4UE2A 2UXCB 1L7VC 1YL5A 3A9CA 4E2FA 3BMOB 1ZR4A 4IH4A 1YL7A 3T1OA 2ATXA 4D9FA 1O95A 1W5FA 4MQMA 1FS6A 1MORA 3JS5A 4OQ4A 2PX4A 3ZZMA 1S4QA 4BCBA 1N2CA 2HZ7A 1CF9A 3MMZA 1JYFA 2JFBA 4JLNA 2P2NA 3IEIA 5JJ5A 4PICA 1O6BA 4MKIA 5TQ2A 2VDNB 2Y1LA 1O2DA 2VF2A 1XLTA 2C4KA 3KJFA 2VJMB 1XA3A 1U2ZA 2VF5X 2Y05A 3NU1A 3WBKA 2NU9A 2FPOA 3HKCA 4ZPXA 1MW9X 2OL4A 2ZRMA 5H3CA 3R7FA 4BC0A 2P0EA 1SOMA 4ZOEA 3GC6A 1W4ZA 3Q7QA 4BUCA 5U1PA 4UFOA 2J32A 4H4EA 3JQ7B 1IZ0A 4JVOA 3PGLA 4ETNA 2X85A 5CIQA 4B4VA 1JEJA 1YZTA 1C8BA 2WPDA 1FS5A 2ZI6A 3TSYA 4E09A 3GJXC 1W76A 4FHEA 4Z0PA 4ZOLF 1Z8HA 4TYQA 5FQOA 1Q7TA 4X60A 3CS3A 3C97A 3ITKA 4YI5A 1VLMA 2WG2A 2YH2A 3NHZA 1H8ED 1KI4A 1DTWB 4AG6A 1SZDA 3RBZA 5LQKA 3X2SA 3A4VA 1GQRA 3DVSX 4ARZB 2I1VB 2ACEA 3WMGA 1R6XA 4DJ5X 5IC4A 2WM8A 4ND5A 2O8EB 4NJMB 3IA2A 1MHPA 1YZYA 3MMNA 3VR6A 5SV2A 4I6GA 2D6FA 3NOVA 3HXQA 4MYUA 1HNWB 2CKMA 4V0MA 1JTEA 3D3WA 3O21A 3GP5A 4XM1A 5CHYA 3OLVA 4G0XA 2I87A 1LWOA 1NB0A 2IUEA 2PUDA 3C5EA 5G1PA 4U1RA 3IVGA 2JBWA 1TUEA 4X84A 3SCZA 5FUBA 5LR6A 3CLUC 2RFLA 2ZREA 2G5GX 1W4AA 2A9VA 2OXRA 3DPSA 1M2VB 2C9OA 2DX7A 4K46A 5AJUA 3W0LB 1NI4B 1UBJS 4BFVA 4QUKA 2GFHA 3W2EA 2BZSA 2V6JA 3WYCA 3ISXA 2BM1A 3GLHE 3OQIA 2PR7A 3PEUA 1ODLA 4XWTA 3RNLA 3G2KA 4MW4A 3B36A 4DC9A 4EECA 4CVNA 4YRBA 5CDSA 1EWKA 5BW4A 1IAQA 2AJTA 4Z4QA 4BDTA 3I1IA 3ZQUA 5EE9A 1GAEO 3OJFA 3VTAA 4DIEA 4MWTA 2OHOA 4RV9A 2V55B 3MF4A 1Q3KA 2ORWA 2YRWA 4LC0A 1N3LA 1YB2A 4LHYA 4P1VA 3WLHA 4DILA 3NUQA 5F4MA 3A11A 1CETA 3CF6R 4ZT7A 3M4YA 3INGA 1NULA 1PL6A 4ZXPA 1L5ZA 1QR6A 1S3SA 2KHZA 2V9ZA 4KE7A 4H6PA 3AERB 4LZLA 4M1KA 1OLSA 3HY6A 1SG0A 3LQKA 3N7AA 1G7RA 3ZTWA 2OY0A 5JJLA 3R5KA 4CQMD 3OEEA 2YW9A 2DTEA 4HQFA 4YGYA 1F0NA 2WK1A 3T0IA 3ZJVA 4GBMA 3BKWA 2RHRA 2ZULA 1ZC3A 2RGWA 3JR3A 4Q7LA 2IYQA 4TL9A 3GO4A 1U2PA 5CT5A 2VHEA 3LU1A 5DTJA 5IAJA 2W37A 1NPDA 1MAWA 3HR4A 1ZOLA 4MDYA 4MK4A 1EAYA 4GZ6A 4RIHA 4XOUA 5FFFA 2GM4A 1KARA 3IJEB 1MEJA 4Q48A 5F33A 3OZIA 4PZ0A 1VBFA 1C3JA 2W6MA 1QX3A 4O08A 1YJNB 4XQGA 4JUIA 5CUQA 5EUCA 4WBNF 1M8FA 8AT1A 3K0KA 1FQJA 4JJKA 2PZEA 1MIOA 2EX1A 4OHPA 5KWJA 3A6DA 2P1DA 1R0RE 1TJNA 3DR5A 4JLWA 5CB4A 2WZNA 2B4AA 5EJEA 4QJ4A 2R8ZA 9LDBA 3KKQA 2JLSA 2EERA 2VHCA 2X23A 3AETA 2XKBA 3OPQA 3R5FA 4BNNA 4X66B 2J87A 3SZGA 2QN9A 3FVRA 4RK5A 1RXCA 1RBZA 2NG1A 1Q86D 3Q87B 2QP9X 4V0SA 5GP1A 3MBOA 1PJRA 2Q49A 4R1LA 3LIIA 5ECGC 2WEKA 1KC3A 3ZHXA 3CPHA 4U5QA 3LP5A 1UM9B 3ZIUA 2H63A 1JE0A 3K5IA 1NXTA 4Y2VA 5JFGA 6AT1A 1T2CA 2IYUA 1LRKA 3W8RA 2VDQB 3HABA 1FRQA 4XSVA 1MG5A 3E70C 2AH5A 