1OI7A

The crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
270
Chain Sequence
MILVNRETRVLVQGITGREGQFHTKQMLTYGTKIVAGVTPGKGGMEVLGVPVYDTVKEAVAHHEVDASIIFVPAPAAADAALEAAHAGIPLIVLITEGIPTLDMVRAVEEIKALGSRLIGGNCPGIISAEETKIGIMPGHVFKRGRVGIISRSGTLTYEAAAALSQAGLGTTTTVGIGGDPVIGTTFKDLLPLFNEDPETEAVVLIGEIGGSDEEEAAAWVKDHMKKPVVGFIGGRVGTPESKLRAFAEAGIPVADTIDEIVELVKKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Succinyl-Coa Synthetase from Thermus Thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Synthetase
molecule keywords SUCCINYL-COA SYNTHETASE ALPHA CHAIN
total genus 101
structure length 270
sequence length 288
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2003-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1oi7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1oi7A01
2NU7A 3F1KA 3LC1O 3AM4A 1GTMA 1YL7A 4IDEA 2TMGA 5BSHA 4GH5A 2WYVA 3KB6A 1NVMB 1Q1NA 4FIZA 4E6PA 1HLDA 4KWIA 4AJIA 3JTMA 1U8FO 5TNXA 1M6WA 4WECA 3PYMA 3VPGA 2HJRA 2EKPA 5JLAA 4DWVA 1GU7A 1E3JA 3C85A 1SBYA 3INRA 4MJLA 3UCXA 4XRGA 1LNQA 3DMYA 4PG6A 4L76A 2FHSA 2AQKA 1KY5A 1NQAO 3TZHA 1DAOA 4BGUA 5ITVA 1A9ZA 4NMHA 3U4DA 4XKJA 2ZTVA 3RBZA 1C0KA 1H6BA 4R68A 4L4SA 1VM6A 2PGLA 2X9NA 3LT4A 4RPKA 4PLYA 1I01A 4M1QA 3DFUA 4B7UA 1AXEA 1BTOA 2FSSA 3ZHZA 3QIVA 5CEFA 5L45A 2PY6A 2WD8A 2OP1A 1DAPA 3IQDB 4H7PA 2HU2A 8ADHA 2P9CA 5COAA 2Q2WA 3QWIA 3ZWYA 4R1NA 4DQVA 3VOSA 4CMJA 4KTVE 4I9HA 3VC7A 3F3SA 1F12A 3VKUA 1U4SA 1VL6A 1Y8RB 3O38A 4KUEA 4MVJA 1PWZA 1VJ1A 3JYQA 4BNVA 1U3VA 1AXGA 2YZ7A 3GGPA 4HFJA 2ZKLA 4L8VA 4NFYA 1SEPA 1CDOA 5JS6A 4ZQBA 2BRUA 3PWKA 1EE2A 5KJEA 3WDSA 4XCVA 4BB5A 4Y8VA 5L40A 1WAMA 4TRMA 5F1KA 5B4VA 4J90A 3OP4A 4PZEA 1V9LA 3OJOA 3FNEA 1VKNA 3DZKA 1NBOA 5L7TA 3MWEB 4OMUA 4H3VA 1GV0A 1HF3A 1RKXA 1K6JA 3KYDA 5A4DA 2BHLA 2IYOA 4E0BA 3NYWA 5L53A 4TKLA 5G0SA 3DBHA 3JQ9C 3WGOA 5KJ6A 4I5DA 2NACA 3DR3A 3IUPA 2IXAA 3D64A 3TQHA 4WNIA 3NAQA 5DCYA 2C0CA 1SB9A 3W4KA 4FB5A 4YWJA 3JV7A 1MXHA 1W6UA 5G0UA 2CF5A 3M2TA 4G65A 3TL3A 3HDYA 4MP3A 4BMNA 1WPQA 1JKIA 3A06A 1SNYA 3RBXA 3VVCA 4EEXA 3MJCA 1BSVA 2DM6A 3FTNA 1HDZA 3U62A 1KETA 3VDRA 4CLDA 3JQEA 5KJFA 3EMKA 1P1HA 4NU5A 2WEKA 5EMHA 3SLKA 4UVIA 1R4MA 1HSOA 3HDQA 4KDFA 4XYMA 3VHRA 3ZU2A 2HKIA 1TT7A 4DL9A 2D5CA 2Q1WA 4DREA 4ZJUA 4NHEA 4CM1A 1U8XX 3QWHA 3HQ4O 1FDSA 5ENVA 1N9GB 3PHHA 1UJMA 5I7FA 2X5OA 1L7DA 4GI2A 3C3XA 4II2A 3GGGA 4JNKA 1HSZA 4GMGA 3ABIA 1ZJYA 2P5YA 1GZ3A 1ID1A 2CF6A 3BTSA 3VH2A 1CWUA 4DC1A 3Q2KA 3EYWA 3HSKA 1E7QA 4B4WA 4UAGA 2PGJA 1ISJA 3ADOA 3DQPA 3PVZA 3ZV6A 2PKRA 1YBVA 1Z74A 3DMTA 2B83A 3E8XA 2IZ1A 2NV6A 4GKBA 4PVCA 4R16A 1XA0A 4DLAA 2DPGA 1EVYA 4AJKA 3W8FA 2BMAA 5KKCA 2Y0CA 3PZRA 1DDOA 2RH4A 1PJQA 1RM4A 2UV8A 4URFA 1VRWA 1LU9A 5HWSA 3JQAA 3PLRA 1ZBQA 4WCFC 5L7WA 4QEDA 1YS4A 5ILGA 1NQTA 1BMDA 5A05A 4AJHA 2F1KA 1GEGA 4YAEA 3ZNOA 4DGSA 1NX6A 1N92A 1JAYA 1QXSA 1LLQA 1BDBA 1LQTA 1ZEMA 3LLVA 4IJUA 2GN8A 2ZJ1A 3DOCA 3BHJA 1I8TA 2HJSA 2Z1NA 1KC1A 1KEUA 2J3JA 4BNUA 4XWYA 1Z45A 5JDIA 1G1AA 4QQRA 1A4IA 4X54A 5FWNA 4CM5A 4WJZA 1X7GA 5JAIA 1DEHA 1DJQA 3ITDA 3CSDA 1VLLA 3BMOB 1UZNA 3SBOA 5A02A 3OJFA 5JYEA 3S2IA 3GFBA 1EQ2A 2DTEA 4GPD1 1LLUA 1BRMA 4PLHA 1BXZA 2DFVA 4FS3A 1ZK3A 2Q2QA 4OGWA 2B4TO 1GV1A 5ER9A 5KVQA 3PIIA 1NHGA 4HUJA 1P0CA 4TRJA 2FY8A 4FJ0A 1ADCA 1JAXA 1Y6JA 1QV7A 3EVNA 4CQLA 3GZNA 3L77A 3PQFA 4E2XA 2XXBA 3RC7A 1MG5A 4XDYA 4CMKA 5EIOA 4ROSA 2CDCA 2EJWA 2R00A 4ZD6A 4F6CA 4PCVA 2ZATA 1ZKMA 4I5EA 3VZSA 2FZEA 3VTFA 3F5QA 3Q11A 1GCUA 4IXWA 3JD2A 3T4XA 3IAHA 4NPCA 4JP2A 1WZIA 1A9YA 2AHRA 3FR8A 5IXYA 1O9BA 1LBEA 4CMIA 2EP7A 3ORFA 1HE3A 4OIMA 4Y9DA 2X86A 1MV8A 3JQGA 4QFDA 4JX8A 1VL8A 3DMTC 4DPLA 1JLLB 4MKRA 4ZRMA 3VTZA 4NBWA 1ZK0A 1VKOA 4RF4A 2FWMX 5AQ1A 2IXBA 4U5QA 1P45A 4A0SA 3KSZO 4JGBA 3T7EA 3AFNA 2AW5A 5K6AC 1H94A 1I0ZA 3C1TA 3KVOA 3H5AA 5IZCA 4M54A 2FPIA 5EQFA 2PH3A 1P1KA 1PQWA 1GUZA 1WP4A 3NJ4A 5JPIA 4BKOA 4J0FA 3GGOA 4UVEA 3CH6A 3IP1A 1EVIA 5EERA 4XQEA 2B4QA 1T26A 5CEJA 1GQQA 4FJ2A 3QWBA 4AJPA 4AJ1A 1KY4A 4BUCA 1EUCB 2OBYA 3KUXA 4LISA 3V5NA 1NNUA 1Y7TA 3WYBA 1I30A 3LT1A 1UDBA 1ADGA 1DFIA 1IZ9A 1WMBA 2JD1A 4R1UA 4ZQEA 1E77A 3L0DA 2JKVA 2YHUA 2ZK7A 1OAAA 4XD2A 3B70A 2IDZA 5U9CA 2VTEA 1SO8A 1Y81A 3I5MA 3DC2A 1SAYA 1RM0A 2RHCA 2C2YA 2EGHA 2JHGA 5LC1A 3ASVA 2Q4BA 2WTBA 4RV9A 2NU6B 1JQBA 3MOGA 4DLBA 1WMAA 3M6IA 4R3NA 1IE3A 3L4BA 4XYGA 3STHA 1DLJA 2C5AA 4WLFA 4W9NC 2VWQA 3PZBA 4O5OA 2QX7A 5IDQA 4CMEA 1FJHA 3Q1LA 2G5CA 4R1TA 4J0EA 3VPSA 2EEZA 3AY6A 2DUWA 3WGYA 5KVCA 2NU8A 1UZLA 3ZZNA 1LSSA 1EBUA 1Y1PA 3WB9A 3WNQA 2ZTUA 4EJ6A 2WD7A 3PFFA 2QW8A 5JDCC 4Q39A 4K6CA 4D45A 3FWNA 4GVXA 2B69A 4QECA 3GEDA 3UGKA 4UUOA 1C0LA 3F4BA 4I1IA 5TT1A 1HXHA 3JD4A 3OETA 5L95A 4FSHA 5TT0A 2ZYDA 5HS4A 2V6MA 4LRTB 1UXJA 2GUGA 2NUAA 1E7MA 4C7KA 2P91A 2F00A 2X4GA 3H2ZA 1MG0A 1EUCA 1I2CA 3B1JA 4J1TA 1JWAB 1PZEA 3ZNPA 4NI5A 2IEDA 3I4FA 3H5RA 5KOIA 4RDHA 3QVOA 1NAIA 1EDOA 2FR0A 2HK7A 3VPHA 3VKVA 1MFPA 3ZWBA 4OSOA 1IB6A 4RPGA 1NVTA 4I8XA 4FCCA 3ULKA 5F5NA 4QX6A 1XYGA 1CF2O 3OA0A 4MVJF 4ZHSA 1YOVB 3MCVA 2HMSA 5JFOA 1P3DA 1Y9AA 3QRWA 2O48X 4GAEA 3TWOA 3ZGYA 4MVJM 4A10A 