1OIBA

Phosphate-binding protein mutant t141d
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGDSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphate transport
total genus 105
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oibA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oibA02
4NEDA 5TU0A 3TAJA 4OFLA 2H4IA 4PFUA 3SKPA 4GQOA 1I69A 1H45A 4C0RA 2RC9A 5L9SA 2Y7KA 3IAZA 3LSXA 5CBRA 1N84A 4YICA 1ZIUA 1FQDA 3WAEA 3SERA 3V83A 2NVUB 2IEEA 2R71A 3K01A 3T9UA 3KSXA 4XXUA 1NFTA 4F18A 1TXFA 4Z0IA 1LAHE 4R2FA 3IO4A 5H8HB 4G77A 3C36A 1XC1A 3RN8A 1B3HA 2OBGA 3PUZE 3TTLA 1Z7ME 2Y7IA 3CFZA 3EHTA 4PFTA 3HSTA 3C4MA 2HFBA 3OO9A 2BJJX 3LSLA 5H8QA 4LATA 5FHOA 3HCQA 4BDRA 3MPLA 2GRVA 1P1OA 4EF2A 1MXUA 1IUDA 4U4XA 2I48A 1HSEA 3IL1B 5I57A 2X7PA 3FZVA 5BWJA 1N0TA 1EZOA 5I58B 3IJXB 4WEDA 4AB6A 2RCAA 3G3IA 1Y20A 2DSFA 4F22A 2NOOA 3O2AA 3Q25A 4YB7A 2XXQA 1OLCA 2HAUA 3PMWA 3U93A 1QKAA 3H7MA 5L8DA 1YPNA 3T9HB 1LCFA 3IB0A 3CG1A 4R2BA 3SEXA 4R75A 1B3FA 4ISUA 4XKRA 3BFUA 1CE2A 3MZ9A 2QS4A 5CMMA 1RYOA 4IO6A 3PPRA 3LBSA 3CIJA 1MXZA 3M3FA 1Q1KA 1IITA 4JSDA 4ZE8A 1IXIA 3G3HA 4R74A 2QRYA 1MDP1 1OVBA 3RLFE 3TTMA 3KN8A 2Y7PA 2HXWA 1F9BA 4NF8B 4RA1A 2NWJA 3O6GA 3E3KA 4XKQA 4TLLB 4JWXA 2PVUA 3S9NC 4ZEKA 3FXUA 3QYTA 1GR2A 1JW1A 1VSOA 3TFLA 1DSNA 5ITOA 3MVWA 2ALUA 1QULA 5HPQA 4IO5A 1S9TA 1M5EA 3B6QA 4JBZA 1B3LA 4G68B 4TLMB 4EQ7A 4R6HA 1JETA 3DM0A 4YZZA 4FEBA 1SBPA 3PU5A 1URGA 3B6WA 3ZSFA 3MQ9A 3FD3A 4DXUA 2PYYA 3CSGA 3MJNA 1B52A 2F6GA 4QSEA 1M5DA 1SW1A 1Y3QA 3IORA 1MDQA 5CM6A 1LFHA 3GBAA 5K2YA 1VFEA 3RQTA 4UA8A 1EH3A 3K00A 1XOCA 4ZEBA 2ZYOA 4OETA 4R6YA 4KD5A 4RNSA 4ONYA 2Q8JA 3FVKA 1M5BA 3OOAA 4F1YA 1Y4TA 4LZ7A 3PD9A 4EF1A 4GWOA 4QFKA 3C35A 2H25A 1ZMGA 4HCYA 4YMBA 1T0KA 1IXHA 3MW0A 3LUYA 4KFQA 1EZPA 4RY1A 1YCJA 2XD3A 4E0XA 4FATA 1B3EA 3OD7A 1II5A 3QUFA 3SESA 2VD3A 5KCJA 4KI0E 4PETA 2OCUA 4L17A 2F5XA 4K3FA 3S4UA 2O69A 3KN3A 4F19A 5DVJA 4BDMA 4P0IA 1LSTA 1OQGA 2P0SA 5I2KB 4G4PA 5L9OA 1UIUA 2XXRA 3PUYE 4KYDA 3TCGA 2F78A 4RPNA 1O63A 3EN3A 2OWSA 2HCAA 4XIGQ 4TOZA 1DMBA 4OHNA 3FJGA 3K1PA 3S2VA 1FQBA 1HSJA 2X26A 1JVYA 1B1HA 2Z8EA 2VP1A 4ZZEA 2VGQA 3WAFA 4H67A 4IB2A 1GV8A 3SEYA 2DQVA 1WODA 3TCHA 2CZLA 5TPAA 4NF5A 5CC2A 4DZ1A 2HQ0A 1FTJA 3IX1A 1L5TA 2PX1A 5M2VA 3PMVA 4OEUA 4F3SA 5AA2A 1IZ1A 3D4CA 5JK4A 4ZS9A 2DWJA 3MPKA 1GGGA 3T93B 2XD2A 2V84A 1UIVA 1A55A 2OLBA 1A40A 4MF3A 4F3BA 1FTMA 3OO6A 4BDNA 4FECA 4GVOA 3VLVA 2Z8DA 1OIBA 1MS7A 1PBPA 5H8QB 1Y3NA 3VVDA 3G3GA 2XX9A 2ZNTA 2O1MA 4YAHX 3BKIB 4IO7A 2NXOA 4F3PA 3MZBA 2QS1A 3ILTB 1AH5A 4U23A 1SI1A 2DS9A 1MY3A 3QUJA 3K4UA 4ELRA 2D21A 3IOWA 3TTKA 5AE4A 4NE4A 1VE4A 3ONMA 5I59B 2PT1A 2DVCA 3TYHA 5CMBA 3CRBA 3KOSA 1S7YA 3JV9A 2DVZA 4GXAA 1IEJA 3O9PA 4YKIA 1FQCA 4AB5A 3K0VA 1J1NA 4LZ8A 5I84A 3DP8A 4P11A 3HV1A 4PFYA 5ELVA 1N7WA 4RK2A 3K1MA 2GHAA 3U1OA 5DEXA 1BP5A 1SI0A 3RUMA 3K6WA 3UGWA 4O3AA 4I9DA 3KGCA 2DE2A 3MZ1A 1I6AA 3LR1A 4H5GA 4FEDA 4U2RA 1D9VA 3TPAA 1QUIA 1B1XA 3H6VA 5EYFA 2V93A 3OO7A 3C33A 1MPCA 1XVYA 4OYVA 1LAGE 2I3VA 4GL8A 4IY6A 3SDFA 1A7LA 1LB8A 3K2DA 3HO7A 5ICQA 1PB8A 2FNCA 2F8DA 1JNFA 3PUVE 1H3DA 5H8NA 2A5TA 1FQEA 3MP1A 5AA4B 2REGA 4QFLA 1HSLA 5LOMA 1SYIA 