4YN3A 1OZAA 5C1PA 4UHFA 1YRYE 5IN4A 2A0WA 4XMYA 3WK9A 4F4UA 5AW6A 3DTVA 3PEYA 4X3CA 1JU4A 1EWYA 3FAZA 3KALA 1CR0A 1FXUA 4FC6A 4AQ7A 3ZGNA 2AZTA 4G5QA 2IS1A 1SUFA 3AL3A 3R77A 2DBYA 2ERCA 2F59A 4Y2QA 3TDNA 2C7RA 2JBHA 1J07A 3DWGA 4LHEA 4R2LA 1ADGA 1ENOA 1Z37A 4KWIA 5IF3A 5BNTA 1RQ2A 1XZGA 3L7IA 2JC3A 4KXMA 2FSHA 1RMQA 2VJOA 4BRZA 2FK8A 3Q40A 1RR6A 3F5SA 3ZWAA 5CW2A 5FWXA 4HQ0A 4R7ZA 5F2EA 1N75A 2G08A 3IQHX 3LPMA 1ULZA 4YIKA 4IDBA 2J59A 4UCXA 3ZI0A 5ITZB 2RGNA 1TC2A 4QBKA 3C48A 3U5TA 3RE1A 1QKIA 2M6RA 2OILA 2NO9A 4MLDA 4ZZ0A 4I1IA 3AFGA 3P0EA 2VBIA 2L2QA 3BORA 8ADHA 5KQGA 2BHTA 4PFJA 2GBLA 2IKSA 2MSNA 4V0LA 3BRQA 5EUQB 1ZBDA 1L2TA 1AS2A 2YOFA 5C18A 1KPGA 4L3WA 1FMJA 2WTMA 1NAIA 4TTIA 3FSJX 3QF7A 1G66A 5THQA 4YAUA 4YAOA 4OP1A 1U5CA 1PZMA 1EWQA 4N65A 4WPGA 1PR6A 1LSUA 2R1TB 2R4TA 1CRPA 2PMBA 1KI3A 4P4SA 1HT3A 5CDYA 3I9FA 1R7RA 2IY7A 3L6DA 3ZE0B 2PD6A 2VUTA 4MJLA 1WM1A 1UD3A 1YFKA 2CNNA 1Z47A 3A1FA 4UDXX 1K6IA 1DQYA 1XZFA 4WCFB 4ALMA 1MJNA 3LSTA 4FOLA 3FM9A 2HW8A 2QGGA 3W5JA 4KMSA 3BB1A 4CL0A 1C81A 5KB3A 5EXSA 4RPGA 1OWOA 2BOVA 1DIGA 2P9HA 4G07A 1NLMA 1PKEA 1CYDA 1T6NA 1HVXA 1Y3BE 5FI5A 5C1BA 1ZVVA 2OHHA 1T43A 3UOGA 4TLMB 4WFKA 1OFTA 1O0SA 4HUQB 4LRSB 3COPA 3Q5EA 4JIMA 2I3ZA 1F12A 2XCRB 1PR0A 1QQAA 1I8TA 1QRTA 4N6GA 3LFUA 3GRAA 1LGYA 4AUEA 1DC3A 4BNWA 2R87A 4I99A 1DBWA 2PMKA 4RELA 3HU3A 5NULA 3VH1A 1GSAA 1QBKC 1E7SA 5JRDS 1JAZA 1OXTA 4K3UA 4N5DA 5KSPA 5EA2A 1XJ5A 1YJXA 2D5BA 1DXQA 4KCGA 4YDQA 5KHLB 1C2YA 5DNDA 4FIDA 4JEIA 3LAWA 4C78A 5LA6F 3HRIA 4GS5A 3KQVA 1P1CA 2Z2JA 1AY0A 2YCBA 3ESZA 3N2IA 3QKIA 4MULA 2SECE 3GIDA 3IAUA 3RK0A 3EGOA 4YRJA 4ZQFA 1S01A 3EEYA 5AHKA 3I0MA 1DKRA 1QQ7A 2YY7A 3RRJA 2E4WA 2DG2A 5HVNA 2R0QC 2VT3A 1FRNA 1NPYA 4FDVA 3ZHOA 4EHNA 2IT1A 2VBFA 4JC0A 2CXXA 4DXAA 4G8BA 5HQTA 3AIOA 5DH9A 1RJ9B 1EK1A 2PUWA 3EXHB 5HG0A 2AQ8A 5KYUA 3L8MA 5JSUA 3ANYB 4B3MB 1J33A 1KJ9A 2Q3CA 3HVIA 4KE9A 4QFMA 3CPSA 3C3DA 4NV3A 3QA9A 3RAJA 2H54A 3ZS9A 5A6SA 3TQCA 4DRYA 2JKZA 4B5KA 3L41A 3OHMA 3PFFA 5A5EA 5CTAA 2ZT5A 4ZI5A 4PYNA 3Q5GA 3V4OA 3TFOA 4X71A 3B6MA 3CUEF 4AF8A 3V76A 2OV3A 3KVVA 2JCBA 1XWFA 5EEGA 5F52A 1WCYA 1ZEJA 2R9VA 4WK0B 1CJMA 1NUSA 3E3OA 4XARA 1I14A 2ODEA 2F8SA 3OFNA 2OCYC 3C2QA 4C01A 4PLGA 3M9WA 1S3FA 3A10A 3BH6A 2UVPB 2X76A 1MZPA 3DO8A 4Q1FA 3MMSA 2Z2IA 1QX4A 3SLNA 2OKGA 1OQAA 4I08A 5EL0A 4NJEB 5FTKA 4INJA 1SURA 3ID6C 4DLUA 3ZDYB 5EZYF 5D6NA 4EW3A 3HYCA 1Z4KA 3A2NA 4BIIA 3WLAA 2ONZA 4AD8A 4BWYA 2FSFA 4B4UA 1U28C 3SC4A 2I4RA 2QTLA 2QLJA 4CIDA 3WLFA 4RW0A 3VSBA 4F8JA 3KRTA 