3H4VA 4DBZA 3GZ4A 4FW8A 1DIHA 4UUMA 2SCUA 1ZEJA 4R1SA 4AG3A 2OL4A 3QVXA 4M8SA 3DAGA 2Y1CA 3FCOA 3HN7A 4J1SA 4FOOA 4WGGA 1PU2A 1UH5A 4OYRA 4XQGA 2JJYA 2WD7B 4IQ0A 4BB6A 4DQXA 2UUOA 4BVAA 4E2YA 4XEHA 4CR7A 1P9LA 1O0SA 3JQFC 3W6UA 4XGIA 3I9KA 2QRKA 1JLLA 3QP9A 3O4RA 3PQDA 1YGYA 2JCVA 4Q3BA 3H6KA 3L4BC 3TF5A 1OC2A 4CL3A 4FC6A 3S2GA 4YEDA 4CMBA 1E7RA 2NVUB 1JU9A 4YT2A 3D4PA 4ITUA 1XKQA 5TSDA 5KIAA 3FRJA 3RFVA 4BNWA 2OOSA 5TF4A 4EYEA 1A27A 4YVFA 4G81A 4E31A 2AG5A 3W4JA 4HNGA 5U4QA 3LVFO 5DZSA 3RC9A 4DRYA 3DONA 3GMDA 2B35A 1U7HA 1MB4A 1GADO 3RC2A 3WQRA 2X0NA 3JQAD 2Q1SA 3RWBA 4ALJA 4BGIA 1QR6A 3RKUA 1H5QA 4YQZA 3BMOA 5HTOA 1EVZA 4E5MA 4LRSB 1D4FA 3CUKA 3HADA 3PIDA 1DIAA 1ORRA 3GHHA 2QIOA 4PZDA 1ENZA 3E48A 4CLOA 1DC3A 3IC5A 3JQBA 1X14A 3K6JA 4E32A 3TRIA 4ND3A 5F21A 3WJAA 4HV4A 5DOVA 3K31A 3MJ4A 4CM9A 2X22A 2C59A 5I7EA 1D1TA 1HYEA 1UAYA 1XQ1A 4Y67A 3WS7A 1U2DA 4XIJA 2Y1EA 1CJCA 4EBFA 3WR5A 2BELA 2FR1A 2DKNA 4Q9NA 3T4EA 3TN7A 4HBGA 1PJSA 2DFDA 2IE0A 2YJZA 1OI7A 3JQAB 3L6DA 3GNQA 3A28A 4CODB 4A7PA 4CLHA 1BGVA 1UAGA 1PL8A 1UXGA 1SCUA 5L51A 1NWHA 3S8MA 5DP1A 1ML3A 4J2HA 2ZTLA 4CM7A 4QO7A 1GFSA 4OXYA 2OORA 3S55A 3SLGA 5DF1A 4JJFA 1R4NA 2HMUA 1QYWA 4WOKA 1CERA 4W4TA 2AA3A 3LC7O 3OQBA 2ILTA 1E1MA 1EUDB 1LQUA 4B7XA 3IL2A 2EW8A 3H9UA 3K30A 1G0OA 4P4LA 3O8QB 3ZNQA 9LDTA 3HB4X 3IP3A 2Y1FA 4DC0A 3PHIA 4ZRNA 1HE2A 1KEWA 3GH3A 2X5KO 1KOLA 3CIFA 2GZ3A 1DB3A 3U3XA 1BW9A 4CUZA 3GN1A 1T2EA 3W4IA 4GLLA 1OZAA 2PR2A 4RQUA 5EESA 2OBNA 3AUTA 3EDMA 5DCWA 2AQHA 1VPDA 2PGDA 1P0FA 4RVUA 3AY7A 3O03A 4YR9A 4HFRA 1FDTA 3VZPA 4IMRA 4UVHA 3WTCA 1ULSA 1EUDA 5LCXA 1JN0A 1N9GA 3EGOA 1MLDA 4XYEA 4FDAA 3GAFA 3EUWA 1I5RA 1WW8A 4NG5A 1J6UA 2VHZA 2Y0DA 3DO5A 4A5OA 1HL3A 3RFXA 2NADA 3PDUA 2BGMA 4BNJA 2GD1O 4W82A 6ADHA 3KYDB 5A5FA 1DIGA 4CLOB 1I33A 2W8ZA 1IZ0A 1U7TA 4E30A 2YYYA 4CM4A 4E33A 1UP4A 3N74A 4O6VA 4PZCA 1Z73A 1O6ZA 2BFPA 3KLPX 5BQFA 3H9GA 4ND5A 4O0LA 5G0WA 3VZRA 5MGBA 4CM4B 3DHNA 1YJ8A 1HTBA 1DFGA 3SJ7A 3GDGA 3NDJA 5K6AA 4JCOA 3PK0A 4OQYA 5FYDA 4D42A 3AY3A 3WGHA 4AJNA 2QRLA 3BMQB 1H9AA 5DT9A 1YB5A 2ZYAA 3A1NA 4RPHA 4RJTA 2CDAA 4NFHA 1NPTO 2P2SA 3LSYA 4A2CA 2HAEA 4WLEA 1PEDA 2HK8A 4QTZA 4EUEA 3ZH2A 4IDGA 1YB4A 1YKFA 5IDYA 4N54A 2HMVA 1I3KA 2DVMA 4Y98A 5C7LO 1ZCJA 3C7CB 2QYTA 4CMGA 3ANLA 2E49A 2PD6A 4WLOA 3TZCA 4JIGA 2VUTA 3HFGA 1TVEA 1YVEI 4RORA 3HHPA 3ROMA 3D5TA 5FI3A 3AOEC 3CMMA 4EJ0A 2WM3A 2NVUA 2X6TA 3OEWA 5TQVA 5GZ1A 1I2ZA 3GAZA 2EKLA 1BW9B 4UUPA 1Y5MA 1CQIB 3RI3A 4IBOA 3BMQA 3IKTA 2UYYA 5A5EA 4IQGA 4XRRA 1HDXA 2AXQA 5CFZA 1R0KA 3SJUA 3HE3A 3RU7A 4AICA 5GZ6A 1PGQA 4C4OA 1P1IA 2O3QA 5DNAA 3RSHA 4Z6KA 1RYEA 2C7GA 2BKAA 2V65A 1KBZA 2E48A 5IAAA 3G1UA 1IUKA 1GY8A 5IXSA 1ISGA 4JN6B 1NQ5A 3F47A 3WMWA 2XAAA 3JQ6A 1NAHA 5F1OA 2P4QA 3V8BA 2FPGB 1N7GA 3Q9UA 3GY0A 4PLCA 3IOYA 2YDYA 4R3WA 1XGKA 2E82A 2EV9A 1ADBA 1N2SA 4Q3NA 4BO8A 4D41A 2FRDA 3Q2IA 1UP6A 4Z9FA 2I99A 4E5PA 4E21A 1NPYA 1H93A 3DL2A 3N7UA 1D7OA 2CFCA 4TZTA 2GRAA 3WFJA 4LVUA 3TDKA 2OXIA 4LW8A 2JHFA 3FNHA 1P74A 3KEQA 2DC1A 3IMFA 4IDDA 3VPFA 4JXKA 5HA5A 2OGUA 3I1JA 3FN4A 4QT0A 3HWRA 3R0IA 4XB1A 4YRAA 1HDCA 1GZ4A 4XIYA 4CV1A 2EGGA 1PZFA 3KO8A 3WNVA 2GSDA 2P9GA 1JKJB 2E37A 4QXMA 3RVDA 1KVTA 3H8VA 3EZYA 5T5QA 3PDJA 4NU6A 1K89A 4OOFA 2C29D 3DZGA 2QHXA 3UCFA 1ZFNA 5KCZA 2DBQA 1LI4A 3DZHA 3HB5X 1I2BA 4OH1A 3WWZA 8LDHA 3VDQA 1SMKA 5T64A 2PV7A 3FI9A 5HBRA 3DFZA 5JY1A 1T1SA 4U0KA 3KYCA 2BGKA 2O2YA 3EVTA 3AWDA 4GSKA 1GR0A 1C14A 3Q3CA 4D3SA 1BVUA 1XR3A 2HMTA 4R41A 5AXBA 4W7IA 3QJ5A 1YOVA 3WGIA 5EINA 1WDMA 1OOEA 3AU8A 1JTVA 4RF2A 2NU9B 2A92A 3O9ZA 2GPTA 4B3HA 2HLPA 3ADPA 1X7DA 3GF4A 3FNGA 5DBFA 2JFGA 3ZU3A 3NTOA 2TMDA 5B4UA 5K9ZA 5LDHA 3H7AA 3UH1A 1B8PA 3GRKA 2AG8A 3C24A 2XXJA 3RFTA 2ZTMA 3A14A 1M76A 1ZMOA 3H5NA 2PFGA 3TZ6A 5JE8A 4BO5A 5IJZA 3O26A 5THQA 4LMRA 1D3AA 2X23A 3GQVA 3F1LA 2VOJA 2QG4A 1Z75A 5GMOA 2JD2A 4BNIA 1B3BA 4BNXA 2YV2A 1YONA 1NQOA 4PFJA 3WWYA 2EIHA 4WLNA 2X0IA 5AXCA 4PLFA 1YB1A 3DBLB 3IS3A 3WTBA 4XA8A 4CMIB 1ZSYA 1MP0A 5TC4A 4YRBA 1TLTA 3DZJA 1XWFA 4EW6A 4BNNA 1QYVA 2X0RA 1LLCA 4RL6A 4BQRA 3JQ8B 2DT5A 4Q3DA 4FR5A 1L1FA 5DP2A 3FWZA 2H6EA 5BSEA 5BNFA 3KYCB 5T8KC 2WWRA 3ENKA 2Q1UA 3HJAA 3PRJA 3W6ZA 2EERA 5A06A 3WLEA 5ICSA 4RGBA 2C82A 4I9UA 1IYZA 4IS2A 3ZV4A 4BNMA 3QVSA 1XQ6A 2J3IA 4KDEA 3FF4A 1JA9A 1T4BA 4YT5A 1RYDA 3WGTA 5L4LA 2VZ9A 3DDNA 1J5PA 1P33A 1PJ4A 3I6IA 3H2SA 1YBAA 1LRKA 2CVOA 4FBGA 1Z7BA 3ETEA 3EW7A 4XB2A 1T2FA 4CLEA 4DXHA 1E7WA 2HDHA 3ZWXA 2I5PO 3BHIA 4ESOA 5AVOA 4RF5A 5KTKA 3ICCA 2NTJA 4AJLA 1U5AA 1ENYA 3DOJA 1OMOA 3ZU4A 1U9JA 3PI7A 4J91A 1PWXA 4RPJA 2C54A 4RVFA 4FFMA 3WYEA 3IJPA 3H9JA 5DN9A 4B7CA 1O95A 1OFGA 4J2OA 4W99A 3QY9A 3I3OA 1NASA 2DTDA 1QYDA 2O3UA 2OMEA 3D5QA 5CPBA 3GG9A 2FPPB 2C07A 4BNKA 1QLJA 1UXIA 1U4OA 2O3RA 4CUKA 3GLQA 3OJ0A 4WE3A 1EFKA 3BTOA 3U0BA 3LQFA 2X7HA 1YXMA 5JW6A 1H2BA 5L4SA 1Q0HA 2EW2A 3DZIA 3QQPA 2DQ4A 5HS6A 2G76A 4LN1A 4L0QA 1R15A 3V2UA 4ALKA 1C1XA 2IEBA 2FP4A 4TMFA 1XU7A 2HQ1A 4XYLA 3INGA 3ZWOA 4RLSA 4YPOA 1M66A 1BXGB 1LA2A 3NDIA 2PK3A 5TRTA 3ZN2A 4PLTA 3WSVA 1UZMA 2FPGA 4R9SA 2FR8A 2VOEA 2QYSA 4EEZA 1C0IA 