1OGJA

Ferredoxin:nadp+ reductase mutant with leu 263 replaced by pro (l263p)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity
pubmed doi rcsb
source organism Anabaena sp. (strain pcc 7119)
molecule tags Oxidoreductase
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ogjA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ogjA02
2VNIA 1W34A 3W2FA 3JQQA 2RC5A 2B7CA 3P27A 4M53A 2OK8A 1ELOA 2EIXA 1E64A 1GO2A 2CRVA 1VQNB 1Q81D 3W5VA 1SM4A 2B7BA 2YWGA 3MHPA 4TN1A 1EP1B 4C0SA 4YALA 1M1KD 1DG1G 3U6BA 4RD4A 1XE1A 4RCZA 5H5JA 4AF6A 3CMAB 1N8RD 4NCNA 1QUFA 1HA3A 3I56B 3VO1A 4EH1A 3A1FA 4ACBA 5TV2A 1FDRA 5GV7A 3AVWA 4N3NA 4B48A 1QUEA 1N0UA 1KRHA 4H9GA 5THXA 1VQLB 3CMEB 5H59A 3J81k 1QFZA 1CNFA 1TTTA 2BF4A 5GV8A 1EXMA 4LBYA 2BPOA 3W2HA 1R5NA 3ZC3A 3WYAA 1K8AD 3B78A 1QGZA 5JBQA 1YHQB 4WQMA 4B47A 5HXBA 3WBJA 1YIJB 2E1RA 4G1VA 4TMZA 4R71A 3WXMA 1JA1A 4TMXA 3CRZA 4M2LA 3CCVB 2OK7A 4ZGQB 1QVGB 4FWTA 2BMWA 1D8TA 2YWFA 4ZCLA 4PC6A 1W35A 1U2RA 1IJEA 4HE5A 3CCEB 1G7RA 3G71B 4BPRA 4ZV4A 4RCYA 3VO2A 1EFUA 1KJZA 3CCLB 4Y7CA 2CNDA 1DDGA 3OZVA 4QFMA 1D1NA 4ZCIA 1G7SA 2OTLB 1A8PA 1IJFA 1KK1A 4YAUA 1NJID 2BN4A 4RD1A 4IW3B 1UMKA 2PLFA 2PMDA 4TMVA 2FX3A 3OW2B 1Q82D 1CNEA 1VQMB 1TUIA 1FNCA 4G5GA 2BSAA 3QFCA 4LC0A 1I7PA 3FJOA 3QFTA 2B5OA 1GR1A 1JA0A 3JQPA 1KK2A 1SKQA 1M90D 2QTLA 3ZZUA 1FRQA 2C78A 2VZLA 4P3YA 3CCRB 1W2BB 1KQSB 4F7DA 4PC7A 1E63A 2HMAA 1EFTA 4Y9RA 3QFSA 2DCUA 4AC9A 1VQ6B 1EFCA 2J7KA 3V76A 1Q7YD 3FPKA 1F60A 2QA4B 3WBKA 5TY0A 2QEXB 4TMTA 4PC3A 4K1XA 1EWYA 4M0LA 1TVCA 1BX1A 3LYUA 1OGIA 1W87A 5AN9A 3VNVA 2QN6A 2YWEA 1S0UA 4C43A 3AVVA 3LVBA 3MCAA 5FA6A 3QE2A 3W2EA 4MYTA 2DEUA 3CCUB 1N0VC 2PIAA 1R5BA 1OB2A 1R5OA 4M1KA 3CPWB 3ZZ0A 1DARA 1YITB 1OGJA 2ZITA 3I55B 3OZWA 4ZCMA 4TMWA 1QG0A 1BJKA 3W5UA 4Q7JB 3CCQB 2GPJA 4QHYA 4LBZA 1VQ4B 3OZUA 2D74A 4HE6A 3W5HA 4PC1A 2YWHA 2RC6A 2VNKA 4NBSA 3VMFA 3CC7B 1QH0A 4B4DA 1XB2A 1VQKB 2EFGA 3AGPA 5EMNA 1YJNB 1H85A 4PGOA 4RD3A 1IB0A 3WNCA 2R6HA 2QMUA 3LO8A 3QSYA 4FK8A 4RJLA 4RD2A 1VQOB 2HCJB 3E20A 1YJWB 1KC8D 4M4SA 4DQLA 4LBWA 1VQ7B 3AVTA 3ZBTA 1J9ZA 2X3UA 1ZM9A 1H42A 4B43A 1Q86D 1CQXA 3CCSB 2OTJB 1D2EA 3AGQA 1VQ8B 4YAFA 1FNMA 4UAJA 4FN5A 2BV3A 3AVYA 4AF7A 3B82A 1B2RA 1DDIA 4B44A 1AMOA 4J0QA 2HDNB 1FNDA 2BM1A 1JJ2B 2BVNA 1FNBA 4PC2A 1FRNA 1YJ9B 3OJWA 1K9MD 1GJRA 1G7TA 1NDHA 1B23P 4RD0A 1GAQA 2AHOA 3CB4A 4YAWA 3CC2B 3W2IA 5KSWB 5DSZA 2XNJA 3ZBUA 4YAOA 2C77A 3OJXA 4G1BA 1TLLA 3AVXA 2NPFA 1YI2B 3G6EB 3CD6B 1F20A 1KTVA 3CC4B 2BGIA 1S72B 4P6VF 1GAWA 3MMPA 1BX0A 3CXCB 3ZZTA 2DY1A 3CCJB 1KD1D 4YHBA 1KK0A 3WNBA 1VQ5B 4MYUA 3VNUA 1AIPA 3U2QA 1QFYA 3G4SB 3E1YE 1QX4A 1QGAA 1GVHA 2GQFA 2VNHA 3QFRA 3JQRA 2VNJA 1JB9A 3P26A 3WNDA 3SJZA 1G7CA 2QDXA 1ZM3A 4LBVA 1ZM4A 3CW2A 1ZUNB 4ZGNB 2DETA 1QGYA 3PENA 3ES9A 3W2GA 1K73D 1VQPB 4B3XA 1OB5A 1EP2B 1QVFB 1E62A 4RD6A 3U6KA 3LRXA 1WDTA 1VQ9B 3CCMB 2BGJA 1EP3B 2QTZA 4DQKA 2VYQA 3B8HA 2XEXA 1QFJA 3AVUA 3WY9A 1ZM2A 3I1FA 4U9UA 2BM0A 1BQEA 4Y9UA 4N3GA 1KK3A 2XNCA 4ACAA 5TR9A 1JNYA 2DERA
chains in the Genus database with same CATH superfamily
4OKSA 3W2FA 1FMJA 3U9TA 4ZANA 1EUDB 4FCTA 3BWYA 4RS4A 3V8PA 1RADA 2EVWX 3MS4A 1VRWA 4RGVA 1J8FA 1QSGA 1ELOA 2BFFB 1GTVA 4P3IA 3AKYA 3O1IC 4RQAA 4I5FA 5FI3A 3UUEA 4LFBB 1Q81D 4LNAA 4P5DA 1FUKA 1YS1X 2P3MA 5FV7A 1SM4A 3BHIA 3CLTC 4HZUB 4Z4QA 2XQKA 2I7DA 4LCBA 4NL4H 1FPQA 5CXXA 2PTGA 1KMQA 3I28A 2HMYB 3IBTA 3AJ9A 4J75A 5CEEA 5KTOA 4L16A 4XB1A 1ML4A 4AZTA 1N7GA 1WHSB 2W37A 4J4HA 2OORA 3ACCA 3F5SA 5ABPA 4YPFA 3RYHA 2ISSD 4G4SP 1MDBA 4I19A 4KPGA 4URFA 4X97A 2YJNA 1MJGA 2W5UA 3JD0A 4JUBA 4DAEA 4ENQA 1T6NA 2YFYA 1NNLA 2FR0A 4OFWA 1SQGA 3USCS 1KQGA 3LDGA 5IK2A 5DT2A 3D6JA 1J39A 4C0SA 3EAFA 5IAOA 5EXDA 5P21A 3ER9A 4CM9D 2A1UA 4X93A 3FUWA 1VBNA 4L5CA 3WJ7A 4DARA 3GRPA 1ZOLA 1XE1A 3R7NA 4WA8A 3TTYA 2V7QD 1TT5A 3PGVA 3ZGZA 2WU0A 2Y1DA 1ZG3A 5M7EA 1WBJB 2JGFA 1I6MA 1UPTA 3R5HA 5AHRA 3O2QB 3ORQA 4OQFA 4ZVTA 3M6VA 1JJFA 3RNOA 5EPEA 4RHFA 3ZWDA 2WLSA 4LSMA 3K31A 4WZZA 2R8EA 4EJSA 1T5SA 1X86B 2FRDC 4NX2A 4PSUA 3S27A 1RRGA 2GCPA 3WKCA 2FP4A 1APBA 3FSGD 3EY4A 4ZT2A 1LNQA 3A6LA 2O20A 3IPYA 1BH2A 5K8VA 1UMCB 5F76A 1YH3A 3UHAA 5JCPA 4ZT6A 3CG0A 3VM6A 1DKPA 1KMIY 4HGOA 3U9LA 4QTUB 1ZL0A 2B0CA 4I9GA 2ZJYA 3RBAA 3SF8A 4BRUA 4G26A 2IKQA 4OG2A 4J1SA 1OD6A 4X3PA 4XNFA 4DWWA 4YCLA 4DQDA 3CMEB 1EGAA 2K6GA 3WJ2A 3A6FA 1MVLA 5CH5A 2XD4A 5H59A 2X2EA 5EP1A 3RSLA 2RBEA 3GLHB 3SYKA 4HNSA 3IFSA 1XE3A 3T3OA 1MB0A 1WDKA 3ZHTA 1KYYA 4KO1S 2AKYA 4ZTBA 3MINA 4S35A 1VI2A 1HUQA 4WZBE 4TZ0A 2GPWA 2ZI6A 4X1KA 1VFPA 3FVRA 2YIMA 3AG5A 3O2SB 3G9XA 2QW0X 5JBQA 1VSUA 3DTYA 3F7NA 3JWIA 3O8DA 5AH0A 4R69A 4K9DA 5EVCA 1KI6A 1NYRA 2COKA 4QTTB 4RESA 3RTGA 3V9PA 1IB6A 3NVMB 3EVFA 4ZOQI 5LKAA 4UVGA 4C3ZA 5BURA 1UJ6A 3ROEA 3QKTA 1XZJA 2C5HA 1NMEA 1NI5A 1J0DA 4WLUA 4FDAA 5EWLA 5KWIA 3O9MA 3V48A 3IHTA 4RL6A 3VU0A 5GIOE 5HXBA 2CDAA 3UMBA 1V25A 3USES 3KSMA 3W4IA 4MPJA 1PFQA 4PU0A 4HEA6 1Z2DA 4R71A 1MNAA 4O1HA 4HZIA 5E9QA 1UZNA 5F9HA 3HXQA 5F1YA 3H5NA 1E2BA 3M4JA 1B74A 1ISSA 3GI1A 2DTEA 