1OGJA

Ferredoxin:nadp+ reductase mutant with leu 263 replaced by pro (l263p)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP+ REDUCTASE
publication title Involvement of the Pyrophosphate and the 2'-Phosphate Binding Regions of Ferredoxin-Nadp+ Reductase in Coenzyme Specificity
pubmed doi rcsb
source organism Anabaena sp. (strain pcc 7119)
molecule tags Oxidoreductase
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1ogjA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1ogjA02
1IJEA 3CCSB 3AVUA 1VQ8B 4TMVA 3QFSA 1Q86D 4PC2A 3CMAB 2CRVA 4B48A 4TMWA 2OK8A 1JA0A 3WBJA 3AGQA 3CRZA 4TN1A 1OB2A 4M53A 2HDNB 2YWGA 3W2GA 4PC3A 1VQ9B 3VNUA 4PC6A 2BGJA 2VNJA 3E20A 2E1RA 3W5VA 4Y7CA 3CC4B 2B7CA 1ZM4A 3CCQB 1KQSB 2DETA 1G7TA 3AVYA 1KK2A 2BMWA 3JQQA 2BGIA 5FA6A 1EFCA 3LVBA 2RC5A 3MMPA 2QN6A 3LO8A 1QFJA 1YJNB 4EH1A 1IJFA 2BV3A 1UMKA 3OZVA 4PGOA 1R5BA 4H9GA 3LYUA 1YITB 4TMXA 2BM0A 1OGJA 4YHBA 2YWFA 1F20A 3CCLB 1EWYA 1YI2B 4B43A 4K1XA 1JB9A 5KSWB 4PC1A 4N3NA 3CW2A 4UAJA 1B23P 4M1KA 3QFTA 1XB2A 4C43A 4YAWA 1VQOB 1M90D 3PENA 3J81k 3FJOA 1YHQB 1E63A 3G4SB 1K9MD 4B4DA 3ZZ0A 2QA4B 1QFYA 4AC9A 2QTLA 3ZZUA 1QFZA 3OZUA 1BQEA 2XNJA 3JQPA 3WYAA 1S72B 1YJWB 1G7SA 4M2LA 2BM1A 3OW2B 5H59A 1YJ9B 1H85A 4MYTA 1JJ2B 3OJXA 3WBKA 1SM4A 1E62A 1VQKB 1S0UA 4AF7A 1DARA 1ZUNB 3V76A 1Q82D 4G1BA 1KJZA 3CPWB 4ZV4A 1QGZA 4ACAA 1B2RA 4RD2A 4ACBA 1VQ7B 4B3XA 2VNIA 1Q7YD 3W2EA 3W5UA 1NJID 4M0LA 5EMNA 1N0UA 1W87A 3P26A 1G7CA 1D2EA 3U2QA 1H42A 2DY1A 2QMUA 1GVHA 2OTLB 4ZGNB 3B8HA 1EFTA 1EXMA 5TY0A 3AVTA 2GPJA 3LRXA 1QGAA 4NCNA 3QFCA 1IB0A 1QX4A 4AF6A 4M4SA 1F60A 4R71A 1VQ5B 2VNKA 3I56B 1KK0A 1K8AD 1FRQA 2GQFA 4RJLA 4MYUA 1QG0A 5AN9A 2YWHA 2XNCA 1KD1D 4LC0A 1N8RD 3SJZA 3ZBTA 1ZM9A 3JQRA 4Y9RA 3CXCB 2EFGA 3WNDA 2NPFA 1D8TA 2QDXA 2PMDA 3G71B 3CCVB 2QEXB 1GO2A 4G1VA 3CMEB 3FPKA 4DQLA 3AVXA 3CB4A 1HA3A 1DDIA 1QGYA 3QSYA 4YAUA 4HE6A 5TR9A 4J0QA 3ZBUA 1OGIA 1TUIA 1JA1A 2DEUA 4FN5A 1EP3B 2ZITA 3CC2B 2VYQA 4DQKA 3E1YE 4F7DA 3OJWA 4P3YA 1BX0A 2PIAA 4RD0A 4LBWA 3CCMB 2VNHA 1E64A 1FDRA 1WDTA 1TTTA 3ES9A 1VQPB 3VMFA 2PLFA 4TMTA 1DDGA 1K73D 1DG1G 4ZCMA 2D74A 4YALA 4BPRA 3VO1A 3W2HA 4PC7A 4YAFA 2OTJB 3B82A 1SKQA 1M1KD 1VQNB 1KRHA 3MCAA 3B78A 1QUFA 2B7BA 4Y9UA 3G6EB 4RD4A 4QFMA 4LBZA 2RC6A 3CCRB 3CD6B 4LBVA 2X3UA 3QFRA 2VZLA 1GAQA 1W2BB 3P27A 1ZM3A 2B5OA 2BSAA 4RD1A 3I55B 2BVNA 1CNEA 1AIPA 1FNBA 3AGPA 1ZM2A 2OK7A 3AVWA 4FK8A 2BF4A 3VNVA 3QE2A 1EP1B 1W35A 1XE1A 1N0VC 4YAOA 2C78A 1FNDA 2R6HA 5TV2A 4C0SA 3W5HA 5HXBA 3CCEB 3WY9A 5GV7A 5JBQA 1GJRA 1ELOA 1QVGB 3WNCA 1D1NA 4B44A 1FRNA 1Q81D 3OZWA 1G7RA 4P6VF 1EFUA 4G5GA 1CNFA 4U9UA 1CQXA 4RD6A 2BPOA 2BN4A 3VO2A 4NBSA 5H5JA 1QH0A 1I7PA 1KTVA 4RCZA 1R5OA 4B47A 4TMZA 1A8PA 4FWTA 1QVFB 3CC7B 1JNYA 1VQ4B 4RCYA 3W2FA 1BX1A 2DCUA 4ZCLA 3W2IA 1VQLB 1U2RA 1QUEA 1FNCA 1EP2B 1J9ZA 1YIJB 1AMOA 2AHOA 3CCJB 2CNDA 2HMAA 4N3GA 4Q7JB 1GR1A 4IW3B 1TVCA 3WNBA 3A1FA 2QTZA 5THXA 3CCUB 1NDHA 2DERA 2J7KA 3I1FA 4ZCIA 4QHYA 1KC8D 1GAWA 5GV8A 4ZGQB 2EIXA 4HE5A 2C77A 1KK1A 2HCJB 1VQ6B 1KK3A 1W34A 3U6BA 1TLLA 3U6KA 3MHPA 1R5NA 4RD3A 3WXMA 1BJKA 1OB5A 5DSZA 4WQMA 2YWEA 3ZC3A 1FNMA 3ZZTA 1VQMB 4LBYA 3AVVA 2FX3A 2XEXA
chains in the Genus database with same CATH superfamily
2XR1A 4CZ2A 4MGEA 3U1BA 2ODEA 3AVUA 4B17A 1ZSVA 5DLQC 3B1KA 1ZHFA 5FI0B 4O63O 3ZQKA 4O2AA 1RD4A 5IF3A 3BDAA 2HBQA 5HF5A 4LXXA 4CIWA 4OY3A 1XQYA 4DR7B 1RQLA 3E9NA 2GN8A 3JQAD 3DWGA 2CRVA 2D1RA 4Q9AA 3TLYA 4YUWA 4JROA 2Y1EA 4ENRA 3BVPA 1E1YA 3FZGA 4BX8A 1YE3A 1XWWA 3N1UA 1ISFA 1CIJA 1F4LA 2DBVO 3HEAA 4ZV9A 4YASA 4ENVA 1Z5GA 5EL0A 3HVJA 1U8ZA 2FMHA 4OA8A 1RJDA 3DKVA 3UJ7A 4TN1A 2QD4A 3WWCA 3SSMA 3D6AA 2ZTVA 2V8OA 1KPGA 4JMPA 2C83A 3GJ5A 3ELBA 3MFQA 2F43B 3QQPA 5KYYA 1NLUA 1VJCA 1WEKA 4FYIA 1DC8A 4ZCQA 5CFRA 5KJFA 2QU8A 1J97A 1EXDA 1JXMA 3EVGA 3IH5A 4N76A 4M53A 4CGZA 5LZ7A 1IY9A 4WLUA 3SEJA 2V7QA 5AW4A 4LGMA 1OVGA 2GILA 4PC6A 2QORA 1HETA 1ML3A 1XVVA 2FMXA 1TZKA 3X1ZA 2ZR8A 1DFIA 1HSZA 4CQLB 1H66A 1VPWA 1YMUA 1YL5A 5DPMA 3I2YX 3B1WA 3V3KA 1T1JA 1VRWA 1AX9A 3D1LA 4TTSA 3T12A 1H2AS 1PWXA 4K9SA 1VLQA 2FF7A 2V5VA 2YY6A 1NMQA 1PI3A 1JHOA 1RHMA 1RZVA 4GPAA 4I0WB 4LHYA 4ZVQA 3THSA 1VI2A 2ZIWB 1DEAA 3C5HA 3WGGA 5AJXA 2VH1A 4KXNA 1TK9A 3VKVA 1A72A 1KKUA 2KLHA 2H2GA 4EZIA 5IJ0A 2DM6A 2CL5A 2M5SA 2O8DB 5EIAA 4G2NA 1ESDA 3QYPA 4C7BA 2ACWA 5CFLA 1B7GO 3OZEA 3WL4A 2EERA 3EYWA 3HPQA 1UEXC 1GKLA 4RPHA 3T53B 4QGBA 4CIXA 3O74A 1LV7A 1QLHA 2DFKB 1UMBA 1UWKA 3AI3A 2O2CA 3E0XA 2Y05A 2P3LA 2DKOA 4K2HA 4ZRMA 4L5IA 2HPZA 3U7JA 2BV3A 1OLSB 1NQ5A 3OKCA 1M3SA 4H31A 3MRXA 4B6PA 2PS9A 3UA4A 3DFMA 5ECDA 1NVFA 4WK6A 3S5JA 4ZYXA 1X94A 3AEUB 1T2UA 1P2BA 2HXGA 1HE1C 5ULLA 3LI2A 4FFOA 3ZE7A 2HRZA 5HVNA 1CIVA 5EIOA 1IM5A 4RK7A 1JZQA 4FINA 1P1RA 2WLTA 3M0EA 3PBKA 2RJ3A 3WJAA 2YIJA 1DXYA 5HK8A 3ROXA 3ZY2A 4B3GA 3CTAA 1IVNA 1CPYA 1UFVA 3JVEA 2JD0A 3KAPA 2YV2A 3HNOA 5C0OE 3N2KA 1PE0A 1KHTA 1B8OA 3PPWA 4I1YA 1R9MA 2NUBA 1CERA 1I4WA 1KERA 3QPAA 2CXNA 4PSKA 4R31A 5JZOA 1FUEA 2JJ1A 4GX5A 2INGX 1FW8A 4IJUA 3KTOA 5HS4A 3LUHA 1X13A 1KVQA 