3ILUB 3E9XA 3MVYA 3RT8A 3U8QA 1B5HA 4OESA 2V25A 5I56A 1LFIA 3QSLA 2RF1A 3V5AA 3T22A 1JEUA 1B46A 2I4BA 2R9JA 3TCFA 2F35A 5HBCA 2H98A 2G93A 4NF4B 3USDA 1B4ZA 4XKPA 1SYHA 1OVTA 2UVHA 2B3FA 1DPEA 3OMBA 1AMFA 1H44A 4DE8A 3W15C 3FVNA 5TP9A 3ZS6A 4BLAA 1B5IA 2XXHA 1Y3PA 3QIMA 3FV2A 2UVGA 1B9JA 4MBPA 2DP8A 3SEVA 2CMOA 3O6IA 3VLWA 1MY1A 5DVFA 2REJA 2ONKE 1YAEA 1YTVA 1MPDA 3GZGA 3ZKKA 1M5CA 3TQWA 2P2AA 1Y4CA 4OFJA 4OFOA 4KCDA 1US5A 1N04A 3A09A 4F2QA 3TTRA 1B4HA 4ZDMA 2D5WA 2ZMBA 1ZBMA 1CB6A 5KCJB 2DOJA 2VHAA 4OEVA 3DLNA 2QS3A 1GVCA 2VD2A 3KBRA 2XXIA 1S50A 1B51A 1USYE 3RPWA 1QVSA 1GTKA 3MC2A 3Q29A 5CBSA 1WDNA 2DXYA 2UVJA 3H03A 4RXLA 4R9FA 1AOVA 4QFPA 5ICTA 5B70A 3C9HA 1N3XA 4H8JA 3CG3A 3EHUA 4ZEDA 4EXLA 1B58A 1QW0A 1EZ9A 4EUOA 1FW0A 1OQHA 1PBQA 1MQHA 4ZEIA 4IGRA 3CFXA 4X48A 4QSDA 5L9MA 4R6KA 3BBRA 2E1SA 4ZEFA 2FA7A 4HW8A 4NF5B 2XHDA 3T66A 1P1QA 5ISUA 4OVJA 1BTJA 2DYXA 1MG1A 5AA2B 4FAJA 2ZYKA 2V3QA 2ESNA 4F1UA 1JW5A 2Z23A 3MUQA 3H6TA 1USYH 1JQFA 5AA3A 5J1DA 3RTFB 3JYRA 3VVFA 3L6GA 4JWYA 4LQ5A 4GIZA 1MPBA 3B7DA 4HTGA 4PP0A 3C31A 1ZKBA 3I5OA 3A3UA 2OK2A 3FGSA 4DXBA 1JVXA 2ANJA 4BDLA 2I6EA 5KZTA 1SQYA 2Y84A 1I6QA 1US4A 2Z8FA 3TTNA 4OQOA 4HS7A 4I62A 3HHFA 5A5XB 3T9XB 3H06B 2F36A 2I0BA 4POXA 2Q88A 5K2XA 4LQ2A 3U94A 1H43A 3OENA 2RC8A 4YB6A 4YB5A 4R9GA 4ELOA 4Q0CA 1B7ZA 3KEIA 3TELA 4THIA 4MH5A 4EQ9A 1FQAA 3C32A 2V3UA 4WEPA 1R6ZA 4XTCQ 1TT1A 3FXQA 1ZLQA 1XT8A 2I0CA 1MQGA 2QL3A 2PBWA 3OEMA 3LSWA 4DIGA 2HZKA 4DCXA 3N6UA 1A54A 3CR9A 2YJPA 2DE4A 2RC7A 2AYSA 5EHSA 1POY1 2F7CA 2I3WA 4X1DA 5IAIA 3M8UA 3H4ZA 4H5FA 4RPOA 4GOTA 4LA9A 1SVXB 4U22A 1O7TA 1PDAA 4JDFA 5KDTA 3N6TA 2Q89A 1FTOA 2Q9TA 4NF8A 1IIWA 1LB9A 2OJTA 2I58A 3PV0E 3O66A 2ZYMA 4IO3A 4Q8RA 1MXWA 2Y7WA 4ELQA 4GL0A 4JXIA 4XKNA 2O68A 3VE1B 3KJ7A 4DDDA 3OSRA 4N6PA 2A5TB 4KHZE 5DT6A 3OXNA 1A99A 3FVOA 4G68A 4IO4A 1LGBC 3G7WA 1MM7A 3GLBA 4TQUQ 2M8CA 2XX7A 1ELJA 3UP9A 3FIRA 2WKYA 4EXKA 3ODBA 2UYEA 4BDQA 3H6WA 4Q5TA 2G29A 2GHBA 5DYHA 3VV5A 2XX8A 1B40A 1AIVA 4DLDA 3DP4A 1Z7NE 1I6BA 3SEWA 3EPEA 5TP9B 5I57B 3A3CA 4U4SA 3S9LC 2RINA 2UXAA 2QPQA 1POTA 5IKBA 3E4RA 3OSQA 3PGFA 5FHNA 1PC3A 4LUBA 5CRYA 5F7VA 3Q26A 4F29A 2DWHA 1PEBA 1FQFA 1A8FA 5ITPA 1NMUA 1KWHA 4YKJA 4DXCA 3GBBA 4O3CA 3VDFA 1OMPA 1RYXA 4I8CA 3QAXA 1DOTA 1NKXA 1DTGA 4RK9A 2P1SA 3FJMA 4P0GA 4EDPA 3TEPA 5CMCA 2VOZA 1PB9A 2THIA 3S9MC 4QF9A 5I2KA 3IOVA 1D3KA 4U1ZA 4OMBA 4KR5A 3K1NA 5EHMA 3K02A 1FTLA 1URDA 4HCWA 1MXXA 1N76A 3KG2A 4MFIA 3MP8A 2DE3A 1MQJA 3K6UA 4G2ZA 3MAMA 3KJTA 2OZZA 2XXXA 5FTIA 1D4NA 2F34A 3IJOB 3CVGA 4IY5A 1B7HA 1UTHA 1UTBA 4BDOA 3K6VA 3KSJA 3UN6A 5HM4B 3TZAA 3B6TA 1MRPA 2RKMA 3OEKA 1R9LA 2AL4A 4Z7EA 3OO8A 4PE5B 3PPOA 2QJEA 1SDXA 2ZNSA 3RT6B 4KPTA 1IQ7A 3EHSA 3O28A 3O6HA 2DWIA 2HEUA 2FYIA 3TKDA 4PFWA 3UIFA 2UYFA 3FUZA 3PPQA 1TWYA 3DELB 1LCTA 2XXVA 2F97A 4NF6A 4GRKA 1D9YA 3N94A 1P1WA 5H8FA 4MLQA 2GH9A 4YU0A 4G8NA 3MBPA 3CI8A 4H8IA 1FCKA 3G3FA 4ELPA 3PUWE 5I2NA 1NNTA 3P7IA 1A8EA 1LBCA 4KYEA 1Y9UA 3UK4A 1P1NA 1SW2A 1MXYA 1WVJA 4MLVA 2O51A 1B0HA 4ESWA 1Q35A 4F1VA 3V89B 1P1UA 3MVXA 5I59A 4M1VA 3R7XA 3IB1A 5JTYA 4O3BA 3TUSA 4FJPA 3L6HA 2HZLA 4U21A 1QJMA 2XXUA 2Y7RA 1LBBA 1BKAA 2I4CA 1IXCA 4H65A 