2PH5A 3EY4A 3O8QA 4ALLA 1PGJA 2D4AA 4FOSA 1V35A 4AJJA 2D0IA 1JKJA 5JC1A 1NYTA 3RJ5A 4ALNA 3BIOA 3KTDA 1B14A 1KYQA 4B8WA 2EF1A 1QSGA 2VHXA 1XHLA 3AM5A 4UVDA 5B37A 1LSOA 3BTUA 3E9QA 5TX7A 3G79A 4ONEA 3GDOA 2GN4A 1DRVA 2ZQYA 3R3SA 3WX0A 1M67A 5TIIA 4P38A 3QVTA 2IZ0A 1FDWA 1X7HA 4ND4A 3FHLA 3H9EO 3PYXA 3UVEA 1VC2A 4GX2A 3R6DA 5J23A 2I65A 2I66A 2JCXA 2VRCD 3AFMA 2WMDA 1NFRA 1XDWA 4QO8A 4YJFA 2I6TA 1WLYA 1GZ6A 2NVBA 2ZCVA 3LYLA 1FDUA 2VUUA 2CSUA 2VT2A 1ZIDA 4FD3A 4PRLA 4XR9A 1K2WA 3TJRA 4Q3AA 4MP6A 4ZN6A 1HWYA 4GWKA 5F3RA 1I3NA 2CVQA 1PL6A 2FZWA 3ASUA 2BI8A 5JMWA 4RVHA 1NWCA 3GT0A 5T6BA 3RAJA 2IRWA 3X2FA 1U1IA 3TZKA 3WLFA 4FQ8A 3RBVA 4CLRA 1NP3A 3RUEA 3RUFA 2C7VA 4NK5A 2D2IA 4BS9A 4BMSA 5CDGA 4HFMA 5H83A 5FFFA 3JQ7B 3LF2A 1PL7A 3JQGB 4JROA 4IZHA 1MA0A 3DAFA 2RBEA 3NUGA 1Q7CA 1UDAA 4NK4A 4A27A 3ZWAA 1R0SA 5KVVA 2O2SA 1ISHA 3FR7A 2P68A 3FSRA 4BO7A 5CHEA 1TXGA 2GYYA 1YE3A 4PLZA 3ANMA 1F17A 2CMDA 2Y05A 4Z9YA 3JQBC 5EN4A 4GVLA 3WGZA 4UEKA 3WYCA 2RCYA 3VH4A 3ONDA 4N5NA 3I83A 3UF0A 1ZZEA 2EKQA 3I9MA 4XZ3A 4XGNA 1H6DA 4I9NA 4KUHA 3QW2A 5JMPA 5H81A 1CEQA 1BVRA 3MEQA 5IF3A 4D0RA 4AJOA 5IN5A 4FFNA 4LK3A 5CDSA 4Z9XA 4EDFA 1KVSA 4IIVA 3D7LA 5B12A 3AU9A 2QZ9A 3R3JA 1IOLA 3G17A 4YACA 1PGNA 3I9NA 4ZA2A 4GSLA 2NQTA 1B0AA 2XOXA 3CKYA 3G0OA 3OJEA 4J9VA 1GYQA 1JVBA 2R6JA 5G0TA 3BMNA 2Y93A 4CUJA 4JK3A 2PD3A 4N5MA 2YV1A 1KVRA 4W9NA 2VN8A 1V0JA 2H1SA 1B26A 2BF7A 5JCJD 4TZKA 4ZQHA 4KQXA 5GZ3A 4PGFA 1ZSVA 3AW9A 3NT5A 1D8AA 4QSMA 4BNHA 4R5MA 4RZIA 3WGGA 1E5QA 1HYHA 4MPDA 2DLDA 1IHXA 4CM3A 4TRRA 1X0XA 1YQGA 1IHYA 2W2LA 4BNGA 7ADHA 5CP8A 4KMSA 2FPPA 2ET6A 4NZ9A 2W2KB 1YJQA 2J5RA 2C20A 4DYDA 5JDCA 1OC4A 2BI7A 2ZB8A 1MC5A 4ALIA 3KYBA 5T67A 2QQ5A 3KOUA 2CUKA 4HFNA 4R69A 4N18A 1FXSA 2PZLA 1LDGA 1VSUA 1W0CA 4S1VA 2NU8B 3P2OA 1Z82A 2CY0A 1HKUA 2JFHA 4F3YA 2O7SA 4W6ZA 1I24A 3PLNA 1U5CA 3ROQA 4TVBA 2Q49A 1Q0LA 4L73A 4RVGA 2OZPA 4D46A 1LLDA 1GUYA 3JQFA 2P5UA 2EJVA 4J3FA 2VZ0A 3HG7A 1LRJA 1NXQA 1RPNA 3QHAA 1DC5A 3GOHA 4IIUA 3K8ZA 1A5ZA 1PZGA 2YFQA 1KERA 1HT0A 2J3KA 1MGOA 5AOVA 1RM5A 3RQSA 2VYNA 2BFOA 4OM8A 2CZCA 4OKNA 3OQ6A 3RU9A 4FFLA 2D1YA 2GNAA 4E2ZA 1S7CA 3CZMA 1LJ8A 1UUFA 4S3MA 1LUAA 4MIOA 1E3EA 1E3LA 4BO3A 4IJVA 1J4AA 5JAMA 1HEUA 1X0VA 3LF1A 2O50A 4PIVA 5COBA 1U3UA 2EP5A 4O59O 2E6UX 3AOGA 2R00C 3DWFA 3SXPA 5HRUA 5A3VA 2GERA 3Q9NA 5DDIP 1TT5A 1NR1A 2O7QA 3E18A 1VI2A 1WVGA 3MJTA 4INAA 1A72A 4GGPA 4MKZA 4MVJP 2P9EA 2BFMA 2VUSA 3SVTA 5MDHA 4BV9A 5I8WA 1PGPA 5THKA 3WJ7A 3B6ZA 2PLAA 3B20A 4D79A 4E5KA 2V6GA 1MUUA 5CDTA 1FMCA 4PVDA 5LDGA 3U49A 3E5MA 5U1PA 1PJTA 2I9PA 1V3TA 3COSA 4BKUA 3U09A 1EK6A 1XEAA 4K28A 4CM8B 4PLPA 5A9SA 4YJHA 2AEMA 3KHUA 4PRKA 4PG8A 3LK7A 4OXKA 2X9GA 1SOVA 4CR8A 2CVZA 1E3SA 1GDHA 5G4KB 1DC4A 5G2OA 1C1DB 4IQ8A 4WCFB 2Y99A 4B8ZA 2EWMA 2A9FA 3EAGA 3EC7A 5IZCC 2CNBA 3OA2A 1PTJA 3NRCA 1EK5A 1KVQA 1LDMA 2WE7A 2VHWA 2VYVA 4IS3A 2RHRA 3ZU5A 2POQX 4Z0HO 3PTZA 2EG9A 1DRWA 3AK4A 3HUDA 4YQYA 2H63A 2NU9A 1M6HA 1QLHA 2DBRA 3JCZA 3OSUA 1ENPA 1ULUA 2J8ZA 3L4SO 1PS0A 1B8VA 3B1KA 3ZW9A 1ENOA 1O94A 2JL1A 4D7AA 1WZEA 4GX1A 4XR4A 1DJNA 3OECA 1R6DA 2W90A 3ST7A 2ZCUA 4NBVA 3PWZA 1K5HA 5I8ZA 1PZHA 1MX3A 2ZB7A 3OM9A 4PG7A 3AUUA 3U4CA 4TRNA 3D0OA 5EL0A 1Y8QA 1JW9B 4RCVA 3AM3A 2PKQO 4CQLB 3RUAA 1VJ0A 1ZUD1 4MVJI 2GN6A 2YHIA 3AI1A 3OJLA 4RO0A 3GC6A 3AI2A 5K0ZA 5L3ZA 3WMXA 4QFCA 4CM8A 4JJGA 4BNTA 1K3TA 2EHDA 3SEFA 4TVOA 4AJ4A 1E1KA 1E6WA 3ZWVA 2ZB4A 1Z6ZA 4WKGA 4LVCA 2IODA 4MINA 1UXKA 3ZV3A 5TJHA 2GASA 1E92A 1SPXA 4BNLA 3OIFA 1I10A 3C1AA 1LDBA 1GYPA 4H15A 4OJNA 4WASA 3VZQA 3BMCA 1LC3A 2W2KA 4ND2A 1SOWA 2BH9A 1PX0A 2XPCA 3G49A 1PJCA 4CM9D 1GUFA 4ZICA 1E5LA 3MJEA 3LU1A 1IULA 2PD4A 4MVJE 1AUPA 1YBMA 2CD9A 3OFSA 4BOYA 4E13A 4YDRA 4OSPA 1DRUA 1F0YA 1EUZA 1DXYA 5T57A 4M89A 2YFHA 4JBHA 4YYZA 3E9NA 1HDOA 4MP8A 4IXTA 3E5RA 2FOIA 3NJ8A 1HDGO 1WDKA 3BMNB 2GLXA 1YDEA 1HETA 1V8BA 2JAHA 4N5LA 3M1AA 4J6FA 5IDWA 4AJ2A 1Z7EA 3QWAA 4DBVO 4GGOA 1PR3A 1NFQA 4EZBA 3GHYA 3L9XA 4G2NA 3ZWWA 4XQ9A 2DTXA 3OH8A 3TSCA 2FN7A 3HFSA 3DZFA 5C7IO 9LDBA 2VNAA 1N1EA 4LGVA 3S1LA 1YRLA 1E1NA 1DO8A 1HDRA 1PS9A 3KZVA 3WBBA 1T4DA 5CEEA 4CMCA 4BNZA 3NKLA 2A4KA 3C7DB 4KOAA 4EI2A 1J49A 2VT3A 4GWGA 3E1KA 4R51A 4XDZA 4NDNE 3WSWA 1CYDA 3Q6IA 1EZ4A 3KSUA 1DC6A 2GGSA 2NTVA 2VRBA 3VH1A 2VNSA 4MIYA 5L9AA 1B2LA 1ZXBA 5B4TA 3PEFA 3TPCA 2BGLA 1W73A 1T1RA 3D3WA 3GVHA 3OF2A 3OEYA 5FEUA 3MZ0A 5JBIA 2ZYGA 1LDNA 3QSGA 3UUWA 2R2GA 3NEPX 3H3FA 4PLVA 5CPFA 3UCEA 3ANNA 1W4ZA 1AN9A 1NM5A 4ILKA 5KKAA 2O3TA 3GNSA 5JCXA 4E2WA 3V2HA 4IPTA 3K5PA 3E03A 2O23A 1H2HA 3ETDA 3R1IA 1JKFA 3F6YA 3WGQA 1KEVA 4UVGA 2B5WA 1LX6A 2JD0A 1GYRA 4P8RA 1U3WA 4OAQA 1R0LA 2YUTA 2B5VA 1NHWA 4OQZA 3ROPA 4TKMA 3E82A 4J1NA 5JXWA 3TOXA 4NBTA 2HK9A 5A04A 3I4CA 5A1TA 1Y5RA 4TQGA 2NNLD 3GVCA 4JLWA 3RIHA 1CQIA 3U4IA 4PN3A 5KVSA 3X2EA 4WPGA 4LSMA 4B3JA 1R4NB 3ZV5A 2C2XA 4Y6PA 1B8UA 1HYGA 3UFXB 5JAQA 2B37A 1M2WA 3MTGA 3CEAA 3OIDA 4ALMA 4IDBA 3NGLA 3P7MA 4JBIA 4I08A 4NJOA 4L74A 1NR7A 1WWKA 5AXAA 3K96A 5L4NA 4ZVVA 1TI7A 1HZJA 3D1LA 3C8MA 3FD8A 4YAGA 2Y66A 4NR0A 5TLSA 1A7KA 2ZIZA 4UEJA 4BKRA 4NQZA 1BXKA 1QG6A 