2CLIB 4JUCA 4PNZA 3WMWA 5ALLA 4FHGA 2P11A 1C4XA 2DTXA 3VHQA 2XXAB 2B8TA 2OGSA 1GNTA 3RK1A 1JNXX 1E9AA 3BULA 1GPH1 1ZOIA 3IHWA 5AKXA 3TUIC 3OEHA 1MX5A 1DRKA 1ZK0A 1NPDA 1Z4NA 3LP5A 4QXAA 5L3QA 2PO5A 2IKQA 1R9JA 2OV2A 3H9GA 4D3XA 4YCLA 3OZFA 3K05A 2FN8A 1J8DA 2A9JA 2WMDA 2J3IA 3NHFA 1NA5A 4ME6A 2HBRA 2WYVA 4QDOA 1BWPA 4QG7A 4DHWA 2FQYA 3J81k 1KS2A 2WWXA 3H19A 3I45A 2ZRKA 5FFFA 2BGRA 3AI2A 2PWAA 1T26A 1XVLA 1YVRA 4G9BA 4IG9A 1K6JA 3IE1A 4KUGA 1X19A 2FHPA 4LXUA 5KVAA 1FLDA 4M0EA 1Z39A 3WJ1A 3ZCPA 3L6EA 4FT4A 4AUNA 1W59A 1QFZA 3OZUA 3GZNA 4XB1A 2OQIA 3RT1A 5EPUA 1YR1A 2IYRA 2VBUA 1SZCA 1FU7A 2OFOA 4HVCA 3KWLA 1XF1A 3GRVA 1G7SA 3OQVA 4JJ8A 5EWLA 3FFXA 2GN0A 7REQA 4FPXA 4KMMA 3D7SA 1DBPA 3OW2B 1ACLA 2B4QA 2F2TA 1FJXA 3MIZA 3LKDA 4EG4A 3CZ5A 1ZNWA 1NXXA 3CCCA 1EQAA 1FYWA 4FHCA 5HTOA 1UH5A 1SQFA 3RVLA 5ADHA 3CP8A 3BF8A 4ZVLA 2Y76A 2CVZA 1W2GA 5SV2A 1VHDA 5L7YA 5LA6B 5CXUA 2FEXA 1S02A 3ZN2A 4AWAA 1NZJA 4CQJA 1GG8A 3GUUA 5HBRA 5BNWA 1T5IA 1A7KA 2YMPA 3UJDA 3WMRA 1Q22A 3ETNA 1BS2A 2UVPB 4ZV4A 3CGGA 4C4AA 4ACAA 4U7JA 5F1KA 3N6RA 1ZD2P 4J75A 3E9ZA 2D1TA 1RQGA 2OT3B 2F3TA 4K9QA 4MB6A 3WYDA 3ZWXA 5D1HA 4ZJUA 5KNBH 1M5RA 1DKNA 3R7NA 3C3KA 4KQEA 5DM70 2HCTA 2GEJA 4ZT3A 4JIGA 1YZFA 1GFSA 1MB9A 3C3BA 1ADYA 2H16A 2HXSA 4I46A 3VYSB 1K66A 2C3UA 2H7VA 2X9LA 1U02A 3DFUA 5IJ9B 1H1LA 5HNKA 4J3FA 2RI0A 1OI2A 1T15A 3PUXA 1IDOA 5EPEA 1NMZA 3UK0A 1NXVA 2FEWB 3D02A 4I5IA 2IY8A 3DLBA 5SY9A 3QW2A 3KQQA 1QZ3A 2FU5C 3OU2A 1KNQA 1L9XA 3FTCA 5LQDA 3UJCA 4J49A 4CHGA 1WZUA 4HQKA 1M6VA 1R6UA 1TRKA 2PZLA 3KQMA 2WM8A 2ZZQA 1J22A 1WCYA 2QRMA 4R3NA 4IMJB 3AIKA 1ZW6A 3C5EA 1D5CA 3NBQA 2HHHB 5HF6A 3DTYA 1IONA 1KF0A 3PD7A 3ZK7A 16PKA 3DDCA 4ZDIA 1R16A 2JVIA 3EGIA 1I6LA 1N9GB 1NTOA 3B2QA 5JD6A 3KL9A 3TL2A 1U04A 4RF4A 1E2EA 2QN9A 2GMWA 3C45A 4QDTA 3JYLA 4K26A 1G4HA 1II8A 3B9RA 4TOIA 1HE5A 1M1XB 2QXUA 3BXFA 3ETHA 1Z68A 3G6KA 1E6UA 2CUTA 3O7WA 3R3XA 3B9BA 1BE0A 2HF9A 2G71A 2AN5A 1IEVA 2R3SA 2RSLA 4QJIA 2XT9A 2PSSA 4DUGD 1ISPA 3AHFA 3EGXB 4RJKA 3L07A 4BVHA 3K09C 4OHBA 3DVRX 3R5TA 4OKIA 4W6ZA 1NF9A 3L49A 3RG8A 3UG6A 4P84A 3NHJA 3RG2A 4HK4A 3CZ9A 1GGHA 2OV4A 5HKBA 3NW9A 2I1VB 2EHDA 5KCMA 2SICE 2VT2A 2CW5A 1PZHA 2WKQA 4JT8A 4RV5A 4Z3OA 3GFVA 2D5AA 2X8JB 1POWA 2YY7A 3PL1A 4UUPA 2EGUA 3IEKA 3RJTA 1HR0B 1A88A 4EG0A 3PC4A 5JQGB 2IZZA 2A9OA 4FCCA 2C2YA 1Z5PA 2I8CA 5E1MA 4EA7A 3VH4A 2X0IA 4NJEA 5AJZA 4D79A 1UBHS 3LNCA 1CWUA 4OGFA 2GBLA 5EMMA 3H8SA 3BCDA 1BMTA 2P4EA 3T5GA 4ZICA 3SJUA 4RC9A 1WV0A 1YQXA 1UBLS 3GLGB 2WFLB 3GMIA 2H2WA 4UVHA 5IHPA 2X13A 1U0LA 3GFPA 2FEKA 4HIZA 3G82C 5DOZA 1Y80A 3Q8LA 5CNJA 3BXPA 2F3RA 2I7CA 4CKWA 1KQ3A 3GJ4A 3IBFA 3IQXA 5DX1A 4Z0NA 2UUAB 5K2OA 2HA4A 3EXHA 1U1EA 3THXB 3GRKA 2I1WA 3KKPA 4KKXB 1A9XB 4BMYA 1G21A 4E13A 4PBTA 3F6BX 4QAJA 3TI9A 1QE3A 2VYND 1T29A 2FK7A 5DN9A 2BBSA 4YYEA 4ALLA 2TYSB 3ZHUA 3LV8A 2ZR0A 1CEYA 4O08A 2YYYA 2V7PA 2RHWA 3KXPA 1N2SA 1N36B 4MVWA 3N0VA 3G2QA 4MNTA 2EZ9A 5HTKA 1R4AA 3DTVB 3ET4A 4L4SA 4RVGA 1NVVQ 2YOHA 4DK0A 3IIIA 5CVUA 1SVMA 1JEAA 2VKQA 5AVQA 3GU3A 5KQPA 2RGBA 1YS7A 2H59A 4FGUA 1DG1G 1KVUA 4WZ6A 1KY5A 1Y6FA 1DKMA 3KQNA 1FS5A 4YALA 3AXSA 4PXSA 4FR5A 5LQUA 1N8SA 5I7RA 3FLMA 4C30A 1OAOC 2WE8A 1Y7HA 2DHCA 1LK0A 1MRNA 1QIJA 4XEUA 2VSNA 4P6YA 3CX6A 1C7QA 3A1VA 4C0JA 2PQ0A 1KORA 3CNEA 3AR7A 3JQ7A 1DBSA 1Q0PA 4IIDA 4EVSA 4HT3B 3WZ2A 1GQRA 4HQRA 5KVCA 2W8ZA 2I7DA 4JZYA 2GD0A 4DJEC 3NHBA 4NAUA 4OBEA 3B60A 3VDMA 1ABFA 1RXCA 5HA5A 3W9UA 4H3KB 3ELYA 4JSYA 5FTJA 4YRPA 2RB4A 3CBQA 1TCVA 3GWZA 3R7SA 4GM1A 4K8RB 2C5LA 4G07A 2CXPA 1RQNA 3IVGA 4I7EA 5KYVA 1KEVA 3UWPA 4Z0TA 4CPDA 4F4IA 3IQZA 1USKA 1XTVA 1W2BB 2OV6A 2IPXA 3O1HB 2VSOA 1NURA 4IKEA 4C22A 4Z3KA 3EX7C 1OT5A 2G9VA 3IE0A 1KS9A 1V6CA 2QJRA 4QGHA 2R5FA 4XPIB 1MBZA 2JEYA 4FBMA 3ILYA 1NLZA 1XQ9A 2GSWA 3OSZA 5A7HA 1QQAA 3CFYA 3WS7A 4V0ME 3PX7A 1J7JA 3M9WA 2OK7A 3FB4A 1VJ5A 1VOTA 1SR8A 2PKWA 4XA8A 3HYNA 2AFVA 2DY0A 3CZCA 2VP4A 3PVDA 1ARZA 3E6AA 4UEQA 4DMHA 3G8CA 4I6JA 1U3VA 4DSTA 1NM5C 3X1WA 3BL6A 3M6XA 3AFIA 4D8YA 1BWSA 5BPFA 3PVCA 1AGRA 4JI1B 3QMVA 4RH1A 2D00A 4MV3A 3WL7A 2WF9A 2FW0A 2ES4A 3EA0A 2B2NA 1MJGM 2EU8A 2IYZA 3NHMA 1K89A 4INOA 2J0VA 4GM4A 4WAUA 1RYFA 3Q9UA 1QAMA 1WQ3A 5G53C 5TMBA 3IVMA 4G36A 2Q7OE 3S4YA 5M04A 3KQVA 4ZU1X 2ZSEA 5DYYA 3TQHA 5IYZB 2KSQA 3CLTD 2HJWA 1WPGA 1KIAA 1D1NA 3QIVA 1FU8A 3OZXA 4FNAA 4QYIB 5CX1A 5KDLA 4FYJA 4WJZA 3WKAA 1DMRA 1KBQA 1U6JA 4R8LA 3UJ9A 4QDZA 1O1YA 5E3JA 4PHHA 2J3MA 3FGZA 3K2QA 5IAGA 5D7NA 3W7BA 4ZYVA 3GBPA 2WNHA 1G59A 5EZ5A 3Q9LA 1JQDA 4NWIA 2O8EA 1F51E 1TADA 1TYCA 2AXNA 1HDGO 2XRZA 4Z4SA 5IC6A 1JG7A 5DASA 1J06A 5FNVF 2Z6AA 1HQYE 4B47A 3ILXA 5T67A 3NHRA 2PWYA 1OFIA 2AJBA 4CIYA 3FTEA 3JQFC 5C5IA 1J2RA 5KYTA 3BZWA 3MUNA 1C9MA 4UHHA 4WPGA 5G4KA 1ISMA 3VHXA 4HS9A 5E0OA 2WUEA 3ZDYB 3TM5A 3W3ZB 2OGTA 5TGTA 3O95A 3P52A 5EXSA 2HJVA 3GFQA 4R69A 2DTDA 5FH9A 5BORA 3QPVA 1FYVA 2H29A 1E3LA 3Q11A 4E0BA 4BUJA 4M22A 5DHFA 3DYIA 3FETA 5ALQA 3LQ6A 1UDXA 1D2GA 3A36A 4UU1A 3VR6A 5LUAA 3JD1A 4BLSA 3E9RA 2OAP1 1BHO1 1VE7A 4JVMA 2IYVA 2BELA 3PHGA 4FKBA 1PJZA 2R6DA 1Q0SA 