1OGUB

Structure of human thr160-phospho cdk2/cyclin a complexed with a 2-arylamino-4-cyclohexylmethyl-5-nitroso-6-aminopyrimidine inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
255
structure length
253
Chain Sequence
YHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Structure-Based Design of 2-Arylamino-4-Cyclohexyl Methyl-5-Nitroso-6-Aminopyrimidine Inhibitors of Cyclin-Dependent Kinases 1 and 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 253
sequence length 255
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1oguB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1oguB02
1W98B 5EFQB 3G33B 1ZP2A 3H4CA 5HBJB 4CFVB 4EOKB 1H1QB 2WHBB 3TNIB 1PKDB 4I3ZB 4BCQB 2CJMB 2IW9B 5CYIB 5HVYB 3BHUB 2PMIB 1P5EB 2BKZB 2PK2A 2WMBB 5HQ0B 2EUFA 3BHTB 3EJ1B 4BCKB 2F2CA 4UN0A 1BU2A 5HBHB 3TNHB 1VOLA 3O0GD 2QDJA 2W9FA 4CFXB 4CFNB 3MY1B 4CFMB 4EORB 1URCB 1GUXA 3TN8B 1OL2B 4EOOB 1H24B 5ACBA 3DDPB 1H26B 2IVXA 2WIPB 2V22B 4ELJA 4CXAB 1GY3B 4NSTB 1QMZB 2I40B 4BCMB 4EOIB 4F7SB 2C5OB 2IW6B 3QHWB 4OGRB 1E9HB 2W96A 5LQFB 4CRLB 3DOGB 4OR5B 1H1PB 4G6LB 4CFUB 5IDPB 1JSUB 1N4MA 2C5XB 5FGKB 3TNWB 4F6WB 3QHRB 4II5B 2C6TB 4IMYB 5ICPB 4F70B 5L2WB 2X1NB 4EOJB 2C5VB 1JOWA 5LMKB 2UUEB 2UZBB 1UNHD 4Y72B 1H1SB 3EIDB 1UNGD 1TFBA 2UZLB 4BCQD 1D3UB 1H27B 4EOSB 4TTHA 4BCGB 4EOLB 1C9BA 1OIUB 4YC3B 1H25B 4YOSA 2B9RA 1OGUB 4F7JB 1GH6B 2WEVB 4BCNB 5I5ZB 1AISB 1OKWB 1FVVB 4EOQB 2PK9B 2WPAB 4BCOB 4BCJB 3EOCB 2PHGA 2W2HA 1OIYB 3LQ5B 4EONB 5BNJB 4BCHB 5HNBB 3MY5B 5CEIB 2BPMB 4ROCA 1VYWB 2UZDB 3F5XB 3MIAB 4BCIB 2R7GA 4EC9B 4FX3B 2G9XB 4BCMD 3MI9B 1F5QB 2C5NB 1OKVB 4EC8B 4EOPB 2WXVB 4KRDB 4CFUD 3BLRB 5HBEB 3DDQB 2JGZB 1G3NC 4F7NB 4CFWB 4F7LB 3BHVB 1H4LD 4BCFB 1O9KB 1UNLD 4BCPB 1JSTB 2CCIB 2WIHB 2WMAB 1XO2A 3BLQB 1GUXB 1KXUA 4ELLA 1FINB 2CCHB 4F6UB 2IW8B 4ROEA 1JKWA 3K7AM 4KRCB 4YOZA 2W9ZA 3M03A 1O9KA 1AD6A 2I53A 3BLHB 4YOOA 1H28B 1OL1B 1VINA 2UZEB 5IDNB 4F6SB 2C4GB 3POMA 4RODA 4EOMB 1H1RB 3RGFB 5IF1B 2W99A 2WFYB 1OI9B 4BCND
chains in the Genus database with same CATH superfamily