5ILOA 4BKQA 4KTTE 3DEYX 4GX0A 4DTIA 4HX5A 1GPDG 3DHYA 2J5KA 3VPXA 3FPCA 3BA1A 2BLLA 4IDAA 4J9UE 2SCUB 1DBVO 1D1SA 1Q0QA 1E7SA 4U6SA 4Y6SA 4MDHA 3IJRA 1Q7BA 2VWPA 1SCUB 3EZLA 1E3IA 1ZK1A 5COQA 3UW3A 1JWBB 2BFAA 2J6IA 1ZW1A 2W98A 4WCDA 3WG9A 4JQCA 4WOJA 2B4RO 2B0JA 3KXDA 4E4YA 3OIGA 1SB8A 5KJCA 1ZSNA 3GUYA 4CMEC 4GQAA 3CMCO 3KETA 1CETA 4D3FA 5A03A 1NTOA 4YAKA 3L07A 4ZU3A 4AVYA 2VTDA 2Q46A 1F06A 4BGVA 3ZWPA 3NX4A 3PPIA 3GA0A 4CQMA 4IMPA 4FN4A 5A9RA 3DZBA 4YAIA 1AE1A 2PA3A 4EITA 3FPLA 3F4LA 3SX2A 2V6FA 3MWEA 3C7AA 4BIIA 2NUAB 1ADFA 1CQJA 4L4RA 4PG5A 2Y1GA 1HRDA 1HDYA 1LRLA 2XF8A 1ZMTA 2OP0A 5JYDA 5BNIA 3A9WA 4IGFA 3HZZA 3EK2A 3GVIA 4KZPA 4P22A 4M86A 2X8LA 3I23A 3BTVA 3QWFA 4Z3DA 3ON5A 4K6FA 3K2EA 5G0VA 4HADA 5TS3A 1RM3A 3RUHA 4GX5A 4YAJA 1JVSA 5IG2A 1P31A 3K2BA 4CQMD 3FBTA 4BKPA 4DMMA 1KIFA 1Y8RA 2G1UA 4B79A 4UUNA 1SZJG 4NFSA 1DIRA 1R4MB 3RJ9A 2NLOA 3I52A 4YA6A 2HMWA 2E4AA 1GD1O 1R37A 2EXXA 2G0TA 1GEEA 4FPXA 4Q3EA 3SC4A 2J5QA 3DXFA 5ER6A 1F8FA 4DPKA 2Z95A 2VCYA 4RVDA 4WCFA 2HRBA 2JFFA 4GLOA 3CPSA 5BSFA 1JDJA 2W4QA 5JCJA 1HLPA 4BO2A 4CL8A 4WNCA 3ZHXA 1B3RA 1H0KA 2DPHA 4A03A 4DQUA 4D3DA 3TFQA 1P44A 3K9QO 1YH3A 4TWRA 3PJFA 3RD5A 1HE5A 4BV8A 3JYLA 4NJMB 5ENDA 4JBGA 3PXXA 5JO9A 3SC6A 1C1DA 4AJEA 4BO0A 4E12A 1E6UA 3FNFA 5ADHA 1B7GO 1YQXA 5HM8A 4BO6A 2GN9A 3ZNNA 5AYVA 4MVJD 1MFZA 1LXCA 1ISFA 3TZQA 1IPFA 3GR6A 1PR9A 1EDZA 4HXYA 4P4GA 4LSWA 3GDFA 1P1JA 2GO1A 3RASA 3WICA 4F46A 4OHUA 3VVBA 3LZ6A 4XGKA 2Y67A 2HUNA 4A26A 1VE9A 1V6AA 1CIVA 4UEOA 1BDMA 2J3HA 5CAEB 3RCBA 2Z1MA 3WQQA 2HRZA 2LDXA 4HY3A 4RQTA 5IZ4A 3U4HA 3ICPA 4YJFB 1DFHA 3KRTA 3WQSB 3I9LA 1ZO8A 1FDVA 1PJBA 2GCGA 3BXXA 4XQCA 3T7CA 2WYUA 1HZZA 1YWGO 3PJDA 2V6BA 4MVJG 2RAFA 1DLIA 3RUCA 1LEHA 4NIMA 2X0JA 1U3TA 1CRWG 3JQCA 1NVGA 3JD3A 1EQUA 4YT4A 2YHIB 3ETGA 4B4VA 3GRPA 4YT8A 4O63O 3PP8A 5KNLA 2G17A 5B1YA 4EGFA 4DIBA 1WDLA 1EEHA 3S2EA 4G5HA 1QYCA 1XU9A 1J0XO 4MOWA 3UXYA 3KSDO 2Y1OA 1GPJA 4CM6A 5JC8A 4BL5A 3U5TA 5CAEA 3GFGA 4YBZA 5I9NA 3A4VA 1B16A 4BO9A 3PFWO 2YY7A 1TA4A 4Z0PA 3GPDG 4FFRA 1ARZA 4M49A 3ZW8A 1XELA 4YB8A 2YQ4A 3CE6A 3PWSA 4RDIA 1A7AA 1UR5A 4H16A 2Q2VA 2VWHA 3F9IA 4UREA 4EUHA 1I36A 1X1EA 2VHYA 2FPIB 5DCUA 4IUYA 1HE4A 3ROKA 4WK6A 3H3JA 2GZ2A 3BMCB 3UICA 2DBVO 5CG1A 1Y9EA 1V3UA 3VH3A 4YJGB 2A94A 4R5HA 3UHAA 1CQJB 3AI3A 1LDEA 5JNLA 3DB2A 1T25A 3DOOA 1T2CA 4RVSA 3W1VA 3NGXA 3EHEA 4J7CA 4LCJA 4XX0A 3V1TC 3KV3O 5F1PA 3IKVA 1VL0A 3GPIA 1DHTA 3MJSA 1ISMA 1YDWA 1IY8A 5CDUA 3NT4A 4JP3A 4DVJA 1O5IA 5C7OO 4BHTA 3K92A 4B4UA 2AE1A 4BMVA 5BSGA 2Q4EA 4RF3A 4Z0TA 3CTMA 5BNTA 3LDHA 1H9BA 3F46A 3HDHA 2Y1DA 4ZQFA 2VRCA 4FJ1A 3ZI0A 3PQEA 1P77A 1UDCA 1X1TA 5DOZA 3CZRA 5AXDA 1VJTA 4BNFA 3P2YA 4BGEA 1ZJZA 2WSBA 4OKIA 1E7YA 1AHIA 1H6AA 3INTA 3LC2O 3MWDA 4PLWA 3GVXA 3Q0EA 2QRJA 1E3WB 4FC7A 4LCEA 3L6OO 1EE9A 5FI5A 4D44A 1QORA 3IDSA 1L7EA 2ZQZA 3DBRB 1LTHR 5EPOA 4DPMA 4J7UA 3KEOA 3RUIA 4IM7A 4OO3A 1LDYA 3U9LA 4RPLA 1T2DA 2WDZA 3AOEA 3PGXA 4NBRA 3RUDA 4Y6RA 2AQ8A 4GKVA 1XSEA 3WFIA 4AL4A 4B4OA 2B36A 4N7RA 4YTEA 4CMHA 2BD0A 4YJDA 1LSJA 2O4UX 2VQ3A 3CXRA 5KWEA 3OMLA 4FFOA 2YDXA 4HNHA 1F14A 3NTQA 4J4TA 4RLHA 4YJHB 2GDZA 1ISIA 3GEGA 4IZIA 4BNYA 4CLRB 4D0SA 3B1FA 3GEMA 3MOIA 4ZQGA 4K9DA 5ES3A 4CV2A 2IYPA 4AFNA 2DAPA 3E6AA 3L6EA 1IL0A 1OBFO 2VZ8A 1QYXA 3AUSA 4CV0A 3BAZA 3FTPA 3GZNB 4NBUA 4TSKA 4DA9A 3N58A 3DTYA 1O89A 2AQIA 3QLJA 5ICMA 4CJXA 1DPGA 1N5DA 3BHMA 1PSDA 3PHGA 5F5LA 2VWGA 3GVPA 3UFXA 2I3GA 1U2GA 1WXDA 1EFLA 1DOHA 4GMFA 1RWBA 2Q1TA 4U8GA 1PJ3A 1I32A 3RKRA 4J49A 3DBRA 4MO2A 4TROA 4FGSA 4NJMA 5C3MA 2H9IA 4LMPA 2FSVA 2O4CA 3D4NA 1B15A 3QA9A 1NPDA 4F6LA 4WEOA 2GZ1A 2WYWA 4DLLA 5IN4A 1PGOA 5FF9A 1E3WA 4BO4A 3AJRA 4JJIA 5T8KA 1U28A 2V7PA 3KBOA 1ZK4A 2PZKA 2PKQP 4FFPA 4DMLA 1FK8A 2UDPA 2PZMA 4KP7A 2JAPA 3MWDB 1LSUA 2X1HA 1DIBA 2WE8A 4YXFA 1I3LA 2DU8A 4HKTA 3UN1A 3ONEA 3QV1A 4ZGWA 2NQ8A 5EJ2A 4IINA 4Z3KA 1ZH8A 1E6EA 3ZHBA 4PLGA 1AGNA 2Y68A 3IUSA 1X13A 1PJLA 3PJGA 2I76A 4J4BA 1C0PA 1H6CA 3TFOA 2RIRA 3HN2A 4ND1A 4B3IA 1BXGA 1XG5A 3DBHB 4WLUA 2AE2A 1ONOA 3HDJA 4CLXA 3G1TA 2YQ5A 3KM0A 1G6KA 3PJEA 1PJ2A 1VSVA 1MC4A 2NTNA 4IDCA 5DBGA 1C1XB 3ONFA 1P1FA 4L4XA 1TEHA 3DHEA 1IPEA 4M87A 1C3VA 4E5NA 4XYBA 4CQMB 5BR7A 4J1QA 4O1MA 1W8DA 2PNFA 3JQDA 3OICA 2JCYA 1ONPA 3CINA 4QUKA 5G4LA 5ITWA 1Q7GA 3OHSX 3D3WB 1BHSA 4HP8A 1R12A 3PYLA 3LT0A 3JD0A 4L75A 4XJTA 3WIDA 4W7HA 3P19A 4WLVA 1I3MA 1M75A 3L9WA 1K6XA 2NU7B 2WJPA 1WNTA 1ZVMA 3D4OA 1ZXLA 2CDBA 5C5IA 5TJ9A 3I6QA 3I9OA 1KVUA 4C7JA 3JQ9A 2D59A 2DUUA 2VYND 3BYZA 2UVDA 2H5LA 4IY1A 3JYPA 5JAZA 2HCTA 5CDYA 1Y8QB 3MJVA 3ZWNA 2IZZA 1A4UA 2YV3A 2P4HX 3WXBA 1LC0A 3PHJA 2A35A 4CV3A 4MIEA 2OHXA 1ZNQO 1YO6A 1T2AA 4XJSA 2D5AA 3H65A 2W2LD 1MXFA 3K73O 5I7SA 3I9JA 3LT2A 3ENNA 5TGDA 1E0DA 4ID9A 1KC3A 3DBVO 1YQDA 4II3A 4OXNA 4RZHA 1SEVA 2ZB3A 2UUPA 1PIWA 3OBBA 1PS8A 3GG2A 1P1RA 1DSSG 4J43A 3PHLA 3ZWMA 2DBZA 1GQYA 4Q3CA 2OUIA 2D3TA 4WEQA 4WUVA 3E9MA 3WOHA 1KEPA 4F45A 3GN2A 5IDXA 4HWKA 4OOEA 1EMDA 3ZDFA 1SC6A 2Q50A 1GL3A 2AMFA 4MKXA 4U0JA 3UOGA 1QKIA 5JDIC 1R16A 1GCOA 4KWHA 3V2GA 4D43A 1QP8A 1AHHA 2Y0EA 4I5GA 2HO5A 3V1UA 1UXHA 