1TC1A 1XR3A 4JLSA 4RA9A 3WNBA 3P5SA 1QRAA 2ZJ2A 1OA1A 3IESA 4ZPJA 1P6QA 1J2JA 2Z8YM 4TTQA 1TAUA 4ISBA 1O5OA 4QYMA 1JXAA 3RUHA 1FX0A 2RKOA 2TSYB 3QY9A 5BQ3A 3H94A 3WGNA 1Q57A 4P9SA 4UEKA 1SN7A 2I2XB 1XK7A 4Q1FA 4QQKA 5L3RA 4CLEA 3Q41A 4R7GA 5TIIA 2CUNA 3E18A 2N1BA 4CODB 1J2UA 2BUAA 2GCOA 3R3SA 3RV3A 4EUFA 3G1WA 4HE5A 3GGSA 4KXFB 1YUNA 3LWZA 2WZDA 4JKYA 5DYWA 3NHPA 5TQJA 5B7GA 4P38A 2PUVA 2C77A 1PUXA 2QP9X 3MRSA 1RS0A 4UM9D 4YRZA 1KKLA 1GPDG 3JALB 2QL6A 1W34A 5AHXA 3EVEA 4JLDA 3RIMA 3SG0A 2FMKA 1PV1A 2X86A 1MAWA 3CV3A 1WDKA 2PZFA 4QU9A 3GBVA 4JT4A 4AS3A 4RCVA 3QTTA 4HAWA 2YYSA 3KUDA 2GK7A 3SF8B 4EQZA 3DEFA 5THQA 3J81A 2FUG1 1ZHOA 1L5WA 1OF1A 5AKJA 3QVSA 1DKOA 5GINE 2BFDB 1TQ6A 1V25A 4WQMA 3F8SA 2IYEA 1KXJA 1AK2A 4KQMA 1IJKA 4XDZA 4C0WA 1J33A 5FTMA 3GCZA 4KNWA 5IAOA 4AU1A 4O4JB 1GITA 5AI4A 4QARA 3C1UA 3BTVA 3IQGX 4GVLA 4KLNA 2QYSA 3L0SA 2DJ5A 3SJ7A 1A71A 2XUIA 1Z5VA 1ZL2A 2B1GA 3IMGA 1VG9B 1Z2DA 2WUVA 3K4HA 2NU8A 3V9PA 1JLRA 2MYPA 3AT1A 3SXUB 4AURA 1GQQA 2V7GA 4M1WA 4MLPA 3IXQA 4Q4AB 4MV5A 1OX4A 1OXKB 3FROA 2E4UA 3ISVA 5D5HA 1KR2A 1XJ5A 2JK1A 1KI9A 2GBFA 5CT6A 5C52B 5AVTA 2CFOA 2IUFA 4MS1B 4INAA 3VZBA 2O8FB 4Y6SA 4RNDB 3T61A 4AROA 3TINA 1QPGA 3MYYA 1U5BB 1VFPA 2XYPA 4XKWA 1AN0A 4HN9A 4YJ3B 1XXHA 2ZBGA 1DBWA 3DV0B 3STWA 4DGSA 1VZ2A 2CBXA 2PU5A 1OTXA 1SBZA 4CIVA 3DUWA 5IS2A 2E49A 2VO1A 3DF9A 3SIRA 3DV9A 1KI2A 1G19A 4B2YA 5K51A 2REBA 2C04A 5TQVA 3FTPA 5F7ZA 3UWMA 4CN8A 4PC3A 1CXZA 2G76A 2ZSFA 1AKYA 4GLJA 4HUQA 4Q48A 4ZU3A 2JGIA 2BGJA 4AJ4A 3NLLA 1DKRA 2PUBA 1UOEA 1XEXA 4DHEA 3LT1A 3VBEA 5KKNB 4EGSA 1W9XA 2Q8NA 4KX5A 5CIWA 4XOIA 4X71A 4XQ9A 2GK3A 4KB5A 1E3WA 3PUNA 1GUFA 1PIWA 2WWIA 4NHEA 2HBYA 4IJQA 4OAQA 2I4TA 2Z83A 1B8VA 4JI6B 2SHKA 3LRPA 3HA2A 3X3HA 4C7OB 2C96A 3D3NA 3K9WA 4YPVA 2BKVA 3VX4A 4QDKA 5D3QA 3VC2A 4DA9A 5K6AA 1ZD3A 4FR0A 4J91A 2Z4SA 5EIXA 4AMGA 4PU0A 1GSHA 1SBQA 3EQ9A 3GLIA 3P9KA 3N0WA 3A32A 1WMFA 4EVIA 1RDFA 4FKMA 4PTYA 5T4EA 3LWNA 4D4JA 1A7UA 1RJ9A 5BN4A 2BM9A 2JH8A 3UT5B 4RSRA 4O2BF 3L4KA 3RUAA 2QM0A 3CNHA 3MT9A 3NM5A 4JUBA 3KL2A 2Q46A 2P9QA 3EFOA 4L27A 1I14A 1H6CA 2D62A 1QP4A 1QYWA 2V7XA 3FPSA 4YV1A 1SZJG 1DG9A 4D3SA 1LI7A 3GFGA 3HFJA 1QVAA 4O4HB 4N0QA 2YXEA 2O2DA 4M46A 3O4GA 5I6DA 3NYWA 5KAPA 4KGDA 1ULHA 1JSRA 3OF2A 1U7HA 2WUWE 4DQDA 1U7OA 3PL5A 4G86A 4CM6A 2QR3A 3WHKA 5BW4A 2ZBUA 2O2HA 5LWHA 3OICA 5EC8A 2P6UA 3GOHA 2J0QA 1OBCA 1QIFA 1QVZA 3QHAA 1KSGA 1XTBA 2NM0A 2OESA 3KKOA 4G4GA 3DJFA 4HMPA 1H0KA 2CLKB 2DSTA 4ND6A 5DGXA 5B1HA 1PW7A 5GPBA 4RTOA 1IWBB 1DC4A 5AVKA 5CBKA 3MRVA 5EP4A 5H9WA 5KBYA 3RC8A 3JQAB 4FGSA 4MQ6A 4R7TA 4H6WA 1R0BA 1YVUA 3Q98A 2FEOA 2EBHX 1S89A 2XUPA 2ZSJA 5EGSA 5EXXA 3N6XA 1A9QA 2GCEA 1E3DA 2GPYA 2OL4A 4QQNA 3NNDA 4RETA 2E5FA 3DVLA 1G63A 3BY1A 4EAAA 1N78A 5DBFA 5EUQB 3M6MD 5JC8A 3MWFA 1MOQA 3EH1A 4C0AC 1G8SA 3INYA 2EKQA 4ZCTA 1JA9A 2LIPA 4QT0A 2QZ9A 1VYHA 2ZAYA 1DJOA 2WJHA 3PEWA 4G2TA 4M9ZA 4IWYA 2DUWA 2ZWIA 521PA 3BSSA 3JYNA 4C1BA 5BQ5A 4I55F 3M81A 3NIGB 1L4BA 1OBFO 2XSZA 3HO8A 3UPTA 1PDOA 1HNWB 1DZ3A 1VQOB 4ZEVA 1ZLXA 4HAYA 4NULA 3UVEA 3V42A 4DC0A 5DSXA 3K16A 4KDEA 1IIBA 4PNPA 2HCBA 4LC9A 1K9MD 4L07A 2LW7A 5CNIA 1IK6A 2PZAA 3VR5H 3RUCA 1WMEA 2ZUCA 3TW4A 1E7YA 4O3MA 1XDSA 3I9KA 3LGXA 3REFA 5FL7D 3EGEA 4GP7A 4HWPA 2ZBFA 4PZ0A 5FWDA 5IM4F 2ZVPX 3GF4A 4NQRA 5M2QA 4GPIB 1YNOA 1XFAA 1C14A 3KBOA 2GN6A 3PEEA 5EJ2A 5K5EA 3NWOA 3PGA1 4CDGA 1ORVA 4XX1A 4LPSA 1L4UA 4MCHA 1K9VF 5FBWB 3TLGB 3BMQB 3BMNA 4WKPA 3ZWDA 5B2EA 4LPKA 5I7EA 4GZ3A 3OJXA 3SNKA 4AAYA 3BIFA 3E7XA 2PTGA 4PNHA 3RTEA 2QY6A 2NPOA 1MB0A 3BRQA 3MS7A 5BYJA 4F4DA 1Z4MA 1VE3A 3LXMA 1PJAA 3BK2A 4Q82A 3FTFA 4WA8A 5C8ZA 1ZUNB 1OFUX 4DCUA 1MNQA 1NMYA 3TWOA 3ZWCA 4WBNA 3I4LA 1PFUA 3R3JA 2AI3A 4WOBA 1AN9A 4MUAA 4DLWA 1I1OA 3CMCO 5J2TB 1RLUA 1T6ZA 4CCAA 5KKCA 5L6MB 4JI7B 1D8AA 1FXWF 1B2RA 3N6VA 1PJ5A 5CVCA 4NLLA 5CHYA 2H31A 2H1HA 1CF4A 4KE9A 3LXXA 1C30A 2X58A 1SQ0A 3KLBA 5E7IA 3TR6A 3H17A 4UQPA 2CK3D 4P4TA 1R1DA 4XARA 4B80A 5CB6A 4A15A 1U63A 4TT3A 5BT8A 1PS9A 2PZEA 2V6GA 4OQYA 3RT9A 4I9UA 3K0CA 2JFNA 2P9CA 4IXDA 4LF9B 4PLWA 2E4YA 1L8XA 4DWJA 5AVZA 4CFSA 5FYDA 4A8TA 4RVNA 1Y3HA 1A96A 3NV7A 3TN7A 4BGUA 2EP7A 2FMUA 3FH0A 2KMLA 2GKGA 5GZ1A 3AVTA 2A9FA 3DGFC 2J0SA 2BIFA 3TLBA 4EG8A 4I9HA 1EB8A 4N8DA 4KIUA 2VYVD 1XMXA 3SIXA 3VSBA 4CXMA 1Z08A 3BIWA 3CM0A 3RDPA 4YEJA 1MDFA 2OZVA 4G8DA 1XZPA 1WMBA 3I39X 3OTIA 4A73A 5KOHA 3AR6A 4C20A 2M1ZA 2O2GA 4IL5A 1W5FA 3PXDA 5DRYA 3BTSA 5THKA 1E6KA 1GLNA 2YQZA 3R3WA 2P8SA 2AZXA 1KY2A 2CFSA 3BTUA 4I8IA 4F91B 4U8HA 5LQJA 4V0QA 4ZALA 4CKYA 4UD2A 3RYFA 5ALVA 3AG5A 2YWHA 2XNCA 3DMDA 4X54A 4LC0A 4OH7A 5DE3A 5AOCA 1E1RA 2GVDC 2IPOA 3R77A 5DLYA 4ARUA 2E89A 4EFKA 5JQWA 1QC5A 3L8DA 1F0PA 5EIHA 1DKUA 3BBPA 2YV4A 1GGMA 3HQ4O 2BTQA 2E37A 3KEOA 4IH9A 4QFDA 1ZVKA 1F14A 2J08A 3NXKA 1VJDA 4TWIA 5LQKA 4MHTA 5F4OA 4NF2A 5BWLA 4YPFA 2QSZA 4GKKB 3DMHA 3ZNOA 4G7XA 3ZBTA 3CXCB 1E0AA 5J4YA 4IHJB 2X0KA 1FLAA 2Q6TA 4UVGA 3M1IA 4TSKA 2VHJA 1YJQA 1DLIA 1BH6A 2RGWA 4UUAA 4C0XA 1DT3A 1N6PA 3CB4A 2C42A 2YZNA 2AJDA 2XXBA 3C4QA 1G20E 3N8KA 5B58C 