1PJZA 3QOFA 3TL2A 3I8XA 1SCJA 3ZU2A 2GBFA 2RJ3A 2P4QA 4IR7A 1WSWA 4YALA 1N2CE 3I05A 3LOPA 1BC5A 1VLVA 2PY6A 3WRWA 1RAHA 4N7RA 1PG5A 4WZAE 1NW4A 3TLBA 1JLMA 2YV1A 4QL3A 3R7SA 4F2HA 4Z4EA 2AXNA 1E1QD 1PV1A 2HF2A 2LV8A 1R6TA 3GCGA 1Y7LA 3O95A 1UKBA 3OZ7A 4X1YB 1VQKB 2FMTA 1Y7HA 3N8IA 1BMTA 3N0TA 3A1PA 3UXMA 3V48A 4BGVA 2JARA 2XHEA 1ZWKA 4TTQA 1DC8A 1E32A 1OX5A 2XTMA 3KKOA 3U39A 2VJLA 1T0BA 4KMOA 1Y8QB 1HQKA 3KTOA 4R2HA 5D8DA 1NQTA 5GONF 4DTIA 2AR7A 3E5RA 2Z1MA 5FBLB 2YDXA 3W9UA 4D1YA 2XBUA 1N77A 1ADCA 2C98A 3VUFA 2HU5A 4C0HA 4QLAA 1AV6A 3GJTA 3E1YE 2G9NA 2P3OA 3CNHA 1M2VA 4E51A 1HYQA 2R3SA 4ZYYA 1L7DA 1UPBA 1NW5A 2JFUA 4OGWA 2NUTA 3Q72A 4E2YA 3DL7A 4F1WA 3GMIA 3S4YA 3VHXA 5CAEB 3OQIB 5CJJA 1W47A 3D7LA 2HPHA 1U3GA 4HX9A 1ZRHA 1XDGA 2CBZA 1ULUA 3CW8X 5TRDA 4BUZA 1W0JD 3N05A 3AUFA 3FFAA 4LRYA 5ABPA 5CBPB 5C46F 3E4CA 1UZNA 1Q1NA 1IWOA 2YOGA 2R4UA 2BFEA 3MT8A 5TQVA 4QDXA 4HH4A 3MT0A 5EE1A 3WYFA 1NW9B 1RXEA 1H5QA 2P79A 2QZ4A 3BTSA 1MBZA 3EF1A 3LT2A 3F6PA 2W5UA 1SCKA 2NU8B 2FJPA 4OXXA 4EHFA 4MQBA 2FWNA 3QUAA 4IRMA 5TY0A 3TR0A 4CCAA 1QTNA 4K6HA 1FBTA 5TNXA 3C15C 4RJTA 2CRVA 3BJRA 4RLFA 3WAJA 5BNIA 5KQSA 1DCKA 1G8KA 2WG1A 1ZRNA 3A1WA 3RANA 2QQEA 1ZI9A 3FYHA 2O20A 2QY6A 3RU9A 3T5GA 4X0CA 1GAXA 5BNZA 2DT8A 2ZB4A 1CE8B 3OHSX 1EH5A 2ZTNA 1BKSB 4DSZA 1AJEA 3A1SA 1TAUA 1Z2CA 2C3UA 3HJGA 3V1UA 5ALIA 4F5EA 2QW8A 2O0KA 2AFHE 3A6FA 3T94A 5ADWA 1TYAE 1P62B 3FNIA 4U0JA 3ICOA 4B34A 5HKKA 3HJBA 4Y6OA 3VOSA 3VYTB 1G4UR 4QU8A 2IEAA 1V7QA 3ESXA 3W1EA 2ZU6A 4ZVTA 4CF3A 5EXEA 3RKRA 4E1AA 4EFKA 2P5SA 3IPRA 1WP9A 2C8JA 3PZRA 4IWNA 1TVEA 2ENWA 2J9XB 3KPWA 3KU1A 3L43A 4N0MA 5LQSA 2D0OB 3KSUA 3C5VA 4EL0A 4G0VA 4L9SA 3KBBA 3ZZUA 2E4VA 1YB6A 2WUFA 1Z0UA 3LX5A 3K9LA 1YJWB 4Q3NA 2RIPA 3C41J 4I8XA 4BIMA 3VMMA 2XRMA 3S8EA 3W8NA 4O3MA 5AKHA 3ZKWA 3FJYA 3IX7A 3D4BA 3E8SA 4AB1A 3OCWA 2YV5A 3ORYA 1CQPA 1QH0A 2J67A 4BNUA 5BN3A 4AY2A 3D6VA 1YQUA 1RYEA 4RDJA 2ILVA 5BMOA 4F6LA 1E0AA 1W48A 4IIYA 4J03A 5BWCA 4FZVA 4POOA 2E5WA 4PHHA 4RNCA 5D86A 1Z7EA 2CJYA 5JS2A 1XU9A 5C8YB 2Q8PA 1CB0A 1UP6A 5E7QA 1U6JA 5H70A 5KMGA 4KSYA 3EAFA 5DB4A 3QITA 4Y2XA 4ZT6A 1SKMA 2G0NA 3WYDA 4UVIA 3PQCA 4UJ5A 3AI3A 2XJ9A 3N2LA 4OLJA 2Q41A 3QTBA 1KY3A 3BL5A 5M2QA 3H4IA 3L0ZA 4KQ1A 2JIQA 4LZWA 4MI1A 5AHWA 3KR0A 4GPBA 2IDJA 3WKAA 1WPCA 1N7JA 1NXVA 3UJCA 4Y7CA 1N57A 1FP6A 3W2HA 3AEQB 1VHDA 4WN9A 1CULC 1TMYA 1WB4A 1OKKD 2QN8A 2X6WA 3FUWA 4ANFA 2Z6BD 3I1YA 4CLOA 2YJZA 5H7XA 1JF8A 4L6AA 3K6SB 2NX2A 3ON5A 2HU2A 2EX0A 3GFFA 4I9FA 5DNWA 4G0UA 1YGYA 1FP1D 