5IFLA 3DBLA 4PG4A 2FMUA 3TOZA 3ZWCA 1XLTA 3TL2A 5I7VA 4OL9A 1N7HA 1A71A 1V3VA 2O3SA 3DTTA 4YRDA 7MDHA 3JYOA 3D3EA 5A9TA 3BZUA 5DBIA 3JQ7A 5H82A 1QMGA 3JQ8A 3S2FA 4DIOA 1PQPA 5CG2A 2AEJA 3F5SA 4K1LA 2YW9A 4IJWA 3C1OA 4CPDA 4YJGA 2G82A 3NDRA 3TNLA 3H9QA 3WBFA 5KJ1A 2AEFA 4DUPA 1GAEO 1Q2XA 4BO1A 1NFFA 4KQWA 4P4NA 5I9MA 3W8DA 4GL4A 5A9SB 3M1LA 2NM0A 3KLMX 5JO0A 3UAGA 3M2PA 4NH4A 3UKOA 1X15A 4E5YA 1QV6A 1DHRA 1S6YA 2Z5LA 3G3EA 1EBFA 3ITKA 3MTJA 1N1GA 3V1YA 1ZK2A 5I9LA 4IDFA 2VYVD 1EVJA 4M55A 4R54A 2NWQA 4R01A 3VAZA 1K0UA 5C37A 2RH8A 3ZHYA 4E3ZA 2Q99A 1YL5A 3FBGA 5EQDA 4IJKA 2LDBA 3JSAA 1ONNA 3LLSA 6LDHA 2UAGA 2X58A 3IIEA 1O8CA 5L7YA 1XIVA 1FF9A 2GR9A 3DAPA 3JD1A 4J16A 5GY7A 3WIEA 4MVJH 4EJMA 4R4JA 3GNTA 5G4KA 3GMSA 4XX0B 4DIFA 5JSFA 4A73A 4K26A 2PTGA 4J4HA 4EUFA 4L9RA 2OFPA 1TB4A 2VHVA 1BWSA 1E1LA 1QRRA 1XCBA 4U7WA 2X5JO 4U6QA 5JY6A 2Q45A 2GF2A 3P5SA 3RC1A 1F8GA 4CR6A 3RROA 2I3AA 2O3JA 4I5FA 2D8AA 1PQUA 1T24A 1G0NA 3JYNA 4R9RA 3NT2A 3QVWA 2X9VA 4IGEA 3OQ1A 5BT9A 2QZZA 1UP7A 2PZJA 2NU6A 3QE3A 3NV9A 1K6IA 4GBJA 4KUGA 1KS9A 3NTRA 2NVWA 4BQPA 2FP4B 4UULA 5A3JA 2HSDA 4FGWA 5DULA 3ZCXA 1R66A 2NSDA 1BG6A 4DYVA 4J7XA 3AUAA 2ZJ0A 4NNJA 1YL6A 1GQ2A 2OO5A 2Q3EA 3GUCA 1RJWA 2C5EA 3GK3A 3PGJA 1N8KA 4CMAA 2I67A 3HNPA 4YCAA 3W8EA 1TT5B 2PWZA
chains in the Genus database with same CATH superfamily
3FYDA 3OFKA 4QHSA 1M74A 1V5GA 4MHSA 1YL7A 1JI3A 2WDPA 4IDEA 2NSHA 2XMBA 4ZVTA 2G63A 5CH8A 2O8CB 1QDEA 1R6AA 1S8AA 3KB6A 4LDPA 4MEAA 3WMFA 1I5OA 5CVJA 2ZE6A 3F5FA 5BYBA 2C58A 4AJIA 3JTMA 3EBOA 5EXTA 1O54A 1U8FO 3LXUX 2ZVDA 4KI0A 3PYMA 4WECA 4L16A 5AR1A 1GPMA 2AT1A 4LNHA 5IASA 5L53A 3H0KA 1PK8A 4MW5A 1WNFA 2QD4A 5UKDA 4PG6A 3T12A 4EEKA 2NO9A 4X0EA 3TXXA 3C41J 4RIIA 3STXA 5ITVA 1A9ZA 4G01B 2LTAA 1DGQA 2J5XA 4L4SA 2PGLA 4RPKA 1PUJA 4JJEA 4PLYA 1I01A 4M1QA 3F90A 5LBUA 1L7AA 1UDWA 3QKUA 3UUEA 5HQ3A 3RIXA 1ACLA 2F43B 4RK1A 4YN3A 4B7UA 5CCXA 1CF4A 3F49S 2FSSA 1BTOA 2C8VA 3DE5X 1XA3A 1V8ZA 2PY6A 2VK1A 2HF8A 3D3QA 2DHEA 2NZYA 4H7PA 3A25A 1JS1X 4AN4A 2HZBA 3SSAA 1SG6A 3ANYB 3GUHA 2C5HA 3ZWYA 3ND8A 3WAGA 3W7BA 4CMJA 2E85A 2LKDA 4X6XA 2Z3ZA 1YZ3A 2HA4A 5J4LA 1G5HA 3MCUA 3DPIA 5FTMA 5IABA 4KUEA 3KR9A 2A5LA 3FFAA 1VG9B 1CPYA 4OI0A 4WDRA 3SFVA 3HJBA 2W4IA 1UDRA 3JYQA 4BNVA 2VF5X 1AXGA 2AJDA 4CT0A 3QEBZ 4EGAA 4E2FA 4KREA 2H57A 1YRYE 2NYUA 2VDKB 1G1MA 1JJFA 3A1EA 1SCBA 3BDVA 4QYMA 5D8DA 4HDOB 1YZHA 3CB4A 5KJEA 3P45A 4MKIA 4JENA 4XCVA 4BB5A 4B31A 2QAJA 4UFOA 3BZWA 4CF3A 4Y7CA 3DZCA 2HNBA 1II0A 3M3PA 5FO0A 2B2CA 1I1QB 5L40A 5F1KA 2BH2A 4J90A 2AX4A 2I3DA 3PNPA 4XUDA 2H11A 3KZ1E 1Z06A 5ARBA 1B6TA 5LQDA 5JSZB 1VA5A 4LYJA 4H3VA 1JG7A 1GV0A 2P65A 3VC2A 4RSHA 4JXJA 1PBNA 1I13A 1E6LA 1NC3A 1XHEA 1KNXA 2GI4A 1J00A 3FSGA 3GLVA 2IOFK 3GQBA 1W59A 3GGSA 1BN7A 2NXEA 4PZUA 4Q9HA 4CCYA 1HDIA 1K5PA 4Y6QA 5KJ6A 2VQEB 2NACA 2C2ZA 1YS6A 3D64A 3H75A 1X94A 4FNGA 5J4HA 1DX4A 2FN3A 1FLDA 3MMPA 1QVWA 4MQFA 4U2KA 1NN3A 2VJPA 1BH2A 4EF5A 1W6UA 1ZUNB 4CN8A 5JBNA 1NJ2A 1WPGA 3L8YA 4G65A 4UU7A 3HDYA 4U2DA 5EKUA 4ZVRA 5TMEA 3T7RA 5BVHA 1OCEA 1ZCZA 1SNYA 5GOTA 1FUIA 1U80A 4EEXA 1HDZA 5C53B 3U9TA 2BTQB 1S2OA 3OCWA 2YVAA 2NZ2A 4NU5A 3AEKB 4JVNA 3AF6A 2WEKA 5EMHA 2W7TA 1KSGA 4BQQA 2GWRA 3KZMA 1R4MA 3CX7A 4ID3A 3S2YA 2IA5A 3ZU2A 2HKIA 2SBTA 2RGNC 4X60A 1DQYA 5AHOA 3R7FA 4DL9A 4DREA 2BRUC 3GLFA 3LPLA 3QWHA 2EOAA 1W30A 1SHLA 5CW1A 5ENVA 1ZGGA 5LUAA 3BEOA 5JS1A 3EWAA 2X5OA 4W8HA 4FGKA 4GI2A 4Z1MD 2XA2A 4JNKA 3RPEA 3TNDA 3IILA 3QYFA 3ABIA 5K4AA 1D1PA 1GZ3A 4IAOA 4BWVA 1KAQA 2AG0A 5ETJA 1CWUA 2QYHA 4P2GA 2PUFA 1EM6A 1SC3A 2Z3VA 4B4WA 2YC4C 4HSEA 4ZEWA 5IS2A 1E9FA 3AVQA 2C95A 1YBVA 1XZIA 1KKMA 2QI9F 521PA 2B83A 5KYXA 2IU6A 4PAOA 4REQA 2IZ1A 3S2UA 4LWPA 4XIGS 3FUCA 4F4IA 1TTPB 1HQCA 5F3WB 2ONZA 2PUVA 3GA7A 3DOEA 4R16A 5AVZA 4B6GA 2JIBA 2BMAA 2GA8A 2Y0CA 3NPAA 3UH0A 3Q9SA 5B36A 1VJRA 2ECFA 1VRWA 3QFTA 4O29A 3BFPA 2GJKA 2QSUA 2WIJA 3QGMA 4KQHA 4LYEA 1WO8A 4CGYA 4WCFC 3ZD9A 2ORIA 1BA2A 1WSWA 5E9JA 1YS4A 3ZD7A 1BMDA 1P61B 3D9QX 2J7PD 1GEGA 2V7VA 4OJMX 4YAEA 3ZNOA 1NX6A 1RYMA 4PCUA 2OCDA 1LLQA 1BDBA 1VLMA 2B8EA 4IJUA 4JJ8A 1E5DA 2ZJ1A 2GK6A 2OM6A 3BHJA 2CBZA 1CVIA 1K63A 3E1GA 5JH7F 3U17A 2HO4A 1R9MA 4Q3KA 1X7YA 1KC1A 4OHFA 4MLZA 1XTKA 3WIBA 2XJ9A 1L4YA 2JK1A 2NYRA 4IP0A 3RS5A 4RD2A 1ZJ4A 5FWNA 2O1SA 4J0KA 3L7MA 1ZY2A 3B13B 3TEJA 3W7AA 3HBJA 4DJDC 2IU3A 1TGVA 2A0FA 1JJAA 1KI4A 1Y4UA 2IVZA 2PL1A 1UZNA 5CRIA 3MWJA 1N25A 4NMXB 2R8EA 3S2IA 1XTVA 1FW8A 4LZOA 2O9JA 1C7RA 2XWPA 1LLUA 4PLHA 5GJCA 5C52B 4DJJA 1ZK3A 3DZDA 4IZOA 3LQQA 2FZLA 3I6ZA 4RK5A 5KX5B 5M5BA 2O8VA 1EFHA 5IVKA 3O93A 2J0QA 3PIIA 4HUJA 1P0CA 2FY8A 3GJ7A 1ADCA 1J2JA 2D06A 5E7IA 2AVDA 3E9CA 1NG9A 3RM3A 4HUQB 3MB5A 5KYXB 4RHYA 3PQFA 3AP2A 1LVUA 4E2XA 4QHYA 4LMAA 4OVKA 1MG5A 4YJ2F 4F56A 2WUFA 5ICGA 5CYFA 3W2GA 4IDQA 5EIOA 4M7PA 1KRXA 2A1UA 2CDCA 1MIOA 1UT5A 4OGFA 4ZD6A 1WXHA 1MNAA 3LTEA 3AP1A 3STWA 3BGOS 3T9CA 3OE4A 2ZATA 3DLBA 1V37A 3OCCA 2WYIA 2IWHA 2KLHA 2A1TR 3EFOA 3ZIUA 1T6BY 3Q11A 1GCUA 5H4GA 1W75A 3T4XA 2PX3A 2WJWA 3O0DA 2EKBA 4EHAA 2BEVA 4L5CA 1BU5A 1J8MF 3MBIA 1QZZA 1LBEA 4UZEA 2EP7A 3RYTC 