5EKUA 3QSYA 2PRKA 3FM9A 4LRQA 4M7OA 5EY5B 1V71A 5C80A 2AI2A 2W4QA 1JH8A 3BD8A 3L7JA 3ZBUA 5EYPA 1KI4A 2I99A 3LCMA 4JB2A 4JQSA 3ZE0B 1Y6RA 4RYDA 3THRA 3FGOA 4IFBA 1MH1A 4WGFA 1N1MA 2BE9A 1O95D 2WRZA 4IDHA 2VJPA 1T0HB 3A1PA 4C87A 3AI7A 5K8JB 3AKYA 1XRQA 2HMWA 2VP3A 3FAZA 4J4BA 1CTQA 4URFA 3RSZA 5CFMA 4K9LA 1NP6A 4L0CA 3HXTA 3N86A 1JHUA 1Y5IA 3FN4A 4MEJA 5T57A 5JAMA 1APBA 2FVXA 5AUQA 3I92A 1CQIA 4Q7QA 4OLHA 3BMCA 4J76A 1QHIA 3WB1A 3MM4A 5HKAA 3FYCA 4RENA 3ZHOA 1UK8A 4GVPA 4JGGA 5F5XA 2PJZA 3OEEA 4UULA 1LPMA 3JAWA 5LDGA 5LU8A 3I1IA 5J5VA 2VUHB 2IUUA 1F1JA 1G98A 4KAXA 3AKEA 3BXXA 4K05A 1PJBA 1RNLA 4UAVA 2I1QA 5DFAA 1DPGA 4CG3A 2JFHA 4QBFA 3OM1A 1K27A 4L50A 3X2SA 4DT1A 4DUYB 1XO1A 2UUBB 9GPBA 4G0UA 1F2UA 1FFEA 1ZK3A 1AU9A 4ESVA 3PD1A 2WWFA 1C1XA 3A04A 5HP4A 1Z4QA 1M2OB 3G59A 4EA9A 1XDDA 2IEBA 2SCUB 1XXLA 3A31A 2GBPA 5JNUA 5TVKA 3L4BC 4Q4JA 4CCYB 5KDOA 1JHPA 3D3WB 2IZ0A 3WI7A 2P2NA 3ICWA 3FKJA 4EA6A 4BKPA 2QTRA 2C9BA 2WI8A 1ZN7A 2GKOA 3F6EX 4KVAA 5B1SA 3RE1A 5G1NA 2IX3A 1RVDA 4DRXB 1I9CA 4XDHA 5LU9A 1EUYA 2B7BA 1TTQB 3BORA 4UBNA 2IHTA 1N2CB 1SBNE 3K1AB 2NXJA 4EFMA 2NV4A 4X6UA 1PEKE 1B15A 2JGJA 4EUNA 2PWZA 4YJFA 7GPBA 2KHZA 2RC6A 3ZHYA 1ZGJA 1WVMA 3ZXUB 4ANFA 2CXQA 4X8MA 2DKNA 5BN3A 2BEUA 1PX2A 1G21E 1NATA 2F00A 2E4ZA 1KU6A 1L7XA 5AW7A 3BMOA 4CMEC 1ZMRA 3ZQUA 3TTVA 3QUCA 1UC4B 2BI7A 4BBAA 1YVEI 1WZIA 1D9XA 4JVLA 3IKVA 3GPBA 1YZQA 3CNLA 1NKSA 4UOEA 5HZAA 3RVOA 3OCZA 4M0PA 1V5GA 4GI1A 2WSLA 3G8DA 4BN5A 4DLAA 1ODJA 3FVTA 4CI9A 4L76A 4DLLA 1SCBA 1ZLYA 2Y1FA 3CMMA 1RRPA 4GPBA 4WWHA 2IYYA 4GI2A 4A10A 1S9HA 2C78A 1YZTA 2WR8A 4OP2A 3C48A 4ZIRB 1DRJA 1L4FA 2ZBQA 4XX0B 3LQYA 5JPCA 4EKGA 1WPXA 3C7AA 1XWIA 5AOVA 5EUMA 1TZMA 4BNDB 1K68A 3GRRA 1MO5A 4D26A 4CFZA 5LWQA 4CG1A 5KNDD 4QTUB 1S4MA 1B73A 5EN4A 1BAPA 1KO8A 1YAJA 3WY9A 2GVZC 2ORYA 3GLHA 4YTEA 5KYUA 5I4KA 1O58A 2H1LA 1QMPA 3OQIB 4PG5A 4QUDA 4URUR 3TRDA 3CG4A 1YBMA 3GAZA 2H3HA 1STOA 4B6JA 2A3RA 2I3GA 4P54A 2WQ6A 4ARCA 3EMBA 3AESA 4B44A 4GRDA 2Q28A 5GONB 3LDHA 3S99A 1GPUA 4D97A 4PQYA 2VPWA 3ADKA 1UBOS 3WWEA 3DBLA 4E88A 2HUNA 1AY0A 2J6IA 4PSDA 4U5QA 5DLEA 3ZCTA 2BN4A 5A89A 1G3UA 1MGPA 4NBSA 3IAFA 4XLZA 1Y8AA 1T8PA 4DR6B 5CCXA 5G02A 1OUMA 5KTKA 3D3KA 3N8GA 2Q49A 5JD3A 4D3DA 4GOXA 1E3ZA 4US0R 3UBMA 5CD9A 1CUWA 4OD0A 2ZI4A 4CM7A 3FKSA 4FS3A 4N0EA 4XIIA 2DPYA 2O5RA 4YCDA 3OCUA 3T6KA 3FLAA 2R1VA 3TIXB 4MR7A 5TPZA 3U37A 4ER7A 3QG5A 2ZAGA 1R0KA 3KFXA 4QHSA 3A25A 4N7BA 1T36B 5F78A 4JXXA 4ZI3A 1XJCA 4Q02A 4V38A 3AUKA 2LKDA 5JYCA 1TEHA 4GSKA 2D2VA 2C3YA 4AJJA 1I2BA 4JL6A 4WSOA 4B7XA 2H4XA 2DVMA 4TMYA 2G36A 4RXUA 3TKLA 3DVAB 1HV8A 3MMSA 5KWIA 4EGJA 4DDTA 2YTZA 2O0LA 3LY9A 2Y8EA 1E1DA 1LZLA 3F98A 1JJFA 3G2NA 4MV7A 1VMKA 3RIGA 3IQWA 4YQYA 1OZHA 2JANA 4XSGA 3ET5A 1KMIY 2A67A 1J0BA 2G5CA 2EG9A 3W5CA 1Y6GA 3KBBA 4OU5A 3RWMB 2YCBA 5GV8A 1KBOA 3JD0A 3RYIB 4S1NA 2KW5A 2QMOA 2IIPA 4D5EA 3LC0A 1TX4B 1BWRA 3DEIA 3IV7A 3ZLJA 4LISA 1IUKA 1OWNA 2NZUG 1UJBA 4RZ2A 5D6NA 3ETJA 4WZAA 1R6VA 3BDIA 2V6FA 4JLPA 2JFOA 3M70A 4RBNA 1UODA 5IRCD 3TB4A 2VAMA 3NOOA 4A6XA 2F1LA 5ABPA 2Z1NA 3MHPA 4P8RA 4YCCA 2HO4A 4TUYB 2AXQA 4Z1MD 4BFUA 1QKKA 3OBBA 2UZ0A 3RSLA 3NONA 3BRWA 1L8AA 1PHPA 3Q2KA 4R1SA 1P9LA 5HUJA 1IZ0A 3RI3A 1YZ3A 1T5DX 3O1JC 3A05A 3PTLA 3SHWA 1HEUA 3R7DA 2MSCB 4NEQA 4WWVA 4ATNA 1B41A 2DHDA 4O2LA 3WAKA 1FJGB 1AHNA 2GRJA 2REOA 1LEHA 2MDTA 2V74B 3NB0A 3ESDA 1NFQA 4RQUA 5KOJA 2FWRA 4JLVA 5KTNA 3OECA 3GEEA 1NB0A 2A5LA 4FFLA 4HSEA 1EA7A 1LNZA 5EXEA 4K9KA 2NVUB 1T0JB 3PVSA 1YONA 1XG5A 2ZULA 3ZVMA 5FTKA 5JAPA 3Q3VA 5AKIA 5KYNA 1JIKA 2DPHA 3EFBA 4OFXA 4KO2S 3FDFA 5BOVA 5B4VA 3H4IA 3CPXA 1JLLB 2DUJA 1V1MA 3MZ0A 2HWKA 4O4IF 1Z6TA 2ZUDA 3IPYA 4OQDA 5L3ZA 2LR0A 2H4HA 2I2FA 3PQ8A 3P9RA 1JX6A 4PG4A 1CFZA 1MT3A 3IYLW 2DT8A 3A6GA 2XIQA 4M21A 1S5PA 1YRYE 5JPDA 1GV1A 1XFDA 2FDXA 4RTJA 5DHQA 1H2WA 4NOMA 1IWPB 4IZ6A 2O3QA 1ZRMA 5DXAA 3MBKA 1RPNA 5ARBA 1AA6A 2BBTA 2PO7A 3A9RA 1FP6A 1I1NA 3DH0A 2E21A 2DRIA 4W9MC 4BLOA 5ALWA 1VTKA 2Z43A 5EZYF 1M72A 2WAYA 5LQNA 3LSYA 4MW5A 4BE7B 4KN8A 3UK6A 4BO5A 3L9WA 4UTZA 1G64A 1CY2A 3CC4B 2CVHA 2OV1A 2WDPA 4MGIR 3O8RA 3CCQB 3TNLA 1Q2UA 2P40A 2ECQA 2XE8A 5DEIA 4R9UC 3FR7A 3TDNA 1EFAA 2BFFA 3RFVA 3TMYA 3ZI4A 1KYYA 2JW5A 4GL4A 2QR5A 2GCIA 1WUJS 4M99A 2PKQO 2B8EA 4BMXA 4LDPA 4M8LA 5TDHA 1A7JA 1KC1A 3DLAA 2OZLB 5FPTA 5J2UF 5LMCA 5IKOA 2X85A 2IY7A 2LCFA 3AMVA 3FOBA 1JQAA 4JJ7A 5CCEA 2WY2D 2B0JA 1I1QB 2XVAA 4HLDA 3VAAA 4IQ8A 1RRCA 1JVSA 4MX8A 4ZPXA 3ROEA 3PLAE 1XTPA 3CUEF 2X2EA 1GT6A 4S12A 2PVPA 3EXFA 3EGVA 3T56B 2PX8A 4HRXA 1XXHE 3GJYA 4HQ0A 4O5AA 1U0GA 4L8YA 1EVIA 2J31A 2ZDHA 4O5OA 5BSYA 4NMLA 5D5PA 2XGMA 3CPEA 5FV7A 4NICA 2Q3DA 3OZVA 3RS7A 1F17A 6AT1A 2DXIA 4H1VA 3T9EA 3Q39A 3X1JA 2OB1A 2P30A 4UHBA 2R25B 1NN5A 2ZTNA 3KJZA 2H0RA 4QJBA 3X0DA 2XTAA 6LDHA 2PX0A 3QVWA 1PLKA 3B1ZA 1P77A 4KSCA 3UJHA 3TJZA 4DVGA 2O2YA 1NUUA 1NVTA 2PRJA 2JK0A 2PTHA 3CRNA 2YDYA 1NVVR 2DQSA 4QA9A 5C4GB 4PINA 2O3JA 3DAGA 1FJHA 2XBUA 2Q9CA 1G6OA 3FVQA 1OYYA 4JBWA 2ZZKA 3MJDA 1ATZA 2NQ8A 4WW0A 4EB6A 3LECA 3ML1A 2YWFA 4O1MA 4UUMA 2QVZX 2PSHA 