2XT6A 4TKMA 4IZIA 3GSIA 1W5TA 2VHWA 4I14A 4EFDA 1D07A 2I2XB 2C4NA 2QX8A 4CIXA 2KBEA 4JLBA 1XLTA 3VR5H 4EHIA 3MRVA 1Y8RB 4AY5A 3WL7A 2JHPA 4A91A 4EI2A 4ME6A 4OXKA 2YJZA 1JIJA 1JU9A 5LD2C 1L8LA 1GA4A 4KREA 3SM3A 1NUTA 1NP3A 3IDQA 4TTAA 2JLQA 1M0EA 5TEWA 2NQTA 3A7EA 3OZVA 3DZFA 3E3MA 2AX4A 3NM4A 3JATA 3VZRA 4BBZA 3IXLA 1II8A 1DRJA 3H1EA 2JIZA 4WZAB 5ECYA 2H2DA 1BQ4A 3C7TA 1XXHB 4MB0A 1LTHR 2XQIA 4Q19A 5J40A 5IJ0A 4HQFA 1BVUA 1IEWA 5C46F 1L5VA 5YASA 5D51S 1J0CA 1N6OA 1UMKA 1MGOA 2FMXA 1U7HA 2PAFA 3K9NA 3KALA 5TX7A 2Q45A 4JL6A 1P44A 2HB6A 4JN6B 4XWKA 2QXYA 4C0QC 5LQDA 4X63A 1MA0A 3MZ0A 4EY6A 2QYOA 2JANA 3OLWA 4MCJA 3ZNOA 2FMIA 3QW2A 2R9VA 4CNBA 3G9TA 4G5GA 4ARUA 1S2DA 2RK3A 5DK6A 5ECDA 5I3CA 3K0CA 1VLQA 3Q11A 4QM7A 2Y0CA 4EF5A 2QNBA 1Y4ZA 4F4UA 1Q19A 1Z7EA 3EGDA 2ZATA 1OAOA 3JQPA 3FNQA 4ON9A 1UBHS 2CXHA 2WYOA 3NHFA 4GGMX 4RA9B 4F2PA 1UBTS 1TJ4A 1SXIA 2FE4A 3U0BA 1QANA 1ZMBA 2NO1A 4JSRA 4CR7A 1YLOA 1N1GA 5DTMA 4NOJA 4WOPA 2VZLA 4KGXA 1IEQA 2QGGA 3L0ZA 2A0WA 4WXEA 1QH1B 5FAXA 4O0MA 4CDMA 5I4CA 2ZUEA 1FSZA 2G70A 4JLOA 2CXQA 2WPDA 1Z2NX 5K01A 2JB9A 4IGAA 5B3KA 1PG5A 2G5TA 3L1HA 2X5KO 2B1GA 3AQ4A 1ZI8A 1UIRA 4KEAA 5IXYA 1BN6A 4G7XA 4IMJB 2JFBA 4GLBA 4NBUA 2BKAA 4F46A 1T1EA 4YRGA 4YMLA 3GCGA 4DMCA 1T4MA 5AVQA 3KELA 4BNKA 4B87A 4LJ4A 4PO9A 1EFCA 1D7AA 4EHDA 4MPRA 5KYUB 3B3JA 2O4UX 3S7TA 5F5LA 5M04A 1DXQA 1GKYA 4R2MA 3RVLA 5FDFA 3GMSA 1IJBA 1J56A 2PT7A 1IU9A 3D6NB 4Y6RA 4RULA 1WEHA 1GG2A 2QEXB 1GL7A 1REQB 5ALEA 4NZNA 4DIEA 1Q0PA 1R6XA 2XZOA 4M1TA 3IA7A 5FUVA 4BATA 2FRXA 3LPDA 4DB2A 4RDKA 5K0NA 1KOLA 4D5GA 1MV5A 2VYFA 4DMHA 1WPQA 2XRFA 4RE6A 1KMNA 3PF8A 4MH0R 2GXQA 2QN6A 2AOTB 1S0UA 3EVDA 1P9NA 4L4RA 3AVVA 1O94A 1JQKA 3SHVA 5K51A 4YYZA 3QPCA 3H3FA 3VHLB 3UAOA 2PH3A 3C7DB 4JQSA 5DXFA 3NYIA 2QVCA 3W6NA 4BMVA 1ISGA 3QIAA 4RZSA 3IOEA 4K9RA 4E4YA 1GGNA 1OA0A 1VJCA 1YQQA 3COWA 4MQ4A 5EFZA 2QZ9A 4H3HB 4EI8A 1HLGA 1VHEA 3STYA 2YVUA 1A9RA 1XZHA 1ZK3A 3Q2IA 1QHXA 1M8KA 1Y1PA 1NE2A 4EFMA 3II6X 1PYDA 1DEAA 1Z5UA 3UVEA 3W5UA 2C95A 4TL6A 3T3MB 1SWWA 3BCHA 4QHYA 3DFZA 4PZPA 1RAEA 4KWTA 5EZYF 2LIPA 1C1HA 1OXSC 5JMTA 5AVJA 4XYGA 3GWZA 3BRWD 2Y9PB 1NY5A 1TIBA 2OAP1 3KP1A 1KI3A 1NY6A 3FFBA 3CC7B 5CNKA 1WHTB 3HCCA 1NX9A 4Y67A 2IIPA 1L5HB 3AR4A 3RVJA 5HQTA 1P81A 4K7JA 3W77A 4E15A 3ZU3A 3SSOA 1Y1TA 1WXGA 2EFHB 5DISB 2JGJA 4HDMB 1R6UA 4DR1B 4K88A 1SFRA 3DJFA 3ZH9B 3KKPA 4B4KA 3I32A 2G6TA 2FFQA 1VG8A 1T25A 2ZTLA 2Y0EA 3A7DA 4UD6A 3VYRB 1EUQA 2Y93A 5ERYA 4Y0NA 2LP4Y 1MJHA 1Z2AA 3MYYA 1MEEA 4LI3X 1Q7CA 4D9NA 4CCAA 2A0XA 2YTZA 3OIVA 2G5GX 1CS0A 3HP7A 5TT0A 4OLAA 4BWGA 2GILA 3D02A 5DX8A 2ZPUA 3FHCB 4XCQA 4XGQA 3D1VA 3MT7A 4MCIA 5DVZA 4W9NA 2NU9B 3UT5A 4INPA 1R6BX 4U2EA 2O1EA 3L93A 4Y0AA 3VU8A 1T0IA 1E9BA 4B4WA 1EDOA 2FR8C 1PSDA 3LO8A 4U6SA 3IUQA 2FJ0A 3B6KA 2VYND 4A26A 4JUDX 4P7GA 3WYEA 5E8JA 3UWOA 4K9QA 3E20A 1YJWB 3NP7A 3TECE 2QLTA 2QAJA 3H1GA 1M10A 2QUBA 4Z1MA 2QBYB 4LBWA 4OTZA 3UB4A 1NVAA 1E4YA 1TA0A 3HB4X 2ZSFA 3KQLA 4DSTA 4DV0B 4MA0A 5B7QA 3TZKA 1K28D 1UBUS 4XTRA 5DGCA 3P0IA 1E2HA 1V8FA 5BUSA 3I58A 3ONFA 1GSAA 1XLUA 3OQVA 4KLZA 5CK5A 4KQ2A 5C8ZA 3GP5A 1BVYF 4PQGA 1ZMTA 1D2EA 2IEGA 1KDPA 4IUBS 4WNAB 1QTIA 1UDCA 1CLUA 1R4ZA 1WZIA 2XZDA 2ZYVX 3EIFA 3N76A 4JLMA 5H3LA 3VR3A 5JSQA 1SXQA 1L7NA 1FIUA 2ZXFA 3MTDA 3IAFA 1ZKDA 1VXRA 2Y0DA 3G2KA 2E9SA 4GX0A 3VC1A 3A06A 4X8IA 1I0IA 2IU4A 3BDVA 4B17A 5I7AA 3ROQA 4AF7A 1E79A 2R6JA 4JXXA 4TKZA 2X15A 4ETWA 2BKLA 2R4QA 1N2HA 2Z2KA 1FFBA 1TCBA 2F59A 2Z83A 3Q8WA 2QRJA 4AWAA 1ND6A 1GDHA 3A3NA 1A69A 4F04A 1B0PA 2G76A 1M2VB 4RDXA 3CF6R 3R9IA 1GKIA 1IHOA 3F4BA 3JX9A 1NBHA 1Z5WA 5ARDA 4K26A 4S1OA 3V1TC 1OFIA 3OM1A 4HD8A 4OV6B 2O8VA 3IHWA 2RGNA 1IXRC 4J90A 4IHJA 3BMCA 1IXSB 5IFLA 1MJGM 3RS3A 2RIPA 4XJXA 5I9TA 1FNBA 3DM5A 2GNOA 1ZUHA 4XCVA 2C2XA 4RNDB 2C57A 5M2QA 4Q5IA 2VFAA 3NUQA 3H2ZA 4JI5B 1I1HA 5CPBA 1IHYA 1ZBDA 2FPUA 3VOSA 2G9RA 1Q2UA 2J87A 4OP2A 4XSHA 4EB0A 3VNSA 1UL1X 3NV9A 4R2KA 2CFTA 1S96A 4WZ6A 2BFAA 1R74A 3O8QB 5BRAA 2F4VB 1O89A 1QH9A 1YK0A 4PNEA 1ZJYA 3TF5A 4IIXA 1V3QE 1HNZB 4QODA 3ZW7A 5J23A 1NC1A 1LBHA 2OD7A 3D8TA 3DR3A 3FUXA 4MVJE 5PNTA 5EJ5A 1SQ6A 2NO9A 3EQZA 3PE6A 3COYA 1OLSA 4XUDA 1JSCA 4D9GA 2J67A 1JW9B 4BZXA 1NHGA 1Q3KA 4R41A 1C0IA 1MOSA 1OLXA 1JLHA 3L0SA 5GIPE 2X2PA 4XN0A 1VDMA 3NBAA 3V97A 4RDCA 4DSUA 3T7KA 4ZI7F 5IVPA 3I3SR 5ALIA 5D3MB 1E9EA 5BRJA 4ND3A 4L8GA 3ASSA 1KZ1A 3SKXA 4KPFC 2OHVA 1AO0A 2J4FA 4CLOB 5LD2B 2QX9A 1C29B 4JLPA 2IX9A 3V00A 3WNBA 5BT8A 4PHTA 2JEZA 2OQVA 7YASA 4R1OA 4PZ9A 4Y1EA 1QFYA 1SEVA 3DFIA 3VC7A 1B3RA 3ER6A 3PEFA 2QPLA 1OFGA 3MPUA 1Y6FA 1Y5IA 1ONOA 1RBYA 1XDWA 4WBSA 3UOGA 2J3JA 3ESDA 3LGAA 3L6CA 3KQUA 2BFEB 3EN0A 4FX5A 3U44A 4NU8X 2DBQA 4P38A 1M34A 2UYQA 3B7WA 3OQIA 3QXJA 4ALLA 2BFBA 2HKIA 1XROA 4L3WA 1PZGA 4FE7A 2O1XA 2B20A 1U1FA 5INTA 4NCIA 2IPOA 2RCYA 5AVWA 2HM7A 3R0XA 4BV9A 5EIBC 4BEWA 2JD2A 2ZUBA 1YOVA 4XUGB 3BQMB 5HCIA 2ZKLA 3BA6A 3WB1A 2ENUA 3FMPB 1YDFA 4RPKA 4WLFA 4MIEA 5HG0A 2DYIA 5DNDA 3ZCPA 5I9BA 4AJHA 3MGAA 4WK0B 3DF9A 3H9NA 2VBGA 3PTZA 4TWJA 3KETA 1AJEA 