1OI8A

5'-nucleotidase (e. coli) with an engineered disulfide bridge (p90c, l424c)
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
525
structure length
525
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVCESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVCKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trapping a 96 Degree Domain Rotation in Two Distinct Conformations by Engineered Disulfide Bridges
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN USHA
total genus 177
structure length 525
sequence length 525
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1oi8A01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1oi8A02
1G5BA 3H63A 3HVQA 4V0XA 3RL5A 1OI8A 4DSYA 1HPUA 1T70A 2QFPA 3TGHA 5JPEA 2HYPA 4IL1A 3P71C 3LL8A 4JA7A 4M0VA 2GJUA 2WDEA 3EGGA 3H69A 3PSNA 3THNA 2Z1AA 4H2FA 4H2BA 4ORAA 3V4YA 1M63A 3DSDA 4B2OA 2HYOA 3AV0A 3H67A 3IVEA 5EQVA 2QFRA 1S3NA 4HD0A 2NPPC 3H61A 2YVTA 1QHWA 2O8GA 1W24A 3QG5C 5JJTA 5J28A 4ORBA 3K7WC 3QFKA 1HO5A 3GVEA 4F0ZA 4UT3A 2CV9A 4ZVZA 5IOHA 3JYFA 2WDFA 4TUIA 5GTUA 5B8IA 3H60A 3IB8A 1NNWA 1JK7A 4FBKA 2Z72A 2IE3C 4O24A 1KBPA 3RL4A 3ZU0A 4H2GA 1MF8A 3RL3A 3QFMA 1U32A 4O43A 2Q8UA 4G9JA 3H66A 4J6OA 3QFOA 3ZTVA 3N5UA 3E7AA 2R17A 3K7VC 3H64A 4KKZA 5C1VA 4KBPA 1XZWA 2BDXA 3AUZA 1AUIA 3CK2A 2WDDA 4WWLA 1XM7A 2BQ8X 1S8EA 1SU1A 5INBA 2JOGA 1TCOA 2IE4C 3FGAC 3QFNA 1WAO1 2WDCA 4IYPC 3DW8C 1Z2XA 4FCXA 4I5NC 4XPNA 2BCDA 5DNYA 2USHA 2HY1A 1S70A 1QFCA 2O8AA 2AHDA 3E7BA 4YKEA 4TUGA 3C5WC 4H2IA 3H62B 3H68A 2QJCA 1FJMA 1UTEA 4O5GA 1WARA 4LTYA 2DFJA 3C9FA 4Q7FA 1OIEA 1T71A 2Z06A 3PSOA 2NYMC 1S3LA 1USHA 4UT3B 1S3MA 4V0WA 4H1YP 4I5LC 3KBPA 4MOVA 5JPFA 1Z2WA 3RQZA 4O4KA 1II7A 5F3WA 3THOB 2A22A 4ZX2A 1HP1A 2IAEC 3IB7A 1S95A 4MP0A 4NZVA 4OR9A 4UWQA 1UF3A 1OIDA 4DT2A 5HPEA 4LU9A 2ZBMA 2P6BA 1IT6A 4LACC 1V73A 4MOYA 3IVDA 4FBWA 3ICFA 4JA9A 4ORCA 4H1SA 2KKNA 2XMOA 2NYLC 3T1IA 2NXFA 4FBQA 4UT2A 4DHLA 3EGHA 4V0VA 3DSCA
chains in the Genus database with same CATH superfamily