3IB2A 3KFMA 3KN7A 2UVIA 4X1BA 2QS2A 4GXSB 3E13X 2D3IA 4OWDA 2NUVA 3IK6B 3JZJA 2QMXA 5AA2D 1NNFA 5CMKA 2O7UA 2PMSA 2H9BA 4GF8A 1NNKA 1Y1ZA 2H5YA 2DXRA 4ZE9A 1AL3A 3CSBA 4X9TA 3IR1A 5KDTB 4IO2A 3O29A 1NH7A 4WXJA 1ANFA 4G68C 4UACA 4I1DA 4YKPA 5TPAB 3VFJA 3R6UA 4QSCA 3PD8A 3KZGA 3RTWB 3IO6A 1NH8A 1ZTYA 3K6XA 4RJZA 3M3LA 4WKMA 4F2OA 1O64A 3W9WA 4AQ4A 3RY3A 5F1QA 5AA4A 1NL5A 5B7DA 1NNPA 4H6DA 3KOTA 4NWCA 5H8HA 4LP2B 1TFAA 4GLIA 2F7AA 2R6GE 1QUJA 1B2HA 3S9EA 1MY2A 2F6PA 1SW5A 4FE8A 2YLNA 4H0WA 2B65A 4LZ5A 4NF4A 4KYSA 4JB7A 2QMWA 1MQIA 2E0SA 4IGTA 4JSOA 1H76A 3FV1A 2O1LA 3T9VA 3TODA 1Y1MA 2Q2AA 4LONB 3H3GA 5I58A 1UQWA 4OXVA 3CFLA 3PMXA 1DPPA 3Q28A 2LAOA 2XXYA 2ONSA 1R9QA 3LC8A 1R1NA 1RKMA 2O84X 3TMGA 4N07A 4F39A 1LLSA 2B3BA 1MQDA 2PT2A 4ZECA 2AIXA 1QKBA 3FATA 1SD3A 4POWA 3ZKLA 4PQJA 3EF7A 4ESXA 3H6UA 5DEXB 1EU8A 1M5FA 1BLFA 1ZU0A 4GFRA 2QSXA 3W9VA 2XXTA 2O7IA 3N5LA 2I49A 4EQBA 4G8HA 4G8MA 3FASA 2GFEA 4C1UA 3EQ1A 1MXVA 2V3TA 4OTEA 2ZNUA 4F3GA 1N7XA 2H99A 1XS5A 3PPNA 5FHMA 3LSFB 4RYAA 3MWBA 4E0WA 1BIYA 3QK6A 4R72A 3T96B 3QXMA 5JEIA 1URSA 1B3GA 1MH3A 4U1OA 2XXWA 2XXPA 3PUXE 3THIA 4FORA 4QFOA 1UTHB 1P99A 1UTBB 4ND9A 3DP6A 5H8NB 3C34A 3PPPA 4QFNA 3R26A 2Z22A 1B0LA 3U72A 3RGYA 3F11A 4LVQA 4ECFA 1JEVA 3I6VA 3G3KA 5I56B 5BUUA 2Q2CA 5AA1A 4F31B 2A5SA 2ZYNA 3BFTA 1B6HA 5DTBA 1TFDA 1LAXA 1XVXA 3VVEA 1DTZA 3V8XB 4YKKA 3FJ7A 2F7BA 3VXCA 1ATGA 3MP6A 4OZ9A 4FIMA 4NF6B 3G3JA 5H8FB 1MM6A 1MY4A 3HN0A 4ZZAA 2X7QA 2YPNA 4QRZA 1B7UA 1QUKA 1N3WA 3D4GA 5I2NB 5A5XA 3HPIA 3ECRA 3SEUA 3IOTA 1IXGA 4KCCA 3I3VA 4GD5A 1OLAA 5CI5A 3MVZA 1MH4A 3TQLA 4JWOA 1PB7A 5H8SA 1VR5A 3N26A 2HAVA 2KLFA 3FVGA 3Q27A 1ZJLA 3OELA 5JTYB 1XHYA 2ZXTA 3RNNA 4YMAA 1FTKA 3TDJA 2ONRA 1B05A 3GXAA 4NWDA 4Q30B 1MY0A 3SETA 1LAFE 2OWTA 4OENA 4KQPA 4QHQA 1B32A 1VFDA 2IA4A 3VLUA 3FXRA 2ABHA 3UORA 4M4GA 3AXFA 4NMYA 3IOUA 4OERA 4DCYA 1B5JA 1LFGA 5DVIA 2DWAA 3HHGA 3M3KA 2AL5A 5FTHA 3UA8A 4N13A 1JW4A 4R73A 2W7YA 2RCBA 3O97A 2O6AA 4H1XA 3U92A 4NTLA 3VXBA 1SW4A 4C1TA
chains in the Genus database with same CATH superfamily
4NEDA 5TU0A 3TAJA 4OFLA 2H4IA 4PFUA 3SKPA 4GQOA 1I69A 1H45A 4C0RA 2RC9A 5L9SA 2Y7KA 3IAZA 3LSXA 5CBRA 1N84A 4YICA 1ZIUA 1FQDA 2KR0A 3SERA 3WAEA 3V83A 1RDZA 2NVUB 2IEEA 2R71A 3K01A 3T9UA 4MIJA 4NG7A 3KSXA 4XXUA 1NFTA 2DDKA 2PCRA 4F18A 1TXFA 4Z0IA 1LAHE 4R2FA 3IO4A 5H8HB 4G77A 3C36A 1FBHA 1XC1A 3RN8A 1B3HA 2OBGA 3PUZE 3TTLA 1Z7ME 2Y7IA 3CFZA 3EHTA 4PFTA 3HSTA 4QXDA 3C4MA 2HFBA 3OO9A 2BJJX 3MYUA 3SZPA 1KZ8A 3LSLA 4JVDA 5H8QA 4LATA 5FHOA 3HCQA 4BDRA 3MPLA 2GRVA 1P1OA 4EF2A 1MXUA 1IUDA 4U4XA 2I48A 1HSEA 3IL1B 5I57A 2X7PA 3FZVA 4N15A 4MNIA 3D1RA 5BWJA 1N0TA 1EZOA 5I58B 3IJXB 4QBAA 4WEDA 4AB6A 2RCAA 3G3IA 1Y20A 2DSFA 4F22A 2NOOA 3O2AA 3Q25A 1Q9DA 4YB7A 2XXQA 1OLCA 2HAUA 3PMWA 3U93A 2CZIA 1QKAA 3H7MA 5L8DA 1FSAA 1YPNA 3T9HB 1LCFA 3IB0A 3CG1A 4R2BA 4OVPA 3SEXA 4R75A 1B3FA 2FHYA 4ISUA 4XKRA 3BFUA 1CE2A 3MZ9A 2QS4A 5CMMA 1RYOA 4IO6A 3PPRA 3LBSA 3CIJA 1MXZA 5A5LA 3M3FA 1Q1KA 1IITA 4JSDA 4ZE8A 1IXIA 3G3HA 4R74A 2QRYA 1MDP1 3RPLB 2KQZA 1OVBA 3RLFE 3TTMA 2VPOA 3KN8A 2Y7PA 2HXWA 1F9BA 5ESYA 4NF8B 4RA1A 2NWJA 3O6GA 3E3KA 1IMAA 4XKQA 4TLLB 3LV0A 4JWXA 