4ZZ1A 4UEWA 1YHZA 5FBVB 4L2IA 4LJKA 3SKYA 5KC8A 4JVNA 1E62A 4ND5A 4BQPA 5F4MA 4C30A 4YMHA 5HIJA 2P2YA 2Z04A 4C0XA 1FX1A 2VHXA 4OK6A 1XYGA 1UBCA 3RFUA 3CLRD 5FLKA 5MHTA 4OQNA 3HP1A 1HURA 1RAHA 1SC6A 4XDGA 5FBRB 3ZD9A 3MJ4A 4NU6A 1YVPA 3OCZA 2BGRA 2GWRA 4YV0A 1ZD9A 1WMBA 3RLFA 2PNFA 1ZNXA 3WYDA 1UP6A 1EVYA 4M1QA 4PE5B 3ANTA 3KHUA 3BKXA 1V8PA 3O95A 1NXOA 4G0PA 4QARA 4XX0B 4ZRDA 2P77A 2JAXA 2P11A 1KEEB 1VTKA 2NUPA 2G17A 1ODIA 4DILA 3BNWA 1EFRD 1DO8A 5JCJA 2WYIA 2VH5R 3ZGXA 1ZW6A 4BO4A 1HYQA 2UYHA 1AM4D 1L7MA 2LWIA 1SCDA 3HXOA 1TA4A 1YVEI 5SV2A 4JYMA 2AD5A 2OBNA 4DLLA 2QORA 2IE0A 3E22A 4J7AA 4BFYA 4XYMA 1KS9A 2Q4TA 3DYIA 4GEKA 3AUSA 5ALDA 3ZV7A 3HY4A 3QXCA 3C98A 4IJUA 3NEAA 1CUUA 1JG3A 1W75A 3RUPA 1SKYB 2YFKA 1F2VA 5IC4A 2GJPA 5HILA 3WLKX 3CTMA 1YAHA 2IU6A 3BERA 2CK3A 2ES4A 3HI6A 3IP1A 4X61A 4XWTA 1A77A 3GRUA 5KQPA 5DLYA 1ACMA 1P74A 5E6TA 3R6DA 4IRUB 2YWGA 1FDOA 2Q07A 1HTWA 2GCNA 2ZIEA 5A71A 3T3GA 5JC1A 3N05A 5C7IO 2HJWA 4AYTA 4F56A 3L8HA 2G7ZA 1EDDA 1G21A 3O6VA 1KC3A 3AM4A 2YIVX 4FI3F 4I50B 4ZKEA 2AR0A 2O6HA 2Q1XA 1MBZA 3OPQA 1QRSA 3WGMA 3O4GA 2P1ZA 5HKBA 1HE8B 4DTIA 2C96A 2HJRA 3EBLA 5TJHA 5KNBD 1U9ZA 1VZ2A 4NEGA 3SFVA 4V3BA 4WK6A 2QSJA 4GO1A 4YJFB 4YMGA 2KHZA 4PIMA 1RC0A 16PKA 1QZZA 5EXEA 4EYGA 4NCNA 1VYTA 2ZTNA 5JSZA 1HZZC 4XCXA 2I1VB 1TZCA 1QUFA 2NT4A 3I56B 1Z5ZA 3WG9A 1MHPA 3VO1A 3NGXA 2SHKA 1K06A 5AI6A 3H1BA 3WAJA 3EE6A 2WDZA 3I6MA 2FQYA 4JXKA 4ACBA 1TJNA 2R8RA 3OPVA 3H05A 3ZU6A 4DLAA 4UVEA 1VL8A 2G3YA 2J5RA 1FFEA 4B4UA 4EB6B 3ZGVA 3EMBA 4LYYA 1WOOA 3T7JA 1XZAA 3DC7A 1QK3A 4FB5A 2OY0A 3PNSA 3Q5GA 5FKJA 4E1VA 3E9RA 5EJGA 4KXUA 2YZNA 1MOPA 1LQ2A 1U8ZA 3AW9A 1V71A 1JVBA 3ILYA 4DCTA 1JHRA 4WNIA 3MWYW 2EGUA 3L8MA 4CLDA 3DBHA 3U09A 1EJ2A 3THWA 2I4OA 4BJ6A 3L7LA 4MW5A 1J4AA 1UIMA 3P0JA 3PVCA 1FBNA 1JILA 1VLZA 3BFPA 5KCMA 4E5YA 2AJCA 3DONA 5B37A 2Y68A 1X7GA 1FZQA 2Q50A 4JY7A 1QIIA 3I6ZA 5BP7A 3AI3A 2Q5FA 1OI2A 3JYPA 4DR5B 1UWKA 3SBEA 3PICA 1K8AD 1XELA 3PS9A 2WRZA 4Y6LA 3B78A 4URVR 1KAGA 4MSUA 1PJCA 3CF0A 4Q1EA 3H17A 4YB8A 5FORA 5GPBA 2YXBA 4L9WA 1YHQB 3AHJA 4C1NA 3I62A 2DHQA 2H65A 4CT0A 1TTHA 4YO7A 2WV9A 1XPOA 5JVDB 1UBEA 5K0CA 2CJFA 1D2RA 3BTUA 3FWZA 4YUXA 5L3VA 5IABA 3HSKA 4GR9A 1XYYA 1T3HA 5EPOA 5HK9A 2QUHA 1E2UA 2FFJA 2W2OA 5KJCA 1KOFA 5CX4A 4TMZA 3TM4A 4FINA 3AOEC 1JA1A 4KR7A 4UE2A 3U4CA 1OPXA 1K7XB 4M37A 2OCLA 3G9UA 1PGOA 2YWFA 1W4RA 2Q4BA 3LH5A 1J2JA 1XYVA 2XF8A 4NJEB 4RV5A 3ENQA 4LXYA 4UUNA 4PC6A 3HM2A 4PG7A 1NNEA 1N9GB 4HG2A 2CZCA 4UPDA 4UQPA 1IOZA 3IIMA 3JD3A 4B84A 1ZUD1 4HXEB 4LRTB 5AOAA 3V7FA 2JVKA 3MF4A 2JF0A 4EY3A 4OXIA 3B38A 3TZEA 4CVNA 4LQCA 1R4NA 3G2JA 4INJA 2IEYA 3FRHA 5EQFA 3PI7A 5B55A 1ENPA 4OI4A 2DOKA 1JKIA 4G86A 2WF8A 3AR7A 3JYOA 3UO8B 4PLPA 4NFLA 4P36A 1EIWA 1DJQA 1QO9A 3FZQA 1JSRA 1M2OA 3A6GA 1KK1A 2CXSA 3P2YA 2DFNA 1DQSA 2QMOA 3L0PA 5EZYA 2GSWA 4H0NA 3UH0A 1AOXA 3L7IA 4LQDA 3LXXA 4JI8B 4ARZA 2D5LA 2ACVA 1WOPA 1IBKB 3VR2D 3W4KA 2JLWA 4L28A 4P80A 4GPTA 4BWFB 2OFPA 2FX3A 1EE1A 1IOVA 3FRJA 3KLOA 1Q82D 5I4IA 4PIVA 4KLRA 4BN0A 3NJ4A 3U3OA 2IH5A 2HA7A 3O8LA 1U7UA 1TKBA 3ZEIA 1GPKA 3VC3A 2VHQA 2ZSUA 1K7FB 4Y1FA 4MHTA 4BMPB 4Q4HB 3EAQA 1SUBA 3CINA 1Z8FA 2AUNA 1KMMA 2FP3A 1OVGA 2JGLA 2XQJA 2YWDA 4OUKX 3C7KA 4KYVA 3N5CA 1M67A 2AN9A 3GG2A 5IM4F 1VJ1A 5G0TA 1VLVA 2NPIA 3HFSA 5D6OA 4YUZA 3T95A 1JUDA 4I9NA 1JIIA 4A16A 3FF4A 3Q8XB 1DWPA 4I99A 3GY0A 1CF4A 3FMGA 1OJLA 3KYJB 2PDAA 3KSRA 3K2QA 1J2RA 1RLUA 1R8SA 1NPDA 2P67A 1QAMA 2Q6TA 2VRWA 2P0AA 3IVRA 4Q0MA 1J1ZA 1GQ2A 3R44A 1SUPA 3EEOA 1XEFA 4PC7A 3WMRA 3JQ8A 5FWYA 3FBWA 1DQZA 3X2SA 3EPRA 1Z4KA 2Q5QA 4LG1A 3REQA 1MRSA 4ZO4A 2GN8A 3QBVA 4RCVA 3ORFA 5FLXA 2FG7C 4JI3B 4L7QA 1KVRA 4EA8A 2X9GA 4M99A 4IJQA 3OKXA 2HRQA 4JKYA 3CVWA 7ADHA 2IHZA 5EN4A 2W2KA 3E1SA 3TLJA 4CCYB 3D6FA 1RU3A 3C97A 1K4MA 3GT7A 4H1HA 4BQIA 4EEZA 1D1SA 3ZX4A 5FUXA 4EHAA 3MOIA 1DRVA 3EWSA 3FYTA 5U1PA 2A57A 4AJJA 1S8AA 2OG2A 3SPXA 4B8ZA 5BR7A 3I1IA 5ES3A 3WGNA 1V47A 5TIIA 2RG1A 2FTKE 3BA1A 2BRUC 1B8UA 4KQGA 3OC0A 1O9BA 3L0BA 5CD9A 2HO5A 3GJSA 3LYUA 1W87A 4OGLA 4TL7A 1Y34E 4DM3A 4AS1A 2X0RA 2QN3A 2D59A 2O8FB 3ZWWA 1FYXA 4JI4B 4MI3A 4EHNA 4H31A 3RRYA 3NI2A 4ZVQA 1QMPA 5T6MA 1N2CE 2VNSA 2WKQA 1Y4SA 3AUTA 4FDVA 4BMCA 5BPFA 2FPKA 3WO0A 3KKOA 3RC1A 2DEUA 2VH1A 1XNRB 3OZDA 1O96B 2PX4A 3AF3A 4IWNA 3VNAA 4DYVA 4FFMA 3UA3A 2FX2A 3JARA 4OLJA 2PG3A 2JGKA 4M7OA 1DJMA 3RRFA 3TGLA 3QVLA 4DREA 4DXDA 3DLIA 121PA 2AT1A 3C5CA 5JH7A 1N5IA 5EMMA 1IK6A 1U99A 2PGAA 4QGGA 4JQOA 1U4NA 1TFUA 5IARA 4BBJA 5J1SB 3SJAA 4FSDA 4NEHB 3ZLTA 1G4HA 5JJIA 1C7FA 3IBSA 4ZXPA 4HDSA 1EHCA 1ZD2P 4UXHA 1E6MA 4CKEB 5B6JA 2IYOA 2HU5A 2V9ZA 4HN4B 3SMQA 2OC9A 1H1LB 1RT9A 1U7WA 4HE6A 2W6PA 3PWSA 4A0RA 1OIVA 5DNUA 2N3ZA 4NABA 4UCQA 3O26A 3OEHD 4KYUA 3ZWKA 5HWSA 4HLUA 5JZSA 2OE2A 2PUJA 4EQ6A 3CPSA 4KIJA 1FFDA 1USUA 3FVVA 5JDCA 3TYXA 4REQA 3QE4A 4X7FA 4C7MA 3TRFA 2LDBA 3KSAC 1EPUA 3I61A 1XZCA 4FYJA 3RKSA 1D3AA 2XUFA 5T4EA 4WBNF 3RS8A 4BO8A 3H13A 3WWEA 3FLAA 1TEVA 3LUGA 3C1OA 4KSBA 3AIMA 4YMVA 1NJ8A 4E7PA 4J7UA 3PZBA 3I12A 3UIEA 3R9WA 