3CNBA 3RAGA 4ABTA 2VRWA 3BF7A 2O52A 2EL9A 5DBOA 1C1YA 1C3OA 2EAUA 4EQ6A 2QLTA 1XMIA 3KWMA 4MIEA 4N54A 1EWYA 2FVYA 1ZITA 2O19A 4HNRA 2J4DA 1G66A 4QQ8A 4O1IA 3F8WA 3QKRA 4NCJA 4H77A 3VXKA 3PRKE 4OEHA 5ESWA 1PVOA 2Z1DA 2C2HA 5C34B 3RU9A 3W06A 5JU6A 2Q21A 5CBPA 2J9ZB 5KDDA 1DEKA 2FRDC 1MX3A 1WAMA 3PLNA 1UP4A 4PW0A 3H5IA 4R1TA 5CYFA 3QFTA 1OI4A 2PYDA 3UGKA 4EMTA 3OPQA 3WGKA 2ANBA 5AMXA 1M90D 3LQEA 3PENA 5HG0A 4MW4A 2O0JA 1PGPA 4B84A 5MFPA 1MABB 3LHSA 3DE4X 1ILEA 3OUZA 3M6AA 1X7XB 5K0LA 4H15A 1AGPA 3JQGA 1ORHA 4KX3A 1VIVA 4PEVA 4LNHA 4LZPA 5FLYA 2BHRA 2VBTA 4PIPA 4DQ0A 3QE4A 1BQEA 4KH1A 4AN4A 3T5CA 4PG7A 5DWDA 2UZ1B 2QTBA 4AYXA 5B57C 2AZ4A 1G8PA 3JQPA 4EG7A 1GU1A 3NYQA 4XFKA 4KZKA 1RWBA 4DN6A 4TKOB 3TFQA 1FMLA 2J32A 1SUSA 2P4UA 4FDLA 1C2TA 2VHQA 1IB6A 3LXRA 4IJMA 5FQNA 2FZCA 4CLOA 4AJPA 3OCJA 1QRTA 5CM8B 3LPMA 3H86A 3VJKA 5EUBA 3FSGD 1SM4A 3QKWA 1HEIA 3T9FA 1R0YA 2CV0A 2A1IA 3R5SA 3ZXYA 4PYJA 1O5IA 2PS3A 5JT1A 3AJEA 1O7JA 5KSPA 3SZUA 2BRUA 3G8AA 2H0QA 1KRWA 4UTPA 1A98A 2R4QA 4G09A 3G2KA 5A1JA 1H6DA 2XUJA 4ZAXA 3REOA 4EATA 4JZKA 4ZCSA 3OURA 3JY6A 4I5FA 1GT91 3B3GA 5DK6A 1ZRSA 5DYGA 2Z5LA 2ZKLA 4MVJE 3U7QA 5F1PA 2P7HA 2G6TA 4L02A 3IUQA 3H0KA 3IHLA 4S1PA 4V1CB 4A6EA 3T1NA 3NJ4A 4QLOA 1SOUA 1KKMA 2QN8A 4HDSA 4W1QA 3DA8A 1UMCA 1D2EA 1T0IA 1XKXA 1U2TA 2HQSA 3AONB 3U2QA 1DWQA 1BXRB 1HFJA 4Z7NB 1XCMA 1OU0A 4OUKX 2AK3A 3FF1A 1WTAA 3GV0A 3VPBA 1R6TA 1KDTA 2VK8A 4Q9NA 3TRKA 3MC1A 1EXMA 1KQFA 5KJEA 2HMUA 1IULA 3GJTA 3PFFA 1SU7A 5CVTA 4ZVTA 1SD1A 1IOWA 3QFCA 7ADHA 1R64A 5F23A 4Q37A 4RPIA 4YUYA 2VR1A 2Q1SA 2VBIA 4BWVA 1W85A 3I9V1 5B1YA 3I5YA 3EZYA 2R8RA 1K75A 2I2AA 3FCXA 4XM1A 3BH6A 2Z2XA 3E9CA 4LE0A 1FRQA 3OTOB 4MQFA 3FHTA 4WV3A 4FU0A 2WTUA 3AY6A 3IURA 3ONVA 3UAYA 4YV2A 1R10A 4V1CI 4YRGA 4NBRA 4EITA 5IPFA 4TZTA 1CZLA 3FPPA 1KD1D 3THWA 4OPOA 3PKIA 3QEAZ 1A2BA 4F7WA 4UJ3A 3ZYCA 1XZJA 1JVBA 5HGJA 4UCWA 2CE7A 3KOZA 3SJZA 2L0XA 4BQSA 3ZDDA 1T2DA 1VL8A 4MS4B 3L92A 3L7KA 1CRPA 4HWGA 3WIEA 1E0JA 4IS2A 3A1CA 3OZDA 1YDWA 4HWRA 3DXXA 4DAOA 2J6BA 2A9KA 4IDPA 2FJUA 3KKZA 3W5SA 1C81A 3D2LA 1DCMA 4MINA 5AK0A 1JKMA 5FOQA 4XIGS 5LP6B 1V11B 3R3ZA 4TS9A 5CLGA 4RWZA 4B9EA 4RSMA 3ONFA 5JMPA 3S28A 3VJLA 5BYAA 2OCKA 5B55A 1H8HA 4G37A 3O3CA 1IXRC 4NU8X 3OPMA 2PWPA 1Q21A 1YKGA 3MGAA 4HYYA 4HE6A 3RRNA 2R6ZA 1NVEA 3UICA 1PQUA 3GSIA 4W5WA 2GD2A 2JAHA 1JEOA 2JAXA 3NEPX 3UHPA 3OE5A 2BKEA 4P1ZA 4B7ZA 5ALGA 1NLYA 1NVWQ 2IS4A 1EP3B 3U16A 3WNVA 1M73E 3GCWA 2IIVA 3DE6X 2VYQA 2TMDA 3GUZA 2I6SA 2AB0A 3F6SA 1QHHA 2PVCA 4HAUA 4LOHA 3RVJA 3BH0A 1T2EA 4NNOA 1P7YA 4F1KA 4EMBA 1JBEA 5ALTA 4PRYA 1MV8A 1S7GA 1EFVA 4XWGA 5I7HA 4QXQA 4EB0A 5IT9A 1GQ2A 3BJIC 2LDBA 3HC7A 2QV7A 3V1MA 1JSXA 4Q3EA 1ABEA 5K01A 3K15A 3KR9A 1LXCA 4B2IA 4UMEA 4MOWA 3MLEA 4MHOA 5F3DA 1RIIA 1UKEA 4EW6A 3BQMB 5BYBA 4PONA 2CF4A 2JGDA 1OBOA 1YHZA 4K6GA 4NFLA 1Z0KA 3TRIA 1DELA 2ZWAA 2VSYA 2VAXA 3EDRA 3KVYA 1U2DA 1Y3IA 3SLKA 1T9AA 1JEEA 4TYWA 1DEHA 2L18A 3UJ3X 3KXDA 1DIAA 1IOVA 3NT2A 3OCCA 1UEJA 3VRHA 4KE7A 4ZQHA 3W2HA 2HT1A 2HSDA 3A14A 2JJMA 2J5BA 3AVOA 3N2GB 3U4GA 3ZKWA 4RVOA 1ONBA 4ALKA 4NY1A 3KOXA 1EDBA 3RPEA 3OY2A 3MCAA 2PRSA 2GSDA 2V3VA 3G02A 4Q4LA 3EG9B 4LY0A 2F8MA 4EEZA 1ONOA 1M75A 1RXWA 1C8BA 1C9KA 3ZWKA 2F48A 1DEOA 3OZCA 4ZMSA 4KXQA 1PNTA 3OUTA 3AEYA 4RD4A 1P5RA 3BCUA 2PXCA 3NYRA 3OKFA 3OC0A 4L57A 5K0SA 2GJRA 3PT9A 2HK7A 1RZRD 1XLTC 2X3UA 2C3MA 4LFCB 2HU2A 4MA5A 4W5RA 5FLKA 1KY3A 1HZZA 3FWNA 4QJ3A 6REQB 1KMMA 3WLKX 5CH8A 1QZUA 4XB2A 2Q29A 2XOXA 1WUIS 1U0HC 2GD1O 2PMWB 4KQFA 1GFIA 2AJCA 4BGIA 1JU4A 3LF2A 3EGWA 5E6RB 2JFXA 3CGWA 3IKLA 1HG1A 3ZVRA 2DGDA 3R76A 3OX1A 1PR6A 4M1EA 4PFSA 2HREA 3OM9A 4WASA 5ICGA 1VHQA 1TM5E 1BG6A 2C07A 1M2HA 2Q8QA 2QRUA 3DBOB 3VZDA 4FR2A 3MTEA 1N0VC 4A3SA 4HGZA 2RBGA 3LVFO 1U3FA 3ZW7A 3EN0A 4D4GA 1YB5A 4E21A 4LJSA 3T3OA 2IYLD 4MJXA 1SD5A 4DCVA 1R27A 1Y34E 1MFPA 2YN0A 1T6XA 2F43A 4WZTA 1JI0A 2Y9PB 3B51X 1JP7A 4JBYA 3CWZA 2IH2A 1PQYA 1WD5A 4ZZ0A 1VLLA 2E5LB 1KEPA 1JF8A 4QUGA 3EF1A 1M2EA 6NULA 2XRYA 1BTOA 1M6YA 3TDMA 5CDSA 1XJ0A 4I5EA 3THOA 1D1SA 1NQOA 3DBRB 3LDAA 3CW8X 1GGJA 2C03A 1XYVA 3U4DA 4F9FA 4TQAA 4CQLA 1A2KC 4ER3A 4E5VA 1QCDA 2CNKA 2CD7A 1Z5NA 3FCUB 3KTAB 5CR9A 5EGNA 3DQQA 2X19A 4TQGA 4C6RA 5LOVB 5EJ7A 3ZDQA 3DHEA 2IPMA 4R5HA 1Q16A 1AXEA 5HKKA 3JPWA 2GJPA 3O8LA 1Q1BA 4IRUB 1E1CB 1FNNA 3TOZA 5BR1A 4X3CA 4X44A 1JLHA 1YZHA 2PV7A 1AQNA 2VZ0A 1DNPA 4ZO7A 2QY9A 2QROA 4JWKA 5ALZA 4KKUA 1XE3A 3UBTA 2VCHA 2ZPTX 5TVGA 2XZLA 3HVKA 3DDYA 3OD5A 4A6PA 2O8DA 3ZHCA 5AVVA 3WK6A 1OD6A 1U2RA 4DB4A 3QV1A 4IWXA 4EHFA 2ZYHA 3PTAA 8MHTA 4XD7A 3DV2A 1JBKA 1I9GA 1U7XA 1YV9A 2HM7A 5CT5A 4HVAA 3O1IC 2XW6A 1EXNA 4Q7JB 3KE9A 2RK6A 3PA8A 4X97A 1XJQA 1OLSA 2PUAA 1B4DA 1Z3IX 5AKYA 2P41A 2GXAA 3T94A 1DB3A 1NC3A 3LLSA 3TAUA 4B33A 1E2MA 2WJWA 3GLHE 4G01B 3CCUB 5FEUA 2PL3A 2RKBA 3EIUA 3GGPA 4PFKA 3KETA 3O91A 1TU4A 2JIQA 4C01A 1TUEA 4EI9A 2IW1A 4YRLA 3B12A 3G0GA 2BZ1A 4IR7A 4LSGA 4J2OA 4R6XA 3S7ZA 2IYFA 1IN5A 2AA3A 4LI3X 4TVBA 1M2VB 4GW3A 1Z33A 3SQDA 3R6TA 3TLEA 2PYZA 4JK3A 1Q44A 3A1DA 3GZ4A 5A6VA 2P5YA 1V5IA 