1G5BA 3H63A 3HVQA 4V0XA 3RL5A 1OI8A 4DSYA 1HPUA 1T70A 2QFPA 3TGHA 5JPEA 2HYPA 4IL1A 3P71C 3LL8A 4JA7A 4M0VA 2GJUA 2WDEA 3EGGA 3H69A 3PSNA 3THNA 2Z1AA 4H2FA 4H2BA 4ORAA 3V4YA 1M63A 3DSDA 4B2OA 2HYOA 3AV0A 3H67A 3IVEA 5EQVA 2QFRA 1S3NA 4HD0A 3E0JA 2NPPC 2DXLA 2YVTA 3H61A 1QHWA 2O8GA 1W24A 3QG5C 5JJTA 5J28A 4ORBA 3K7WC 3QFKA 1HO5A 3GVEA 4F0ZA 4UT3A 2CV9A 4ZVZA 5IOHA 3JYFA 2WDFA 4TUIA 5GTUA 5B8IA 3H60A 3IB8A 1NNWA 1JK7A 4FBKA 2Z72A 2IE3C 4O24A 1KBPA 3RL4A 3D03A 3ZU0A 4H2GA 1MF8A 3RL3A 2DXNA 1U32A 3QFMA 4O43A 2Q8UA 4G9JA 3H66A 4J6OA 3QFOA 3ZTVA 3N5UA 2ZOAA 3E7AA 2R17A 3K7VC 3H64A 4KKZA 5C1VA 4KBPA 1XZWA 2BDXA 3AUZA 1AUIA 3CK2A 2WDDA 2ZO9B 4WWLA 1XM7A 2BQ8X 3FLOA 1S8EA 1SU1A 5INBA 2JOGA 1TCOA 2YEQA 2IE4C 3FGAC 3QFNA 1WAO1 2WDCA 4IYPC 3DW8C 1Z2XA 4FCXA 4I5NC 4XPNA 2BCDA 5DNYA 2USHA 2HY1A 1S70A 1QFCA 2O8AA 2AHDA 3E7BA 4YKEA 4TUGA 3C5WC 4H2IA 3H62B 3H68A 2QJCA 1FJMA 1UTEA 4O5GA 1WARA 4LTYA 2DFJA 3C9FA 4Q7FA 1OIEA 1T71A 2Z06A 3PSOA 2NYMC 1S3LA 1USHA 4UT3B 1S3MA 4V0WA 4H1YP 4I5LC 3KBPA 4MOVA 5JPFA 1Z2WA 3RQZA 4O4KA 1II7A 5F3WA 3THOB 2A22A 4ZX2A 1HP1A 2IAEC 3IB7A 1S95A 4MP0A 4NZVA 4OR9A 4UWQA 1UF3A 1OIDA 4DT2A 5HPEA 4LU9A 2ZBMA 2P6BA 1IT6A 4LACC 1V73A 4MOYA 3IVDA 4FBWA 3ICFA 4JA9A 4ORCA 4H1SA 2KKNA 2XMOA 2NYLC 3T1IA 2NXFA 4FBQA 4UT2A 4DHLA 3EGHA 4V0VA 3DSCA
chains in the Genus database with same CATH topology
1G5BA 3H63A 3HVQA 4V0XA 3RL5A 1OI8A 4DSYA 1HPUA 1T70A 2QFPA 3TGHA 5JPEA 2HYPA 4IL1A 3P71C 3LL8A 4JA7A 4M0VA 2GJUA 2WDEA 3EGGA 3H69A 3PSNA 3THNA 2Z1AA 4H2FA 4H2BA 4ORAA 3V4YA 1M63A 3DSDA 4B2OA 2HYOA 3AV0A 3H67A 3IVEA 5EQVA 2QFRA 1S3NA 4HD0A 3E0JA 2NPPC 2DXLA 2YVTA 3H61A 1QHWA 2O8GA 1W24A 3QG5C 5JJTA 5J28A 4ORBA 3K7WC 3QFKA 1HO5A 3GVEA 4F0ZA 4UT3A 2CV9A 4ZVZA 5IOHA 3JYFA 2WDFA 4TUIA 5GTUA 5B8IA 3H60A 3IB8A 1NNWA 1JK7A 4FBKA 2Z72A 2IE3C 4O24A 1KBPA 3RL4A 3D03A 3ZU0A 4H2GA 1MF8A 3RL3A 2DXNA 1U32A 3QFMA 4O43A 2Q8UA 4G9JA 3H66A 4J6OA 3QFOA 3ZTVA 3N5UA 2ZOAA 3E7AA 2R17A 3K7VC 3H64A 4KKZA 5C1VA 4KBPA 1XZWA 2BDXA 3AUZA 1AUIA 3CK2A 2WDDA 2ZO9B 4WWLA 1XM7A 2BQ8X 3FLOA 1S8EA 1SU1A 5INBA 2JOGA 1TCOA 2YEQA 2IE4C 3FGAC 3QFNA 1WAO1 2WDCA 4IYPC 3DW8C 1Z2XA 4FCXA 4I5NC 4XPNA 2BCDA 5DNYA 2USHA 2HY1A 1S70A 1QFCA 2O8AA 2AHDA 3E7BA 4YKEA 4TUGA 3C5WC 4H2IA 3H62B 3H68A 2QJCA 1FJMA 1UTEA 4O5GA 1WARA 