1L7AA 1LX6A 2OOKA 4Q3NA 4R2JA 3BL8A 4L8VA 5FWDA 2J3MA 1V41E 3RRNA 1R15A 4PPQA 1UJCA 3WNCA 5KVQA 2Q7DA 1SD1A 2XT9A 1PWYE 3HY3A 4GSLA 3NASA 2FAXA 2FGKA 5D3KA 1EWKA 4K2HA 1JNXX 2HCFA 2I6FA 3HDVA 2Z57A 4TXLA 4N41A 4Q9AA 1AKQA 1E9SA 1F14A 4O4IB 4RJLA 4R9VA 4UCXA 5FBLB 4D6PA 1WZ2A 1VQOB 4OGFA 1T6XA 4L5AA 3LQKA 5KWJA 2GBIA 2Q5LA 4B35A 3IJRA 5TNXA 4D25A 4MI6A 3G5MA 2VSXA 4M9CA 5BSRA 1LSJA 1OC2A 1ZMRA 1RQXA 1W88B 1GLVA 2NX2A 1QZXA 3B85A 1PQYA 10MHA 3AB3A 3QJGA 1Q16A 4U9IS 1H42A 2NZJA 1H65A 2QG6A 3O4JA 1JG6A 1XTZA 2R6FA 2YZMA 1U63A 2CLIB 4G5SA 2NTYC 4BV2A 2FSIA 4P26A 1FMCA 1GTMA 3DZJA 4INZA 3DL0A 2C4VA 5J3OA 2XGGA 3ZU2A 2ZR9A 5KOHB 2F9LA 3MRSA 3CYFA 2LCFA 4GOJA 5CURA 4DLPA 1RXVA 2JGDA 4Q37A 2A9JA 3NTLA 4K9SA 3IV7A 4UCFA 3S40A 5A62A 1M74A 1IOLA 1Q1NA 1QKIA 5HZAA 2QVZX 4WJKB 5BNFA 3STWA 2BI8A 4KGZA 1PVVA 3HFJA 1PLKA 5TQ0A 1E7SA 1NWCA 4ZVSA 4BCCA 1DMSA 4L15A 2GK3A 2AOUA 3NVDA 4GNKA 4YLGA 3WIOA 2QZPA 4XH9B 5CDFE 2E55A 1J00A 1G20E 4OEHA 1EZ4A 4JJ8A 2DUUA 2X1VA 1QJ4A 1N1DA 1X7WA 1P0MA 3UMFA 1NF3A 4R8KA 5HF9A 3VAAA 2XCTB 4MLZA 1CHNA 3OOYA 2G7MC 4TVOA 2XNKA 5ECGC 3VOAA 4AK9A 1NM5C 4OHYA 2ZI3A 4B2YA 3HKBB 3HDGA 5I4BA 4Z4GA 1K3TA 4FR5A 4H6PA 5EA2A 1DAEA 5IAAA 2B21A 2WW8A 1W46A 2HDWA 3SVLA 1GDDA 1SXGA 5LFAA 1XMXA 3EUWA 1BW9A 1KETA 3W8NA 3DOJA 1NT2A 5GZ6A 4CF3A 5IDQA 3WDKA 4DG9A 4ZP1A 3DFMA 4E08A 1K5DA 3B1KA 3BX1A 1EE9A 4PZUA 1XAJA 4OYYA 5CYOA 4XRGA 3QA3E 5B3LA 5FRDA 5JS2A 1SOMA 5JDIA 4LGYA 1KAMA 2AC2A 3U7FB 3H5AA 3NRBA 3FYDA 2VP3A 3GEDA 1RHQA 3G8CA 1MPTA 5CJ2A 3K9HA 2YS7A 5LUAA 4PANA 5LZ5A 2R7MA 5JISA 4E5NA 1TYBE 1EFDN 2HRBA 1WQ1R 3BDAA 2ATEA 1P5RA 2IEAA 3E27A 4OQQA 5AM4A 3V4OA 3OX3A 3PKZA 3P20A 1TTQB 2C58A 1YI2B 2NVOA 2Z1MA 3CH7A 4RTQA 1JLSA 1SUSA 3K6SA 1C3OB 1YBFA 4AP9A 3A1PA 5CJPA 3HACA 4WKOA 3QUCA 2IV3A 1PL6A 4BFWA 1AH2A 1TD1A 4QGBA 4ZTZB 1OT5A 3EGXA 3LUCA 1H2ZA 4M1SA 2OGSA 2JDIA 1EYZA 2QVBA 2H0AA 3DTVB 4ZEWA 1WY5A 4WTOA 4QSHA 4ETMA 1QJCA 3NHZA 4BFVA 5DX1A 2NU6B 2X0EA 1JPVA 3HY6A 3UJ6A 1G3MA 4RAOA 2QQFA 4PCUA 3EB9A 3EMDA 3WLAA 2C8KA 3PK0A 5SZHB 3TXXA 3A2NA 3VR5D 4ARIA 3K09A 4NNJA 1QVVA 1XL1A 1Q91A 1YOBA 2AYXA 3G88A 2OV1A 3D8UA 4GMKA 2IYXA 4GW3A 1GQSA 2EZ9A 3JRXA 1JSZA 2MU1A 3DBIA 3ADDA 1Z35A 3Q7QA 4FR0A 4G5YA 1KPGA 4B80A 3A4NA 1CDOA 3JQRA 1FDIA 1NVXQ 1SC9A 3RAGA 2VCHA 1SCAA 3NHWA 1M5TA 2ZIAA 1Y6ZA 2HPZA 1A9QA 3VZCA 3CT6A 3LE8A 4Z1OA 4WZBB 5H82A 2D5AA 1G7CA 4QQFA 3DUFB 2PX0A 3LDHA 1FVOA 5C4GB 5E7JA 5COBA 5DWDA 4I5IA 1N7IA 4DL9A 4QOSA 3AINA 4UMDA 4FGWA 3QG5A 4AJEA 3BH0A 2IXFA 4F8EA 2GJ8A 1OYWA 1TQ8A 1PGQA 2Y1FA 1IULA 2EBWA 2WWRA 3G2OA 2FPMA 1U1IA 1NMZA 4EIWA 3DT8A 3ZK9A 2HBRA 2QAGA 4QUAA 4XOPA 4H77A 2PTHA 3S68A 2ZSJA 4K81B 4IJMA 5A2QA 4IQ8A 3LRXA 2IVZA 2BGLA 4X90A 5DO9A 3QX3A 1W6RA 5UKDA 4MWEA 2QTZA 1K2VN 4EG8A 1M5RA 4MV4A 1V4NA 3HBFA 3T3IA 4AFNA 1NDQA 1P6UA 4R2LA 3OA2A 4CFSA 2QLLA 3SJPA 2QY6A 1KEUA 4HH0A 4K46A 1II9A 3LUFA 4TMKA 2BFWA 3RJ9A 3WL3A 3U19A 5HTOA 1FFYA 3GDOA 1HDGO 1M2WA 3IMKA 2DFVA 2JGMA 3L4BA 2J0EA 3NH6A 3GLQA 4IV8A 3I09A 3W78A 5MFPA 4JB0A 1H0RA 3KHKA 1BDBA 3NTUA 2OYCA 2EZUA 3DMGA 3QVOA 4DMUB 4JP2A 1WMAA 2A88A 2FSVC 4G1CA 4Z3KA 1G19A 2CYCA 2PRJA 1C7QA 1RQGA 1UXJA 2AMFA 1FS4A 3IEIA 3KM0A 5KVSA 4QVIA 3HJGA 2BFNA 2AWOA 2R85A 1ST3A 1B4DA 1XGKA 4JJEA 4CE6A 4Q1VA 1G5FA 4V0SA 3GNQA 2TECE 1YASA 5CLJA 2AR7A 1B00A 4GYYA 3DEHA 4HQRA 4UBKA 5IYPA 2PIDA 5AK4A 5HCNA 4A6PA 4KDFA 3G5TA 3IAS6 2VHTA 5EWMB 4OI0A 2MSKA 1ZMXA 3LK7A 1TM5E 2ZAMA 3VGPA 1QFXA 4WFIA 1UT5A 1SWVA 1KBZA 2COEA 2E3JA 1P1JA 1E2QA 2OZLA 3K15A 2ATXA 4LC1A 3FPLA 4XWYA 5DPMA 2H59A 2VDKB 2XKBA 4J3NA 4EKDA 1X7HA 3TG2A 1I18A 1DUVG 2FLWA 1VE9A 5EKSA 3TTXA 4N0QA 1K0UA 2RGYA 3SR0A 3EZFA 5KIAA 2WUGA 3I2YX 4AWXA 3LHSA 5AHWA 4MQUA 4ALJA 1JJBA 2X0JA 1QQAA 1NBWB 2B2NA 1BGXT 2JFHA 4C6RA 2F1HA 1EI9A 1NMYA 2IYRA 2XMGA 3IAM6 3MIZA 2CHUA 2VYVA 1CYDA 4LKOA 5AJYA 3Q8MA 3SAJA 4CKWA 1DC4A 4NP6A 3HDTA 1D1QA 1P7CA 4H59A 3V8QA 2VG8A 5HMLA 2KW5A 1SC1A 3WDSA 5J2UB 1WZUA 3BXOA 3TZLA 3KUXA 2A2ZA 1U9IA 1K6JA 3EZYA 3OJEA 1PWEA 4K9NA 5NLLA 3STUA 4WJZA 5GM1A 5FH9A 3FA2A 3A11A 2ZREA 3EVGA 4W6QA 3W3AA 1DWOA 3NM5A 3LBIA 2JZCA 2YWXA 5ENDA 3CIFA 1BG6A 3ICPA 4UZSA 4G97A 1ODJA 5EIFA 4G0NA 1E3XA 1IHPA 3MS7A 3GO4A 5HZGA 3SHTA 5I7OA 2MSWA 1FDRA 1BWPA 3AVWA 1VC2A 3ZCQA 1IN1A 4NBTA 1K89A 1EBFA 4B4OA 4B48A 1PJ5A 3B1YA 2R79A 3M6LA 1E6CA 4H3VA 3EDOA 4Q1DA 1X9IA 2Q3JA 1DO0A 4LF4B 1VCOA 4BC1A 1K8YB 2I4TA 4NH0A 4XDZA 4K28A 1AQIA 1PG0A 2FMUA 4GOMD 3VO8A 4AKSA 1IBMB 4DKJA 1DP4A 2I67A 2XNDA 1G8YA 1BEZA 4JQCA 4UNQA 4IOJA 1H4QA 1JLLA 1GV0A 1PGJA 1DV2A 4EUFA 3WYBA 1SIBE 3LVFO 2BF4A 1GZVA 4ZDIA 1W5BA 2HBZA 1IM2A 2JGNA 3P2IA 3I0NA 1EX9A 5BSFA 1RPZA 4ZMRA 4MQEB 2I2WA 2CUTA 2X19A 1HT0A 3B20A 1QRDA 1X80B 1P2VA 3BH6A 4QU0A 1NUQA 1KNXA 2GX6A 1Z9BA 3IQZA 4OA5A 3SYNA 4CTOA 4RY0A 2C2GA 4PGFA 5DASA 3AL3A 1GKKA 1PTJC 3H5WA 3VZQA 4DQ0A 4DUZB 4F60A 1RYBA 3M33A 3HWX1 2YY5A 4R81A 1JHXA 4CIYA 4QBKA 5JROA 1F6DA 3Q40A 1Y9AA 2BTQB 4ZD6A 1DS6A 1TEXA 3FWYA 1XFOA 1R0CA 2O2DA 1IUPA 2QLNA 3KOYA 3TAUA 4LWZA 4TMFA 3W05A 3ZHXA 3RB8A 3IEUA 1D9ZA 