1OI8A

5'-nucleotidase (e. coli) with an engineered disulfide bridge (p90c, l424c)
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
525
structure length
525
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVCESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVCKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trapping a 96 Degree Domain Rotation in Two Distinct Conformations by Engineered Disulfide Bridges
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN USHA
total genus 177
structure length 525
sequence length 525
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1oi8A01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1oi8A02
2WDCA 3IB8A 2Z72A 5EQVA 2IE4C 2YVTA 5GTUA 3C9FA 4ORAA 4DSYA 4F0ZA 3C5WC 4DHLA 1S8EA 2R17A 2AHDA 3AUZA 4JA9A 4MP0A 2USHA 4XPNA 3RL5A 4WWLA 4J6OA 4H2BA 2DFJA 1II7A 2JOGA 3HVQA 3H64A 4O43A 5IOHA 2GJUA 4I5NC 1OIDA 1W24A 1IT6A 4ORBA 5J28A 2P6BA 4V0VA 4KKZA 1S95A 3GVEA 4H2FA 4H1SA 3H68A 3RL3A 3KBPA 5JPFA 3H63A 3RQZA 3JYFA 4G9JA 3ICFA 3RL4A 1HP1A 4YKEA 1UTEA 2NYMC 4Q7FA 1T70A 2XMOA 2WDEA 1JK7A 4MOYA 1AUIA 4O4KA 4V0XA 2NXFA 2HY1A 1FJMA 3H69A 3P71C 1Z2XA 3CK2A 4M0VA 1SU1A 1QFCA 3E7BA 2WDDA 3QFKA 3ZTVA 4LTYA 3K7VC 3QFOA 3PSOA 2QFRA 5JJTA 2NYLC 3ZU0A 4H2IA 2Z1AA 3V4YA 4O5GA 4TUGA 5HPEA 1S3NA 4JA7A 4LACC 4HD0A 1OIEA 2Z06A 3H61A 3H67A 4OR9A 1T71A 2NPPC 3QFMA 1WAO1 1QHWA 2ZBMA 3QFNA 4FBWA 1KBPA 4H2GA 4FCXA 1M63A 3IVDA 4I5LC 3H66A 1XZWA 4NZVA 2Q8UA 2CV9A 3H62B 1MF8A 2O8GA 4IYPC 5JPEA 2WDFA 1HPUA 2O8AA 1OI8A 4MOVA 4LU9A 1TCOA 1S3LA 3T1IA 2BQ8X 1Z2WA 3PSNA 4O24A 3TGHA 3DSCA 1S3MA 5B8IA 4UT3B 1U32A 5C1VA 2IE3C 2BCDA 1HO5A 3FGAC 3IB7A 4FBKA 4ORCA 3EGHA 2BDXA 3DSDA 2QFPA 3DW8C 1V73A 3AV0A 3K7WC 4DT2A 4UWQA 1S70A 1UF3A 2HYPA 5DNYA 2HYOA 4IL1A 3E7AA 4TUIA 3THOB 1G5BA 3EGGA 5INBA 3THNA 3QG5C 1USHA 5F3WA 4FBQA 3H60A 4UT3A 4UT2A 4ZX2A 2QJCA 3N5UA 4H1YP 2A22A 2IAEC 3LL8A 4B2OA 3IVEA 2KKNA 4KBPA 4V0WA 1XM7A 4ZVZA 1NNWA 1WARA
chains in the Genus database with same CATH superfamily