2PVUA 3S9NC 4ZEKA 3FXUA 3QYTA 1GR2A 5FBPA 1JW1A 1VSOA 3TFLA 1DSNA 5ITOA 3MVWA 2PFZA 2ALUA 1QULA 1NUXA 5HPQA 4IO5A 1S9TA 1M5EA 3B6QA 4JBZA 1B3LA 4G68B 4TLMB 4EQ7A 4IR8A 1NV4A 4R6HA 2FIXA 1JETA 3DM0A 4YZZA 4FEBA 1SBPA 2WYPA 3PU5A 4N6DA 1URGA 3B6WA 3ZSFA 3MQ9A 3FD3A 4DXUA 2PYYA 3CSGA 3MJNA 1B52A 4P56A 2F6GA 4QSEA 1M5DA 1SW1A 4PE3A 1Y3QA 3IORA 1MDQA 1LBYA 4P47A 5CM6A 1LFHA 3GBAA 5K2YA 1VFEA 3RQTA 4UA8A 1NV2A 1EH3A 3K00A 1XOCA 4ZEBA 2ZYOA 4OETA 4R6YA 4KD5A 4RNSA 4ONYA 2Q8JA 3FVKA 1M5BA 3OOAA 4F1YA 1Y4TA 4LZ7A 3PD9A 4EF1A 4GWOA 4QFKA 3C35A 2H25A 1ZMGA 4HCYA 4YMBA 1T0KA 1IXHA 3MW0A 3LUYA 4KFQA 1EZPA 4RY1A 1NUYA 1YCJA 2XD3A 4E0XA 3IFAA 4MX6A 4FATA 1B3EA 3OD7A 1II5A 3QUFA 3SESA 2VD3A 5KCJA 4KI0E 4PETA 4XFEA 3KBZA 4PFRA 2OCUA 3IFCA 4L17A 2F5XA 4K3FA 5ET5A 3S4UA 2O69A 3KN3A 4F19A 5DVJA 4BDMA 4P0IA 1LSTA 1OQGA 2P0SA 5I2KB 4G4PA 5L9OA 1UIUA 3B50A 2XXRA 2L5VA 3PUYE 4KYDA 3TCGA 2F78A 4O7MA 4RPNA 4LN5A 1O63A 3EN3A 2OWSA 3LUZA 4GWUA 2HCAA 4XIGQ 4AS4A 4TOZA 1DMBA 4OHNA 3FJGA 3K1PA 3S2VA 1FQBA 1HSJA 2X26A 1JVYA 1B1HA 2Z8EA 2VP1A 4ZZEA 2VGQA 3WAFA 4H67A 4IB2A 1GV8A 3SEYA 2DQVA 1WODA 3TCHA 2CZLA 5TPAA 4NF5A 5CC2A 5J16A 4DZ1A 2HQ0A 3ISPA 2QVUA 1FTJA 3IX1A 4PDHA 1L5TA 2PX1A 5M2VA 2PFYA 3PMVA 4OA4A 4OEUA 4F3SA 5AA2A 1IZ1A 1YXIA 2WEFA 4I3EA 3D4CA 5JK4A 4ZS9A 2DWJA 3MPKA 1GGGA 3T93B 2XD2A 2V84A 1UIVA 1A55A 2OLBA 4OVSA 1A40A 4MF3A 4F3BA 1FTMA 3OO6A 4BDNA 4FBPA 4FECA 2FVZA 4GVOA 3VLVA 1IMCA 2Z8DA 1OIBA 1MS7A 1PBPA 2Y5KA 5H8QB 1Y3NA 3VVDA 4I3YA 3G3GA 2XX9A 2ZNTA 2O1MA 4YAHX 3BKIB 4IO7A 2NXOA 4F3PA 3MZBA 2QS1A 3ILTB 1AH5A 4N91A 4U23A 1SI1A 4GWWA 2B4LA 2XWOA 5EQ7A 2DS9A 1MY3A 3QUJA 1IMBA 3K4UA 4ELRA 2D21A 3IOWA 3TTKA 4PC9A 5AE4A 4NE4A 1VE4A 3ONMA 5I59B 2PT1A 2DVCA 3TYHA 5CMBA 3CRBA 3KOSA 5T3JA 1S7YA 3JV9A 2DVZA 4GXAA 1IEJA 3O9PA 4YKIA 1FQCA 4GBWA 4AB5A 3K0VA 1J1NA 4LZ8A 5I84A 3DP8A 4P11A 4PF8A 3HV1A 4PFYA 5ELVA 1N7WA 4RK2A 3K1MA 2GHAA 4HE2A 5DEXA 3U1OA 1BP5A 1SI0A 3RUMA 3K6WA 3UGWA 4O3AA 4I9DA 4PGPA 3PTYA 3KGCA 2DE2A 3MZ1A 1I6AA 3LR1A 1FPEA 4H5GA 4DI4B 4FEDA 4U2RA 1D9VA 3TPAA 1QUIA 1B1XA 3H6VA 5EYFA 2V93A 3OO7A 3C33A 1MPCA 1XVYA 4OYVA 1LAGE 2I3VA 4GL8A 4IY6A 3SDFA 1A7LA 1LB8A 1LBXA 3K2DA 2QVVA 3HO7A 5ICQA 1PB8A 2FNCA 1FPBA 4PTKA 2F8DA 1JNFA 1FJ6A 3PUVE 1H3DA 5H8NA 2A5TA 1FQEA 3MP1A 5AA4B 2REGA 4QFLA 1HSLA 5LOMA 1SYIA 3MSTA 3ILUB 3E9XA 3MVYA 3RT8A 3U8QA 1B5HA 4OESA 2V25A 5I56A 1LFIA 3QSLA 2RF1A 3V5AA 3T22A 1JEUA 1B46A 2I4BA 2R9JA 2F35A 3TCFA 1FPLA 4NF0A 5HBCA 5IZ3A 2H98A 2G93A 4NF4B 3USDA 1B4ZA 4XKPA 1SYHA 1OVTA 2UVHA 2B3FA 1DPEA 3OMBA 1AMFA 1H44A 4DE8A 3W15C 3FVNA 1K9YA 5TP9A 3ZS6A 4BLAA 1B5IA 2XXHA 1Y3PA 3QIMA 3FV2A 2UVGA 1B9JA 4MBPA 2DP8A 3SEVA 2CMOA 5EQAA 3O6IA 3VLWA 1MY1A 5DVFA 2REJA 2ONKE 1YAEA 1YTVA 1MPDA 3GZGA 3ZKKA 1M5CA 2ZZWA 4UABA 3TQWA 2P2AA 1NV3A 1Y4CA 4OFJA 4OFOA 4KCDA 4PDDA 1US5A 1N04A 3A09A 4F2QA 3TTRA 1B4HA 4ZDMA 2D5WA 2ZMBA 1ZBMA 1CB6A 5KCJB 2DOJA 2VHAA 2FBPA 4OEVA 3DLNA 2QS3A 1GVCA 2VD2A 3KBRA 2XXIA 1S50A 1B51A 1USYE 3RPWA 1QVSA 1GTKA 3MC2A 3Q29A 5IM2A 5CBSA 1WDNA 2DXYA 2UVJA 3H03A 4GX3A 4RXLA 4R9FA 1AOVA 4QFPA 4OVQA 5ICTA 5B70A 4NN3A 5I5PA 3C9HA 1N3XA 4H8JA 3CG3A 3EHUA 4ZEDA 1BK4A 4EXLA 1B58A 