2IP4A 1YIAA 2EKQA 4MGHA 1QVGB 3H0KA 3DCJA 3I0MA 3G0OA 4UEQA 1S9DA 4B3CA 3IUNA 2NXWA 2ZZFA 4J7CA 1MO4A 2NO6A 3IMEA 1SRRA 1JDTA 4FC7A 4OJKA 3UJCA 1XEXA 3A9WA 4RFSA 2PY6A 4R7GA 3VYVA 3FZYA 1NQ5A 1XC7A 4G9BA 1XQVA 4P9SA 3LF2A 4JL8A 2NV4A 4W7SA 1A76A 1QP4A 4KHPB 5JC8A 1X8KA 3KB8A 3O3MB 3ZE2B 4Y7CA 2ODAA 2JCXA 4ALKA 2OKGA 1GNSA 1HR0B 1G7SA 4LJLA 1MU0A 1DE0A 1GRCA 1X1DA 2FZKA 3ND9A 2VK4A 3SDBA 5B58C 5IEBA 5JNLA 4MA4A 4P08A 2QN8A 4YRPA 4BZPA 4RPDA 1VKJA 5C3MA 1E9CA 1ZBQA 2GMWA 3QE3A 3L4EA 5HPYB 3EZ9A 4M21A 2KPOA 2AG0A 4IW3B 2EWVA 4LRWA 2AFHA 4ZVLA 4FOLA 2YVLA 1OW3B 4MKXA 4O29A 4OU5A 4IXMA 2HIAA 1QP0A 5AW0A 3I2IA 2E5WA 3KJXA 4G4GA 1Y5MA 2P4EA 2W0SA 5JD5A 4JYPA 2P5YA 4URUR 3HJAA 1H94A 1WW2A 3E05A 1OSNA 3K0EA 5C7OO 1LSUA 2X77A 1Q0TA 1Q9SA 4LC0A 3FSRA 3N1UA 4G5OA 2C4WA 4JMPA 3U31A 3VSEA 4LFAB 2NQ2C 3L8GA 4BNXA 1UCFA 2VA9A 1S2LA 3GGOA 5CYPA 2X8KA 2TMYA 3OE1A 2H5EA 5JAQA 3COJA 3QNWA 3K4HA 3LC0A 1DAMA 4L6AA 4UPVA 4C0KA 4L22A 1RCUA 4MAAA 2HPHA 2VPXA 5MN5A 1CIPA 2WA2A 3VPXA 1WXQA 3WL6A 2PS9A 2W6NA 1N8NA 1EVQA 1XUOA 2ODWA 3A4TA 3AYXB 3I9OA 1ULTA 3HLTA 4DKXA 4GL4A 5JI3E 3MELA 1OFHA 3ZK8A 3JVEA 4QBIA 3NB0A 2E4ZA 1Q0HA 4Q4AA 4ZT7A 4PM4A 4GZ6A 1E2NA 4JLJA 3DFKA 1O6FA 2ZB2A 4JBHA 4OHCA 4K0RA 4OSOA 4QG3A 2I62A 4RTLA 1DEOA 4E03A 1SUCA 2G5PA 4UHHA 1AX9A 3A3YA 4FGKA 5HFJA 1L5NA 1JKJA 1NQOA 2OFFA 4LV5B 3YASA 4MW7A 4TVBA 5BOSB 2WPNA 1D2GA 4Y6PA 4IFEA 3W5IA 3ISJA 4TYQA 5JZBA 4EI7A 5DSTA 2UZ4A 2C5SA 2BBTA 1CVLA 2LXNA 2X6RA 1DWQA 5H0IA 4BB9A 3K9QO 4MTLA 5HGXA 2IF2A 4O08A 2JJ8A 3F46A 4R16A 4Y2RA 5I9NA 2N42A 1EXWA 5LSAA 3RWOA 3CE6A 3M1LA 3P4UA 2A35A 1CC1S 2JS7A 1MX3A 1P9LA 2WF5A 4IQ4A 3P0FA 4DLSA 1AQUA 2XQGA 1XTKA 4MS3A 2YHIA 2WA1A 4PTYA 1CY8A 2Y1OA 1GUDA 5AN9A 1NFRA 1ZD4A 2INGX 3EVCA 3P32A 2W6MA 1EVJA 5JWRA 3VR6A 1QO0D 3L7BA 2XQFA 3O47A 4WFJA 2DH6A 2YXDA 4JMQA 2FPXA 1CP3A 4Y8VA 3PNMA 3TR6A 1JHVA 3HZZA 4DEVA 5HX7A 4QSMA 3X43A 4EL0A 1AHPA 2ZVPX 2UZ1A 3BK2A 3T1NA 3I2GA 4CHGA 2FPGB 3V1YA 4C08A 5FTMA 3WR5A 5L95A 2GZSA 5ENZA 3EAGA 1NW5A 3FTEA 3ICQB 1NI4A 2K7ZA 1K97A 2ID8A 4J49A 3THRA 3EFBA 1P0CA 1YJXA 3B7GA 3BILA 4IJWA 4YMTA 5KYXB 2RE8A 1H69A 1T2FA 1XD8A 3HN7A 4GKAA 4U9HS 4WDQA 5FQNA 4XORA 1DBWA 2PGXA 3Q0EA 3SE0A 3I55B 3EXG2 4RZUA 4AZ3B 2ZRPA 2GXUA 4M46A 1BVRA 5EVJA 4UHJA 1UJ2A 1XD2A 3S1AB 4ZCMA 3JPWA 4DIFA 2YV1A 4TMWA 3H9JA 5CM9C 4MICA 2NSLA 3CCQB 3IMGA 3BE4A 3ZQUA 3BFJA 2YN0A 3FGNA 2K7FA 1ZCZA 4ER7A 1KYVA 1K6IA 2BKEA 3W5HA 4NMWA 4X1OA 4Y1RB 4CEJB 3AEQB 5DHTA 2D3TA 1Z6ZA 2JHFA 2AFIB 1P5JA 3LGSA 4B4DA 1TX4B 1LGYA 3T41A 4EA9A 1FFWA 3T35A 1CQWA 3C0KA 5DOVA 1E0AA 4L78A 1GGVA 3VHQA 5BV8A 4HFJA 5A3SA 3DHWC 4Z7NB 1G5TA 3BGVA 4ZOCA 2GERA 4Q3LA 2V4UA 3CLSD 3EJWA 4DABA 2D7DA 3B9QA 1X9HA 2CNWA 2Q6KA 1UR5A 1NU6A 3RUCA 4EX6A 2Y92A 3EDCA 2NTVA 1RRMA 3ZI4A 1HF3A 3RVKA 4RD3A 4ND8A 1ZJJA 2ZI4A 1NPYA 3V8NA 3HDQA 1Q22A 2GO7A 3LUDA 5JADA 2CSXA 7GPBA 2GYVA 1BHO1 1WLYA 1VFNA 4BO2A 3FYHA 1C7RA 1L5YA 1T9HA 3N0TA 1CQIA 1ZK1A 3L4SO 3PHCA 3AEKA 3L7CA 4B3IA 2AS0A 5CFMA 2KVOA 2ZYDA 4JJ4A 3HJNA 4MUGA 2HTFA 2L0XA 1W1WA 4M1OA 1XVLA 3IBCA 3R5KA 5KQRA 3WFIA 3Q7TA 4Y6QA 1XZKA 2AV6A 3FH0A 1GUFA 4MYSA 4WKBA 2MSLA 4IO0A 2BZSA 2QM8A 1PR4A 5JCXA 3Q7EA 3EVTA 4LWQA 1CUDA 4M86A 2VBSA 4OFZA 3LLUA 1IIBA 2GYYA 2YDXA 1MO3A 1M6EX 1T4GA 1QV7A 2G80A 3W6ZA 5AIAA 3K9CA 4ZYUA 3WE7A 1MVOA 5HIKA 2VN8A 5KKNB 1GG9A 3LFTA 4TL9A 2RAUA 2C9ZA 2YXPX 4RYLA 4XJVA 1QO7A 1IBLB 2ZR7A 3G2IA 2AKEA 4B3GA 2AK2A 5AJZA 5G1PA 5JXIA 3HEAA 2IODA 4AJKA 2HMWA 3LUHA 2XZLA 3UUWA 1R27A 5CB4A 3P0RA 3W34A 1YVRA 2QI9C 3RPEA 3ZXUB 1J42A 5KYYB 4MKFA 2G4LA 3PRJA 1G8JA 3QYJA 1NR1A 1H8HD 4MVWA 3LT1A 5EHIA 3U7JA 3GJ7A 1AHIA 3DW1X 3N8HA 1E3JA 2A9FA 2NUTB 4X6LA 1PYOA 5FBQB 1FMTA 2ZJ6A 3OT1A 3DMPA 2R25B 4DCGA 3JW8A 3FAZA 1JJ2B 3DR5A 3NEJA 1KYZA 2NVUB 2JIQA 2XB8A 3QVGB 1SIWA 4NBRA 4KFSA 1WE2A 2QAIA 3F1LA 3LA8A 1SHUX 2BELA 1G66A 1TDJA 4XASA 1Z15A 2F17A 4DJJA 4PC2A 3SN6A 1XDSA 2I54A 3UN1A 2CE7A 1IN5A 1K9MD 1F5NA 4OHFA 3QA9A 4RHXA 1GNQA 1HV8A 5AW8A 1NDHA 2R6R1 4QNMA 2VJCA 1NBMA 3DLHA 3RS5A 2W70A 1BMDA 2V8BA 3SQOA 1XVUA 3S8EA 4OUDB 4Q24A 1SCNE 3I9JA 4BLQA 2DBYA 4DBVO 2H4JA 1I7SB 3CJQA 1G4AE 4EG7A 4LHWA 3JD4A 3KQHA 4E5KA 2JEYA 1KEPA 3MMZA 1H2AS 4TKLA 3F98A 3PUMA 3UXYA 1V6CA 2KI5A 2ALJA 2WSMA 4B4VA 4E30A 3A0RB 5FCDA 4BO1A 4HMOA 3M1YA 3CNNA 4HH4A 2GVNA 1T8PA 2IYFA 1WL8A 2G1KA 1UWLA 2Y4NA 2C3UA 5E9AA 4AICA 2GUWA 1AN9A 2KJQA 3HVRA 1ZK0A 1X7XA 4WD3A 4E46A 2VJKA 2EP7A 1QZTA 2AYYA 1HKHA 1HYBA 1BXZA 3R0ZA 2RKBA 3R3WA 4JT9A 1HEYA 1Y8QA 2K87A 2ZJ1A 2FQWA 3GDGA 3MG9A 3WO1A 4AZVA 3KKNA 1ECLA 2F3SA 4GX2A 4F3RA 4X1YB 2YX1A 4P6VF 3K1AB 1C2YA 5LLSA 5KJFA 3MMPA 3BIFA 3UW1A 3FHLA 4ZQIA 4YT4A 2E5LB 4KO2S 3W4JA 3LBNA 4LRXA 3OPNA 4ZIRB 5MGNA 1YQUA 3LOPA 5CU7A 4EYOA 1NP7A 3QHPA 1QIDA 4DLXA 4GXTA 3EGEA 4Z4EA 4C2UA 2VBFA 2ZRJA 5A4DA 4NEQA 1OFUX 2BFDB 3K3PA 4OO3A 1C0LA 4Q1CA 5DHFA 1Z0IA 4E14A 1NHWA 2I87A 2MOKA 4ZN6A 3QNUA 1PJ7A 5HF5A 3CVXA 4ENWA 1NUAA 3JZAA 3QFRA 1C1XA 1E1LA 4I55F 4KK4A 3ZLJA 2XF2A 3MC1A 5CCDA 1DC3A 1DI0A 5JECA 1ID1A 4HCJA 2GAIA 1GRRA 1BJRE 