3AU8A 4KFTA 3UJ6A 5KNLA 4UZEA 3ASRA 1ORRA 1UINA 2D4HA 2WWIA 3PGKA 5CPBA 1DWUA 1YVEI 3E35A 3EZ9A 3HUFA 3L0PA 2V5VA 2WDZA 3QVGB 4IDPA 5ALPA 4DZRA 3KQKA 2YWHA 4ZYWA 5C51B 1OB5A 2P6MA 1P4JA 2CJWB 2HSDA 3A36A 2PU5A 2CXSA 2Y71A 2XA2A 1RYNA 3JAWA 3NTQA 4M0PA 4WOPA 4IIJF 4DADA 4CYMA 3PXXA 5A4IS 5K0FA 3ETNA 4FLEA 4B6SA 5I01A 2AX3A 5HKAA 1KXJA 1SUCA 5HZKA 2I22A 1ICIA 5D3ZA 4DCGA 3G2IA 5JPCA 1L9XA 1Q16A 4X3OA 4PSAA 3RIYA 3DL0A 1YHNA 1VQPB 1OV6A 2J4FA 5K03A 4HAZA 3MHTA 1X0XA 3ABSB 3ER8A 1HE2A 1GTVA 1OXBB 4M87A 3OKFA 1IY8A 1LDYA 3EXIB 3NH9A 4QHTA 4OU5A 4QQRA 1UUFA 1Y63A 1ILWA 3IP9A 1A8UA 4JI4B 3KZNA 4YCNA 4Y3UA 1P0CA 2J0UA 1CIPA 3U4GA 4XLZA 2ERYA 5CG2A 3LOUA 1ZZGA 4FYWA 1OR8A 2AC7A 1I7LA 4X6YA 1GU0A 1SCIA 4QOIA 1YL6A 1TXGA 2P27A 4MOWA 4J3JA 4ZAFA 1JH9A 1KY5A 3KT8A 4P0QB 2YBDA 1TDJA 1OJ7A 4F2PA 1F8UA 2ADOA 2PGAA 4O8CA 1MGPA 5KJ1A 4LTMA 4EG0A 3DCIA 3TUIC 3KR2A 4XJVA 1KVTA 2HWXA 3R9IA 1UEXC 4ZREA 1BGWA 1P74A 4QOGA 4WRRA 4AVZA 1PJAA 2GBPA 1BCRA 3BJMA 1ST2A 5E6RA 3RRZA 3HHEA 1DQZA 1PG0A 4UC0A 4D9CA 1XOIA 5H0IA 2GN9A 3ZXYA 2Z6VA 2DR3A 5KVSA 4M7OA 4U3JA 1NFFA 3HLTA 3Q98A 5EESA 1ZD4A 2QD1A 4OQXA 521PA 4XONA 4BNVA 3OKPA 4BP1A 2ERXA 4EPWA 2PH5A 2Y1GA 4GKKB 2P9BA 3M9LA 2PN1A 1L7RA 1GG2A 1CJTC 1NVMB 5EC8A 3IP7A 4W5RA 2A9FA 2P35A 3CF4G 3SK0A 1ECFA 3THRA 1AKWA 3KXPA 1K7FB 4J16C 1SBHA 1MLDA 4R0VA 1ZIYA 3B1KA 2B1RA 4DNRB 2J5BA 3VZBA 4G5GA 1GGMA 2FOIA 1U8AA 1EEHA 3OPXA 4CG3A 3AZQA 2HF8A 2YUIA 3M9XA 3PKZA 5HQJA 3SYKA 1JLSA 2CHFA 1OYYA 3DLTA 5T6BA 3QKSB 2H3EA 4WZBA 4ZHQB 1TO2E 5AM2A 5MN4A 1E94E 2W8ZA 4C0SA 3H87A 1FOEB 4D8UA 3PEWA 4NPCA 5J58A 4UEWA 1MRNA 1X74A 4D79A 5CFRA 4KKUA 2GVNA 3HI6A 2JCYA 4EOGA 3CZAA 4GPIB 2PV7A 5TQ0B 4K9NA 2B21A 2XQVA 4L75A 2GEBA 4OVKA 3NKLA 4WAUA 4EEZA 4QAJA 1EDDA 3N07A 4R5MA 3T9FA 1R6BX 2JKVA 2YVLA 2AEMA 2C99A 2BEWA 2GYVA 4PG7A 3QNUA 1UK8A 4CWAA 3P9NA 2ZJYA 3LNTA 5CGQB 1N7HA 2K6GA 1ACMA 4OFWA 3GCXA 4YAEA 5FUMA 1IHDA 2FRDA 3COZA 3DA8A 4B3TB 1FP4A 1RWBA 1R64A 2ZANA 3PA2A 4EY3A 4QTUB 2V58A 1A9OA 4RZXA 5A5GA 1CUHA 3NHPA 4C0XA 5CT8A 5E2AA 1T29A 1LNQA 1VQ4B 3SIXA 3EPHA 2FEOA 2JFXA 3O8BA 4OHCA 4QBGB 3ZX4A 3WRVA 3AR2A 4RTMA 3K8QA 5IMBA 2W6JA 3EVBA 1UF9A 3K1TA 3M4NA 4MS3B 3KSZO 4GLFA 3EZNA 5CDUA 1TRKA 4XSHA 5J5CA 3LCVB 3A9SA 3A3BA 2VTDA 1F1BA 1ZGJA 1Z25A 3JQ9A 3K92A 3O8NA 1BW9A 5J59A 1CUCA 3CKKA 4FYMA 1YBMA 2VJCA 2Y2UA 2AF3C 3OLCX 2XNSA 1J22A 4CQJA 4L3VA 2PE5A 4NQZA 1EVJA 2AN4A 4PHGA 3KUUA 4M36A 4EKYA 1QRAA 3NGMA 4TUYF 1KMCA 1FUEA 5C4GB 5E4JA 2PT6A 4KLNA 5C52B 5AKZA 4P58A 2B8WA 4F91B 