1ZP2A 5HBJB 4CFVB 1PKDB 4I3ZB 2CZ1B 3BHUB 2PK2A 2WMBB 3BHTB 4BCKB 3BG3A 5HBHB 4CFXB 4CFMB 3DDPB 1GY3B 4NSTB 1QMZB 4BBSM 3DOGB 4CFUB 1JSUB 2C5XB 3TNWB 4ZGEB 4EOJB 2C5VB 3GTMS 4Y72B 4BCQD 4EOSB 4EOLB 4YOSA 2B9RA 4BBRM 4F7JB 3HZJA 2WEVB 4BCNB 1OKWB 2PK9B 2WPAB 2PHGA 2CZ6B 1E7PA 3MY5B 4ROCA 1VYWB 2UZDB 4AI6A 4HLQA 1OKVB 3BG9A 4ZGJB 2AHJB 3BHVB 1H4LD 4BCFB 4Z6YA 1XO2A 2CZ0B 4ELLA 4F6UB 3QYGB 2IW8B 4ROEA 1AHJB 3HB9A 4YOZA 3M03A 2G77A 4YOOA 4MIMA 1VINA 2UZEB 4F6SB 3POMA 4OB3B 3WVDB 1W98B 3G33B 4EOKB 1H1QB 3TNIB 4BCQB 2CJMB 1UGQB 5DQWA 4JX4A 4HNUA 2ZPBB 1VOLA 2QDJA 3A8LB 1GUXA 3B57A 1H26B 2V22B 1IREB 1UGSB 2C5OB 3KHIA 3QHWB 2W96A 2WJ9A 4G6LB 3VYGB 1N4MA 3QHRB 3DJBA 4FM4B 4IMYB 4F70B 1JOWA 2UZBB 2QDYB 1OIUB 3DTOA 1GH6B 3TW6A 4HL4A 1FVVB 4EOQB 2DXCB 5BNJB 2LW4A 4BCHB 4JX6A 3F5XB 4BCIB 3X26B 2G9XB 3MI9B 2C5NB 2WXVB 3BLRB 4F7NB 1G3NC 3A8HB 5IHYA 2PJQA 1O9KB 1UNLD 2CCIB 2WIHB 2WMAB 2ZPIB 2CCHB 3PO3S 1AD6A 3BLHB 4M6VA 2QGSA 1H1RB 3RGFB 3BG5A 2W99A 2WFYB 1QLBA 1P5EB 2DD5B 3A8GB 3H4CA 4NC6A 2WHBB 4AKIA 3VKHA 5CYIB 1FKMA 4LOCA 5HQ0B 2EUFA 3EJ1B 2F2CA 1ENWA 1BU2A 3O0GD 2W9FA 4CFNB 4EORB 2KR6A 1URCB 1H24B 5ACBA 3VKGA 2IVXA 2WIPB 5LQFB 4CRLB 4OR5B 3X25B 1H1PB 3QYHB 5IDPB 4ZGDB 5FGKB 4F6WB 2BS4A 2DXBB 2C6TB 5ICPB 5L2WB 2UUEB 4MFDA 3EIDB 4OB0B 2UZLB 1D3UB 1H27B 4BCGB 3X20B 1H25B 1V29B 1OGUB 2BS2A 3A8MB 2ZPFB 1AISB 5I5ZB 3DL1A 3A8OB 4BCOB 3EOCB 2W2HA 1OIYB 3LQ5B 3HBLA 5HNBB 3NDQA 3MIAB 2R7GA 4EC9B 4BCMD 4EC8B 1UGPB 4EOPB 4KRDB 5HBEB 4F7LB 3QZ5B 4BCPB 1JSTB 4BY1X 3X28B 1GUXB 1KXUA 1FINB 2CYZB 3TW7A 5DQVA 1JKWA 3K7AM 4KRCB 2W9ZA 1O9KA 2I53A 1H28B 5IDNB 4RODA 4EOMB 5IF1B 1OI9B 5EFQB 3QXEB 4OB2B 2IW9B 5HVYB 2DPPB 2PMIB 2ZPGB 2BKZB 3HO8A 4UN0A 3WVEB 3QYEA 3TNHB 3MY1B 3TN8B 1OL2B 4EOOB 4ELJA 4CXAB 2I40B 4BCMB 4BY7X 4EOIB 4F7SB 2IW6B 4OGRB 1E9HB 5EJCA 2ZPHB 4II5B 2QF7A 4AKGA 2X1NB 5LMKB 2BS3A 1UNHD 1H1SB 1UNGD 4AKHA 1TFBA 4MFEA 2D0QB 4TTHA 2IN3A 1C9BA 4YC3B 3QYBA 1UGRB 3X24B 4BCJB 4HNTA 3VYHB 4EONB 5CEIB 2BPMB 4HNVA 2CZ7B 3HHTB 4FX3B 1F5QB 2KMGA 4JX5A 1TD6A 2ZZDB 4CFUD 3DDQB 2JGZB 4CFWB 3QZ9B 4OB1B 3BLQB 2QFZA 4QSHA 3QWLA 2DD4B 2QQ8A 1OL1B 2C4GB 2ZCFB 2ZPEB 2DMEA 4BXXX 4BCND
chains in the Genus database with same CATH topology