2WDCA 3IB8A 2Z72A 5EQVA 2IE4C 2YVTA 5GTUA 3C9FA 4ORAA 4DSYA 4F0ZA 3C5WC 4DHLA 1S8EA 2R17A 2AHDA 3AUZA 4JA9A 4MP0A 2USHA 4XPNA 3RL5A 4WWLA 4J6OA 4H2BA 2DFJA 1II7A 2JOGA 3HVQA 3H64A 4O43A 5IOHA 2GJUA 4I5NC 1OIDA 1W24A 1IT6A 4ORBA 5J28A 2P6BA 4V0VA 4KKZA 1S95A 3GVEA 4H2FA 4H1SA 3D03A 3H68A 3RL3A 3KBPA 5JPFA 3H63A 3RQZA 3JYFA 4G9JA 3ICFA 3RL4A 1HP1A 2DXLA 4YKEA 1UTEA 2NYMC 4Q7FA 1T70A 2XMOA 2WDEA 1JK7A 4MOYA 1AUIA 4O4KA 4V0XA 2NXFA 2HY1A 1FJMA 3H69A 3P71C 1Z2XA 3CK2A 4M0VA 1SU1A 1QFCA 3E7BA 2WDDA 3QFKA 3ZTVA 4LTYA 3K7VC 3QFOA 3PSOA 2QFRA 5JJTA 2NYLC 3ZU0A 4H2IA 2YEQA 3E0JA 2Z1AA 3V4YA 4O5GA 4TUGA 5HPEA 1S3NA 4JA7A 4LACC 4HD0A 1OIEA 2Z06A 3H61A 3H67A 4OR9A 1T71A 2NPPC 3QFMA 1WAO1 1QHWA 2ZBMA 3QFNA 4FBWA 1KBPA 4H2GA 4FCXA 1M63A 3IVDA 4I5LC 2DXNA 3H66A 1XZWA 4NZVA 2Q8UA 2CV9A 3H62B 1MF8A 2O8GA 4IYPC 5JPEA 2WDFA 1HPUA 2O8AA 1OI8A 4MOVA 4LU9A 1TCOA 1S3LA 3T1IA 2ZOAA 2BQ8X 1Z2WA 3PSNA 4O24A 3TGHA 3DSCA 1S3MA 5B8IA 4UT3B 1U32A 5C1VA 2IE3C 2BCDA 1HO5A 3FGAC 3IB7A 4FBKA 4ORCA 3EGHA 2BDXA 3DSDA 2QFPA 3DW8C 1V73A 3AV0A 3K7WC 4DT2A 4UWQA 1S70A 1UF3A 2HYPA 5DNYA 2HYOA 4IL1A 3E7AA 4TUIA 3THOB 1G5BA 3EGGA 5INBA 3THNA 3QG5C 1USHA 5F3WA 4FBQA 2ZO9B 3H60A 4UT3A 4UT2A 4ZX2A 2QJCA 3N5UA 4H1YP 2A22A 2IAEC 3LL8A 4B2OA 3IVEA 3FLOA 2KKNA 4KBPA 4V0WA 1XM7A 4ZVZA 1NNWA 1WARA
chains in the Genus database with same CATH topology
2WDCA 3IB8A 2Z72A 5EQVA 2IE4C 2YVTA 5GTUA 3C9FA 4ORAA 4DSYA 4F0ZA 3C5WC 4DHLA 1S8EA 2R17A 2AHDA 3AUZA 4JA9A 4MP0A 2USHA 4XPNA 3RL5A 4WWLA 4J6OA 4H2BA 2DFJA 1II7A 2JOGA 3HVQA 3H64A 4O43A 5IOHA 2GJUA 4I5NC 1OIDA 1W24A 1IT6A 4ORBA 5J28A 2P6BA 4V0VA 4KKZA 1S95A 3GVEA 4H2FA 4H1SA 3D03A 3H68A 3RL3A 3KBPA 5JPFA 3H63A 3RQZA 3JYFA 4G9JA 3ICFA 3RL4A 1HP1A 2DXLA 4YKEA 1UTEA 2NYMC 4Q7FA 1T70A 2XMOA 2WDEA 1JK7A 4MOYA 1AUIA 4O4KA 4V0XA 2NXFA 2HY1A 1FJMA 3H69A 3P71C 1Z2XA 3CK2A 4M0VA 1SU1A 1QFCA 3E7BA 2WDDA 3QFKA 3ZTVA 4LTYA 3K7VC 3QFOA 3PSOA 2QFRA 5JJTA 2NYLC 3ZU0A 4H2IA 2YEQA 3E0JA 2Z1AA 3V4YA 4O5GA 4TUGA 5HPEA 1S3NA 4JA7A 4LACC 4HD0A 1OIEA 2Z06A 3H61A 3H67A 4OR9A 1T71A 2NPPC 3QFMA 1WAO1 1QHWA 2ZBMA 3QFNA 4FBWA 1KBPA 4H2GA 4FCXA 1M63A 3IVDA 4I5LC 2DXNA 3H66A 1XZWA 4NZVA 2Q8UA 2CV9A 3H62B 1MF8A 2O8GA 4IYPC 5JPEA 2WDFA 1HPUA 2O8AA 1OI8A 4MOVA 4LU9A 1TCOA 1S3LA 3T1IA 2ZOAA 2BQ8X 1Z2WA 3PSNA 