1QW0A 1EZ9A 4EUOA 1G0HA 1FJ9A 1FW0A 1OQHA 1PBQA 1FPGA 3T0JA 2QFLA 1MQHA 4ZEIA 4IGRA 3CFXA 4X48A 1NV5A 4O7IA 4QSDA 4HE1A 5L9MA 4R6KA 3BBRA 4MNCA 4PBQA 2E1SA 4ZEFA 2FA7A 4O8MA 1IMFA 4HW8A 4NF5B 2XHDA 3T66A 1P1QA 4PGNA 1FRPA 1KA1A 4OVJA 1AWBA 1BTJA 5ISUA 2DYXA 1MG1A 4N6KA 5AA2B 4FAJA 2ZYKA 2V3QA 1SPIA 2ESNA 4PBHA 4F1UA 1JW5A 2Z23A 3MUQA 1VDWA 3H6TA 1USYH 1JQFA 5AA3A 5J1DA 3RTFB 3JYRA 3VVFA 3L6GA 4JWYA 4LQ5A 4GIZA 1MPBA 3B7DA 4HTGA 4PP0A 3C31A 1ZKBA 3I5OA 3A3UA 2OK2A 3FGSA 4DXBA 1JVXA 3U65A 2ANJA 2XA5A 4BDLA 2I6EA 2F3BA 2OX3A 5KZTA 1SQYA 2Y84A 1I6QA 1US4A 2Z8FA 3TTNA 4NX1A 4OQOA 4XF5A 4HS7A 4I62A 3HHFA 5A5XB 2VPNA 3FBPA 3T9XB 3H06B 2F36A 2I0BA 1FPIA 4POXA 4DI3D 1EYKA 2Q88A 5K2XA 2XXKA 4LQ2A 3U94A 1H43A 3OENA 2RC8A 4YB6A 4YB5A 4R9GA 4ELOA 4Q0CA 1B7ZA 3KEIA 3TELA 4THIA 4MH5A 4EQ9A 1FQAA 3C32A 3QMFA 2P3VA 2V3UA 4WEPA 1R6ZA 4XTCQ 1TT1A 3FXQA 1ZLQA 2QVRA 1XT8A 3KC1A 2I0CA 1MQGA 2QL3A 5EQ9A 2PBWA 3OEMA 3LSWA 4DIGA 2HZKA 4JVIA 4DCXA 3N6UA 1K9ZA 1A54A 4OANA 3CR9A 2YJPA 2DE4A 2RC7A 2AYSA 5EHSA 1POY1 4PAIA 2F7CA 2I3WA 4X1DA 5IAIA 4MJOA 2XWKA 3M8UA 3H4ZA 3RPLA 4H5FA 4RPOA 4GOTA 4LA9A 1SVXB 4U22A 1O7TA 4O94A 1PDAA 4JDFA 1G0IA 5KDTA 2HXRA 3N6TA 2Q89A 1FTOA 2Q9TA 3T1BA 4NF8A 4GWXA 1IIWA 1LB9A 2OJTA 2I58A 3PV0E 3O66A 2ZYMA 4IO3A 4KXPA 4Q8RA 1MXWA 2Y7WA 4ELQA 4GL0A 4JXIA 4XKNA 2O68A 3VE1B 5LTCA 3KJ7A 4DDDA 3OSRA 4N6PA 2A5TB 2Y5LA 4KHZE 5DT6A 1NV6A 3OXNA 1A99A 3FVOA 4G68A 4I40A 4IO4A 1LGBC 3G7WA 1LBWA 1MM7A 3GLBA 4TQUQ 2M8CA 2XX7A 1ELJA 3UP9A 3FIRA 4PFBA 2WKYA 4EXKA 3ODBA 2UYEA 4BDQA 3H6WA 4Q5TA 1FPJA 2G29A 2HHMA 2GHBA 5DYHA 3VV5A 2XX8A 4N4UA 1B40A 1AIVA 1DCUA 4DLDA 3DP4A 1Z7NE 3BIHA 1I6BA 1LBVA 4JVCA 3SEWA 3EPEA 5TP9B 5I57B 3A3CA 4U4SA 1INPA 4OVRA 3S9LC 1EYJA 4GBVA 2RINA 2UXAA 2QPQA 1POTA 5IKBA 2XWVA 3E4RA 3OSQA 3PGFA 5FHNA 1PC3A 4LUBA 5CRYA 5F7VA 3Q26A 4F29A 2FIEA 2DWHA 1PEBA 4PFIA 1FQFA 1A8FA 3BIGA 1NMUA 5ITPA 1KWHA 2XWIA 4YKJA 4DXCA 3GBBA 4MMPA 4O3CA 3KC0A 3VDFA 1OMPA 3ROJA 1RYXA 1LBZA 4I8CA 3QAXA 1DOTA 1NKXA 1DTGA 4RK9A 2P1SA 3FJMA 4NGUA 4P0GA 4MHFA 4EDPA 3TEPA 1NUWA 2Q74A 4MAGA 5CMCA 2VOZA 4MCOA 1PB9A 4AS5A 2THIA 3S9MC 4QF9A 1FBEA 5I2KA 4P3LA 3IOVA 1D3KA 4U1ZA 4OMBA 4KR5A 1NI9A 3K1NA 5EHMA 3K02A 1FTLA 1URDA 4HCWA 1MXXA 1N76A 3KG2A 4MFIA 3MP8A 2DE3A 1MQJA 3K6UA 4G2ZA 3MAMA 3KJTA 2OZZA 2XXXA 5FTIA 1D4NA 2F34A 5IGAA 3IJOB 3CVGA 4IY5A 1B7HA 3NOHA 1UTHA 2B4MA 1UTBA 4BDOA 4HE0A 3K6VA 3KSJA 3UN6A 5HM4B 3TZAA 3B6TA 1MRPA 2HPGA 2RKMA 3OEKA 1R9LA 2AL4A 4GX6A 4Z7EA 3OO8A 3E79A 4PE5B 1FTAA 3PPOA 2QJEA 3EKIA 1SDXA 2ZNSA 3A29A 3RT6B 4KPTA 1IQ7A 3EHSA 3O28A 3O6HA 2DWIA 2HEUA 2FYIA 3TKDA 4PFWA 3UIFA 2UYFA 3FUZA 3PPQA 1TWYA 3DELB 4N8YA 1LCTA 4XEQA 1FPFA 2XXVA 2F97A 4NF6A 4GRKA 1D9YA 3N94A 1P1WA 5H8FA 4MLQA 4NQ8A 2GH9A 4YU0A 4G8NA 3MBPA 3CI8A 4H8IA 1FCKA 3G3FA 4ELPA 1FBGA 2CEYA 2CEXA 4MEVA 3PUWE 5I2NA 1NNTA 3P7IA 1A8EA 5ET6A 1LBCA 1NV0A 4KYEA 1Y9UA 3UK4A 1P1NA 5EQ8A 1SW2A 1MXYA 1WVJA 4MLVA 2O51A 1B0HA 4OVTA 4ESWA 1Q35A 4F1VA 3V89B 1P1UA 3MVXA 5I59A 4M1VA 3R7XA 3IB1A 5JTYA 4O3BA 3TUSA 4FJPA 3L6HA 2HZLA 4U21A 1QJMA 1DBZA 2XXUA 5F24A 2Y7RA 4NAPA 4PF6A 4N17A 1LBBA 1BKAA 2I4CA 1IXCA 4H65A 2V4CA 3IB2A 3KFMA 3KN7A 2UVIA 