4XX0B 1L6RA 5C3UA 2ZJZA 1U7WA 3OCYA 4HLUA 3B5IA 3DV9A 4YMSA 4FCTA 4Q3OA 2XBLA 2O7VA 3LUBA 1M8KA 3AKDA 3B78A 2GCOA 2XTZA 1E3IA 2CNBA 3LUJA 4RJLA 1L7XA 1RCTE 2JGMA 4RA9A 5EKSA 1BHJA 3WI7A 2IYVA 2WLTA 1QHHB 1ZG3A 1E1MA 1JGTA 4TQAA 1A8QA 5GONB 2XYGA 3JQAD 4G0QA 3TTUA 5B4TA 3MC1A 3WQRA 2GZAA 3VC7A 4LCJA 5CM9C 3HXPA 5C1DA 3UJ8A 4LGVA 4EPXA 2VCEA 5B36A 2ZM6B 1KWKA 2BH9A 1E3LA 2BFPA 2GBLC 3KYDB 2VDVE 2OQ2A 4RXTA 5AK4A 4MGIR 5GQSA 1G6OA 1V8OA 2Z3WA 4PAWA 3SX2A 4BXOB 4R71A 1W96A 3JRNA 3B6KA 2H2AA 3W6OA 3P96A 1EFTA 4NYMR 4YX9A 1BFDA 3RS7A 1WDLA 4BO8A 3G2OA 1IUOA 4QGBA 4AJPA 3ZGOA 5A2QA 1FSFA 4QX6A 1VLLA 4Q18A 4NBVA 4NARA 2DUUA 2ECPA 4C0KA 1IBMB 2D1TA 3ETGA 1E99A 1U94A 3PKIA 2YXLA 5J2TA 1K6MA 3GRCA 4TS9A 2UYGA 4RGQA 1SOWA 3TZQA 2B5WA 2C0PA 4WNYA 1VJCA 2R7AA 5EMHA 3V9AA 3PHLA 2ZRAA 1YRHA 5AIBA 1SULA 1IYZA 1EM6A 2PGXA 3KOXA 1TM7E 4R31A 4QNRA 3WOVA 2GJ4A 3B5JA 3MQFA 1X15A 2ZZNA 1C30B 5E2IA 4P22A 2PD3A 2DR0A 4N6OA 2HR1A 1Z2NX 5EIFA 5BRNA 3RVRA 2VZ9A 2CYCA 2V7PA 3SHVA 3F47A 3ANTA 3RHZA 2B69A 4RK4A 3V2GA 1UXOA 4R16A 1NAHA 1GDDA 2GAFA 1T6BY 2V6IA 2EZUA 4A36A 2W2NA 1XR3A 4MVJI 4MWDA 1JECA 2BMDA 3HB1A 4BLUA 1L5FA 1RKBA 3MQ2A 5LJIA 3L8FA 3NBUA 1G8PA 1ZUNB 2WU0A 4WY5A 1YZ3A 5LYYA 4DCNA 1P18A 2ZUDA 4PZCA 4BWGA 1ZHFA 4GQAA 4C0JA 5K3EA 1XDDA 4L4XA 2YFQA 4ZQIA 4EI7A 5JJBA 4DUGD 3KZCA 4JROA 3ZUPA 3L5KA 3K30A 3N2EA 3OKXA 3QFHA 5JNUA 5A06A 4BWFB 5LFAA 4EHIA 1GTL1 3HCBA 2D5AA 3A8KA 4TMZA 1P2SA 2Y1FA 3PQEA 3SPXA 2IL1A 2VG8A 1O08A 3EC7A 3VXKA 1KJQA 5JZ9A 3HM9A 2GLTA 3C3WA 5EZYA 4D2IA 2FFAA 1JPVA 1SUEA 3V00A 1O94A 1PZGA 2DPYA 1G0OA 3DC2A 3U9SA 2MYUA 3KPUA 4ZCQA 3PX3A 5DHFA 2EGUA 3GFGA 2WIGA 2JFFA 3BFKA 1XZAA 2PXAA 2OGZA 4FYXA 5EWMB 4CFZA 4HDMB 4R83A 3E20A 3R24A 4Z8XA 3JQ8A 4KFCA 1S0UA 2VOEA 1P4SA 4MB2A 4LWQA 4JENA 4Q4LA 3ZCRA 1ZWLA 3K70C 2VK4A 3SEFA 5JADA 1JU3A 3DOCA 3KG2A 1W9MA 2WQZA 3B70A 1RHUA 1CV2A 3Q0EA 3VKUA 3UAZA 5ADHA 1DXYA 4FN5A 3LTEA 3N75A 2D3WA 4LYFA 1DWQA 3QUTA 3PK0A 2YWEA 4OQEA 2XITA 3AQ4A 5JZVA 2HCJB 4TQGA 3TLXA 2I33A 2BGUA 2FR1A 4LJ6A 3VR6H 4CM9D 3QUSA 3ZY4A 3ROTA 4GVXA 4IH1A 3EIUA 1BNCA 3KSBC 1ZIDA 4LYJA 5ED4A 2IYPA 4U7TB 4RPCA 1KORA 3G5MA 4C0WA 5L9AA 5DHUA 4E03A 4O2LA 2EQ5A 3CUYA 1I2CA 1VSQA 1L3CA 1LBEA 3H99A 3KZKA 3L79A 2QMHA 4PR0A 4C20A 3ZE2B 3DSRA 4LQDA 4KGDA 1O97D 4FGSA 2XLCA 2FF7A 3C8DA 4YHBA 1PJSA 1NBIA 3B7PA 1GUFA 1JJIA 4GLBA 4BUJA 2G1JA 2EL9A 4JB8A 3H2ZA 5G0UA 2PO7A 3BSWA 4E5KA 2VEOA 3G0DA 4Y1EA 1MAUA 4LKRA 5AJYA 2Q5FA 2G9UA 2GDZA 1J1IA 1G2PA 3FH0A 1J90A 2GJPA 2VA9A 4N47A 1UL1X 1P2TA 