4O24A 3TGHA 3DSCA 1S3MA 5B8IA 4UT3B 1U32A 5C1VA 2IE3C 2BCDA 1HO5A 3FGAC 3IB7A 4FBKA 4ORCA 3EGHA 2BDXA 3DSDA 2QFPA 3DW8C 1V73A 3AV0A 3K7WC 4DT2A 4UWQA 1S70A 1UF3A 2HYPA 5DNYA 2HYOA 4IL1A 3E7AA 4TUIA 3THOB 1G5BA 3EGGA 5INBA 3THNA 3QG5C 1USHA 5F3WA 4FBQA 2ZO9B 3H60A 4UT3A 4UT2A 4ZX2A 2QJCA 3N5UA 4H1YP 2A22A 2IAEC 3LL8A 4B2OA 3IVEA 3FLOA 2KKNA 4KBPA 4V0WA 1XM7A 4ZVZA 1NNWA 1WARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDC A;  3IB8 A;  2Z72 A;  5EQV A;  2IE4 C;  2YVT A;  5GTU A;  3C9F A;  4ORA A;  4DSY A;  4F0Z A;  3C5W C;  4DHL A;  1S8E A;  2R17 A;  2AHD A;  3AUZ A;  4JA9 A;  4MP0 A;  2USH A;  4XPN A;  3RL5 A;  4WWL A;  4J6O A;  4H2B A;  2DFJ A;  1II7 A;  2JOG A;  3HVQ A;  3H64 A;  4O43 A;  5IOH A;  2GJU A;  4I5N C;  1OID A;  1W24 A;  1IT6 A;  4ORB A;  5J28 A;  2P6B A;  4V0V A;  4KKZ A;  1S95 A;  3GVE A;  4H2F A;  4H1S A;  3H68 A;  3RL3 A;  3KBP A;  5JPF A;  3H63 A;  3RQZ A;  3JYF A;  4G9J A;  3ICF A;  3RL4 A;  1HP1 A;  4YKE A;  1UTE A;  2NYM C;  4Q7F A;  1T70 A;  2XMO A;  2WDE A;  1JK7 A;  4MOY A;  1AUI A;  4O4K A;  4V0X A;  2NXF A;  2HY1 A;  1FJM A;  3H69 A;  3P71 C;  1Z2X A;  3CK2 A;  4M0V A;  1SU1 A;  1QFC A;  3E7B A;  2WDD A;  3QFK A;  3ZTV A;  4LTY A;  3K7V C;  3QFO A;  3PSO A;  2QFR A;  5JJT A;  2NYL C;  3ZU0 A;  4H2I A;  2Z1A A;  3V4Y A;  4O5G A;  4TUG A;  5HPE A;  1S3N A;  4JA7 A;  4LAC C;  4HD0 A;  1OIE A;  2Z06 A;  3H61 A;  3H67 A;  4OR9 A;  1T71 A;  2NPP C;  3QFM A;  1WAO 1;  1QHW A;  2ZBM A;  3QFN A;  4FBW A;  1KBP A;  4H2G A;  4FCX A;  1M63 A;  3IVD A;  4I5L C;  3H66 A;  1XZW A;  4NZV A;  2Q8U A;  2CV9 A;  3H62 B;  1MF8 A;  2O8G A;  4IYP C;  5JPE A;  2WDF A;  1HPU A;  2O8A A;  1OI8 A;  4MOV A;  4LU9 A;  1TCO A;  1S3L A;  3T1I A;  2BQ8 X;  1Z2W A;  3PSN A;  4O24 A;  3TGH A;  3DSC A;  1S3M A;  5B8I A;  4UT3 B;  1U32 A;  5C1V A;  2IE3 C;  2BCD A;  1HO5 A;  3FGA C;  3IB7 A;  4FBK A;  4ORC A;  3EGH A;  2BDX A;  3DSD A;  2QFP A;  3DW8 C;  1V73 A;  3AV0 A;  3K7W C;  4DT2 A;  4UWQ A;  1S70 A;  1UF3 A;  2HYP A;  5DNY A;  2HYO A;  4IL1 A;  3E7A A;  4TUI A;  3THO B;  1G5B A;  3EGG A;  5INB A;  3THN A;  3QG5 C;  1USH A;  5F3W A;  4FBQ A;  3H60 A;  4UT3 A;  4UT2 A;  4ZX2 A;  2QJC A;  3N5U A;  4H1Y P;  2A22 A;  2IAE C;  3LL8 A;  4B2O A;  3IVE A;  2KKN A;  4KBP A;  4V0W A;  1XM7 A;  4ZVZ A;  1NNW A;  1WAR A; 