1FBPA 4X1BA 2WYKA 2QS2A 4GXSB 3E13X 2D3IA 4OWDA 2NUVA 4N81A 3IK6B 3JZJA 2JJKA 2QMXA 5AA2D 3CHGA 1NNFA 5CMKA 2O7UA 1QGXA 2PMSA 2H9BA 4GF8A 1NNKA 1Y1ZA 2H5YA 2DXRA 4ZE9A 1AL3A 3CSBA 4X9TA 3IR1A 5KDTB 4IO2A 3O29A 1NH7A 4WXJA 1ANFA 4G68C 1RDXA 1JP4A 2ZZVA 4UACA 4I1DA 4YKPA 2VT5A 3B8BA 5TPAB 3VFJA 1IMDA 3R6UA 1FBCA 3FXBA 4QSCA 2P3NA 5IZZA 3PD8A 2Q8MA 3KZGA 3RTWB 3IO6A 1NH8A 1ZTYA 3K6XA 4RJZA 3M3LA 4WKMA 4F2OA 1O64A 3W9WA 1IMEA 4AQ4A 3RY3A 4GWYA 5F1QA 5AA4A 1NL5A 5B7DA 3RYDA 1NNPA 4H6DA 3KOTA 4NWCA 5H8HA 4LP2B 1TFAA 4GLIA 2F7AA 2R6GE 1QUJA 1B2HA 2WBDA 2ZZXA 3S9EA 1MY2A 2F6PA 1SW5A 4FE8A 2YLNA 4P9KA 4H0WA 2B65A 4LZ5A 5EYGA 2OWZA 4NF4A 5ET8A 4KYSA 1FBDA 4JB7A 1KA0A 3HFUA 4PAFA 2QMWA 1MQIA 2E0SA 4IGTA 4JSOA 1H76A 3FV1A 2O1LA 3T9VA 3TODA 1Y1MA 2Q2AA 4LONB 3H3GA 1YYZA 5I58A 1UQWA 4OXVA 3CFLA 3PMXA 1DPPA 3Q28A 2LAOA 2XXYA 5IZ1A 5LDZA 2ONSA 1R9QA 3LC8A 5ET7A 1R1NA 1RKMA 2O84X 3TMGA 4N07A 4F39A 1LLSA 2B3BA 1MQDA 2PT2A 4ZECA 2AIXA 1QKBA 4P1LA 2CZHA 3FATA 1SD3A 4POWA 3ZKLA 4PQJA 3EF7A 4ESXA 3H6UA 5DEXB 1EU8A 1M5FA 1BLFA 4G61A 1ZU0A 4GFRA 2QSXA 3W9VA 2XXTA 4GWSA 2O7IA 3N5LA 2I49A 4EQBA 4G8HA 4G8MA 3FASA 2GFEA 4C1UA 3EQ1A 1MXVA 2V3TA 4OTEA 2ZNUA 4F3GA 1N7XA 2H99A 1XS5A 3PPNA 5FHMA 3E78A 4HXVA 3LSFB 1EYIA 4RYAA 3MWBA 4E0WA 1BIYA 1NV1A 3QK6A 4R72A 3T96B 3QXMA 5JEIA 1URSA 1B3GA 2WX9A 1MH3A 4U1OA 2XXWA 2XXPA 3PUXE 3THIA 4FORA 4QFOA 1UTHB 1P99A 1UTBB 4ND9A 3DP6A 5H8NB 3C34A 3PPPA 4QFNA 3R26A 2CZKA 4X8RA 2Z22A 1B0LA 3U72A 3RGYA 4GWZA 3F11A 4LVQA 4ECFA 1JEVA 1DK4A 3I6VA 3G3KA 5I56B 5BUUA 2Q2CA 5AA1A 4F31B 2A5SA 2ZYNA 3BFTA 1B6HA 5DTBA 4GX4A 1TFDA 2MKZA 5IZ3B 1LAXA 1XVXA 3VVEA 1DTZA 3V8XB 4NHBA 1XI6A 4YKKA 3FJ7A 1NV7A 2F7BA 3VXCA 1ATGA 3MP6A 4OZ9A 4FIMA 5I7IA 4NF6B 2R8TA 4PCDA 3G3JA 4P1EA 5H8FB 1MM6A 1MY4A 3HN0A 4ZZAA 2X7QA 2YPNA 1LEVA 4QRZA 1B7UA 1QUKA 1N3WA 3D4GA 5I2NB 5A5XA 3HPIA 3ECRA 3SEUA 3IOTA 4N8GA 1IXGA 4KCCA 3I3VA 4GD5A 4H45A 1OLAA 5CI5A 3MVZA 1MH4A 3TQLA 4H46A 4JWOA 1PB7A 5H8SA 1VR5A 3N26A 2WBBA 1FPKA 2HAVA 2KLFA 3FVGA 3Q27A 1ZJLA 3OELA 5JTYB 1FPDA 1XHYA 2ZXTA 3RNNA 4YMAA 1YZ0A 1FTKA 2F3DA 5DW8A 1CNQA 3TDJA 5I3SA 2ONRA 1B05A 3GXAA 4NWDA 4Q30B 1MY0A 3SETA 1LAFE 2OWTA 4OENA 4KQPA 4QHQA 1B32A 1VFDA 1NUZA 4PAKA 2IA4A 3VLUA 2GQ1A 3GYYA 4X04A 3FXRA 2ABHA 3UORA 4M4GA 1FBFA 3AXFA 4NMYA 3IOUA 4OERA 4DCYA 1B5JA 1LFGA 5EYHA 5DVIA 1RDYA 2DWAA 4P8BA 3HHGA 3M3KA 2AL5A 5FTHA 3UA8A 4MNPA 4N13A 1JW4A 4R73A 2W7YA 2RCBA 3O97A 2O6AA 4H1XA 3U92A 4NTLA 3VXBA 1SW4A 4C1TA 1D9QA 2BJIA
chains in the Genus database with same CATH topology
4NEDA 5TU0A 3TAJA 4OFLA 2H4IA 4PFUA 3SKPA 4GQOA 1I69A 1H45A 4C0RA 2RC9A 5L9SA 2Y7KA 3IAZA 3LSXA 5CBRA 1N84A 4YICA 1ZIUA 1FQDA 3WAEA 3SERA 3V83A 2NVUB 2IEEA 2R71A 3K01A 3T9UA 3KSXA 4XXUA 1NFTA 4F18A 1TXFA 4Z0IA 1LAHE 4R2FA 3IO4A 5H8HB 4G77A 3C36A 1XC1A 3RN8A 1B3HA 2OBGA 3PUZE 3TTLA 1Z7ME 2Y7IA 3CFZA 3EHTA 4PFTA 3HSTA 3C4MA 2HFBA 3OO9A 2BJJX 3LSLA 5H8QA 4LATA 5FHOA 3HCQA 4BDRA 3MPLA 2GRVA 1P1OA 4EF2A 1MXUA 1IUDA 4U4XA 2I48A 1HSEA 3IL1B 5I57A 2X7PA 3FZVA 5BWJA 1N0TA 1EZOA 5I58B 3IJXB 4WEDA 4AB6A 2RCAA 3G3IA 1Y20A 2DSFA 4F22A 2NOOA 3O2AA 3Q25A 4YB7A 2XXQA 1OLCA 2HAUA 3PMWA 3U93A 1QKAA 3H7MA 