2HZ7A 3JU3A 4ZDIA 6CHYA 5EJMA 4QGSA 2W6MA 1HE3A 3U40A 2QTCA 4Y9DA 2X86A 2BPOA 1Z6PA 3N6XA 1CZUA 3VJRA 4QFDA 5LVAA 3DMTC 5DMHA 4D9CA 1AN0A 1CUZA 3HVJA 4ZDWA 2NW6A 3IBYA 3GELA 3OZEA 4HDAA 4WKBA 3VTZA 2FWMX 5AQ1A 1KGSA 1U3DA 5HILA 1JEJA 4AYTA 1BIFA 1L5SA 3FMIA 3AVUA 2AW5A 1CUAA 1ESNA 1OBOA 5K6AC 5KUTA 4WACA 1I0ZA 5LQUA 3I04M 3KVOA 3H5AA 1LJUA 2QLNA 4S1NA 5T4FA 3BJZA 1FVXA 2PUHA 4M54A 5EQFA 2XRFA 3NJ4A 2IH5A 5AFSA 2OV3A 2QRVA 3HXQA 4DF3A 4DCUA 1KAMA 4X92A 1KYXA 1FNSA 4FW9A 3VYWA 5IVPA 1JBKA 1GKYA 1J97A 1RWVA 2B4QA 2VLBA 3DOUA 5TPWB 3EY9A 3HDTA 3Q10A 4O4LF 4GFDA 5EFZA 1F20A 1PLKA 1EUCB 4PHGA 3FKJA 5KO2A 2OBYA 1T5BA 3H05A 3LT1A 3VU9B 1Y5LA 3D43A 5HRCA 1T5IA 2WVJA 2C4NA 1IZ9A 2G1JA 4V2IA 1TD9A 4R1UA 5IARA 4FHGA 2EW1A 2D1TA 2JFOA 3GEHA 5FCDA 1N0UA 3L0DA 4I55A 4M7WA 1I7QB 4IOKA 1BXRA 3VNVA 2Y1XA 4PQFA 3UPDA 1F1JA 4HTAA 1P4SA 3C45A 1UK9A 1VSBA 4RULA 1SAYA 2RHCA 4DJFC 1GFIA 3K70D 2EGHA 3K0FA 1DUSA 5LC1A 3ASVA 1BNCA 4ABTA 3MOGA 1KP2A 3CISA 4DLBA 1YUBA 1WMAA 1WXWA 2H7XA 2C4WA 4R3NA 4XQ0A 2Q9BA 2C5AA 4KYIB 2VWQA 2QL9A 4MV5A 4GOMD 1CYEA 3MIIA 3Q1LA 3TLMA 2G5CA 4WJLA 4KMRA 4NYJQ 3MT8A 1F7UA 4DSOA 5KVCA 4B6QA 1WPRA 2XKBA 1LSSA 1MMFB 3FE2A 2EARA 2PG3A 3WB9A 3WNQA 1SBCA 3ENVA 4IUBS 5JG7A 1UFKA 3A6JA 2OFXA 4XJVA 5JDCC 3RS0A 4Z5XA 4K6CA 2O5CA 2A86A 2B69A 4QECA 4A23A 2WU0A 4CL0A 2WKRA 3F4BA 4MH0R 3GL9A 3T7TA 3ECSA 1EK0A 1G8FA 1DPFA 1KDOA 3HGMA 2AYZA 2FPMA 4OCZA 1XK7A 2AK3A 2GJ8A 5HS4A 4LNUA 3K72B 1TZCA 1E9DA 4GBGA 1NVWQ 2NUAA 5BW5A 4EQZA 1E7MA 1BQ3A 4C7KA 1UXOA 3TQOA 3UT6A 4CFZA 3H2ZA 1PR1A 3SHFA 1F2TA 1OUMA 4TL8A 1REQA 4QTYA 2I6XA 4FMCF 4J1TA 1IBLB 5EXSA 2DYKA 3G9XA 2I2WA 1M6EX 1O6BA 3ELYA 3OVMA 2CMGA 4UUQA 3D6HA 1N78A 3PFHA 1YOBA 1US8A 3UWOA 4ZYWA 2GBIA 1TLLA 5IKXA 3WK5A 1QH1B 3LPNA 4PR3A 2OWEA 3FUUA 1MFPA 5FTKA 3E7DA 1ZQ1A 5LP6A 4OSOA 3P71T 2P40A 1X19A 1GL6A 3MWLA 4O4JA 5DWVA 3ULKA 1J23A 1UZUA 4TTJA 1TU0A 2QI9C 3UK2A 4QX6A 3OA0A 2P7IA 1YOVB 3MCVA 2AZ4A 5KYYA 2WMOB 2WUEA 3MFYA 1OREA 4GAEA 2O48X 4ABYA 4CU5A 4JEUA 3FWKA 5B5SA 1IDOA 2IBMA 1MJNA 2JRLA 1U8YA 1OJ7A 3NHFA 3KYIB 2RHDA 4DBZA 1MU0A 2FEOA 2PUWA 1PNTA 3BBPA 1ZEJA 4BLTA 2OL4A 2FCRA 3P52A 4HH0A 1ZCFA 4CKCB 4G0QA 4CRWB 3HN7A 3NUZA 2GEVA 4J1SA 5GONA 1HEYA 2HRDA 1PU2A 2XNDD 3B5IA 4XQGA 4DQXA 1RWKA 2J9XB 3ZY6A 3BCHA 5BRAA 2O0JA 5BW8A 3D2AA 3PQ2A 4P0PB 1IY0A 4KLRA 4XEHA 4CR7A 1W0JD 1PT7A 3CZCA 3L1UA 1AG9A 1S8NA 1J2TA 2BFCA 1PJZA 3HZRA 1SUEA 1WSBA 1VGRA 3QP9A 1F6DA 1RHJA 1Z36A 3E05A 3PQDA 4E6EA 2O5VA 2M98A 1ND5A 1OC2A 1VP9A 2H06A 4YEDA 3JQRA 3AG6A 4DUYB 2EC5A 1ML4A 4ZJZA 3BGSA 5EJ5A 1CD5A 1OXMA 3ZC3A 3H19A 4DJ5X 5HJ2A 3G88A 3RFCA 4TWJA 3HR4A 5JAPA 1J1ZA 4EB6B 4BNWA 1NJ1A 5AVVA 5FWXB 1JHPA 3BFVA 3O6VA 1PT6A 4YVFA 3M3DA 3V4ZA 4E31A 3W4JA 5B57C 4GDMA 5TMPA 2RHBA 3RVRA 4DQ0A 3H5IA 3WNZA 4MGEA 4ROTA 4L6IA 4NCJA 3FNRA 1MB4A 2H9AA 3HJUA 2FZ4A 1V7ZA 3RWBA 2EYQA 4ZZ2A 3H99A 5A4KA 3IESA 5E3IA 4YQZA 1VCIA 2CXXA 4QELA 1CRPA 2CLEB 3ZLUA 4ZV4A 4LRSB 3V9AA 1V2HE 2B21A 1QH9A 1DIAA 2ZBGA 2OSVA 1T3TA 2QIOA 3B1VA 5FOTA 3ZE7A 1H8HD 1DC3A 1QIEA 1A8HA 2YMPA 1J06A 3IC5A 3RT7A 1X14A 1YZTA 3K6JA 1E2DA 1CE8A 1M0WA 3KHKA 4E32A 5J47A 4ND3A 3WJAA 3IOMA 4HV4A 1BFKA 1HC7A 1Q5PA 3IEMA 3FTEA 5GM1A 3UWSA 2XJ4A 3DG9A 2BFWA 2R6AA 2W11A 3ESYA 1ZH6A 4KO4S 3LW7A 3OE7A 3WHLA 2ABWA 4IDPA 1G9TA 2QRUA 3PEUA 1XQ1A 2BMFA 2DHRA 3EZGA 1U2DA 1X3SA 1AD2A 1DC7A 4L8LA 4UEQA 4XD7D 3S7TA 2VRWA 2YR0A 3BREA 5JYCA 3KOZA 1JAIA 1OX4B 2Z58A 4RC9A 2DKNA 2MR5A 2VDPB 3S70A 2VBIA 2CNLA 2YJZA 2E5WA 1U7WA 5B30A 2VF2A 3A6PC 4B46A 2DY1A 3LNTA 3A70A 3P32A 4BLSA 3NEJA 4H3KB 4QDTA 1G8YA 3FHCB 8ABPA 3S8MA 3GLUA 3Q9LA 2H1LA 1TM5E 4J2HA 4OXYA 4WJKB 1E0JA 1AQUA 4IIYA 1XAIA 5JUWA 4QPZA 2R7MA 4WOKA 5T4EA 1H2WA 3GEEA 3QF4A 1Y34E 2G5GX 4W4TA 3A2KA 2OO5C 1GUBA 3OQBA 1TUGA 1C9NA 1GKUB 2JI7A 3JASA 4HJXA 5ALLA 1ZD4A 3SEQA 3GZJA 1KOJA 4B7XA 3HYRA 1G20A 3OZXA 2PUEA 2WAOA 2EW8A 3B8EA 4MMYB 1G0OA 4QWMA 1ZVKA 4EVIA 3G0HA 4X41A 1R10A 1CUCA 1QAOA 1JILA 3BWEA 3I76A 3AKZA 5IBPA 1O6GA 2WF8A 4XGQA 4MWCA 3DV0A 3SKYA 4DC0A 5F76A 3CNEA 3AIIA 5TGTA 4ZRNA 1XQWA 2EBWA 2ZSEA 1KOLA 1N2EA 1V8OA 5JADA 1KO8A 5ALWA 3U3XA 1XXHB 4CUZA 3EARA 4MMXB 3W4IA 4BVGA 2YJ5A 1OZAA 1YB7A 1Z6AA 1Z25A 2PR2A 1WV0A 1LPPA 2XUAA 4BEJA 2AN3A 2X7JA 4LHVA 3EDCA 1VG0B 2HBZA 5DCWA 3RK0A 4Z4CA 2REXB 3SQXA 1DKLA 1X7YB 1NTRA 3AY7A 1NRJB 2BY4A 1MPTA 5U4XA 4H2DA 4ASUD 4F3YA 4G5OA 1OY1A 2Q28A 4IMRA 4MX8A 1SN7A 1ULSA 1UMBA 1VYHA 4OHCA 5LCXA 2OC9A 4NFLA 3ODGA 4BAUA 4F3TA 1JJ7A 1MLDA 4FDAA 2FEWB 3IBTA 1AS2A 3DEKA 4M1OA 2R97A 3EUWA 4FHDA 3C87A 3D31A 4UASA 5JALA 3KFVA 1XRJA 5M29A 1CDZA 4LYGA 5LLDA 2JI6A 1T36B 4YP7A 4FFDA 4NARA 3A2MA 3KXLA 3P4YA 4JLJA 5BYAA 4Q47A 3NVKI 1Y82A 3B5JA 3QX8A 4RY9A 3HC7A 2DKOA 4W82A 3RANA 2RGEA 5ALXA 1DIGA 4LE2A 4A8JA 1BROA 4LDAA 1I33A 4P08A 1M1UA 3AUYA 2C3PA 2MJLA 1IZ0A 1U7TA 2Q4DA 1N2IA 5CLJA 4IYJA 4QHTA 1N6IA 1Z73A 1XQ9A 4XUEA 1BHJA 1GQOA 2PVCA 2BFPA 3FB4A 3L4EA 3KLPX 3PD7A 3VFDA 3EIXA 1AVTA 4HQNA 4O0LA 3A9RA 1XDDA 5HF9A 4U2CA 3V48A 2CEAA 1YJ8A 4Q12A 4DCPA 4DCGA 2C1XA 3I05A 5CJ2A 4UAVA 1BCRB 5C5DA 3GDGA 3NDJA 5K8JB 4QUEA 1S96A 3N9IA 5K6AA 