1W98B 5EFQB 3G33B 1ZP2A 3H4CA 5HBJB 4CFVB 4EOKB 1H1QB 2WHBB 3TNIB 1PKDB 4I3ZB 4BCQB 2CJMB 2IW9B 5CYIB 5HVYB 3BHUB 2PMIB 1P5EB 2BKZB 2PK2A 2WMBB 5HQ0B 2EUFA 3BHTB 3EJ1B 4BCKB 2F2CA 4UN0A 1BU2A 5HBHB 3TNHB 1VOLA 3O0GD 2QDJA 2W9FA 4CFXB 4CFNB 3MY1B 4CFMB 4EORB 1URCB 1GUXA 3TN8B 1OL2B 4EOOB 1H24B 5ACBA 3DDPB 1H26B 2IVXA 2WIPB 2V22B 4ELJA 4CXAB 1GY3B 4NSTB 1QMZB 2I40B 4BCMB 4EOIB 4F7SB 2C5OB 2IW6B 3QHWB 4OGRB 1E9HB 2W96A 5LQFB 4CRLB 3DOGB 4OR5B 1H1PB 4G6LB 4CFUB 5IDPB 1JSUB 1N4MA 2C5XB 5FGKB 3TNWB 4F6WB 3QHRB 4II5B 2C6TB 4IMYB 5ICPB 4F70B 5L2WB 2X1NB 4EOJB 2C5VB 1JOWA 5LMKB 2UUEB 2UZBB 1UNHD 4Y72B 1H1SB 3EIDB 1UNGD 1TFBA 2UZLB 4BCQD 1D3UB 1H27B 4EOSB 4TTHA 4BCGB 4EOLB 1C9BA 1OIUB 4YC3B 1H25B 4YOSA 2B9RA 1OGUB 4F7JB 1GH6B 2WEVB 4BCNB 5I5ZB 1AISB 1OKWB 1FVVB 4EOQB 2PK9B 2WPAB 4BCOB 4BCJB 3EOCB 2PHGA 2W2HA 1OIYB 3LQ5B 4EONB 5BNJB 4BCHB 5HNBB 3MY5B 5CEIB 2BPMB 4ROCA 1VYWB 2UZDB 3F5XB 3MIAB 4BCIB 2R7GA 4EC9B 4FX3B 2G9XB 4BCMD 3MI9B 1F5QB 2C5NB 1OKVB 4EC8B 4EOPB 2WXVB 4KRDB 4CFUD 3BLRB 5HBEB 3DDQB 2JGZB 1G3NC 4F7NB 4CFWB 4F7LB 3BHVB 1H4LD 4BCFB 1O9KB 1UNLD 4BCPB 1JSTB 2CCIB 2WIHB 2WMAB 1XO2A 3BLQB 1GUXB 1KXUA 4ELLA 1FINB 2CCHB 4F6UB 2IW8B 4ROEA 1JKWA 3K7AM 4KRCB 4YOZA 2W9ZA 3M03A 1O9KA 1AD6A 2I53A 3BLHB 4YOOA 1H28B 1OL1B 1VINA 2UZEB 5IDNB 4F6SB 2C4GB 3POMA 4RODA 4EOMB 1H1RB 3RGFB 5IF1B 2W99A 2WFYB 1OI9B 4BCND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W98 B;  5EFQ B;  3G33 B;  1ZP2 A;  3H4C A;  5HBJ B;  4CFV B;  4EOK B;  1H1Q B;  2WHB B;  3TNI B;  1PKD B;  4I3Z B;  4BCQ B;  2CJM B;  2IW9 B;  5CYI B;  5HVY B;  3BHU B;  2PMI B;  1P5E B;  2BKZ B;  2PK2 A;  2WMB B;  5HQ0 B;  2EUF A;  3BHT B;  3EJ1 B;  4BCK B;  2F2C A;  4UN0 A;  1BU2 A;  5HBH B;  3TNH B;  1VOL A;  3O0G D;  2QDJ A;  2W9F A;  4CFX B;  4CFN B;  3MY1 B;  4CFM B;  4EOR B;  1URC B;  1GUX A;  3TN8 B;  1OL2 B;  4EOO B;  1H24 B;  5ACB A;  3DDP B;  1H26 B;  2IVX A;  2WIP B;  2V22 B;  4ELJ A;  4CXA B;  1GY3 B;  4NST B;  1QMZ B;  2I40 B;  4BCM B;  4EOI B;  4F7S B;  2C5O B;  2IW6 B;  3QHW B;  4OGR B;  1E9H B;  2W96 A;  5LQF B;  4CRL B;  3DOG B;  4OR5 B;  1H1P B;  4G6L B;  4CFU B;  5IDP B;  1JSU B;  1N4M A;  2C5X B;  5FGK B;  3TNW B;  4F6W B;  3QHR B;  4II5 B;  2C6T B;  4IMY B;  5ICP B;  4F70 B;  5L2W B;  2X1N B;  4EOJ B;  2C5V B;  1JOW A;  5LMK B;  2UUE B;  2UZB