#chains in the Genus database with same CATH topology
 2WDC A;  3IB8 A;  2Z72 A;  5EQV A;  2IE4 C;  2YVT A;  5GTU A;  3C9F A;  4ORA A;  4DSY A;  4F0Z A;  3C5W C;  4DHL A;  1S8E A;  2R17 A;  2AHD A;  3AUZ A;  4JA9 A;  4MP0 A;  2USH A;  4XPN A;  3RL5 A;  4WWL A;  4J6O A;  4H2B A;  2DFJ A;  1II7 A;  2JOG A;  3HVQ A;  3H64 A;  4O43 A;  5IOH A;  2GJU A;  4I5N C;  1OID A;  1W24 A;  1IT6 A;  4ORB A;  5J28 A;  2P6B A;  4V0V A;  4KKZ A;  1S95 A;  3GVE A;  4H2F A;  4H1S A;  3D03 A;  3H68 A;  3RL3 A;  3KBP A;  5JPF A;  3H63 A;  3RQZ A;  3JYF A;  4G9J A;  3ICF A;  3RL4 A;  1HP1 A;  2DXL A;  4YKE A;  1UTE A;  2NYM C;  4Q7F A;  1T70 A;  2XMO A;  2WDE A;  1JK7 A;  4MOY A;  1AUI A;  4O4K A;  4V0X A;  2NXF A;  2HY1 A;  1FJM A;  3H69 A;  3P71 C;  1Z2X A;  3CK2 A;  4M0V A;  1SU1 A;  1QFC A;  3E7B A;  2WDD A;  3QFK A;  3ZTV A;  4LTY A;  3K7V C;  3QFO A;  3PSO A;  2QFR A;  5JJT A;  2NYL C;  3ZU0 A;  4H2I A;  2YEQ A;  3E0J A;  2Z1A A;  3V4Y A;  4O5G A;  4TUG A;  5HPE A;  1S3N A;  4JA7 A;  4LAC C;  4HD0 A;  1OIE A;  2Z06 A;  3H61 A;  3H67 A;  4OR9 A;  1T71 A;  2NPP C;  3QFM A;  1WAO 1;  1QHW A;  2ZBM A;  3QFN A;  4FBW A;  1KBP A;  4H2G A;  4FCX A;  1M63 A;  3IVD A;  4I5L C;  2DXN A;  3H66 A;  1XZW A;  4NZV A;  2Q8U A;  2CV9 A;  3H62 B;  1MF8 A;  2O8G A;  4IYP C;  5JPE A;  2WDF A;  1HPU A;  2O8A A;  1OI8 A;  4MOV A;  4LU9 A;  1TCO A;  1S3L A;  3T1I A;  2ZOA A;  2BQ8 X;  1Z2W A;  3PSN A;  4O24 A;  3TGH A;  3DSC A;  1S3M A;  5B8I A;  4UT3 B;  1U32 A;  5C1V A;  2IE3 C;  2BCD A;  1HO5 A;  3FGA C;  3IB7 A;  4FBK A;  4ORC A;  3EGH A;  2BDX A;  3DSD A;  2QFP A;  3DW8 C;  1V73 A;  3AV0 A;  3K7W C;  4DT2 A;  4UWQ A;  1S70 A;  1UF3 A;  2HYP A;  5DNY A;  2HYO A;  4IL1 A;  3E7A A;  4TUI A;  3THO B;  1G5B A;  3EGG A;  5INB A;  3THN A;  3QG5 C;  1USH A;  5F3W A;  4FBQ A;  2ZO9 B;  3H60 A;  4UT3 A;  4UT2 A;  4ZX2 A;  2QJC A;  3N5U A;  4H1Y P;  2A22 A;  2IAE C;  3LL8 A;  4B2O A;  3IVE A;  3FLO A;  2KKN A;  4KBP A;  4V0W A;  1XM7 A;  4ZVZ A;  1NNW A;  1WAR A; 