5J2UF 4JCOA 4LZAA 5BSMA 2C7PA 2EZTA 1PEYA 3AY3A 1EQAA 3BMQB 2VJQA 4PYLA 2O2ZA 2ZYAA 5DT9A 2CDAA 2B9EA 3WLPA 2P2SA 2BDTA 4OJQA 2HAEA 5SZHB 4D4GA 4WLEA 2XDAA 2W00A 2JH8A 3IVGA 3TIXB 2I7VA 4EI9A 3ZH2A 3P1JA 2X5XA 3ZDQA 5DNVA 4RA9A 5IDYA 1IM5A 2BR5A 2QP9X 2Q5FA 3A10A 2HMVA 5B3KA 4YRKA 1L8XA 4IIJA 4UNSA 1ORIA 2YVUA 4XEUA 4YMWA 3NONA 2GHTA 4C4YA 1CP2A 2HPZA 2OQRA 5AKIA 4P31A 2XMRA 1K8QA 3QOYA 5TY0A 4CMGA 4ZXFA 4D92A 3BJEA 1NT2A 3SEZA 3IAS1 3IIIA 1D2AA 2WWIA 2CDNA 3PUXA 4BEVA 3QJGA 1IJKA 2X8AA 3CMMA 1OF1A 4EJ0A 2WM3A 2PMCA 5GOZA 5K03A 2YWDA 2Z9CA 2OD7A 3GLSA 2V3WA 4X1IB 3TAHA 5AUPB 4KO3S 4KR3A 2EKLA 4PF1A 2G67A 3TR6A 4JP8A 4MICA 2ZS7A 4ZCSA 4KIFA 1RRKA 1A8IA 2UYYA 2D8MA 2QM0A 3VYVA 4B6SA 4IQGA 2ZRFA 3OX1A 1S0UA 1RLMA 3L5KA 1HDXA 2GD0A 3LPCA 4G2TA 1L7XA 1MKYA 2AXQA 3I2JA 3A3KA 4N7JA 5CNJA 2JVKA 3HE3A 5JVDF 4AICA 2JBAB 2QKYA 4DWJA 1DVRA 2CLSA 5DTJA 1P1IA 1XCOA 4DA0A 1RKQA 2G09A 3RU3A 3I6YA 3OIYA 3RAPR 4DIMA 1G3UA 1W36D 1KBZA 3H8WA 4KLCA 2IHJA 2XUKA 1NMYA 2J3EA 1CJKC 3FUVA 3PT9A 5IXSA 1FMLA 3N05A 4JN6B 1NQ5A 5GM2A 2B94A 3F47A 1Z88A 5JIBA 1MAAA 3ZZMA 3LLUA 1E8NA 1EXMA 1LI7A 4IQFA 4NU0A 3C4QA 4WDQA 5FFMA 4TKVA 1Y4SA 1N7GA 2FPGB 5A5GA 3IOYA 1IOVA 2E82A 1E62A 1YZQA 2EV9A 2GYWA 4FGLA 4N5IX 4Q3NA 3W77A 4FYWA 4BO8A 2QUIA 2NO0A 3UMFA 5C8XA 4UM9D 2GCOB 1BJKA 2I99A 1TA9A 4EA6A 4YRIA 3DWIA 5FUXA 3CPJB 3ZVRA 1XMPA 4NONA 3DL2A 1TYEB 4G0UA 3L4JA 1GNTA 1QPGA 4O25A 1L3IA 4TZTA 4ZVUA 1XROA 2N3ZA 2XMPA 4OY3A 4US0R 2OXIA 3KU1A 2GRJA 5HKOA 2JHFA 3N2IA 4PYOA 5A0VA 5FNVF 1WP9A 3VPFA 2AC2A 1NZJA 1KXJA 1XQXA 4JXKA 1ORDA 4D1YA 5LN1A 3I1JA 4G41A 2QN6A 3AEUB 4QT0A 5JRDS 3K0SA 1IEVA 3R0IA 1WUKS 3AETB 3L0OA 2XH8A 3OUUA 4XB1A 3WLTA 3ZHOA 1HDCA 1GZ4A 1GQFA 2EGGA 4MO9A 3BXFA 3N0VA 1PZFA 4O2AA 1QZXA 3KO8A 3WNVA 1AIPA 1R8YA 1X1QA 2JFYA 3AF3A 4II7A 3S27A 4A0HA 4C29A 1KVTA 1SVIA 2HHLA 5DO9A 3C0KA 3STTA 2Q41A 5ECDA 3PFIA 3PDJA 1K89A 1PBTA 2SECE 3VHXB 1XBTA 3K8QA 5DISB 4U4AA 4D4JA 4CEJA 2DBQA 2ZU6A 3DZHA 1F0PA 4J0HA 4OH1A 5FHRA 4CKXA 5FL7D 3AVPA 2IHZA 3C6KA 5AHXA 1ILEA 4N8EA 3EF3A 3EZXA 1F3LA 4JC0A 5T64A 3D81A 1YJXA 1QAQA 3DFZA 1VXOA 3OLZA 2TS1A 4W9MC 1IONA 3S99A 5KWIA 4YCNA 4DV7B 1ZR4A 2BGKA 1DQPA 3EAQA 4AKEA 3T15A 4B35A 3Q3CA 2W70A 3G85A 1XR3A 1USKA 3NANA 5AXBA 1CUGA 1Y7IA 3U7HB 4J6EA 1YOVA 3B7PA 3D7SA 4ED9A 1OOEA 4Q1BA 1U0RA 1JTVA 1RBMA 4CZ2A 4OB6A 2A92A 1HA3A 1VHQA 2JJMA 1WEHA 1Z4OA 3PNOA 2Z6VA 3G5MA 3O9ZA 3UV6A 1BFUA 2GPTA 3QXCA 2V5AA 2E2WA 2HLPA 3GF4A 5EHZA 3NBYC 4Q00A 3ZU3A 1E58A 1Q20A 2TMDA 1O96A 5B4UA 3LUJA 4LX0A 3H7AA 4K6HA 2O8CA 1F5SA 2AG8A 2XTAA 1A9QA 1CZOA 3A32A 3E2IA 4YJ3B 1JT9A 5CA1F 2CXQA 4LVOA 3ROFA 4MRVA 1UKAA 2IIPA 4ARUA 3RGGA 2QOEA 5JE8A 3RC8A 2VH1A 2V6JA 2LPMA 4BO5A 4DR7B 5LP1A 5THQA 1D3AA 421PA 2OXFA 3HM2A 1QCZA 4N76A 2Q3DA 1XTZA 1Z75A 1O57A 3NWPA 4DLUA 2Q0HA 5HGJA 1S1CA 3AERB 5AM0A 4DADA 1OI3A 1AKNA 1NQOA 1M5RA 3VR6D 1WM1A 2JIPA 3A6ZA 3WWYA 2EIHA 2FMKA 1FPMA 2LUOA 5E9AA 4Z7JA 1KI8A 1N57A 5AI0A 3DBLB 5LQSA 5JPDA 1ZSYA 2FDRA 1SVLA 3AB8A 2G83A 4F92B 2YY6A 4EW6A 4BNNA 1QYVA 2FXVA 2WNIA 4EGJA 4MW7A 2VA8A 4MV4A 2WIFA 5AMXA 2OTCA 3R0VA 4YXWA 2ZEJA 3HCCA 4CCWA 1Y3CE 3LUCA 4XVQA 3QLTA 1L1FA 3IEVA 3KYCB 2WAAA 3SC2B 3HJAA 5ICSA 3KQPA 3I9V1 2O8BA 3E5NA 1CQPA 2C82A 1N2HA 3OWXA 3ZV4A 1UK6A 1E2MA 4S1TA 3QVSA 1CSEE 1CUUA 1YU6A 2J3IA 1JR3E 3HLYA 4BWFB 4LJ6A 2DCUA 1H8EA 1U0SY 4AB1A 1TEVA 5DV9A 1E2PA 2HOQA 5HKLA 5LD2C 3MRXA 1P33A 4RJLA 4OK3A 1E3DA 4DMGA 4JY7A 1YBAA 2VJBA 4N3NA 3ZQJA 1Z7BA 1XRMA 1DO0A 4LGYA 4DXHA 4ZOEA 3N6VA 2VDWB 1H3EA 3ZWXA 2GK7A 2I5PO 1XEXA 3BHIA 4BYMA 3AKYA 5KTKA 4LF7B 4YRRA 2NTJA 2V7XA 2YXLA 2GF9A 4LQLA 1K75A 3U3OA 4AJLA 4EZEA 1X2EA 4MI9A 1YI1A 1BOOA 3DOJA 2GVZC 1R6BX 1NDHA 1FFSA 1U9JA 4MYCA 5DLYA 4RPJA 4ZYLA 2YZ2A 4I1SA 4EZIA 3SYLA 3WYEA 3JVUA 4UTRA 5CBPB 4W99A 3NBQA 2ZIUB 3ILVA 3UGJA 1EI9A 3GJQA 3QY9A 1RACA 3KJIA 2DTDA 1E6KA 1QYDA 2O3UA 3TW8A 5H3LA 4I1VA 1DC8A 4IIBA 4DZZA 4Z8XA 1XZBA 2ALJA 3V4PB 3N2LA 4QGGA 3DDZX 1EJ6A 4CUKA 4DJTA 3GLQA 4A16A 1XF9A 1Z2CA 2BZSA 5BYJA 1AOXA 5JW6A 2F8LA 3OT1A 4RJ2A 2EW2A 3DZIA 2YHBA 3WKBA 3TLGA 4AUNA 3HN6A 2Z2YA 5HS6A 2ETVA 3T9AA 1EFRA 4Q9LA 1CFJA 2O0MA 3DBIA 4L0QA 1O4VA 3HU3A 3ZCVA 1VKJA 4FINA 2A1UB 2XNDA 3WB1A 2G7ZA 4EDHA 3ZGOA 4C5BA 4FMDF 1XU7A 3WLHA 2VHTA 4XYLA 2PWAA 4QJ5A 5J2UA 2E4XA 4LEIA 1BXGB 2X3FA 3DXZA 3CKKA 1O95D 2J3MA 2OLJA 2CB9A 4ZHQF 2RE8A 3EFEA 2VAWA 4CXMA 2VCHA 3WSVA 1OLUB 1MO6A 2FPGA 2P4EA 3FOWA 4PNHA 2QYSA 5B1SA 1C0IA 2PH5A 3AIMA 4ALLA 3B3QA 4WOBA 4FOSA 3WAKA 4PQEA 1V35A 1NZFA 2D0IA 1JKJA 3K9CA 4AJJA 3KTDA 1MVNA 3AIKA 4B8WA 2PSEA 3BSSA 5B37A 1DJPA 3BTUA 2VBFA 3CF0A 4UOEA 1M2KA 3CLRD 3G59A 3L7JA 4WD3A 3LHFA 3FPFA 4BBJA 1N0VC 4GE3A 1KH3A 1DRVA 2B6HA 3T0GA 3N2YA 4DA4A 1DJLA 1P9OA 1M67A 4OI4A 4TKUA 4TLMB 3T94A 3GT4A 4GP7A 4PGMA 1TMKA 3GBVA 3QVTA 4ND4A 3AR9A 3H9EO 4KEAA 2JFUA 1U2QA 4I7EA 4MW6A 3K70C 1OZHA 3RRNA 3A6DA 4DV4B 2R65A 4P9NA 4G84A 1HEIA 3E53A 5FI0B 4B32A 5BYKA 2PJRA 2A0YA 1AO0A 5EKSA 1XO1A 2MR6A 2GCIA 4X94A 1M8GA 1NF9A 1XDWA 1CS4C 1CXZA 4W6QA 3MCAA 3E4DA 3C74A 4R7TA 5K6TA 3I61A 5H1YA 1S4MA 1GZ6A 4P58A 1CX9B 1TPYA 4CF4A 2F3RA 