1CJVC 2YR0A 3CWQA 3NJRA 4BVGA 2IX3A 1HOXA 4XYLA 3I04A 1CLEA 3RYCB 3IAXA 3L04A 1L7OA 4EGCB 3AV3A 3NTVA 1F38A 1CT9A 1RZRD 2VDLB 4FHFA 2QV7A 4ZGNB 4DV3B 3DO5A 1LNSA 3T1YB 3ZXSA 2JJ1D 3PNVA 5GMOA 1UPXA 1ZC3A 3OP1A 5IANA 3X0DA 4QXOA 5BYAA 2OUIA 1JDVA 3JQGB 3SLNA 4EG5A 5BNWA 3PQEA 4Z5XA 4OQDA 1Y81A 1OROA 3NHPA 4XM2A 5BSTA 4E2WA 4H17A 4QDXA 3OM9A 4UZEA 2I6SA 4TLDA 4MVJH 1RMQA 3W79A 5L6MB 3QF4B 4U4AA 2BGJA 4RJKA 2W00A 3RIEA 4DLUA 3TLAA 2NXJA 3KBBA 3I39X 3F4LA 4I5GA 4PZAA 3RVBA 3JXEA 2X42A 3CRRA 3OQJA 4MJ3A 1M5UA 2QM7A 1Y8AA 4Z0NA 4MARA 2QD2A 5F23A 3E5NA 3HN2A 3UC9A 1MORA 1OLOA 1Y80A 4F92B 4QGSA 1VKOA 3IPRA 4H4EA 1KXZA 2RGWA 4NFYA 2QEQA 4XPZA 3ZV5A 1SQ0A 4AKGA 4K86A 3AI1A 3WB2A 3BMQA 2A5GA 2KYRA 2P0EA 4N3GA 4IH1A 2LVBA 2ZRAA 4GMFA 2BMFA 4HAXA 5I9SA 1I0ZA 1ZSNA 1ADYA 3L0CA 4X00A 1GZ3A 5FTJA 3RGGA 3ZE7A 3RQSA 3DVAA 1I1OA 4J29A 3FGPA 3EEBA 4FE3A 2FQQA 4N5LA 4EP1A 4M9RA 1DCKA 1V95A 4QASA 4GBMA 2REOA 5CH3A 4NNOA 4L8WB 4C4ZA 1JLKA 1VE5A 2XH8A 3TW4A 5K0LA 3LL4A 5ALWA 1W52X 2AEJA 1GO2A 2VA8A 1GG8A 4PV7A 4EYEA 2WIKA 2H63A 4G2NA 4K6HA 5H3CA 5TF0A 2ESRA 5EE3A 4A23A 4EHJA 3DTNA 5TGZA 1HDZA 1KI7A 3BRSA 3ODPA 1C4OA 1RVDA 4MUAA 1T8SA 4MUYA 3WLQA 2F8TA 3BC9A 2IDJA 3DD1A 3N2GA 3AHGA 4EHHA 5BWOA 3V7UA 3ETHA 1U3WA 2ZPAA 3MOSA 1T29A 4X84A 1FTSA 1GTJ1 1O1YA 1E2LA 1Z45A 3JQ7A 2C54A 1BQ3A 1QGUB 5CT5A 3ONNA 1T24A 5JU6A 1E18A 1YQEA 1LUAA 2IXAA 1T9ZA 2N0SA 3JQCA 4EDFA 1YL6A 4HX2A 3RTDA 1LDBA 2PL1A 3PVSA 4KIUA 1IRXA 4TKUB 1OBOA 5FA5A 4N76A 3CMAB 2O8NA 2RB5A 4MEBA 2P2LA 3H1AA 4JI6B 1X39A 3E2PA 4OOEA 2X3FA 3NJ8A 5JAUA 3O9ZA 1LPAB 3QTLA 5BOVA 1EUCA 5EJ2A 1XN1A 4F9GA 4PLTA 2ZGVA 3OETA 4AURA 3BZBA 1KRXA 3HB0A 4P3PA 4A0SA 5HCUA 2JLUA 4TT3A 2EW1A 2I76A 1ZJZA 3PE4A 4LUCA 2P3QA 3ZJUA 2C2MA 4QE3A 3KTFA 3C5WP 2O3TA 3MQ2A 3ZXIA 1W4BA 4N7RA 5LC1A 3RT7A 3IUEA 2CHEA 1NMXA 5ELLA 3CWZA 3H11B 4MRSA 3URKA 1UD5A 4A8PA 2WAYA 4MI9A 1V5GA 4O2RA 2VTKA 2Q1YA 1M6VB 3C24A 1NJGA 3F1KA 4ND4A 1JZSA 2H4WA 4X95A 4OPOA 1JBQA 3NDPA 4N9WA 1Z4PX 1TJYA 1N0UA 2WTNA 4B6JA 5THXA 3PD7A 1FTNA 1O95C 2ZULA 2E0IA 2OO5A 3GLUA 1VSTA 1A2OA 1OA1A 4D8YA 3VV2A 2R4TA 4E0BA 1EXVA 5CIYA 5SYAA 3LPMA 5J2TF 2ZPTX 2ZU0C 4DGQA 3U7GA 2J5QA 4HY3A 4ZRMA 3GA7A 3T5PA 3T56B 3SU8A 4D02A 5E9JA 1N2CB 2QUIA 2AEFA 1UK9A 3AL2A 3H75A 3MCTA 2ODTX 3AKZA 1UBKS 2PK3A 4UTZA 2PCJA 3W5SA 5K3EA 2V1UA 5K8UA 5NULA 3RKUA 2SCUA 5JARA 3OTQA 1AUPA 1S8FA 2W2PA 4C07A 4ZYTA 1V8DA 2GJRA 1NKTA 1WP9A 3BJIC 2Y1KA 5ADUS 3AY3A 5JBNA 1EBBA 4YV2A 3SVTA 1E1RD 2R87A 2AG1A 3CRZA 1ABBA 3DCNA 1QDLB 2OK7A 4KVAA 4WSOA 1H8ED 4P5PA 1U3UA 5IJWA 4WESB 2OCYC 2F00A 3ADPA 3U0VA 2JBAB 3F3YA 3N74A 3PQ7A 3O8OB 4G2TA 2JD1A 2OG1A 1G1AA 3CUWA 3LC1O 2B83A 1GYQA 3FOWA 3R0JA 2GB4A 3HR4A 4PX5A 3OCVA 4QRHA 4LJAA 4RF3A 2HXSA 4WCVA 5F73A 3RUEA 1M34E 1R0WA 1IQ0A 2A0UA 4Y2QA 2PE3A 1LPSA 1TOAA 4MYHA 4CM9A 3QLVA 2UZ0A 1M1YB 5LXTB 3B70A 1V1MA 5FT9A 5DBEX 3AJ8A 3A28A 5JJBA 2GZ1A 4WY2A 1SBIA 3LT5A 4B40A 3CONA 4XPIA 5FOSA 4IXWA 1OFUA 4XTCS 1UZAA 1D1PA 5JW6A 4EJFA 3UWSA 1ODLA 1YXMA 3RVRA 1EX7A 3ECAA 4A2WA 2VDUE 4QATA 2CCGA 1AUQA 3EXHA 1EWTA 1ZVMA 3N8IA 3QMVA 1IONA 1LBTA 1NLZA 3EQ7A 5DCLA 5DXJA 3RIMA 1WVIA 2IEBA 4LECA 5KVAA 1XWIA 4ZAFA 5EUQB 2FOXA 2PMDA 2FPLA 2GO1A 2VKQA 1G8KA 2ANBA 1AG9A 2Q1UA 3M7IA 3Q85A 1Z4MA 3W7BA 4HHEA 2ZXIA 3VFDA 1P5ZB 3H9QA 3MSXA 4EGAA 1YS9A 2QD5A 4DIKA 3H1FA 4DR6B 1N3IA 2VCYA 4DXAA 3D3JA 1CQZA 1COWA 3EFOA 3PHJA 4R05A 1BWRA 5CUQA 4P0PB 1OHHD 3ISXA 2PZMA 2QYSA 3BPSA 2XR1A 4PAQA 3CG4A 3NHYA 2CEAA 5CJJA 2IDKA 1D6NA 2WJGA 4AZ0B 1ILEA 3FPJA 4MDYA 2IITA 1SKQA 4AJ4A 1BKYA 2H1FA 2J0UA 4GMXA 3CKLA 2GJ9A 2NUAB 3NP9A 1CR1A 1L1QA 5LN1A 3A2KA 1ZO8A 1A7UA 3GRYA 3DZCA 1XPJA 4LNHA 4J0FA 4Q4CA 5DM0A 5B1SA 4O2BF 2NO5A 5E3HA 4EW2A 5F2NA 1ABEA 2AA3A 1MB9A 1XA3A 1O97D 2ZG6A 2GK6A 3C5VA 5F5NA 2IHTA 3B1FA 3S55A 2RGUA 4UU8A 2QVYX 1XLVA 1NJ5A 1TM7E 2DKFA 2PWPA 2NADA 2HMAA 4FFOA 1EFTA 4IDEA 1IY2A 5GJVC 4N03A 4AC9A 3N58A 5JOQA 4D8XA 1OCEA 1MG0A 3N6XA 3SS8A 1TZJA 1HVXA 1TO1E 4ZWNA 3OJFA 3QMWA 1O0CA 2YVAA 1NLUA 3H4MA 3V76A 1C0PA 3KQTA 1U8UA 5DTJA 1BROA 4OHZA 3ZKWA 2HU2A 1G21E 3WWPA 4D8UA 4J94A 5FBZA 4PC3A 3M5CA 1KJYA 4BQRA 3INGA 1EK0A 3ZYCA 1EFVB 2ZSIA 3IVMA 4GOKA 3PFCA 5A02A 2Z30A 2QM0A 2H7VA 4PYMA 3JWHA 4HO1X 3QK7A 3CP2A 5LQSA 2OAEA 4AP6A 3TQQA 1YB1A 1M6NA 2A0FA 3DW3X 1XFDA 4Q66C 3L6UA 1IOWA 5LU8A 1V1RB 4DHWA 2ZIXB 3G68A 2H4HA 4PYKA 4CGYA 3LKVA 5CVTA 4I1YA 2M6KA 2V7GA 1L1RA 3M4ZA 2DLCX 3PA1A 3ND5A 1G1MA 2I5PO 3G0HA 4H35A 1G5IA 2QG4A 4MYTA 5A5GA 5ED0A 2P9TA 3TCXB 5BMVB 2X5NA 4Z9BA 2CLMB 5A4KA 3EIWA 4QIHA 3P9IA 3AEUA 4OJMX 1N0VC 4MS1A 4IPTA 1I5RA 4MR9A 5GVRA 2P5UA 1JEDA 2NZ2A 3ZS8A 1WOYA 1C4XA 2FZLA 3C8UA 4GQAA 1E3SA 3RHZA 2C7VA 2W6OA 1O77A 4WBXC 5TGDA 3OVMA 3JVIA 1P2TA 4HFNA 3OPMA 4ZOLB 2I71A 1G9TA 2C00A 5EIBD 5CA1F 4D9IA 4LV8B 1L5ZA 5DIZA 4J6FA 4Y98A 1ZVQA 3Q8KA 1E96A 4DUGA 4LXIA 3I2FA 4R7TA 3HK2A 1YRHA 3SXPA 1W36C 1AK2A 3CZ9A 3KFLA 3TNLA 4K1LA 4J76A 2BR3A 2OP0A 3IL2A 5E4JA 2D74A 2RGAA 3EWAA 1R0XA 3IPXA 4B34A 3DOIA 1TCAA 2QTFA 5LIRA 1XU7A 1T36B 5CLIA 4BZZA 3GELA 2QVXX 