1GRQA 3U4AA 1IK4A 4PR3A 3ZDCA 1SCAA 3RBAA 3R9KA 4K9DA 3HDHA 1I8DA 1EINA 1CYDA 1TIBA 4L0MA 4HWSA 3LGSA 1WORA 3TBHA 5DI3B 4RQBA 3ZCUA 5CFQA 2XXAA 3MJSA 4QECA 3JD4A 5IYNA 1FCJA 1ZGGA 2LWIA 2X14A 3EAGA 3ETLA 3NRCA 4F0JA 4R2HA 4YV0A 4XWOA 1QSGA 2HWUA 4CM1A 3N59A 1VL5A 1Z0FA 3TIFA 5E9JA 1RABA 4MWBA 4ZOQI 3K6RA 4WUTA 2JA2A 3QVGB 1W36C 2ZI7A 3PUIA 1XWFA 3IOEA 3ZZ1A 5I4IA 5JO9A 4KG7A 2ZDGA 3D7LA 4M8SA 3AOEA 4QTTB 1EIZA 1WD7A 4OFZA 1B8UA 3JYPA 3PP8A 4Z5XA 1JECA 1PJ7A 1CUXA 3IKJA 3PHBE 4A8JC 4Y98A 2JVKA 1Q86D 3A3BA 3T3HA 1SULA 3CEJA 3JTEA 2PLRA 3GGJA 4MA0A 3RTBA 4CM3A 1ZC4A 1THZA 3QYFA 4HQOA 5FEMA 2VHTA 4DDKA 3IEMA 4WOCA 1IU9A 5JFTA 1XZKA 5TC4A 4IVQA 1BEEA 4DNPA 4XJTA 5K0CA 4LMAA 1M8JA 2A2ZA 4TVOA 4CEIB 3RVBA 1FEZA 4FXUA 2AZDA 4QUBA 5GGYA 1X80B 4U39A 3REQA 1FFDA 1I3CA 1REQB 5KI6A 1IUNA 1EWVA 1VE6A 3ZHXA 2F3PA 1SKMA 3INNA 4PZCA 5FUXA 5LKAA 3C0KA 2R87A 3E7WA 3JWHA 4WZAE 3OCVA 5F21A 3L18A 3KSAC 4BNUA 2QKYA 2V0NA 3L84A 4A23A 3NZEA 3UKDA 2GPBA 5A7FA 3SVZA 4AYTA 1CRWG 1Z7YA 3ZIAA 4E1AA 4QOSA 2HV8A 4X7FA 1F0NA 2QZPA 5D51S 3RIHA 5IAKA 5IM5A 1UBEA 2BHLA 4XUGB 4Q7EA 3JZAA 4U6QA 5LA6A 5TT1A 5K03A 1WULS 4PBSA 3GYBA 5JAQA 1D7AA 2IYAA 1ZHHA 2UVPA 4XB6B 4KN9S 1T4BA 1ODFA 1YR9A 2R2GA 2ID4A 1CP3A 3HR8A 1W9HA 1R0ZA 1RC0A 1Z0DA 4YRDA 3PC6A 4JI5B 3AKZA 1QHEA 2ILVA 2WSSD 4M6WB 1QV7A 1VXRA 1NQVA 2X0FA 1BH2A 3GEBA 1OH6A 2CFIA 3ORYA 3DCIA 3VUEA 3M5DA 5IJ9A 1ZIOA 4AFNA 3WB9A 2WICA 3DE5X 3QVLA 3K6SB 1NRWA 4ROSA 2Y0PA 4CM5A 2CXHA 4IJ6A 4WFJA 4QE3A 2IEDA 4YCBA 1GU7A 1BEUB 2JI7A 3PJEA 2FPOA 3BMXA 5TLSA 2IXEA 2QHXA 2VJAA 2PL5A 1RHJA 1TNDA 5C5CA 2AF4C 1UOPA 1Z56C 1B6RA 1NI4B 1O9BA 4WN3A 1MXHA 4BNHA 1U28C 2COEA 1M2WA 3GN2A 3U62A 4X3OA 4RV4A 5AVYA 1FOEB 3LO8A 4FWIB 4FYMA 1A4XA 1I6MA 2HK9A 4JA0A 2EP8A 3DLTA 1ZZEA 3PFKA 1K7SN 5BPHA 2AG8A 2OTCA 1NUTA 3O94A 5BNFA 4F9TA 1HTBA 1LA2A 1N9GA 1UKBA 5FBQB 5KHAA 2ZJYA 4HDKB 4QOIA 1R5BA 3B3JA 5DBIA 1Q77A 1GYPA 1M5UA 3BB4A 1WB5A 4FDAA 4NS1A 2RAVA 1Y0RA 3B6EA 3SVLA 2QGZA 2AD5A 1X1TA 1JZTA 1L5YA 1U1CA 3D4PA 3ISJA 4JELA 4XR9A 2Y6UA 2ZT6A 4KK3A 1KE2A 1XEFA 4B7AA 3FOFC 2CXXA 1X9HA 2PCJA 2Y1LA 4NBNA 3ZU4A 5LNK1 1ULSA 1NW6A 2ERYA 1KNXA 3A6DA 3EGXA 4KXWA 4OSEA 4BEVA 3CVXA 1PJ8A 4LHEA 2ECOA 5FFNA 3B6JA 5EWJB 3LP6A 1KQPA 2W4IA 5A88A 1ZKMA 3OIWA 1DAPA 4EJFA 2IE0A 4NONA 5LDHA 3C4JA 3CH7A 1IMOA 2OZEA 3HHPA 3HJCA 3I0NA 3IQDB 2R65A 3PQ2A 4G4JA 4R4JA 4BEJA 4J1TA 4KKTA 4OHOA 2X8JA 4Z9BA 4YRJA 5B2FA 2B7LA 3DFKA 1LNSA 1NSTA 3AH8A 5DGTA 1GL9B 5JQGA 2IU4A 5F3WB 4HLCA 4Y1EA 3HFGA 1DIOB 1G8HA 3O26A 1Z18A 4F1JA 3A4YA 4X65B 5E8RA 3MQ4A 1LK5A 4Q9LA 1XQXA 1B2LA 3ZGLA 4BNKA 1F4PA 1Z8DA 3U13A 2G0TA 3GLGA 3M9XA 1JDBC 1X6VA 3SYMA 2F8SA 1B14A 2CNWD 3O4FA 3VYVA 2PMCA 3AUYA 5K3AA 2EOAA 5FI3A 1TZBA 1WUKS 4L78A 3VAYA 2PXXA 4E2YA 2WD9A 4BN0A 4GMGA 3P7MA 4WK2B 3WOHA 2GBCA 1IM2A 3AR5A 1JHAA 4L2IB 5K4GA 2CVQA 2FLKA 1VL0A 2I54A 4HB2A 4P2BA 4D9IA 5G0TA 2IOYA 2JZCA 2VHUA 5A4FS 2QZSA 4EEKA 1E9DA 4H7DA 1A9XA 3GUCA 5B36A 2YFQA 1JU9A 4L75A 4X1KB 2Q62A 4B9AA 3ZZUA 1FMCA 4Y2QA 1A2QA 1E66A 2XUFA 2AUTA 1CP2A 1HDEA 1R00A 5FADA 2JVJA 3V6LA 4Z4ZA 2B83A 2BKLA 3DTVA 1ZUHA 2PHZA 5FUYA 3VH3A 4AMVA 3F2IA 1QBGA 1M83A 1PFYA 1JQLB 2XYRA 3FPLA 3KPWA 5B3JA 4CEJB 3CRW1 3WVNA 1Z12A 3WLQA 2HHLA 2C1EA 4FZ3A 1C1HA 2JHFA 3CONA 4BVAA 3WBKA 2DC1A 4BATA 4FLMA 3UQYS 5HJ2A 1ZK1A 2CKMA 2ZZGA 3TEMA 4KP7A 1DARA 1YK0A 1WNFA 2B8WA 2L17A 3AI1A 3R7LA 3EFEA 1BVYF 5H70A 3KZMA 3VU3A 4G1BA 4LTNA 4F6CA 4ZFNA 3ASVA 1M1NB 3BQNB 2GOYA 1NLFA 1P4GA 3C3EA 1G8GA 3DB2A 1MIHA 3L8FA 3ANSA 3GRZA 2JBAB 3MWDB 5E4FA 5KC9A 1K6MA 2GBIA 5T7BA 4HP8A 1YI0A 1LQTA 4DW8A 1PR2A 1V95A 2ST1A 1TQHA 4N7JA 2OE2A 1Y63A 2J45A 3DL0A 4HBZA 4IUDS 3MMXA 3BCFA 5AW8A 5C8VA 3PDHA 4IGFA 2D13A 1LGYA 1E3JA 2IHZA 4HFNA 1NBMD 1JDTA 3W5UA 1HK7A 1YZYA 2GLXA 5A04A 3ITNA 5GJWC 2BEJA 1EFDN 1W581 1E1MA 4KQIA 3L6RA 3F7OA 4KWHA 5EIFA 4G25A 3I5MA 1R3UA 1SHLA 1Y9DA 2MYUA 1GDTA 1TUGA 4OP1A 2ZPAA 4IMRA 5G1OA 1M8PA 4EHIA 4XPIA 2JGNA 4RE6A 4UHKA 1F0YA 4ZV7A 4N5LA 3T7IA 3T1QA 5UKDA 1H0HA 4URXR 1N7IA 5CAEA 4KLCA 1PLJA 1RKUA 3JQDA 3G2PA 1F6BA 2QWXA 3OKPA 2V3CC 3ESAA 4P25A 3HKCA 1SKBA 3CURA 2UXCB 3SF0A 4LF6B 2GZHA 3T54A 3GJRA 5BVGA 2UYGA 4M0UA 4PRKA 1FDWA 4KVZA 1Y5RA 4K3UA 4G0XA 2W00A 4AJKA 3D0RA 5HW0A 1QQTA 3B8EA 4RHTA 5EMLA 4FONA 4K03A 3IXMA 1DFGA 4FI3F 2R60A 4RDIA 2XB2A 2HA0A 1PJSA 2BTEA 221PA 1FPQA 1WW8A 4US2R 2F1RA 5LJLA 4NCIA 4DNOA 1G2IA 1SRRA 5IXYA 4GIBA 5IYZA 1OROA 2ZL6A 1YL7A 4MW2A 4O29A 4QYIA 1T0BA 4E51A 3C24A 4IVPA 2Y68A 9ATCA 3EVAA 2CNOA 4Q4CA 1ZM9A 3W8EA 4NPAA 2EFGA 3BFXA 4U0KA 1SMKA 5AOBA 1JMVA 3UB3A 1TD9A 3VO8A 2W37A 3OD1A 4ZTBA 2OFFA 4C0HA 2YHUA 3BGDA 2MR5A 1UKVY 3D0KA 3D5QA 3LKBA 1IE3A 4IY1A 4G1VA 4C3UA 1XQ1A 3SOZA 1QGUB 4GPTA 5G2OA 1Y8ZA 2QT9A 2ZCVA 1HA3A 5A4DA 1Q7CA 1RXSA 4US1R 4S35A 1GPMA 5K45A 1H94A 2VBGA 4GE0A 4X5OA 2ZIVB 4F60A 1PCXA 2FUCA 5KWSA 1XRSB 1JKJA 2RGDA 4H1WA 1D4FA 4GC5A 4ABYA 3B1JA 1BN7A 3T7RA 2AIRA 1KZ9A 1FB5A 1JA1A 2DEUA 1IBRA 4MCJA 4BAZA 3II6X 4FD2A 1I3MA 4YRIA 2ZITA 5CRIA 4LDNA 4A91A 5CHEA 2HJRA 4P81A 4NH0A 5H3LA 2FPSA 3JVVA 4IV8A 2IYSA 