1Y8QA 3RS8A 2EF0A 5AKEA 2IVZA 1HNXB 4JBYA 4P53A 2NVUA 1R4ZA 3BMQB 2IHZA 5ED0A 1BSVA 3MOSA 4WCVA 5C34B 2E5FA 3RASA 4O5AA 5AQEA 4IOLA 3U3ZA 4G5OA 4C07A 2XOXA 1DKQA 2GK4A 4KFUA 4N7BA 1QGOA 1WOSA 4CNQA 2QTRA 2XSZD 2C4UA 1NVXQ 4MVJM 5FUVA 2UVQA 1E6EA 1CQZA 1OAOC 3JD3A 4IVQA 3A8JA 5ERYA 5GOZA 4KKTA 3VNQA 1VXRA 1PL8A 5CBPA 2XX3A 4LBWA 4N8EA 3GFBA 4D7AA 1QS0B 3DZDA 1KI9A 1GPNA 4ZA2A 5K3AA 2XGMA 1NQAO 1TL7C 3E9QA 2YXNA 1N2EA 3DDYA 2YMMA 1JA9A 4BQEA 2RGAA 1U3VA 4FMDF 4FXPA 2JAUA 3L7AA 3FRHA 3DT9A 5P8WA 2HMVA 1RP7A 3CTPA 5FWYB 3SMVA 4J2TA 1SM4A 4ZVLA 2ZOSA 2BFWA 1CVIA 2ZJ7A 4H3KB 3GWZA 4MGZR 4UFNA 4BFWA 2CHQA 3THWB 4ZIRA 3T7KA 1RW4A 4GRIA 4RDHA 1X7XA 3BWEA 2N42A 4D0RA 1RADA 1T2VA 1SG6A 4GGPA 5DIZA 4BMOB 5LYJF 1N36B 3P9PA 3G0GA 3WSWA 5D5PA 2P5TB 3N2ZB 1P9LA 3P8ZA 3UB2A 2Z8YM 3WHKA 4G1CA 3SHWA 3WLKX 3R6LA 1DUIA 1CY1A 2NO7A 3ASUA 4FI3C 4V24A 3BXOA 3E0XA 1NVEA 3LXXA 3LX6A 1MX3A 1ISJA 1E77A 1OVMA 1JG4A 3DE1X 2OBFA 2PX8A 1R6AA 2Z08A 1QMGA 1L7BA 4LQLA 1TQHA 3QFSA 1Y3DE 2CZQA 4GI1A 5KNCD 5KNDA 2ZI9A 1ATIA 2DTXA 1QH8B 1U7TA 3JYHA 1WXFA 3KU4A 4OOXA 1AB5A 4KWCA 4QHSA 3O84A 3O93A 4QAQA 1RLJA 4W5QA 3KTAA 2FP3A 4AI6A 3JYOA 4IFEA 3T1NA 3D6MA 3CLHA 3U3MA 1KJIA 4CQLB 3RV3A 1OBHA 1YZHA 4TL7A 3TKAA 4KREA 2HXSA 4XLCA 1QHGA 1E9AA 3MTEA 1J2JA 2B2CA 5B1EA 2ZZMA 4N03A 3OESA 4RXMA 4DQ0A 3NEAA 4RFLA 3G71B 2FEPA 3RAEC 2FSVA 5HPYB 2QZPA 5GWXA 3UGJA 3Q6NA 3RAGA 3MWDB 4Q9JA 2Y77A 3WV4A 1O6GA 1X8JA 3O92A 4MP8A 5FOQA 2RARA 5DRYA 2J8ZA 4LJAA 1L8XA 1I8DA 3FPEA 3ULKA 4EY6A 4OX9B 2SCUA 3T5MA 1FJGB 3Q38A 1S2IA 3CTMA 3GLFE 1H4VB 2HCBA 2ZSAA 1UBGA 3MEQA 4GUAA 1SXGA 5DGIA 2A9OA 4EJ2A 3UHFA 1IY0A 4UATA 2UXDB 3ICEA 2I9KA 1ESMA 4TV8B 1NG1A 3RVKA 3EXHC 2JZNA 4DV7B 4R3UC 1UMDB 3OW7A 2H5IA 1M5UA 2IU3A 1DAEA 4I4LA 4QARA 3PJRA 1SUBA 4JU9A 3GA5A 1GT91 4G86A 3FMVA 2QLTA 4GZMA 3W90A 1MT3A 1L4LA 2NZJA 2R66A 2HDOA 5FB3A 1HFWA 2O6LA 1NLYA 1TJ5A 3RU2A 1N7IA 4PZUA 4GE3A 4QBIA 4YP6A 2FU5C 5H02A 5JC1A 1WUHS 1FYEA 2JL1A 2HQSA 4RESA 1FFCA 4LJKA 1UFOA 3RS3A 2IPXA 5MHTA 1NJFA 1CS0A 2HD4A 4KXQA 1H2ZA 1XJ0A 3A4NA 1WBDA 1SFRA 1TCBA 2OFWA 2OAGA 3EZFA 4JT8A 2II6A 4KXWA 4OD0A 4KIGA 3EW7A 5HMMA 4P3YA 3O90A 5BWLA 1E63A 1I6MA 3EWAA 1YFJA 3BA1A 3NBAA 1KZ4A 3GVHA 2DP4E 4HXYA 4MUNA 5JTUA 4S0ZA 3H5VA 3LO8A 3M4ZA 4CHTA 4EAQA 1GDTA 2H8KA 4ADSG 1FMFA 3AM4A 1YIJB 3SVLA 5GV7A 1E2EA 1N5MA 1I0LA 1WXDA 2ZE6A 3B1YA 3OY7A 4KYIB 1VLQA 1BXRA 1HZZC 4ML3A 4WFJA 1APBA 2WJ3A 3N0XA 2WTNA 3NT4A 3TXAA 1W36D 1T26A 1IXSB 1IPEA 1WCWA 2A0FA 1TQDA 2BFFA 3GP3A 3H1FA 3VNRA 5HM8A 