4LTYA 2DFJA 3C9FA 4Q7FA 1OIEA 1T71A 2Z06A 3PSOA 2NYMC 1S3LA 1USHA 4UT3B 1S3MA 4V0WA 4H1YP 4I5LC 3KBPA 4MOVA 5JPFA 1Z2WA 3RQZA 4O4KA 1II7A 5F3WA 3THOB 2A22A 4ZX2A 1HP1A 2IAEC 3IB7A 1S95A 4MP0A 4NZVA 4OR9A 4UWQA 1UF3A 1OIDA 4DT2A 5HPEA 4LU9A 2ZBMA 2P6BA 1IT6A 4LACC 1V73A 4MOYA 3IVDA 4FBWA 3ICFA 4JA9A 4ORCA 4H1SA 2KKNA 2XMOA 2NYLC 3T1IA 2NXFA 4FBQA 4UT2A 4DHLA 3EGHA 4V0VA 3DSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G5B A;  3H63 A;  3HVQ A;  4V0X A;  3RL5 A;  1OI8 A;  4DSY A;  1HPU A;  1T70 A;  2QFP A;  3TGH A;  5JPE A;  2HYP A;  4IL1 A;  3P71 C;  3LL8 A;  4JA7 A;  4M0V A;  2GJU A;  2WDE A;  3EGG A;  3H69 A;  3PSN A;  3THN A;  2Z1A A;  4H2F A;  4H2B A;  4ORA A;  3V4Y A;  1M63 A;  3DSD A;  4B2O A;  2HYO A;  3AV0 A;  3H67 A;  3IVE A;  5EQV A;  2QFR A;  1S3N A;  4HD0 A;  2NPP C;  3H61 A;  2YVT A;  1QHW A;  2O8G A;  1W24 A;  3QG5 C;  5JJT A;  5J28 A;  4ORB A;  3K7W C;  3QFK A;  1HO5 A;  3GVE A;  4F0Z A;  4UT3 A;  2CV9 A;  4ZVZ A;  5IOH A;  3JYF A;  2WDF A;  4TUI A;  5GTU A;  5B8I A;  3H60 A;  3IB8 A;  1NNW A;  1JK7 A;  4FBK A;  2Z72 A;  2IE3 C;  4O24 A;  1KBP A;  3RL4 A;  3ZU0 A;  4H2G A;  1MF8 A;  3RL3 A;  3QFM A;  1U32 A;  4O43 A;  2Q8U A;  4G9J A;  3H66 A;  4J6O A;  3QFO A;  3ZTV A;  3N5U A;  3E7A A;  2R17 A;  3K7V C;  3H64 A;  4KKZ A;  5C1V A;  4KBP A;  1XZW A;  2BDX A;  3AUZ A;  1AUI A;  3CK2 A;  2WDD A;  4WWL A;  1XM7 A;  2BQ8 X;  1S8E A;  1SU1 A;  5INB A;  2JOG A;  1TCO A;  2IE4 C;  3FGA C;  3QFN A;  1WAO 1;  2WDC A;  4IYP C;  3DW8 C;  1Z2X A;  4FCX A;  4I5N C;  4XPN A;  2BCD A;  5DNY A;  2USH A;  2HY1 A;  1S70 A;  1QFC A;  2O8A A;  2AHD A;  3E7B A;  4YKE A;  4TUG A;  3C5W C;  4H2I A;  3H62 B;  3H68 A;  2QJC A;  1FJM A;  1UTE A;  4O5G A;  1WAR A;  4LTY A;  2DFJ A;  3C9F A;  4Q7F A;  1OIE A;  1T71 A;  2Z06 A;  3PSO A;  2NYM C;  1S3L A;  1USH A;  4UT3 B;  1S3M A;  4V0W A;  4H1Y P;  4I5L C;  3KBP A;  4MOV A;  5JPF A;  1Z2W A;  3RQZ A;  4O4K A;  1II7 A;  5F3W A;  3THO B;  2A22 A;  4ZX2 A;  1HP1 A;  2IAE C;  3IB7 A;  1S95 A;  4MP0 A;  4NZV A;  4OR9 A;  4UWQ A;  1UF3 A;  1OID A;  4DT2 A;  5HPE A;  4LU9 A;  2ZBM A;  2P6B A;  1IT6 A;  4LAC C;  1V73 A;  4MOY A;  3IVD A;  4FBW A;  3ICF A;  4JA9 A;  4ORC A;  4H1S A;  2KKN A;  2XMO A;  2NYL C;  3T1I A;  2NXF A;  4FBQ A;  4UT2 A;  4DHL A;  3EGH A;  4V0V A;  3DSC A; 