1IBCA 3KEMA 4AL4A 3DBIA 1Y8QB 4KQKA 1NULA 1WEHA 1CRZA 4ZAVA 3OIGA 4BFYA 4K1LA 5DS0A 3G9ZA 4KXMA 4RD0A 3K0AB 2G80A 2OBMA 2OXIA 1EPUA 2YIDA 4IWNA 5JADA 1XUOA 3NOVA 4Y6PA 2VNHA 2J4FA 4P34A 3TLJA 2AN9A 4P3IA 4MR9B 4W5TA 1WDTA 1E5VA 2BDUA 3O9ZA 3Q6MA 1TTTA 1SC6A 4QJ4A 2Q07A 1RHUA 3I1YA 3QVUA 3L4EA 4G8JA 1T3LA 4G26A 2GETA 4JWTA 5DNWA 2QJWA 3O2SB 3IAXA 5JE8A 4JI3B 2G1AA 2BFMA 4RZHA 4DLNA 1DDGA 5L53A 1XELA 5CVEA 4IDOA 5FKJA 5I48A 3OE7D 2G5TA 3OZIA 3QLUA 3HZRA 3VKWA 4HV4A 4YRAA 2JRLA 4H3VA 2V6JA 4WXEA 2JHGA 1K7XB 2DIEA 4KUEA 5DN6D 2NU6B 2KE5A 3ONNA 3RVNA 4G9EA 1BGVA 1P31A 4J3JA 1QQ6A 3CN9A 1PKVA 4PNEA 3OWXA 3CR8A 3QZUA 3HSKA 2FEPA 1KI7A 4URYR 3RFFA 1RWKA 3G49A 4LHWA 3M6FA 3NVKI 1W29A 2C9YA 2VT7A 4NDAA 1KU0A 4QVGA 4XWAA 2HPHA 2WJ3A 5CYPA 5LA6F 3SF8A 4S0XA 3PNMA 1E79D 3BRSA 2Q3HA 4ZYUA 3KLOA 2B9EA 4K2AA 3SZ3A 3RWBA 2JN9A 2BFDA 1GCAA 4YRTA 1MVLA 3LUJA 1WXWA 4HGOA 3UC5A 3OOJA 3U3MA 2WPDA 3HUDA 1RYHA 2YOGA 3RU7A 3TR0A 4DIOA 5CB4B 4L8VA 4LBVA 3PQDA 5KX5A 3VTKA 5IT5A 2BGWA 5CP8A 5MHTA 2GCPA 3BWXA 2EZ8A 2H4FA 2NO0A 1YL6A 4O4JA 3VPXA 8ADHA 1G6Q1 3EWIA 3MOGA 2PZMA 3ZHVA 1TO2E 1UADA 2RK3A 2BSAA 3LT0A 2CUKA 3PDIB 4D74A 2Y2UA 4A27A 2C0CA 2MSEB 5I01A 1A9SA 3SXUA 1G6HA 1C29B 4Q4AA 4YROA 1VIAA 1IBKB 1SUAA 5K0ZA 1LPPA 3S0JA 3QHQA 1XZMA 1PWYE 2QT1A 1T8TA 3UF0A 3VNVA 1N2HA 3WKDA 4EKDA 3F46A 3N74A 2QIPA 2VP2A 1E9RA 2WSMA 1EX6A 3R0QA 2VSFA 4LNUB 4MS1A 4JI0B 2GHQA 2O8FA 1O57A 4UM5A 4BQNA 4EUEA 2R6HA 1XDUA 1M2JA 1U5BA 1VQ1A 1AG9A 1XDGA 3L4SO 4XRRA 4YJ3A 5JASA 1ZAYA 2AWOA 3DV0A 1DRUA 2C2BA 3QNWA 2XMGA 4G1CA 1TJYA 1XZ8A 1GDHA 1E0DA 2W2OA 3LQKA 3KXKA 4KQ9A 4LXTA 4OP3A 3RVRA 4QLBA 1YRAA 4RVCA 1ELOA 1QRUA 2A5JA 4BLTA 2JZNA 4L9SA 2GZ1A 3JD3A 3H16A 1XRJA 3QLVC 6YASA 4CIBA 5E9WA 1CJTC 2QNIA 3JQ9A 4MRAA 4PE5B 1RI4A 3RK0A 1BVUA 1LDNA 2JJYA 2AC2A 1AK1A 3C3CA 3P20A 5HMLA 2ZJ1A 1S2OA 3ECSA 2IL1A 3KCNA 4OHRA 2EHJA 4QQRA 4KIGA 4DABA 2CEKA 4U6SA 3SNHA 4C7OA 4B76A 1HX7A 3PUYA 4C89A 1K6EA 3VPCA 3ZPXA 2B30A 5JSFA 3HXMA 3DZGA 4L72A 4C0KA 1JALA 3MK31 3ESCA 2VPTA 1QRRA 2VRCA 4WMLA 2D4HA 1PHRA 5FR1A 3SZRA 5MGBA 2V6MA 4HAIA 4BP3A 1MN6A 1KZHA 4KQ1A 3W2IA 1WSRA 3CESA 1MAAA 5E1DA 3OHPA 1GADO 3UT5A 4B4WA 2VXYA 4CW7A 3R6LA 5JFOA 1S2IA 1XP8A 4FW8A 4AY5A 4DCJA 4P36A 2ZTUA 1BVRA 1UWLA 1NMEA 3R4CA 4HEHA 1YIJB 2A84A 5ALOA 2VPPA 3V4VB 4EB3A 1IATA 4N3GA 2AQHA 2O07A 3ILVA 4GQIA 4UUBA 5EE1A 1FLNA 4O4HA 3LLVA 2AG5A 1TUBB 2VJIA 5FYQA 4FCWA 5K0JA 4FEAA 3HV0A 4M0DA 4DZZA 3LK6A 5K8IA 2KBFA 4GYWA 1GPLA 3EH2A 1GUYA 5KKAA 5CCDA 1EK1A 1QMGA 1UBRS 3JD2A 4G85A 4LXQA 1TM7E 4NFHA 1N2OA 4P5PA 3HYSA 2C5GA 2GZRA 2FA9A 4MRPA 5WRFA 3TBKA 1YVPA 3TDKA 4NCHA 3JX9A 1C4KA 1G5FA 3NTRA 1KETA 1RM3A 3C1TA 2O2EA 5AWFC 5IBQA 4QEZA 2FZGA 4KBYA 3QLJA 4PGAA 1SCIA 5B5SA 1QM5A 2J9GA 3CC8A 1B0PA 1K2VN 2OAEA 4EYQA 3JQAA 3WSTA 1YB4A 4PQGA 1IIRA 4XQGA 4JJ4A 5GVRA 1VLMA 1FDVA 4B40A 5JIBA 1JYSA 2F8LA 2HA3A 2A7XA 1P2DA 2J3KA 2A1TS 2O6HA 4OL0A 1RIFA 4KVFA 3RNOA 4DJTA 1KK3A 1P2UA 2GDZA 3KAJA 2AW3A 2C59A 2PGOA 1C3JA 1TKRA 3COWA 2IK8A 1R5NA 4QJ5A 4UW9A 3R3HA 3HU3A 4CMIA 3FYDA 2V7VA 3VI4B 5JJKA 3MCZA 2ZYDA 3PNYA 5EWMB 1WQ1R 1NJ6A 2IKSA 3H9CA 3LRTA 4ZJPA 8GPBA 1PGNA 2QRQA 1NVAA 4FB5A 1TA9A 3B36A 4GR9A 1BIFA 5LD2B 2CXRA 1ECBA 1H2FA 1FRZA 5FDFA 2OBXA 3EPHA 5KU1A 2JCBA 3AUFA 2IDMA 5TPWB 3K94A 1CNMA 1SG0A 1VQMB 1O9GA 1KE1A 5BWNA 2PS1A 2W6OA 3MRTA 2Q3JA 2XQKA 4QXPA 1IHOA 3T41A 4DGQA 1ZD8A 4FYVA 3ZNNA 4Q34A 3LX6A 1EVEA 3KYCB 4C03A 2XGGA 1VQ8B 5KSYA 1NJSA 5BSTA 4TMVA 4FWBA 3TLZA 1XTUA 3JXEA 5K4HA 4X05A 4I1PA 4LYAA 5JO0A 5FOWA 3MTDA 1H2BA 3ZYZA 4YRMA 4X91A 4LJ5A 5A9RA 5CLHA 2QVYX 5ALPA 2IYXA 2LPMA 2ZSHA 3RC1A 5B30A 1M7GA 2H52A 4GS5A 3D2CA 2AZTA 4LY3A 3CLSC 3WZLA 3EOBI 2JCVA 1M8GA 1E3TA 2OK8A 1XTIA 4Y9TA 2EL7A 2K87A 4HFRA 1N07A 1KHHA 2C31A 2WA1A 3NBMA 3HYTA 3CKKA 4FGZA 4W9NA 1MFZA 2H06A 3PI7A 3NGLA 2EW2A 4PY2A 3BWMA 3BMQA 3TLGA 4DDUA 4J0JA 2VDNB 3GEDA 1XNGA 2YNMD 4OMCA 1BFKA 1YZUA 4L4XA 4FBGA 3ZHRA 4KQXA 2RHHA 4RJTA 4HZIA 5EXTA 3KJQA 2IHBA 2J8ZA 1MTZA 3NS7A 1MO3A 3VPGA 1ZUNA 4KPFC 4F38A 4LRSB 5ENVA 2LNDA 3Q40A 3QPDA 5IVPA 2BHSA 1WVGA 2OXCA 4OMFG 1OCEA 1ZUWA 2NZXA 1Z2EA 2PBFA 2RHLA 2QNBA 4ILKA 3DZ8A 4JLNA 4UVIA 3U40A 5J2TA 5IYZF 3FLEA 2HZ7A 2NSLA 3ZCXA 1X0XA 2OXFA 4FCTA 1ORWA 4QSHA 3RC3A 1GNPA 1EVJA 1CY7A 4CU2A 5E2IA 2QDKA 2IHUA 1H8ED 1LSUA 2DZDA 2IUTA 4KODA 5YASA 3ZGOA 3NCHA 4LYJA 3ZXIA 1ZISA 3PCXA 3ZNPA 4JU8A 4XJXA 2NUTB 2CFRA 3DLIA 3JV7A 4D9HA 4DJAA 4ESEA 2D6FA 3VPFA 2AT1A 1HLFA 5TSDA 3V97A 3B6KA 1X7DA 2BJHA 1PVVA 3LVBA 2JATA 4FHZA 4MPTA 2ADMA 1BD4A 4FLEA 4OQQA 5DF1A 1DGQA 4TLAA 1UANA 3MMPA 2IPLA 3QYAA 4MW1A 1BU5A 4AMUA 4DV3B 2WG2A 4LYFA 2WU8A 1DU4A 2PX2A 2X6QA 1TKAA 2ATIA 3BKWA 3C1AA 1YJNB 3IOBA 4JNCA 4L16A 3DPSA 2NWQA 3SR3A 3MAAC 4LJRA 1EUQA 3S1AB 1JFVA 3MJTA 2IOQA 5ALIA 3AY7A 5IH7A 4Z9YA 2BYTA 2X4IA 3I34X 4EABA 5KOHB 3X44A 3W8FA 2YZ7A 2QTCA 4U2DA 3ENNA 4LJ8A 4MUIA 4QKQA 2W42A 5L4LA 3D0OA 4HC4A 4TMXA 1XRMA 3IE2A 3OQ1A 4GE3A 3GHHA 4CLRB 2P2LA 1Y0YA 3O84A 5KU7A 5KB3A 3H7AA 2I4NA 1U2GA 5EJFA 1N57A 3DEYX 1CUFA 2EGHA 1NNLA 1M0WA 4OOFA 5FNVB 