3W3AH 2L69A 4NG5A 1XMOB 2FEXA 1RIIA 1IEVA 4JLJA 2GPTA 1N34B 2UUOA 4ARAA 1MJFA 1Q74A 1VTKA 3MRTA 3KQPA 3HAGA 1U9YA 2HHAA 4DG8A 5ELXA 1MJ5A 3P4UA 1CZLA 4QVKA 1Y80A 4HN2A 2IXEA 2YHIA 5EHQA 5JARA 5K8JB 4UW9A 3V1LA 2EQAA 3V1KA 4O1IA 4W1QA 2ZXHA 1BGVA 2KBEA 1NP6A 3Q7PA 4R1NA 4D9JA 1P19A 4OH7A 1C30A 4B6PA 2EJCA 2GWHA 4P0TA 1JSRA 4KQMA 3LC0A 2FW9A 4L3OA 3CRZA 2JGIA 4PCVA 4PM4A 1M5TA 4U2KA 1QDUA 3PRYA 4OEHA 5EIBD 4HZUA 3FMGA 1Y33E 1OPRA 3CU5A 4EPTA 4NBLA 1DO2A 5JAQA 4KQCA 1LBIA 1U3UA 4IW3B 1GNPA 2HA6A 3N5KA 4U3JB 5JRZA 3D31A 3IVAA 4IMJB 1G8HA 1CR4A 4RO0A 3VV3A 2XW6A 5BVGA 1V1MB 4C2TA 4K8OA 5KX5A 2AC4A 2OCIA 5MDHA 3CB4A 4PFQA 4U7JA 2PXCA 4B6RA 4R8RA 5C0OE 2Q6OA 1M7HA 2QYOA 1XPOA 4YRLA 2AB0A 1JDVA 4MVJG 1TD1A 3O47A 2ZYSA 3EIFA 3ZVMA 1LZLA 5ILGA 4BL5A 1M67A 1OI2A 2OFOA 3D81A 5DSZA 1A0OA 1KZYC 2IKQA 3AFIA 3O4GA 2GFQA 1DBRA 3WXMA 1YE8A 4UDYX 2J3IA 5KOIA 3MJ4A 4F21A 2V98A 4CU2A 2FH5B 4OQZA 2PKQP 4NENB 3KFVA 4JJAA 1RI1A 5CIWA 4A3SA 4AJKA 1D1QA 3LUFA 5I45A 2WD8A 3OICA 3ADCA 1FQOA 121PA 2O23A 3LC7O 3C98A 2ZBRA 3OZTA 4GSLA 2QF7A 3EZYA 2QRPA 1GNTA 1TA9A 2AD1A 3JQDA 5MFPA 3SWWA 1JPJA 1RWNA 4F3KA 2B37A 1FVFA 1ND6A 4ARIA 3GT7A 3AR9A 3RV4A 1PTKA 1XALA 1OXUA 3EQ6A 1JRLA 2ECQA 3O1JC 4QGGA 5JWHA 2J9FA 2WSYB 1WZ2A 3HJCA 5IJXA 2Q45A 1NVWQ 4XGIA 2NZYA 1P4MA 2H4YA 4Z7QB 2FQWA 4LJ9A 4MNTA 4TUYA 1XRMA 3L7LA 5F1OA 1JTFA 9GPBA 3U7IA 1K88A 5CA1A 5CCBA 4PPFA 4CKBA 5D7BA 3KQWA 1WUJS 3EIOA 4OV6B 5DCUA 1I1HA 4PTLA 1CRQA 3ZDCA 4ZYUA 5JS8A 3EXG2 3WNQA 4NRDA 4WY8A 5LCXA 1E0JA 2WWVD 3C7DB 4YUWA 1A1VA 4YV1A 4UXHA 2GCIA 2PL5A 3DJFA 1ACLA 3KV1A 2BISA 1XFAA 2YWCA 3AOEA 3G5UA 3HGQA 4B82A 5CEEA 3RVNA 4DEYA 2W8BA 4RY2A 1US8B 1JDUA 2FWJA 3PITA 4HS9A 2G04A 4Q00A 3KPJA 2JVKA 3KJEA 3KUKA 3WHIA 3VJLA 2O19A 3Q7RA 4P7GA 3ROPA 2G80A 2J46A 2W6QA 2P62A 2VQSA 3AR4A 4G7XA 3ZC3A 1QF9A 1NGSA 2HOQA 2QUAA 1D04A 1YI8A 2WMNB 4L8VA 1KVRA 2NIPA 2WFMA 1IB6A 2OB1A 3NASA 2AV6A 4Y2TA 5H1YA 4E5MA 2QW1A 2XE6A 3ZCSA 2C7BA 3EZLA 3H16A 2Y27A 2I7VA 2BR3A 2JS7A 1C1DA 3JATB 4HXFB 4YEDA 1S72B 1W5AA 3IBYA 3TSWA 5BV1A 1GXSB 1EBBA 4NMXB 4HDAA 4NI5A 3BULA 1UBOS 3PR1A 3FI0A 3BQNB 3AUKA 1D1TA 4HEJA 2RH9B 1FDUA 4EB3A 5CCEA 5LXTB 3E1GA 1VIAA 2QAJA 2XWJI 4LJ7A 4F5ZA 1C9EA 3TVYA 4PO8A 5FBWB 4BXOA 4TN1A 1W4LA 2ZAMA 4UU1A 1JG3A 2CE2X 3JZDA 3LRXA 3GRUA 5HRUA 3AK4A 1IN6A 3GLUA 3OX1A 4RK7A 2UDPA 4M60A 1NN0A 2I3BA 3PFGA 1QS0A 4K9DA 4XVQA 2GAJA 2YL2A 3V4VB 1I24A 1A88A 3WGLA 1I1QB 2XWSA 1HETA 2FW1A 1DDGA 3G8AA 4EQ6A 4CIWA 4HCJA 1XI2A 2ATIA 1P33A 4YMTA 3DHEA 4UDOA 3VR5A 