1FDUA 2HWKA 4ZV7A 1H2AS 2W71A 2CSUA 1ZIDA 4GNKA 4PRLA 3HA5A 1CY6A 1UJCA 1OFVA 2TRSB 3TJRA 5KEIA 4P98A 3R5XA 3W5DA 3DYIA 1HOTA 4KHZA 4L5AA 4OYYA 4K0RA 2CVQA 1E9CA 3MFQA 5F3RA 5SYNA 1PL6A 1VPTA 2XYQA 3AZQA 4I55B 4N01A 3T52A 5BUQA 1JR4A 4KITB 4I9FA 4EAQA 1UT6A 4IKOA 1CKEA 5JMWA 3CNOA 3GT0A 4X6LA 3RAJA 3X2FA 3LIPA 5FT9A 3KQQA 3R3ZA 1K3FA 2N46A 3MJHA 2PANA 4OD0A 3UK0A 3HV0A 2GJSA 5G1NA 4CLRA 1Z2EA 5JXJA 3T7DA 4BQSA 4JBNA 3R9KA 4EJSB 1SRQA 3K1TA 3G7NA 5LNK6 1GLNA 4HF7A 2B2NA 2QA5A 3V7NA 3VNSA 2XGSA 3G5TA 5FFFA 1RRVA 2P6MA 4HNRA 4HRYA 1MX5A 4OUDA 2ADMA 1KPHA 1PL7A 2VSOA 3JQGB 4JROA 3TO5A 4BC1A 3IO5A 2J67A 1ETHA 3JQPA 3NUGA 4IEEA 3W06A 4F21A 3B9PA 3IPAA 4X1IA 3S7ZA 1UDAA 4EX7A 3QFSA 1R0SA 3QTBA 4FDMA 4GPAA 2O2SA 3FR7A 4OV6B 1UMCA 4RPCA 4UBMA 1RMQA 4FD2A 4JLUA 4BO7A 1LH0A 2VI5A 5EN4A 1F17A 4JGIA 4GPBA 3S8EA 3ZE6A 2F3UA 3O1LA 3V8NA 3WGZA 4UEKA 3O4VA 3WYCA 2H2GA 3ECAA 3ONDA 5E6RA 2A9KA 3I83A 3NIDB 2C5SA 4UNRA 2EKQA 1V25A 3M6XA 3PT5A 4TOIA 2X1LA 4XZ3A 5L7WA 1KPGA 5LOVB 2V9CA 1XD9A 4NZYA 4KUHA 1L5ZA 1U7UA 1XZHA 2FW7A 2OCXA 1K8YB 3QW2A 4JMLA 5JMPA 3V97A 2UYHA 1IWBB 2OYSA 5JJKA 1CEQA 1JA1A 3QEOA 4D0RA 4M0DA 3BOSA 4IIDA 5JSQA 1AS3A 1NBHA 4FFNA 3UHOA 5JS8A 1UPBA 3Q8MA 2WKQA 2ZR7A 3D7LA 3P9QA 3LPMA 4FEAA 5B12A 2GFHA 1WTCA 3JAWA 3IULA 1TYBE 3ZH9B 3G17A 1PGNA 3HRIA 2I33A 1CEEA 1ECCA 4EFDA 3LBIA 2XMZA 2E7ZA 3I9NA 4ZA2A 2NQTA 5EP2A 2J3DA 4L3OA 3CKYA 5D5PA 3CE9A 4NNOA 5AKGA 4WL0A 4HZGA 3R3UA 5C8ZA 1MJGM 1AC5A 3BMNA 2CMFA 2GLUA 1E1QD 3KWLA 3RVLA 1JMKC 4OGGA 3T3DA 1DBWA 1IUOA 3TNYA 2D6FA 8MHTA 1ZMXA 3M4ZA 2MSNA 2BF7A 1L8LA 2Q0SA 3PGA1 4TZKA 4KQXA 4RVNA 5NLLA 3PXGA 2BM0A 4EUEA 2Q21A 1JQAA 1HMPA 3AW9A 3S1AA 2GBFA 2PMBA 3IVAA 3P2EA 3FW1A 2JLZA 2IDMA 3ILSA 4BMPB 3L1KA 2ZRQA 1T4CB 2GBCA 4CM3A 1X0XA 2W2LA 5E4YA 3ZJVA 2JH9A 3S2SA 4WADA 4MWSA 4BNGA 7ADHA 3F2VA 4TS9A 1E3MA 1QK3A 2ET6A 5ESRA 1YJQA 2Z4RA 2J33A 5A7HA 1SURA 5LOVF 4JOSA 4DDUA 5E6UB 5K09A 1YIOA 1ZOPA 5JD3A 1GN9A 3KYBA 2YHAA 4BZXA 2R84A 4TL6A 1E2IA 1T36A 4KKXB 1QTQA 2QM8A 2JLRA 3E22A 5IH3A 4Z4GA 1FU8A 4HEA6 1WB5A 1YFKA 2PZLA 2ZAOA 1W0CA 3EQ2A 3MCWA 5T3YA 1Z82A 2CY0A 1HKUA 2QGZA 2VAXA 1FJXA 4W6ZA 3DMRA 1Z18A 3R20A 3L05A 2WTNA 3A27A 3AHJA 3ROQA 4EECA 5J1TB 5C1OA 3ELDA 2ZDHA 5LMNB 3HFJA 4OA8A 4MV9A 1OHHA 3ZHQA 2OZPA 1RI3A 1GN8A 3CUEF 1NLMA 4KYVA 4RM3A 3SK0A 4U7DA 2C8KA 2HL6A 4QPDA 1FRQA 2EJVA 4CNQA 2DUMA 2NPIA 4R9VA 2IXEA 2CDRA 2VZ0A 1LRJA 1QE5A 3GLGE 3A31A 5FPKA 4ZTBA 2CJFA 3HJGA 2YXNA 1A5ZA 1GCIA 1R18A 2PA0A 2RHWA 4KIUA 1JP7A 1Y7HA 2QTMA 1ZOLA 3LWBA 1H8ED 2V7WA 1L4FA 3K6RA 4KG7A 2VYNA 2BFOA 2DPMA 4S04A 4MVCA 2B1RA 3LCJA 4LWQA 4TLDA 3T3HA 4MCAA 4V3BA 1S7CA 3DKKA 3AL2A 4KRYA 2ANBA 2JLUA 2C3MA 3EDRA 1PQYA 3HJCA 3RARA 1QFZA 4MIOA 3V8EA 2P2CA 3VDMA 1NI3A 2CVPA 1W47A 4YNBA 1S89A 4GZ3A 1X0VA 3REFA 2O50A 2ZE7A 5COBA 4DBLE 2WNSA 3CLVA 3LMKA 1UMKA 3BGWA 3IUQA 4X90A 1EYZA 1YBFA 4O59O 5CVEA 2AD1A 1ICEA 2WI8A 3PDIB 3GPBA 3DWFA 2F4NA 3K16A 2G9VA 4IH4A 3SXPA 5HRUA 3RYHB 1JF8A 3Q9NA 4JIMA 1TT5A 3HYLA 2XDQB 2O7QA 5ENZA 2HA5A 4GZ6A 4CDGA 4Z4EA 3IURA 4CIXA 5CA0A 1P81A 4BWGA 2FWAA 4BV9A 2PXHA 2AFVA 5THKA 2YUIA 4O3MA 1R0RE 2IV7A 5ADWA 4OREX 2HRRA 2X2EA 3DVSX 3VSEA 1TAHA 4DXDA 3Q2OA 4L51A 2V6GA 1QGED 2I29A 4DRXB 3DLCA 2LR0A 5FA5A 4REMA 2R1VB 3DW3X 4JJAA 2BP7A 4D9KA 5LDGA 3E5MA 2ZYIA 2YZKA 3COSA 1V3TA 2BBWA 4F97A 5LFAA 1PK7A 4Q01A 5DX0A 4F96A 1N1MA 3PUIA 1IHUA 2Z43A 4O4LA 3DDCA 5LQMA 4YJHA 3MBOA 4JAVC 4XSGA 3VO1A 4PG8A 3Q7PA 2X9GA 1U7ZA 2Y6UA 1TW3A 1Z4LA 3IOEA 4RHFA 4GGMX 4TMTA 3UIEA 5ELMA 2W37A 3T8YA 2FZGA 5JSZA 2QZPA 3QKIA 5C1BA 1DC4A 5G2OA 1C1DB 1REQB 4EY3A 4ENRA 1HO3A 1GPBA 2UVQA 5B53A 5KOYA 1NXSA 4QYIB 1UWCA 1YCGA 3LE8A 2DFPA 3PGVA 4X7MA 1FZQA 3TTSA 3R9WA 1JYSA 1YHYA 1FNNA 4PCLA 5IT9A 4YCBA 5D7NA 3RRFA 2Y4NA 3MM4A 2QR5A 4P3OA 3PTZA 4EYSA 3SE0A 1X70A 1E79D 2EG9A 3HPRA 4WI1A 3AK4A 4YQYA 3PUKA 2H63A 2HBQA 2ZI5A 2CFOA 4KGXA 1QLHA 2J4DA 1ULUA 5DFAA 3G13A 3R76A 4OBBA 3NVDA 1RD4A 1ZGCA 3B1KA 3NOQA 1M54A 2JL1A 2XX3A 3IAEA 4BE4A 1DCMA 1WZEA 4XR4A 5JZVA 3NDBB 3F96A 3FPJA 1WABA 2ZCUA 4PZPA 1UBSB 1RHUA 2ZWAA 3L06A 3PWZA 1NLZA 5I8ZA 3ZTWA 3CZ4A 4K9QA 1KXZA 2G72A 2VC2B 3DGEC 4O2AB 4UBLA 3EODA 4YH1A 5EL0A 3NGMA 3K9FC 4IG4A 5ALHA 1C9JA 1UMDB 2GEFA 1ONBA 1KKUA 2ZITA 4XM1A 4I3GA 4YFVA 2PO5A 5MFPA 4F91B 1J33A 3PNKA 2R8OA 3EGXA 1RBZA 3WGUA 5BVGA 3UJDA 5DTMA 3AI2A 5EHQA 4GUAA 5L3ZA 3WMXA 1T4MA 4B6JA 1ZOOA 3GARA 3RSZA 2XVYA 1JR2A 4DCVA 1AMUA 2HHAA 3ILYA 4KE6A 4O2BF 5IK2D 4GL2A 1T3LA 1TFUA 4KWCA 4MQUA 3L8FA 5BMVB 3Q3JB 1K3TA 2O0LA 5JTUA 2ZJAA 2QPLA 5LXTF 3SF8A 2NT3A 2RB5A 4P2BA 3LAWA 2A78A 4WKGA 1U3FA 2AX3A 4C4SA 2PWPA 3ZV3A 2A7XA 3IR6A 4COOA 2GASA 3STVA 5DLEA 3ABZA 4BNLA 2P6UA 3OIFA 3KNZA 2PSJA 3WZ2A 3C1AA 3RODA 1Y6GA 5BN4A 4M0LA 1I1NA 5DHPA 1GAWA 3TXAA 2VFAA 2W2KA 2QTAA 2UYQA 3AQ4A 3QI2A 4ND2A 2BH9A 3EVDA 4UHEA 3Q5GA 3SBXA 2XPCA 4W5JA 3RS4A 3MTAA 1GUFA 2YYZA 3KJFA 4CM9D 5K05A 4EIWA 1GR1A 1YCHA 4F3KA 5AM2A 2H5EA 2I1QA 2Q3BA 1IULA 2J85A 2PD4A 2V6IA 4A8TA 2C1EA 3GRCA 4DA8A 1O58A 1IM2A 4YDRA 1YZYA 3UW1A 3R0XA 5T57A 3OPYI 4C88A 1FVFA 1YS9A 4M89A 2QE6A 4DMUB 4QRHA 3VU8A 3RT1A