3NM6B 1U2QA 1RAGA 1PKXA 3CSUA 3DAHA 2EJVA 4BRUA 1OKKD 4TQ9A 1SY7A 3TZHA 4IEIA 4C29A 1E2GA 1HLPA 1UR5A 5IG2A 1F38A 3O1LA 3ADPA 4IHJA 4COKA 1OXVA 1CZHA 4BJ5A 4EFLA 4CR6A 1ORIA 4H59A 1QX3A 2VP0A 2NO9A 3TECE 3FAKA 4K28A 4OIFA 5BWOA 3EG5A 1EHCA 2WZPP 3DULA 1ECCA 1P80A 3FKQA 3U3KA 3ZX5A 4F5YA 3HXLA 2YBEA 3G1UA 4P7GA 4ZAZA 3V8BA 1NAHA 2OHHA 3JQCA 3GFFA 2O2ZA 1A50B 1OZFA 1SHZA 3W6ZA 4EIWA 2QEQA 4Z4QA 1MRSA 2OBBA 2J85A 2OV8A 2P3SA 1VZ3A 2CB9A 2P4SA 1EBBA 3RK4A 1F06A 4C43A 2HQ1A 4X1YB 3F49S 5A0VA 3EYAA 2OCAA 3FWPA 1XA3A 2ASVA 2WF7A 4S1VA 2NO1A 1KOFA 2OVFA 2BGTA 1PV2A 3C98A 4XTCS 1CY0A 4XASA 1SKYE 3S2FA 4Q01A 4UFPA 1QB8A 1JFFB 4CCWA 1PJ6A 4C4YA 4YXFA 3TXYA 5ES4B 2RJNA 3PITA 2BFOA 2LV8A 4DJJA 2Q6IA 1I32A 3OZBA 4RPLA 1JDPA 2VBCA 2JH9A 3HN6A 3EC7A 4QGGA 4KQWA 3H4MA 4ZHQA 1ULAA 2YC4C 3LHDA 2H4WA 2D2EA 1PSWA 4J0FA 5K3CA 5K3FB 3R8CA 3G17A 1HMPA 3WGOA 5L51A 1S72B 1E77A 2C8KA 2J33A 2NU9A 4BFXA 3IUEA 3MTAA 4GWLA 2V7BA 4U6NA 4RADA 4BFCA 5J3OA 1CUCA 1U8YA 5H59A 1EVYA 1G3IA 4OKNA 4MYTA 3OTGA 3O4HA 4QFBA 2GX6A 2KWIA 2WUGA 3INGA 3RLFA 3QOFA 1BEZA 3WQQA 4CKBB 1SXHA 1J39A 2SCUA 4KO4S 4AF7A 1RPJA 1L5NA 4HY3A 2E48A 1QOZA 3KM0A 4P12A 4CCYA 1Q82D 3DEKA 4C04A 3D3WA 1TE2A 2ZXUA 3UN1A 4D80A 3CPWB 3I04A 3JRWA 5HOEA 2A1UB 3RT7A 3GVJA 2P9EA 1VHEA 3I3OA 4RPJA 5FD8A 5HDQA 4XYEA 5C7IO 4RD2A 4DRXA 4R01A 3L6CA 1T9KA 3V34A 1Y4SA 1N2CA 1IHUA 3K1AA 4PS1A 4AVZA 1X3LA 1X8KA 3QUTA 3GLGE 5MFZA 1XAGA 1L3CA 1N7GA 2Q1WA 2QVBA 1F48A 3JSXA 2GCGA 5I51A 5GADl 4MA4A 4HRYA 4KIWA 4Z54A 1DOZA 1Q50A 1HLGA 1YK1A 3TRHA 5KYKA 4OHWA 1AKEA 1XL0A 5F9HA 1NKTA 4JI8B 1LLQA 3CLHA 4HWOA 4IDDA 2PL1A 2ZJFA 1U0OC 3I2GA 1LTKA 2DY1A 1CUDA 1UPFA 2FY8A 4KR3A 3WL6A 5KQLA 4LF5B 4E4YA 1EUDA 4ENQA 3N87A 1NG9A 3TB6A 5JSZB 1EFTA 2X4LA 1K6IA 4Q24A 4LUCA 4X1IA 3W05A 1OPRA 3OFND 4OGGA 2JLSA 2Z56A 4H27A 2PBZA 5I7VA 1S8OA 4M4SA 1DC6A 3FJYA 2II6A 2X1LA 1U2ZA 4OSOA 2KBEA 4NFSA 3I56B 1B74A 1P1IA 3B1YA 1K8AD 3ABRB 3K20A 1N25A 3PQ7A 4K6FA 2B99A 3HBAA 3RW9A 4ZIRA 4TWJA 3C6QA 1Z17A 2HNBA 4XX0A 3DP7A 2JARA 4KYIB 3VR4D 1DJMA 1KPHA 3K3PA 5LP1A 3EEFA 3UGQA 3KD3A 2A1TR 4OK5A 2AZMA 4HDMA 4MK4A 3PRJA 2ECFA 3OQIA 3GNQA 3SE0A 2C5HA 1Z45A 5KNBD 1O8CA 2YHIB 2V4MA 3ORHA 2VYNA 5GONA 4JLWA 2Z1MA 2EVWX 4U2FA 3WGJA 2B8NA 3HR4A 3H1FA 3VPAA 1SIBE 2JASA 1CIPA 1JPJA 1Y9ZA 2P5UA 2WT4A 3ZUGA 8OHMA 3EOAI 2OYNA 2WC1A 4O2BB 5DDIP 3QU4A 2J07A 1A8QA 2FOLA 4CLHA 3HWSA 1D1TA 2ZZEA 1FMJA 1U0JA 4UPEA 2JIMA 4O2RA 1DDIA 2Z09A 3KJEA 1AZWA 2YJ4A 1L5VA 3U7RA 2C2GA 1E0SA 2GFIA 3H11B 4BFTA 1W4BA 3U80A 4CHTA 4F4HA 2AG1A 1E5XA 1MENA 2F1IA 1OC2A 3EMKA 2OCDA 4ZWNA 2AOTB 2RAUA 1HXHA 3ZJ5A 3ECAA 4PRLA 3CZAA 2ZQZA 1AC5A 5EXPA 1JB1A 4XMYA 2CXOA 3N7UA 1HYHA 5KJ1A 4DMGA 2HMYB 1X74A 3O4IA 3BJZA 2IF2A 1XCOA 2WMOB 3OJWA 1QR2A 1ZA1A 3EBLA 2W2VA 2ECKA 2WIJA 2QI9F 3ER6A 4JH0A 4OHFA 1RI3A 3FHOA 3MCUA 2LZ0A 3TSYA 2H0AA 1BCSB 1B8NA 3GHYA 4YCNA 3ANYB 1FFWA 3DVAA 4V0NA 1SUWA 3FYUC 1FFYA 1Z75A 3HZHA 2DKFA 3NIBA 1D0VA 5AUPB 1I7SB 3TCXB 3WNQA 3GPDG 3U5ZB 1NPYA 1U9JA 2ZYSA 4QNMA 5GM2A 4GGOA 3KQUA 3FKSD 2WTEA 3VMFA 3MQFA 3AY0A 3O38A 2ZB8A 1V48A 3O9VA 4E94A 3RYTC 3LBNA 4P4LA 4YUZA 5K3SA 2CY0A 3RYIA 4LE2A 2RIPA 4PICA 3KUCA 1EWTA 3B52X 4EHKA 1QO0D 2FW6A 4AY6A 1RC8A 3WLTA 4C4TA 1X1BA 2N42A 3V8MA 4B71A 1NUSA 3DMYA 2VBSA 1YULA 4I55B 4BNMA 5HJEA 3H04A 4QWWA 1KJ9A 3KV3O 1F5SA 1SKQA 1PR1A 2BC9A 1ODSA 3A9VA 3Q12A 4Q3DA 5BUQA 1UC9A 4DR2B 4TUYA 1A4UA 1RAAA 1VXOA 2RGUA 3RC2A 5EMJA 2WILA 3N8DA 1XCPA 4JJKA 4NKRA 4R8RA 4PYLA 4Q9IA 2ZJAA 1U31A 3FSJX 4ZEMA 5B37A 2GZ3A 3IIKA 3O8OA 4JASB 3MILA 3OE1A 1JUDA 3JATB 3MG9A 3ASSA 4UPDA 3JQBC 2GAFA 3ZD9A 3F9CA 2FXIA 3R3UA 4ZOLF 2WUDA 1Z7WA 3OQJA 4PG8A 5AKLA 4OQNA 4RXTA 2EJUA 3SPXA 2OV3A 4M89A 2NG1A 4RF3A 3AEKB 4RPGA 5GM1A 1X39A 1B1CA 5SZJA 4IMPA 4LRXA 3MBIA 1DAHA 2NVUA 2PMBA 1AQYA 1BOOA 1UBKS 2GF9A 3JWEA 1FNBA 4ND5A 4H6PA 3TZEA 4CKCB 4Z4FA 3I23A 1EG2A 4PZAA 3OP4A 2H11A 2WYHA 4YP0A 2ZTHA 2HIAA 3BB3A 3EISA 4WXMA 2PWBA 3D5TA 4NP6A 4GOMD 1L4HA 3EMVA 4TRRA 3TI7A 1W36D 3M2PA 2QBYB 3PX2A 3U26A 2VSQA 4RZQA 3LX4A 4YRSA 1FMTA 2FDRA 3WC4A 5CB8A 3GEGA 3KB2A 2WAMA 3DNPA 1BYIA 3TQSA 1TJ4A 2WFAA 1DCKA 4G0NA 4H3HB 5LYJF 1J8YF 1I2AA 4DMCA 5K6AC 3FUCA 2DTEA 1UT5A 5JAHA 2EWMA 2W6PA 5BRAA 3JW8A 3Q8WA 2P2ZA 2OXEA 1T2FA 3BL5A 3NTUA 4LJLA 4QNNA 4Q9HA 3T4PA 5ELXA 2Q4OA 2IYTA 4Z7QB 5DMHA 1Z2CA 3T99A 4MKIA 3ONUA 1RPAA 3MF4A 2JKZA 4NBTA 4RLZA 4A1OA 1K06A 1P4AA 3F5FA 5AK5A 1EFUA 1BLIA 1QFXA 1HMYA 2IDKA 2VRBA 1CHNA 3NDRA 3TKYA 4D9NA 2E7ZA 2W8BB 1BFDA 4DLVA 3AB3A 4IHJF 3U9SA 1G4UR 4E6PA 5I5EA 2Z30A 3S3TA 1AKRA 4TSRA 3X1XA 3TTXA 3OZGA 5TQ0B 3TTYA 3VV2A 4X7CA 4GZLA 3ZDFA 1KDOA 5KHLB 3L05A 4XFJA 3BH4A 3E9EA 1EFPB 2VUTA 2OZLA 5ALFA 5GJVC 5ISMA 3ZGXA 1KJWA 2CC2A 5AK4A 4NK5A 4OATA 3BSWA 2OMEA 2P8JA 3HB4X 3N2ZB 4P53A 1COZA 4K7JA 2F3UA 1T6BY 3KE8A 1XTQA 4JLMA 3ND5A 1B26A 1N0WA 1L5OA 1EGVB 1F8FA 1KEZA 1GZHB 3TSAA 1W93A 5CYGA 5I4CA 1JPVA 1EFRD 1GG5A 1F4VA 1I2ZA 1T2AA 2IOHA 2FR8A 3ESRA 3IR5A 4HVTA 4RQTA 3B7WA 2Y9MB 2QYHA 3EZFA 3A1FA 3L7IA 1EX1A 4P0QB 1UZAA 4IUBS 4D9JA 3FFAA 4GLLA 4MARA 3FUXA 4KAFA