#chains in the Genus database with same CATH homology
 2WDC A;  3IB8 A;  2Z72 A;  5EQV A;  2IE4 C;  2YVT A;  5GTU A;  3C9F A;  4ORA A;  4DSY A;  4F0Z A;  3C5W C;  4DHL A;  1S8E A;  2R17 A;  2AHD A;  3AUZ A;  4JA9 A;  4MP0 A;  2USH A;  4XPN A;  3RL5 A;  4WWL A;  4J6O A;  4H2B A;  2DFJ A;  1II7 A;  2JOG A;  3HVQ A;  3H64 A;  4O43 A;  5IOH A;  2GJU A;  4I5N C;  1OID A;  1W24 A;  1IT6 A;  4ORB A;  5J28 A;  2P6B A;  4V0V A;  4KKZ A;  1S95 A;  3GVE A;  4H2F A;  4H1S A;  3D03 A;  3H68 A;  3RL3 A;  3KBP A;  5JPF A;  3H63 A;  3RQZ A;  3JYF A;  4G9J A;  3ICF A;  3RL4 A;  1HP1 A;  2DXL A;  4YKE A;  1UTE A;  2NYM C;  4Q7F A;  1T70 A;  2XMO A;  2WDE A;  1JK7 A;  4MOY A;  1AUI A;  4O4K A;  4V0X A;  2NXF A;  2HY1 A;  1FJM A;  3H69 A;  3P71 C;  1Z2X A;  3CK2 A;  4M0V A;  1SU1 A;  1QFC A;  3E7B A;  2WDD A;  3QFK A;  3ZTV A;  4LTY A;  3K7V C;  3QFO A;  3PSO A;  2QFR A;  5JJT A;  2NYL C;  3ZU0 A;  4H2I A;  2YEQ A;  3E0J A;  2Z1A A;  3V4Y A;  4O5G A;  4TUG A;  5HPE A;  1S3N A;  4JA7 A;  4LAC C;  4HD0 A;  1OIE A;  2Z06 A;  3H61 A;  3H67 A;  4OR9 A;  1T71 A;  2NPP C;  3QFM A;  1WAO 1;  1QHW A;  2ZBM A;  3QFN A;  4FBW A;  1KBP A;  4H2G A;  4FCX A;  1M63 A;  3IVD A;  4I5L C;  2DXN A;  3H66 A;  1XZW A;  4NZV A;  2Q8U A;  2CV9 A;  3H62 B;  1MF8 A;  2O8G A;  4IYP C;  5JPE A;  2WDF A;  1HPU A;  2O8A A;  1OI8 A;  4MOV A;  4LU9 A;  1TCO A;  1S3L A;  3T1I A;  2ZOA A;  2BQ8 X;  1Z2W A;  3PSN A;  4O24 A;  3TGH A;  3DSC A;  1S3M A;  5B8I A;  4UT3 B;  1U32 A;  5C1V A;  2IE3 C;  2BCD A;  1HO5 A;  3FGA C;  3IB7 A;  4FBK A;  4ORC A;  3EGH A;  2BDX A;  3DSD A;  2QFP A;  3DW8 C;  1V73 A;  3AV0 A;  3K7W C;  4DT2 A;  4UWQ A;  1S70 A;  1UF3 A;  2HYP A;  5DNY A;  2HYO A;  4IL1 A;  3E7A A;  4TUI A;  3THO B;  1G5B A;  3EGG A;  5INB A;  3THN A;  3QG5 C;  1USH A;  5F3W A;  4FBQ A;  2ZO9 B;  3H60 A;  4UT3 A;  4UT2 A;  4ZX2 A;  2QJC A;  3N5U A;  4H1Y P;  2A22 A;  2IAE C;  3LL8 A;  4B2O A;  3IVE A;  3FLO A;  2KKN A;  4KBP A;  4V0W A;  1XM7 A;  4ZVZ A;  1NNW A;  1WAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...