4Y2RA 4J9UE 3G68A 3R41A 4Z51A 7REQB 3HVUA 5BMVA 3KOOA 4G5XA 3KYJB 1E7WA 4MPPA 2IXAA 3FHJA 3OMWA 4ZIRB 1I94B 4Z0TA 2DPGA 3F7TA 2J30A 2GI4A 3UAXA 1WF3A 3U60B 1HSOA 1T5LA 3ZY3A 3K2BA 3OPOA 3A1EA 3MCZA 4LE1A 1OH7A 3ZGZA 4QV2A 1D4AA 4GRDA 4C4YA 2JK0A 4J0DA 1VLYA 1DBSA 1IHOA 3CC2B 2FAXA 5HFJA 3JAMA 4YRKA 2P0YA 4WBNB 4FBLA 2NV4A 3PQ5A 4X06A 2IYYA 5DKFA 1A7KA 2GA8A 3VUEA 4EM6A 1MDBA 3QWBA 3CV3A 4EF5A 4QBFA 3H86A 2R60A 1UZAA 4XN0A 2CJFA 2V45A 3A37A 1ZJ5A 4I2VA 4XVHA 1A7UA 4JC8A 1T9ZA 1P39A 4MPTA 5H83A 3RFTA 4K86A 1C3OA 1T4MA 4MV3A 4X7BA 3IPYA 4ZK2A 2XT6A 1WNTA 3IAS6 1WU7A 3BHJA 3SBOA 2REOA 1S3GA 3AINA 4NE7A 5F78A 1NG9A 1FDOA 1GAWA 2XUZA 4OSOA 4CI9A 4RFSB 5DWVA 1E9BA 2KJQA 1O0BA 2EKPA 3LZCA 5C1IA 3FNFA 4RJJA 1WXXA 1UM8A 3GDFA 3LY7A 3T06B 5IULC 1WSAA 3NALA 1KBQA 5KSZA 1RWWA 3AB8A 4ZCMA 3EIXA 1WTHD 1H4TA 1V95A 1WXQA 3TE6A 4CR8A 1CNFA 1FP2A 1RWQA 1M1NA 4E32A 4PXYA 1I01A 1SVIA 4UMVA 3E5NA 3I01A 4PN3A 1A50B 2IH2A 2Q07A 1O94D 3Q3IA 4TMKA 3T61A 1X14A 3Q7EA 2D1RA 5HIAA 1NL3A 3NWEA 4CTNA 5A03A 2ATCA 4KPEC 1AQYA 2RONA 1XRLA 1L1RA 3FY4A 3HCCA 4KKVA 4KTVE 4QELA 2QX8A 6CHYA 2OC9A 5AN9A 1KC1A 3VNUA 2PMWB 4DQDA 4EP1A 3EHEA 1GCAA 2JFHA 1KY2A 3OZSA 4JELA 1J49A 3EVTA 1B0PA 3AEYA 4RL6A 3R9XA 3GLTA 2DKOA 4D6YA 5FULA 2FW0A 3D3QA 3IBTA 1VF7A 4N5IX 3E7PA 4GXTA 5K3FB 1X9IA 2VJKA 4EELA 4QQFA 4XXHA 4RJIA 1M9NA 1DCFA 1ZN7A 1TGVA 4B75A 1AZTA 5I9LA 2VDPB 5EMMA 3V1NA 221PA 2FSGA 2ZTHA 1RWPA 3V80A 5M7EA 5J5VA 3VYRB 1UFRA 1HNNA 1WOMA 2ZU0C 1L5GB 4J0KA 4OUDB 3I9MA 1H2FA 3E9MA 3V2UA 1PFQA 2JHAA 4XRRA 1QU3A 3SEJA 2C0CA 3MGAA 1MABB 1ONSA 4FUTA 2EP5A 3EVGA 1B41A 1YQQA 3B9PA 3HVJA 3LG2A 2JLRA 2J3QA 4A8HA 1T2FA 3IAM6 2GUGA 1NMYA 2UU9B 2WAMA 4KNYA 4LOIA 1U0JA 2HJGA 4G4SP 1WDKA 2WW8A 4MLZA 3QELB 4WOBA 5M29A 4TTTS 5SZIA 2RHGB 4QU0A 1I0ZA 1EIWA 3T52A 2Y4NA 2YN4A 4JL6A 5IYRA 2N3ZA 3QV2A 4B6GA 3CVVA 1M0TA 1AVTA 1R12A 3NG1A 3QEMB 3ZTTA 5CVJA 1FXWA 2BFFB 2OZLB 1NY6A 3EC1A 5L95A 2PA3A 2HTEA 1Z82A 2RGRA 1JA1A 3FW1A 8LDHA 1WCIB 2VNKA 3IO5A 3ECAA 5LD2C 1LPPA 1XMJA 3FDZA 4DLBA 3DE4X 4YONB 3OE5A 3T54A 4WKGA 2WSMA 4J90A 4BBPA 4MYHA 3VVLA 2EW2A 2H2WA 5LOVA 2RGDA 4WA8A 3QVXA 1JR4A 5KYXA 2IU4A 2ZYDA 4V0OA 1EB8A 1FFDA 2G1PA 3S5JA 3DGFC 3SSAA 3YASA 3ADDA 1PYDA 2X9QA 2PKEA 1EIZA 1NJSA 3L4BC 4YS6A 4OQLA 2CC2A 3MTQA 1NHWA 3LW8A 1RZRA 4B3DA 1A76A 4JJ4A 5CDGA 3AKCA 4E70A 4PNEA 3HU1A 1WOOA 3BZUA 3DMRA 3TW6A 1HM5A 1QH9A 3NBZC 2C9MA 1FE8A 2C4MA 4XFJA 1P29A 3MWEB 3N3BC 4OKSA 1RACA 4N0QA 3AEUB 4NLLA 4M7WA 4MVWA 3KQSA 1Y1KE 4ZOLB 4C3UA 4NSNA 1YOBA 2I2WA