5L8DA 1YPNA 3T9HB 1LCFA 3IB0A 3CG1A 4R2BA 3SEXA 4R75A 1B3FA 4ISUA 4XKRA 3BFUA 1CE2A 3MZ9A 2QS4A 5CMMA 1RYOA 4IO6A 3PPRA 3LBSA 3CIJA 1MXZA 3M3FA 1Q1KA 1IITA 4JSDA 4ZE8A 1IXIA 3G3HA 4R74A 2QRYA 1MDP1 1OVBA 3RLFE 3TTMA 3KN8A 2Y7PA 2HXWA 1F9BA 4NF8B 4RA1A 2NWJA 3O6GA 3E3KA 4XKQA 4TLLB 4JWXA 2PVUA 3S9NC 4ZEKA 3FXUA 3QYTA 1GR2A 1JW1A 1VSOA 3TFLA 1DSNA 5ITOA 3MVWA 2ALUA 1QULA 5HPQA 4IO5A 1S9TA 1M5EA 3B6QA 4JBZA 1B3LA 4G68B 4TLMB 4EQ7A 4R6HA 1JETA 3DM0A 4YZZA 4FEBA 1SBPA 3PU5A 1URGA 3B6WA 3ZSFA 3MQ9A 3FD3A 4DXUA 2PYYA 3CSGA 3MJNA 1B52A 2F6GA 4QSEA 1M5DA 1SW1A 1Y3QA 3IORA 1MDQA 5CM6A 1LFHA 3GBAA 5K2YA 1VFEA 3RQTA 4UA8A 1EH3A 3K00A 1XOCA 4ZEBA 2ZYOA 4OETA 4R6YA 4KD5A 4RNSA 4ONYA 2Q8JA 3FVKA 1M5BA 3OOAA 4F1YA 1Y4TA 4LZ7A 3PD9A 4EF1A 4GWOA 4QFKA 3C35A 2H25A 1ZMGA 4HCYA 4YMBA 1T0KA 1IXHA 3MW0A 3LUYA 4KFQA 1EZPA 4RY1A 1YCJA 2XD3A 4E0XA 4FATA 1B3EA 3OD7A 1II5A 3QUFA 3SESA 2VD3A 5KCJA 4KI0E 4PETA 2OCUA 4L17A 2F5XA 4K3FA 3S4UA 2O69A 3KN3A 4F19A 5DVJA 4BDMA 4P0IA 1LSTA 1OQGA 2P0SA 5I2KB 4G4PA 5L9OA 1UIUA 2XXRA 3PUYE 4KYDA 3TCGA 2F78A 4RPNA 1O63A 3EN3A 2OWSA 2HCAA 4XIGQ 4TOZA 1DMBA 4OHNA 3FJGA 3K1PA 3S2VA 1FQBA 1HSJA 2X26A 1JVYA 1B1HA 2Z8EA 2VP1A 4ZZEA 2VGQA 3WAFA 4H67A 4IB2A 1GV8A 3SEYA 2DQVA 1WODA 3TCHA 2CZLA 5TPAA 4NF5A 5CC2A 4DZ1A 2HQ0A 1FTJA 3IX1A 1L5TA 2PX1A 5M2VA 3PMVA 4OEUA 4F3SA 5AA2A 1IZ1A 3D4CA 5JK4A 4ZS9A 2DWJA 3MPKA 1GGGA 3T93B 2XD2A 2V84A 1UIVA 1A55A 2OLBA 1A40A 4MF3A 4F3BA 1FTMA 3OO6A 4BDNA 4FECA 4GVOA 3VLVA 2Z8DA 1OIBA 1MS7A 1PBPA 5H8QB 1Y3NA 3VVDA 3G3GA 2XX9A 2ZNTA 2O1MA 4YAHX 3BKIB 4IO7A 2NXOA 4F3PA 3MZBA 2QS1A 3ILTB 1AH5A 4U23A 1SI1A 2DS9A 1MY3A 3QUJA 3K4UA 4ELRA 2D21A 3IOWA 3TTKA 5AE4A 4NE4A 1VE4A 3ONMA 5I59B 2PT1A 2DVCA 3TYHA 5CMBA 3CRBA 3KOSA 1S7YA 3JV9A 2DVZA 4GXAA 1IEJA 3O9PA 4YKIA 1FQCA 4AB5A 3K0VA 1J1NA 4LZ8A 5I84A 3DP8A 4P11A 3HV1A 4PFYA 5ELVA 1N7WA 4RK2A 3K1MA 2GHAA 3U1OA 5DEXA 1BP5A 1SI0A 3RUMA 3K6WA 3UGWA 4O3AA 4I9DA 3KGCA 2DE2A 3MZ1A 1I6AA 3LR1A 4H5GA 4FEDA 4U2RA 1D9VA 3TPAA 1QUIA 1B1XA 3H6VA 5EYFA 2V93A 3OO7A 3C33A 1MPCA 1XVYA 4OYVA 1LAGE 2I3VA 4GL8A 4IY6A 3SDFA 1A7LA 1LB8A 3K2DA 3HO7A 5ICQA 1PB8A 2FNCA 2F8DA 1JNFA 3PUVE 1H3DA 5H8NA 2A5TA 1FQEA 3MP1A 5AA4B 2REGA 4QFLA 1HSLA 5LOMA 1SYIA 3ILUB 3E9XA 3MVYA 3RT8A 3U8QA 1B5HA 4OESA 2V25A 5I56A 1LFIA 3QSLA 2RF1A 3V5AA 3T22A 1JEUA 1B46A 2I4BA 2R9JA 3TCFA 2F35A 5HBCA 2H98A 2G93A 4NF4B 3USDA 1B4ZA 4XKPA 1SYHA 1OVTA 2UVHA 2B3FA 1DPEA 3OMBA 1AMFA 1H44A 4DE8A 3W15C 3FVNA 5TP9A 3ZS6A 4BLAA 1B5IA 2XXHA 1Y3PA 3QIMA 3FV2A 2UVGA 1B9JA 4MBPA 2DP8A 3SEVA 2CMOA 3O6IA 3VLWA 1MY1A 5DVFA 2REJA 2ONKE 1YAEA 1YTVA 1MPDA 3GZGA 3ZKKA 1M5CA 3TQWA 2P2AA 1Y4CA 4OFJA 4OFOA 4KCDA 1US5A 1N04A 3A09A 4F2QA 3TTRA 1B4HA 4ZDMA 2D5WA 2ZMBA 1ZBMA 1CB6A 5KCJB 2DOJA 2VHAA 4OEVA 3DLNA 2QS3A 1GVCA 2VD2A 3KBRA 2XXIA 1S50A 1B51A 1USYE 3RPWA 1QVSA 1GTKA 3MC2A 3Q29A 5CBSA 1WDNA 2DXYA 2UVJA 3H03A 4RXLA 4R9FA 1AOVA 4QFPA 5ICTA 5B70A 3C9HA 1N3XA 4H8JA 3CG3A 3EHUA 4ZEDA 4EXLA 1B58A 1QW0A 1EZ9A 4EUOA 1FW0A 1OQHA 1PBQA 1MQHA 4ZEIA 4IGRA 3CFXA 4X48A 4QSDA 5L9MA 4R6KA 3BBRA 2E1SA 4ZEFA 2FA7A 4HW8A 4NF5B 2XHDA 3T66A 1P1QA 5ISUA 4OVJA 1BTJA 2DYXA 1MG1A 5AA2B 4FAJA 2ZYKA 2V3QA 