#chains in the Genus database with same CATH topology
 1G5B A;  3H63 A;  3HVQ A;  4V0X A;  3RL5 A;  1OI8 A;  4DSY A;  1HPU A;  1T70 A;  2QFP A;  3TGH A;  5JPE A;  2HYP A;  4IL1 A;  3P71 C;  3LL8 A;  4JA7 A;  4M0V A;  2GJU A;  2WDE A;  3EGG A;  3H69 A;  3PSN A;  3THN A;  2Z1A A;  4H2F A;  4H2B A;  4ORA A;  3V4Y A;  1M63 A;  3DSD A;  4B2O A;  2HYO A;  3AV0 A;  3H67 A;  3IVE A;  5EQV A;  2QFR A;  1S3N A;  4HD0 A;  3E0J A;  2NPP C;  2DXL A;  2YVT A;  3H61 A;  1QHW A;  2O8G A;  1W24 A;  3QG5 C;  5JJT A;  5J28 A;  4ORB A;  3K7W C;  3QFK A;  1HO5 A;  3GVE A;  4F0Z A;  4UT3 A;  2CV9 A;  4ZVZ A;  5IOH A;  3JYF A;  2WDF A;  4TUI A;  5GTU A;  5B8I A;  3H60 A;  3IB8 A;  1NNW A;  1JK7 A;  4FBK A;  2Z72 A;  2IE3 C;  4O24 A;  1KBP A;  3RL4 A;  3D03 A;  3ZU0 A;  4H2G A;  1MF8 A;  3RL3 A;  2DXN A;  1U32 A;  3QFM A;  4O43 A;  2Q8U A;  4G9J A;  3H66 A;  4J6O A;  3QFO A;  3ZTV A;  3N5U A;  2ZOA A;  3E7A A;  2R17 A;  3K7V C;  3H64 A;  4KKZ A;  5C1V A;  4KBP A;  1XZW A;  2BDX A;  3AUZ A;  1AUI A;  3CK2 A;  2WDD A;  2ZO9 B;  4WWL A;  1XM7 A;  2BQ8 X;  3FLO A;  1S8E A;  1SU1 A;  5INB A;  2JOG A;  1TCO A;  2YEQ A;  2IE4 C;  3FGA C;  3QFN A;  1WAO 1;  2WDC A;  4IYP C;  3DW8 C;  1Z2X A;  4FCX A;  4I5N C;  4XPN A;  2BCD A;  5DNY A;  2USH A;  2HY1 A;  1S70 A;  1QFC A;  2O8A A;  2AHD A;  3E7B A;  4YKE A;  4TUG A;  3C5W C;  4H2I A;  3H62 B;  3H68 A;  2QJC A;  1FJM A;  1UTE A;  4O5G A;  1WAR A;  4LTY A;  2DFJ A;  3C9F A;  4Q7F A;  1OIE A;  1T71 A;  2Z06 A;  3PSO A;  2NYM C;  1S3L A;  1USH A;  4UT3 B;  1S3M A;  4V0W A;  4H1Y P;  4I5L C;  3KBP A;  4MOV A;  5JPF A;  1Z2W A;  3RQZ A;  4O4K A;  1II7 A;  5F3W A;  3THO B;  2A22 A;  4ZX2 A;  1HP1 A;  2IAE C;  3IB7 A;  1S95 A;  4MP0 A;  4NZV A;  4OR9 A;  4UWQ A;  1UF3 A;  1OID A;  4DT2 A;  5HPE A;  4LU9 A;  2ZBM A;  2P6B A;  1IT6 A;  4LAC C;  1V73 A;  4MOY A;  3IVD A;  4FBW A;  3ICF A;  4JA9 A;  4ORC A;  4H1S A;  2KKN A;  2XMO A;  2NYL C;  3T1I A;  2NXF A;  4FBQ A;  4UT2 A;  4DHL A;  3EGH A;  4V0V A;  3DSC A; 