B;  1UNH D;  4Y72 B;  1H1S B;  3EID B;  1UNG D;  1TFB A;  2UZL B;  4BCQ D;  1D3U B;  1H27 B;  4EOS B;  4TTH A;  4BCG B;  4EOL B;  1C9B A;  1OIU B;  4YC3 B;  1H25 B;  4YOS A;  2B9R A;  1OGU B;  4F7J B;  1GH6 B;  2WEV B;  4BCN B;  5I5Z B;  1AIS B;  1OKW B;  1FVV B;  4EOQ B;  2PK9 B;  2WPA B;  4BCO B;  4BCJ B;  3EOC B;  2PHG A;  2W2H A;  1OIY B;  3LQ5 B;  4EON B;  5BNJ B;  4BCH B;  5HNB B;  3MY5 B;  5CEI B;  2BPM B;  4ROC A;  1VYW B;  2UZD B;  3F5X B;  3MIA B;  4BCI B;  2R7G A;  4EC9 B;  4FX3 B;  2G9X B;  4BCM D;  3MI9 B;  1F5Q B;  2C5N B;  1OKV B;  4EC8 B;  4EOP B;  2WXV B;  4KRD B;  4CFU D;  3BLR B;  5HBE B;  3DDQ B;  2JGZ B;  1G3N C;  4F7N B;  4CFW B;  4F7L B;  3BHV B;  1H4L D;  4BCF B;  1O9K B;  1UNL D;  4BCP B;  1JST B;  2CCI B;  2WIH B;  2WMA B;  1XO2 A;  3BLQ B;  1GUX B;  1KXU A;  4ELL A;  1FIN B;  2CCH B;  4F6U B;  2IW8 B;  4ROE A;  1JKW A;  3K7A M;  4KRC B;  4YOZ A;  2W9Z A;  3M03 A;  1O9K A;  1AD6 A;  2I53 A;  3BLH B;  4YOO A;  1H28 B;  1OL1 B;  1VIN A;  2UZE B;  5IDN B;  4F6S B;  2C4G B;  3POM A;  4ROD A;  4EOM B;  1H1R B;  3RGF B;  5IF1 B;  2W99 A;  2WFY B;  1OI9 B;  4BCN D; 
#chains in the Genus database with same CATH topology
 1ZP2 A;  5HBJ B;  4CFV B;  1PKD B;  4I3Z B;  2CZ1 B;  3BHU B;  2PK2 A;  2WMB B;  3BHT B;  4BCK B;  3BG3 A;  5HBH B;  4CFX B;  4CFM B;  3DDP B;  1GY3 B;  4NST B;  1QMZ B;  4BBS M;  3DOG B;  4CFU B;  1JSU B;  2C5X B;  3TNW B;  4ZGE B;  4EOJ B;  2C5V B;  3GTM S;  4Y72 B;  4BCQ D;  4EOS B;  4EOL B;  4YOS A;  2B9R A;  4BBR M;  4F7J B;  3HZJ A;  2WEV B;  4BCN B;  1OKW B;  2PK9 B;  2WPA B;  2PHG A;  2CZ6 B;  1E7P A;  3MY5 B;  4ROC A;  1VYW B;  2UZD B;  4AI6 A;  4HLQ A;  1OKV B;  3BG9 A;  4ZGJ B;  2AHJ B;  3BHV B;  1H4L D;  4BCF B;  4Z6Y A;  1XO2 A;  2CZ0 B;  4ELL A;  4F6U B;  3QYG B;  2IW8 B;  4ROE A;  1AHJ B;  3HB9 A;  4YOZ A;  3M03 A;  2G77 A;  4YOO A;  4MIM A;  1VIN A;  2UZE B;  4F6S B;  3POM A;  4OB3 B;  3WVD B;  1W98 B;  3G33 B;  4EOK B;  1H1Q B;  3TNI B;  4BCQ B;  2CJM B;  1UGQ B;  5DQW A;  4JX4 A;  4HNU A;  2ZPB B;  1VOL A;  2QDJ A;  3A8L B;  1GUX A;  3B57 A;  1H26 B;  2V22 B;  1IRE B;  1UGS B;  2C5O B;  3KHI A;  3QHW B;  2W96 A;  2WJ9 A;  4G6L B;  