1QH0A 1LVGA 4X3CA 4DRYA 1VQKB 2EFGA 1GPBA 1EZ1A 2OORC 2WE8A 2WYVA 2X8JA 2XXBA 3PPYA 1ZJ5A 2ZZEA 1YCGA 3DE6X 1T35A 4FMDF 3I04M 3U7EB 1RI5A 3OURA 1C1DB 2YC2C 3R3ZA 2JEOA 3AGPA 3ZI7A 1PKEA 4PHHA 1Z73A 5KTYA 1JAIA 4QU5A 1Z56C 3MLEA 2CD7A 4G0ZA 4LAFA 3SNKA 4BB6A 1GDTA 4G37A 4RKFA 1QCDA 1CJSA 1Y9DA 2CMKA 4M0FA 5EIAA 2C1EA 1UBJS 5KPJA 3JAKB 1GILA 1KMHB 4PTLA 5DGHA 4A8HA 1K2WA 3LY8A 5JD6A 2CXNA 4F4FA 3F73A 1R9MA 3E1GA 1A9XB 4HIZA 3ZWYA 1U94A 3K73O 4C7VA 3QSYA 2JHCA 3TOVA 1CEEA 4RWZA 1AT1A 4NZ9A 1CUVA 4BP8A 2A30A 4IG9A 4KI0A 5T41A 3Q6IA 4KITB 5FYQA 5DCYA 3NBFA 3GBPA 4LMRA 2WABA 4GVPA 1ETHA 3G59A 1PWXA 1UM8A 4C7JA 2M9MA 1QE5A 4CMIB 1TCVA 4X06A 5JSKA 5KB3A 2CV1A 4XVUA 1MIOB 4Q9KA 3CMCO 3UMCA 4Q9LA 4UAVA 1U5BB 2ZT7A 4BGUA 5DYGA 1CUGA 1Z7GA 3P9SA 4TUYF 5HBRA 4A9AA 2SICE 2GYWA 1E7MA 1SN7A 2AZMA 3OD1A 4D9CA 4RMNA 2A7QA 4J16A 3GLKA 1QC5B 2EKZA 4KE9A 1A5ZA 5LNK6 4LTNA 5AW4A 2QX4A 2AQKA 2WAAA 2XMPA 1D09A 1ZL2A 4DSAA 2VJAA 1N4AA 3E03A 4UCWA 4CW7A 1JR3D 3EMKA 4NDNE 2GHQA 4ZGGA 3IE1A 5KKCA 2H29A 4ZU3A 2CL7X 4G07A 3DVRX 4RACA 1QIHA 3KEQA 1GY8A 1L4YA 2FEXA 3R20A 1L7PA 5ICCA 1ESZA 2GRAA 5AUNB 2DTDA 3CIOA 3WMXA 3KAJA 1VJ0A 2VEDA 2B6HA 5I4KA 2PX5A 3ZIAD 3O93A 1HT1E 3FNIA 1U8AA 1GZ7A 3DXFA 2KLBA 2Q6IA 2DPXA 3H0EA 1FA9A 2C4MA 3ZK7A 1T13A 1N8SA 7REQA 3B3QA 1A5TA 4K9PA 4QEDA 5DP1A 3OE7A 4FFBB 1L6RA 3RVMA 5B36A 4RU1A 3DZKA 2QT9A 3BRWA 4DB4A 3LUBA 3W5DA 5CGQB 1GTRA 1SBTA 5JCOA 3KYIB 3T9EA 4GAEA 2QGFA 3QI2A 4I2VA 3E7PA 1Y0BA 3NBUA 3Q0IA 2AX3A 2P9GA 3L7YA 3OOWA 1MAAA 4MWSA 1SEPA 2X76A 1YI1A 1XHEA 3D5EA 3SR4A 1XLTC 2BT4A 1WAMA 4DG8A 3S1LA 2Q3DA 5ELXA 2Q4OA 2JA2A 4FUTA 3USZA 4KGVA 3ZD8A 2HHCA 1JXQA 4L51A 4PFKA 2QQGA 1FDSA 3NG1A 2P75A 4W6ZA 3FW1A 3IDSA 3PQCA 4JIMA 4UVHA 2HQOA 3FE2A 3HE3A 1DTWA 3QX7A 4PRYA 5F78A 5BVGB 3O4HA 3F9IA 2Z6AA 5ULLA 1D4OA 4KE8A 2P2CA 3AXTA 4ZJPA 5IZCA 1KY2A 4BAGA 4PXYA 4HAWA 2VYNA 5I51A 2YV2A 4YAGA 4FQ8A 3EISA 4CBVA 3P97A 2X0IA 2FY8A 1DUSA 2F43B 3CVOA 3BCRA 6YASA 5JNRA 2QHXA 1DINA 1ZUNA 2OSVA 3EC7A 4IQ0A 4N0DA 1G9SA 1NE7A 5K3OA 5HDQA 4CMKA 1N08A 1DFHA 2PT9A 5F7JA 2W2MA 4IIFA 4OQMA 4WCFA 3SJ7A 4UTNA 2TMKA 3PYLA 4YRBA 4LOJA 4RSMA 4J43A 1QH8B 3FUCA 5ITZA 4DC9A 1ZWLA 1B8NA 3ZZTA 1OXKB 4XR9A 4NRDA 2ZUDA 4DC0A 3K0CC 2OHHA 1PGNA 3PR2B 5K4GA 2B9EA 5CDHA 1Z25A 1L5RA 1XDBA 1AUXA 1CERA 5H3HA 4ZQBA 4EYSA 1W73A 2EDAA 1Z18A 1OAOC 2FI1A 1QWOA 1Y7HA 1MR3F 1IXZA 1JXMA 2DJ5A 1V43A 2QT1A 1L5KA 1X1CA 3PRHA 3T12A 4TYMA 3DTVD 1GPDG 4P4LA 3ZW9A 1NWHA 2BHLA 2OESA 4FNAA 1M8FA 3AFHA 4J0EA 1B0AA 4YRFA 3WKEA 4BYGA 4ND7A 3H2YA 3JWPA 4KN8A 2HXGA 4HN2A 3Q9SA 4BMZA 5ITVA 4U2KA 1MC4A 5TMEA 4C87A 5IN4A 3UENA 3K94A 5GINE 3CF4G 4DBLC 5DGIA 3LKZA 3WWZA 5KSOA 1C41A 2X6YA 4D56A 1ZAKA 2DC1A 2PLWA 2QRKA 2GYUA 2JCGA 4H2DA 5K1ZA 3SP1A 1G41A 1TPYA 4BOYA 2DQKA 5BW4A 4L3VA 1EGMB 2G9QA 4PX3A 5BWBA 2D5IA 3KDSE 1TK2A 4LJ5A 4FLEA 3V2HA 2XOKD 2ZB8A 4YT5A 4P12A 3GX1A 4HWPA 1LI5A 4FFPA 3UJDA 1V9LA 2B8WA 3W2GA 1K73D 4O8ZA 2CJPA 5J2TA 3I6IA 3CF2A 1D4AA 3QBDA 4NZOA 4YRCA 1ZP6A 3MD9A 4QDKA 4CIVA 2WP8J 5TQ2A 3FNBA 4BL5A 2WU4A 3CB2A 1KI4A 1PNTA 5L46A 1WMFA 3FYUA 5FPKA 5T4FA 2G40A 3MM4A 4MKIA 1QG6A 4QVGA 3MGCA 1XA4A 1ZVJA 4ENSA 2EFYA 3HBJA 4DFDA 3E15A 5EERA 5KWSA 2R1TA 4TSRA 3LDAA 2VWHA 1CD5A 4UM5A 2E82A 3UAGA 2D1QA 3FOAA 2JLVA 9MHTA 1KAQA 4DXHA 2PVCA 1C30A 1LZLA 2YIDA 3AHFA 4IAOA 4QJIA 3VTZA 4UBMA 3ZDRA 4HDCA 2WIDA 3MMSA 1ISJA 1ZMOA 1EWQA 1C8VB 5FOUA 4DNRB 4BE9A 4JOBA 2XAAA 3H42B 1MOQA 1BYIA 2NACA 3GGPA 3E84A 3ETDA 3INTA 3SC3A 1P4HA 3AC0A 1F48A 5HHTA 3RYIA 1ONNA 3D6AA 2F67A 3C3MA 4ID9A 3Q6MA 4TS3A 3TCKA 3ZXXA 3ASVA 1NV8A 821PA 1M75A 4NATA 3P4XA 4F12A 2EIXA 4MUFA 2WSLA 5DI3A 3CZQA 1QF9A 1MLDA 4RBNA 1YJ5A 3HGTA 4HN9A 3KR0A 3SMVA 2O6LA 3CEMA 1XTJA 1E77A 1DC8A 1YKSA 1JMKC 3K5HA 3C43A 4YQFA 2A78A 4D82A 1N34B 3RS9A 4RX1A 3PCTA 3ISTA 1N32B 1EM8B 2OCIA 2PD4A 4HLQB 4MR8A 4O4JB 5FLEX 4A73A 5B2EA 5JIBA 1OX5A 5K8CA 2CDBA 3QEKA 5H9WA 4P32A 4OX9Y 3B1ZA 2MSEB 1Y6GA 2NOAA 2RFLA 1N3LA 2HMUA 3HA3A 2P8JA 4J4BA 2V9CA 2ZE8A 1Y9JA 3Q1LA 3ROFA 3WGGA 3KTDA 3KQOA 4BU0A 3V5NA 4BTLA 3KT6A 3UTCA 1FSGA 4GF5A 4ZU6X 4EL5A 2QPAA 1B8VA 1B16A 1P1KA 4YGYA 2O54A 2DG2A 4AW9A 3CJRA 4MQMA 3U6BA 4REMA 1HNXB 2X8AA 2FZ4A 5H5JA 3BIOA 4AF6A 1UMDB 1JDNA 3EGOA 2ECQA 3AFNA 2VSFA 4OM7A 1DX9A 5LDHA 1N8RD 1QS0A 4KAFA 4OF4A 4M8KA 1C2TA 3KQWA 1ATIA 4L5JA 4RXTA 1W36B 3GCXA 1FLNA 2L82A 2RHTA 3IULA 2A0YA 3EOBI 2BFPA 1LWOA 2PFGA 3QXHA 4W9NC 3MS2A 2XRYA 2NYRA 1LI7A 2OHIA 2PX6A 3QOYA 4JC8A 5B5SA 4ARSA 5JJLA 3VVBA 3TR5A 4IOMA 1ZC4A 3N75A 1YWGO 1U7DA 4O2BA 2OVBA 3RYHB 1N2BA 4WZTA 4QUEA 5EJMA 3GRKA 1NVDA 4LZOA 1L4HA 2Y0PA 3TGPA 4H0CA 2H1HA 3QBEA 2A1UB 2ZDQA 2C8JA 3PPVA 4H7FA 2IYPA 4W82A 4Y0VA 1HQYE 4Z86A 3WQBA 4CTMA 2JI7A 5KNDD 2BH2A 3SM9A 2PYZA 2XTJA 4DR3B 1TT5B 1I4EB 2ZIGA 1DAPA 2UZIR 1XWWA 3C4QA 2XNHA 3OTWA 4YR9A 1TAHA 1IXYA 4DCPA 3TRDA 1DJNA 1ESEA 2WIBA 3K7EA 4U0JA 4OQXA 4IEEA 1E4VA 4RE5A 1H23A 1KJ9A 3G8BA 4XGRA 3UOAB 4C7OB 5T5QA 2QRLA 1SHLA 3GDHA 4NULA 3RUFA 4WQMA 1H6CA 3E70C 4M6WA 1E9RA 1I4DD 1LWNA 2FP4B 4PLHA 4FXUA 1WSBA 2VQ6A 