#chains in the Genus database with same CATH homology
 1G5B A;  3H63 A;  3HVQ A;  4V0X A;  3RL5 A;  1OI8 A;  4DSY A;  1HPU A;  1T70 A;  2QFP A;  3TGH A;  5JPE A;  2HYP A;  4IL1 A;  3P71 C;  3LL8 A;  4JA7 A;  4M0V A;  2GJU A;  2WDE A;  3EGG A;  3H69 A;  3PSN A;  3THN A;  2Z1A A;  4H2F A;  4H2B A;  4ORA A;  3V4Y A;  1M63 A;  3DSD A;  4B2O A;  2HYO A;  3AV0 A;  3H67 A;  3IVE A;  5EQV A;  2QFR A;  1S3N A;  4HD0 A;  3E0J A;  2NPP C;  2DXL A;  2YVT A;  3H61 A;  1QHW A;  2O8G A;  1W24 A;  3QG5 C;  5JJT A;  5J28 A;  4ORB A;  3K7W C;  3QFK A;  1HO5 A;  3GVE A;  4F0Z A;  4UT3 A;  2CV9 A;  4ZVZ A;  5IOH A;  3JYF A;  2WDF A;  4TUI A;  5GTU A;  5B8I A;  3H60 A;  3IB8 A;  1NNW A;  1JK7 A;  4FBK A;  2Z72 A;  2IE3 C;  4O24 A;  1KBP A;  3RL4 A;  3D03 A;  3ZU0 A;  4H2G A;  1MF8 A;  3RL3 A;  2DXN A;  1U32 A;  3QFM A;  4O43 A;  2Q8U A;  4G9J A;  3H66 A;  4J6O A;  3QFO A;  3ZTV A;  3N5U A;  2ZOA A;  3E7A A;  2R17 A;  3K7V C;  3H64 A;  4KKZ A;  5C1V A;  4KBP A;  1XZW A;  2BDX A;  3AUZ A;  1AUI A;  3CK2 A;  2WDD A;  2ZO9 B;  4WWL A;  1XM7 A;  2BQ8 X;  3FLO A;  1S8E A;  1SU1 A;  5INB A;  2JOG A;  1TCO A;  2YEQ A;  2IE4 C;  3FGA C;  3QFN A;  1WAO 1;  2WDC A;  4IYP C;  3DW8 C;  1Z2X A;  4FCX A;  4I5N C;  4XPN A;  2BCD A;  5DNY A;  2USH A;  2HY1 A;  1S70 A;  1QFC A;  2O8A A;  2AHD A;  3E7B A;  4YKE A;  4TUG A;  3C5W C;  4H2I A;  3H62 B;  3H68 A;  2QJC A;  1FJM A;  1UTE A;  4O5G A;  1WAR A;  4LTY A;  2DFJ A;  3C9F A;  4Q7F A;  1OIE A;  1T71 A;  2Z06 A;  3PSO A;  2NYM C;  1S3L A;  1USH A;  4UT3 B;  1S3M A;  4V0W A;  4H1Y P;  4I5L C;  3KBP A;  4MOV A;  5JPF A;  1Z2W A;  3RQZ A;  4O4K A;  1II7 A;  5F3W A;  3THO B;  2A22 A;  4ZX2 A;  1HP1 A;  2IAE C;  3IB7 A;  1S95 A;  4MP0 A;  4NZV A;  4OR9 A;  4UWQ A;  1UF3 A;  1OID A;  4DT2 A;  5HPE A;  4LU9 A;  2ZBM A;  2P6B A;  1IT6 A;  4LAC C;  1V73 A;  4MOY A;  3IVD A;  4FBW A;  3ICF A;  4JA9 A;  4ORC A;  4H1S A;  2KKN A;  2XMO A;  2NYL C;  3T1I A;  2NXF A;  4FBQ A;  4UT2 A;  4DHL A;  3EGH A;  4V0V A;  3DSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...