3VYG B;  1N4M A;  3QHR B;  3DJB A;  4FM4 B;  4IMY B;  4F70 B;  1JOW A;  2UZB B;  2QDY B;  1OIU B;  3DTO A;  1GH6 B;  3TW6 A;  4HL4 A;  1FVV B;  4EOQ B;  2DXC B;  5BNJ B;  2LW4 A;  4BCH B;  4JX6 A;  3F5X B;  4BCI B;  3X26 B;  2G9X B;  3MI9 B;  2C5N B;  2WXV B;  3BLR B;  4F7N B;  1G3N C;  3A8H B;  5IHY A;  2PJQ A;  1O9K B;  1UNL D;  2CCI B;  2WIH B;  2WMA B;  2ZPI B;  2CCH B;  3PO3 S;  1AD6 A;  3BLH B;  4M6V A;  2QGS A;  1H1R B;  3RGF B;  3BG5 A;  2W99 A;  2WFY B;  1QLB A;  1P5E B;  2DD5 B;  3A8G B;  3H4C A;  4NC6 A;  2WHB B;  4AKI A;  3VKH A;  5CYI B;  1FKM A;  4LOC A;  5HQ0 B;  2EUF A;  3EJ1 B;  2F2C A;  1ENW A;  1BU2 A;  3O0G D;  2W9F A;  4CFN B;  4EOR B;  2KR6 A;  1URC B;  1H24 B;  5ACB A;  3VKG A;  2IVX A;  2WIP B;  5LQF B;  4CRL B;  4OR5 B;  3X25 B;  1H1P B;  3QYH B;  5IDP B;  4ZGD B;  5FGK B;  4F6W B;  2BS4 A;  2DXB B;  2C6T B;  5ICP B;  5L2W B;  2UUE B;  4MFD A;  3EID B;  4OB0 B;  2UZL B;  1D3U B;  1H27 B;  4BCG B;  3X20 B;  1H25 B;  1V29 B;  1OGU B;  2BS2 A;  3A8M B;  2ZPF B;  1AIS B;  5I5Z B;  3DL1 A;  3A8O B;  4BCO B;  3EOC B;  2W2H A;  1OIY B;  3LQ5 B;  3HBL A;  5HNB B;  3NDQ A;  3MIA B;  2R7G A;  4EC9 B;  4BCM D;  4EC8 B;  1UGP B;  4EOP B;  4KRD B;  5HBE B;  4F7L B;  3QZ5 B;  4BCP B;  1JST B;  4BY1 X;  3X28 B;  1GUX B;  1KXU A;  1FIN B;  2CYZ B;  3TW7 A;  5DQV A;  1JKW A;  3K7A M;  4KRC B;  2W9Z A;  1O9K A;  2I53 A;  1H28 B;  5IDN B;  4ROD A;  4EOM B;  5IF1 B;  1OI9 B;  5EFQ B;  3QXE B;  4OB2 B;  2IW9 B;  5HVY B;  2DPP B;  2PMI B;  2ZPG B;  2BKZ B;  3HO8 A;  4UN0 A;  3WVE B;  3QYE A;  3TNH B;  3MY1 B;  3TN8 B;  1OL2 B;  4EOO B;  4ELJ A;  4CXA B;  2I40 B;  4BCM B;  4BY7 X;  4EOI B;  4F7S B;  2IW6 B;  4OGR B;  1E9H B;  5EJC A;  2ZPH B;  4II5 B;  2QF7 A;  4AKG A;  2X1N B;  5LMK B;  2BS3 A;  1UNH D;  1H1S B;  1UNG D;  4AKH A;  1TFB A;  4MFE A;  2D0Q B;  4TTH A;  2IN3 A;  1C9B A;  4YC3 B;  3QYB A;  1UGR B;  3X24 B;  4BCJ B;  4HNT A;  3VYH B;  4EON B;  5CEI B;  2BPM B;  4HNV A;  2CZ7 B;  3HHT B;  4FX3 B;  1F5Q B;  2KMG A;  4JX5 A;  1TD6 A;  2ZZD B;  4CFU D;  3DDQ B;  2JGZ B;  4CFW B;  3QZ9 B;  4OB1 B;  3BLQ B;  2QFZ A;  4QSH A;  3QWL A;  2DD4 B;  2QQ8 A;  1OL1 B;  2C4G B;  2ZCF B;  2ZPE B;  2DME A;  4BXX X;  4BCN D; 