3QXSA 3NIBA 4HAZA 1PG2A 3MT9A 1G6Q1 3BBLA 4HADA 3S2GA 5JNUA 3NFRA 3PC8A 3VOBA 3G23A 2MR6A 1BNCA 1L4FA 2O06A 3CEAA 4GP9A 5ALZA 5FPYA 5DYIA 4UE6A 3BJEA 3PXBA 4GECA 1C1YA 3OTGA 4A8JA 2C3PA 1JFVA 1HPLA 2B4TO 1V0FA 3SF8B 2RGNC 1E1CA 4RF5A 4RSRA 1FJHA 1LI4A 4RTMA 1PJ8A 4MRRA 4QUIA 2XVYA 3SLKA 1MCZA 3FSJX 3NNNA 2BJWA 2YYAA 1VBMA 5CRIA 2QRUA 4TS9A 3GPCA 3IE0A 2ZBUA 5ALYA 1TI7A 1KJZA 4XD7D 3DWEX 3CGGA 4X1KB 3CCLB 3LQ6A 1AZLA 1DMRA 2E4WA 4WW0A 2XE7A 1GQOA 1HLDA 4AO7A 1J5XA 2QG9A 5IT9A 5CA1A 4I1RA 3C45A 4DYDA 2FW7A 1H0KA 3D6VA 4R1MA 5I7VA 3QBTA 2Q9CA 1RI1A 3PNLA 5EWLB 3FNFA 5CDYA 5CFRA 2W98A 2WUEA 1HO3A 5TRTA 4YAUA 1NLYA 3MD0A 4BE4A 1JN0A 2BN4A 1DJOA 3L3BA 4IV0A 2V6IA 3SC6A 2WI8A 4BFUA 4L27A 1KWGA 1AKWA 3I53A 4NS4A 2PLFA 1K4KA 5AVSA 4YRRA 1XVIA 4AQ7A 1FMFA 1T0BA 3DV0A 5A89A 1PQPA 5FPPA 4WIAA 5IJAA 3ZY4A 4BP9A 1P45A 4EMTA 2IWRA 1FZTA 2ZSAA 5DMXA 4OQZA 5CLGA 1KQ3A 2YW2A 2HCTA 3SQNA 1T9BA 2WHRA 1OREA 1YHYA 1PFYA 1V8BA 4EENA 3MTQA 1EB9A 1F4PA 2QRQA 4ASUA 1XCBA 2JIDA 2B5OA 1NSTA 1Z6PA 2BKXA 4NMLA 5HA5A 2FZEA 1DCMA 1L7XA 2CKMA 2PBLA 1T10A 4IDAA 4XGNA 2DVMA 1S2MA 3QYPA 3RROA 2P41A 4CLHA 2XW6A 4EG1A 3AY0A 1VHJA 2RHWA 4IIJF 2J85A 1RPTA 3KIPA 1OUMA 4DRZA 4BY9E 3ZU4A 3H8SA 4QUZA 1U65A 3JATB 1II8B 4RORA 2JFQA 4EMBA 4IVRA 1Z7YA 1U04A 2C78A 3CCBA 3G13A 3HGMA 1IPEA 5EZQA 1ZINA 5IJ0B 4O4HF 1YJQA 1YS6A 4NVRA 4PSDA 2PMEA 3FD8A 4C2BA 3SGLA 2XIJA 4HMPA 1HMPA 2A9OA 2Z8XA 5FOVA 2CN1A 2OD9A 2FEMA 1Z74A 1U02A 1Z2OX 2WILA 5IPFA 1L7BA 4K8RB 4PPYA 3UAVA 2IU3A 2JNWA 3EHDA 3QENA 3U26A 4DC1A 4X92A 4G09A 4Z4IA 5JXJA 2YYYA 3HZRA 4TUYA 4U6NA 3WZLA 2FN7A 1Y7PA 4JOQA 1I32A 1OT3A 4M1WA 1NYTA 1ZN8A 2QY9A 3HHPA 4D2IA 5EGSA 1MEOA 1SUFA 3QVXA 4FUQA 2FLKA 1RQNA 3W5AA 7MDHA 3LWZA 2ZT5A 3WLIA 1WTCA 5LYJA 1Q21A 4PEVA 4M0LA 2G71A 3HB7A 2G88A 3X2EA 2C3OA 3VBEA 1Z4QA 3O90A 4HR7A 4JEMA 2CD9A 4EO4A 1HSOA 5BV0A 4CDNA 2OHOA 4DA8A 3DBOB 3EWNA 3LLCA 1GAXA 1W4CA 3DYBA 5AK3A 5JSUA 1IUKA 1QCZA 3N6VA 2JAOA 3IQXA 2AG5A 3M6IA 1XALA 3GFPA 3IX7A 5HS6A 4JOSA 2OR3A 4Z0TA 2OCGA 3WMWA 2PCLA 2HQBA 3IALA 4IOKA 3OKPA 3C2QA 3DCIA 2V03A 4WEOA 3A6HA 4R1UA 2I6UA 1KZGB 1OXMA 1JEJA 5JG7A 2AQ8A 2JFPA 1TZBA 2ENWA 3L7AA 3NT2A 4XQ9A 3QKWA 1XV5A 2E6KA 1OB2A 4P7FA 6GPBA 1CDEA 5JQWA 4ER5A 3IKTA 2H2AA 3DXXA 1Q14A 3PTLA 1HWYA 3QI7A 3K9WA 4H3KB 3DBLB 3SLDA 2WK1A 3W06A 4LSWA 2H5JA 4JSTA 3OY2A 1UBFA 2NSHA 3OZWA 1X6VA 1BRTA 1RQLA 2AJLI 2H1IA 4M9ZA 4MWBA 3RBVA 3T61A 3ZDZB 4QJ3A 1QG0A 2ZBPA 1NYQA 1KJJA 2Q5IA 3L7NA 3DB1A 2EFEB 1TF5A 5L40A 5CFQA 2QPOA 1KARA 3M6AA 2B2XA 1BOOA 5LP1A 4L9RA 4JVSB 3KE8A 5FI0B 1DCFA 2TS1A 5CFLA 4HJXA 1QE0A 4FHEA 4TWBA 4M38A 4NBWA 4YCBA 3N28A 1XB2A 3Q72A 3V2IA 1X2BA 1PW7A 2IYYA 3V1UA 2AKAB 1ZN7A 2GVDC 1KIMA 1JX6A 4KUHA 2HGZA 1I3OA 4P4GA 3PFGA 4KQCA 3T9FA 2Q9BA 4EHFA 1XDUA 1NQAO 1ACLA 4OQ4A 4ECEA 4QYWA 3NBQA 1OI7A 1JU4A 3PHLA 2VWPA 3WNZA 3V33A 3GT3A 1Y63A 4YN3A 1G8GA 4MVJP 1N6HA 2JIPA 1I4LD 2WE7A 6ADHA 4CTKA 1OH8A 3O03A 4D4IA 1AF4A 1SXJE 1S7GA 3U1BA 1V0JA 2AR9A 3WGTA 3OI7A 3HJRA 1K0FA 2OWEA 4JWKA 4L8LA 3OZRA 3TIFA 1J7JA 1KH2A 2DFDA 3TOCA 3THXA 3BXZA 2N75A 1CWUA 3UJBA 2CHGA 1Z39A 3BE8A 4OSPA 3W9YA 4ERXA 3O7MA 3IVCA 3GL9A 1W0CA 4LHZA 2WJAA 4FT4A 3TFQA 4AJLA 3VSCA 5ITWA 1E2FA 3CEPB 4OQYA 1VPVA 3H83A 3GUCA 3OM8A 1VQ8B 3PC2A 3LCJA 3PD1A 3T9AA 5A4IS 5HKAA 5AP9A 4Z53A 2E4UA 5CM8B 3WLMA 1PO7A 4M8SA 1XVTA 3LQQA 4N5HX 3LA6A 5ER6A 4B83A 3S6JA 4BQOA 2WQ7A 1CS0B 1XQ1A 2R6GA 3ROTA 2AFHE 2BJHA 4YJ3F 1D6MA 1NXSA 1QYVA 2DBRA 1RLJA 5HJ5A 4L6CA 1ZZGA 2FMKA 3L5OA 4BQQA 1FVHA 1MHTA 2XOXA 2NZVG 2QW1A 1INLA 1T8RA 3MBOA 1JRLA 3PUWA 1BXGA 4NE2A 4A15A 1EJ0A 3NZEA 3PT9A 1H2FA 5AJUA 3WQSB 1H22A 1OAKA 2CVQA 4M1EA 4DV4B 5KBYA 3LCCA 5AKHA 5ESRA 4RLHA 3VX3A 3U3JA 3BE5A 3HO1A 3ESZA 1CUCA 4IQGA 4KAAA 1T3SA 1UBLS 1H4SA 3B3FA 4KXWA 4Z9FA 4CL3A 1ECGA 2IQIA 2ZRBA 1NZJA 2EGGA 3CPHA 4XM0A 3T5DA 1I2ZA 3TE6A 4HNQA 2F4NA 2H6EA 4OPMA 1PJZA 1RJFA 1U8EA 2DJIA 1XO1A 2VSQA 1XAHA 1ZUIA 4MITA 3HP4A 3NIDB 3DOHA 2OYSA 4R1LA 4TGLA 5E1OA 3OX1A 4N4AA 2C7OA 3ZE8A 2VJJA 3ETLA 2D0OB 1YC5A 2IA5A 4IJ6A 3GD5A 4BE7B 1VHLA 3C6MA 1C81A 3K2BA 3PQ5A 4ZV7A 1GAQA 2X6WA 2CFRA 1QYXA 3I2JA 4RH0A 5F1OA 4A6EA 2JLRA 3LYHA 1Y4DE 2PLNA 2V4DA 2G4CA 4EJ2A 1NTRA 2NO7A 1OOEA 4WJLA 1OVMA 2DTXA 2ZRCA 4DUYB 1WULS 4KR6A 1E7YA 1VKRA 2XNSA 4UFOA 5A05A 1GFZA 2BWJA 2LV8A 1OKKD 1BHQ1 1G3IA 2WMOB 3DE0X 4YT8A 1EQUA 3O4FA 2CY0A 3VXKA 2VF8A 2YNMD 3DQZA 4EW6A 4D0SA 2BFCA 3FLEA 3LCVB 3CESA 3QTTA 4RPJA 1S9HA 4YCJA 2HRRA 2IOQA 2AZDA 2O2CA 2WSSD 3ECCA 4JHXA 5DW3A 4YRAA 2ZJBA 4R1SA 3JAWA 1M1ZA 3K30A 1BDMA 3BMCB 4KNWA 5ADHA 4MCHA 2X6XA 2FWNA 2BGIA 1DL5A 3ITDA 1MUUA 2XCRB 3T5BA 2GA9A 3BAFA 1G8MA 2ZB4A 1ZONA 1N57A 1NRJB 3KOZA 4MMYB 5IAKA 3KVNA 3DT9A 4DR7B 3QUBA 1W19A 2JAQA 3M8KA 1ACJA 5E7IA 5EPUA 2V45A 3SLRA 4E31A 1KHHA 1GXSA 1KY4A 3BQNB 3CRW1 1QPZA 5KREA 1JFRA 2K2WA 1RWKA 1J24A 1OWOA 2OQIA 2ZRIA 3CSUA 3PDHA 4QECA 4PNHA 4TTTS 2Y77A 1AIPA 3TLGA 3IQFA 2Q4RA 4BNZA 4EG6A 4K03A 1V45E 4RW0A 1E2IA 5F4OA 3U39A 2ZAYA 3H9GA 5F7XA 2F2TA 1C3JA 1ZYUA 3QVKA 3DHNA 3GRCA 3FDZB 3IP9A 3JY6A