#chains in the Genus database with same CATH homology
 1W98 B;  5EFQ B;  3G33 B;  1ZP2 A;  3H4C A;  5HBJ B;  4CFV B;  4EOK B;  1H1Q B;  2WHB B;  3TNI B;  1PKD B;  4I3Z B;  4BCQ B;  2CJM B;  2IW9 B;  5CYI B;  5HVY B;  3BHU B;  2PMI B;  1P5E B;  2BKZ B;  2PK2 A;  2WMB B;  5HQ0 B;  2EUF A;  3BHT B;  3EJ1 B;  4BCK B;  2F2C A;  4UN0 A;  1BU2 A;  5HBH B;  3TNH B;  1VOL A;  3O0G D;  2QDJ A;  2W9F A;  4CFX B;  4CFN B;  3MY1 B;  4CFM B;  4EOR B;  1URC B;  1GUX A;  3TN8 B;  1OL2 B;  4EOO B;  1H24 B;  5ACB A;  3DDP B;  1H26 B;  2IVX A;  2WIP B;  2V22 B;  4ELJ A;  4CXA B;  1GY3 B;  4NST B;  1QMZ B;  2I40 B;  4BCM B;  4EOI B;  4F7S B;  2C5O B;  2IW6 B;  3QHW B;  4OGR B;  1E9H B;  2W96 A;  5LQF B;  4CRL B;  3DOG B;  4OR5 B;  1H1P B;  4G6L B;  4CFU B;  5IDP B;  1JSU B;  1N4M A;  2C5X B;  5FGK B;  3TNW B;  4F6W B;  3QHR B;  4II5 B;  2C6T B;  4IMY B;  5ICP B;  4F70 B;  5L2W B;  2X1N B;  4EOJ B;  2C5V B;  1JOW A;  5LMK B;  2UUE B;  2UZB B;  1UNH D;  4Y72 B;  1H1S B;  3EID B;  1UNG D;  1TFB A;  2UZL B;  4BCQ D;  1D3U B;  1H27 B;  4EOS B;  4TTH A;  4BCG B;  4EOL B;  1C9B A;  1OIU B;  4YC3 B;  1H25 B;  4YOS A;  2B9R A;  1OGU B;  4F7J B;  1GH6 B;  2WEV B;  4BCN B;  5I5Z B;  1AIS B;  1OKW B;  1FVV B;  4EOQ B;  2PK9 B;  2WPA B;  4BCO B;  4BCJ B;  3EOC B;  2PHG A;  2W2H A;  1OIY B;  3LQ5 B;  4EON B;  5BNJ B;  4BCH B;  5HNB B;  3MY5 B;  5CEI B;  2BPM B;  4ROC A;  1VYW B;  2UZD B;  3F5X B;  3MIA B;  4BCI B;  2R7G A;  4EC9 B;  4FX3 B;  2G9X B;  4BCM D;  3MI9 B;  1F5Q B;  2C5N B;  1OKV B;  4EC8 B;  4EOP B;  2WXV B;  4KRD B;  4CFU D;  3BLR B;  5HBE B;  3DDQ B;  2JGZ B;  1G3N C;  4F7N B;  4CFW B;  4F7L B;  3BHV B;  1H4L D;  4BCF B;  1O9K B;  1UNL D;  4BCP B;  1JST B;  2CCI B;  2WIH B;  2WMA B;  1XO2 A;  3BLQ B;  1GUX B;  1KXU A;  4ELL A;  1FIN B;  2CCH B;  4F6U B;  2IW8 B;  4ROE A;  1JKW A;  3K7A M;  4KRC B;  4YOZ A;  2W9Z A;  3M03 A;  1O9K A;  1AD6 A;  2I53 A;  3BLH B;  4YOO A;  1H28 B;  1OL1 B;  1VIN A;  2UZE B;  5IDN B;  4F6S B;  2C4G B;  3POM A;  4ROD A;  4EOM B;  1H1R B;  3RGF B;  5IF1 B;  2W99 A;  2WFY B;  1OI9 B;  4BCN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...