2ESNA 4F1UA 1JW5A 2Z23A 3MUQA 3H6TA 1USYH 1JQFA 5AA3A 5J1DA 3RTFB 3JYRA 3VVFA 3L6GA 4JWYA 4LQ5A 4GIZA 1MPBA 3B7DA 4HTGA 4PP0A 3C31A 1ZKBA 3I5OA 3A3UA 2OK2A 3FGSA 4DXBA 1JVXA 2ANJA 4BDLA 2I6EA 5KZTA 1SQYA 2Y84A 1I6QA 1US4A 2Z8FA 3TTNA 4OQOA 4HS7A 4I62A 3HHFA 5A5XB 3T9XB 3H06B 2F36A 2I0BA 4POXA 2Q88A 5K2XA 4LQ2A 3U94A 1H43A 3OENA 2RC8A 4YB6A 4YB5A 4R9GA 4ELOA 4Q0CA 1B7ZA 3KEIA 3TELA 4THIA 4MH5A 4EQ9A 1FQAA 3C32A 2V3UA 4WEPA 1R6ZA 4XTCQ 1TT1A 3FXQA 1ZLQA 1XT8A 2I0CA 1MQGA 2QL3A 2PBWA 3OEMA 3LSWA 4DIGA 2HZKA 4DCXA 3N6UA 1A54A 3CR9A 2YJPA 2DE4A 2RC7A 2AYSA 5EHSA 1POY1 2F7CA 2I3WA 4X1DA 5IAIA 3M8UA 3H4ZA 4H5FA 4RPOA 4GOTA 4LA9A 1SVXB 4U22A 1O7TA 1PDAA 4JDFA 5KDTA 3N6TA 2Q89A 1FTOA 2Q9TA 4NF8A 1IIWA 1LB9A 2OJTA 2I58A 3PV0E 3O66A 2ZYMA 4IO3A 4Q8RA 1MXWA 2Y7WA 4ELQA 4GL0A 4JXIA 4XKNA 2O68A 3VE1B 3KJ7A 4DDDA 3OSRA 4N6PA 2A5TB 4KHZE 5DT6A 3OXNA 1A99A 3FVOA 4G68A 4IO4A 1LGBC 3G7WA 1MM7A 3GLBA 4TQUQ 2M8CA 2XX7A 1ELJA 3UP9A 3FIRA 2WKYA 4EXKA 3ODBA 2UYEA 4BDQA 3H6WA 4Q5TA 2G29A 2GHBA 5DYHA 3VV5A 2XX8A 1B40A 1AIVA 4DLDA 3DP4A 1Z7NE 1I6BA 3SEWA 3EPEA 5TP9B 5I57B 3A3CA 4U4SA 3S9LC 2RINA 2UXAA 2QPQA 1POTA 5IKBA 3E4RA 3OSQA 3PGFA 5FHNA 1PC3A 4LUBA 5CRYA 5F7VA 3Q26A 4F29A 2DWHA 1PEBA 1FQFA 1A8FA 5ITPA 1NMUA 1KWHA 4YKJA 4DXCA 3GBBA 4O3CA 3VDFA 1OMPA 1RYXA 4I8CA 3QAXA 1DOTA 1NKXA 1DTGA 4RK9A 2P1SA 3FJMA 4P0GA 4EDPA 3TEPA 5CMCA 2VOZA 1PB9A 2THIA 3S9MC 4QF9A 5I2KA 3IOVA 1D3KA 4U1ZA 4OMBA 4KR5A 3K1NA 5EHMA 3K02A 1FTLA 1URDA 4HCWA 1MXXA 1N76A 3KG2A 4MFIA 3MP8A 2DE3A 1MQJA 3K6UA 4G2ZA 3MAMA 3KJTA 2OZZA 2XXXA 5FTIA 1D4NA 2F34A 3IJOB 3CVGA 4IY5A 1B7HA 1UTHA 1UTBA 4BDOA 3K6VA 3KSJA 3UN6A 5HM4B 3TZAA 3B6TA 1MRPA 2RKMA 3OEKA 1R9LA 2AL4A 4Z7EA 3OO8A 4PE5B 3PPOA 2QJEA 1SDXA 2ZNSA 3RT6B 4KPTA 1IQ7A 3EHSA 3O28A 3O6HA 2DWIA 2HEUA 2FYIA 3TKDA 4PFWA 3UIFA 2UYFA 3FUZA 3PPQA 1TWYA 3DELB 1LCTA 2XXVA 2F97A 4NF6A 4GRKA 1D9YA 3N94A 1P1WA 5H8FA 4MLQA 2GH9A 4YU0A 4G8NA 3MBPA 3CI8A 4H8IA 1FCKA 3G3FA 4ELPA 3PUWE 5I2NA 1NNTA 3P7IA 1A8EA 1LBCA 4KYEA 1Y9UA 3UK4A 1P1NA 1SW2A 1MXYA 1WVJA 4MLVA 2O51A 1B0HA 4ESWA 1Q35A 4F1VA 3V89B 1P1UA 3MVXA 5I59A 4M1VA 3R7XA 3IB1A 5JTYA 4O3BA 3TUSA 4FJPA 3L6HA 2HZLA 4U21A 1QJMA 2XXUA 2Y7RA 1LBBA 1BKAA 2I4CA 1IXCA 4H65A 3IB2A 3KFMA 3KN7A 2UVIA 4X1BA 2QS2A 4GXSB 3E13X 2D3IA 4OWDA 2NUVA 3IK6B 3JZJA 2QMXA 5AA2D 1NNFA 5CMKA 2O7UA 2PMSA 2H9BA 4GF8A 1NNKA 1Y1ZA 2H5YA 2DXRA 4ZE9A 1AL3A 3CSBA 4X9TA 3IR1A 5KDTB 4IO2A 3O29A 1NH7A 4WXJA 1ANFA 4G68C 4UACA 4I1DA 4YKPA 5TPAB 3VFJA 3R6UA 4QSCA 3PD8A 3KZGA 3RTWB 3IO6A 1NH8A 1ZTYA 3K6XA 4RJZA 3M3LA 4WKMA 4F2OA 1O64A 3W9WA 4AQ4A 3RY3A 5F1QA 5AA4A 1NL5A 5B7DA 1NNPA 4H6DA 3KOTA 4NWCA 5H8HA 4LP2B 1TFAA 4GLIA 2F7AA 2R6GE 1QUJA 1B2HA 3S9EA 1MY2A 2F6PA 1SW5A 4FE8A 2YLNA 4H0WA 2B65A 4LZ5A 4NF4A 4KYSA 4JB7A 2QMWA 1MQIA 2E0SA 4IGTA 4JSOA 1H76A 3FV1A 2O1LA 3T9VA 3TODA 1Y1MA 2Q2AA 4LONB 3H3GA 5I58A 1UQWA 4OXVA 3CFLA 3PMXA 1DPPA 3Q28A 2LAOA 2XXYA 2ONSA 1R9QA 3LC8A 1R1NA 1RKMA 2O84X 3TMGA 4N07A 4F39A 1LLSA 2B3BA 1MQDA 2PT2A 4ZECA 2AIXA 1QKBA 3FATA 1SD3A 4POWA 3ZKLA 4PQJA 3EF7A 4ESXA 3H6UA 5DEXB 1EU8A 1M5FA 1BLFA 1ZU0A 4GFRA 2QSXA 3W9VA 2XXTA 2O7IA 3N5LA 2I49A 4EQBA 4G8HA 4G8MA 3FASA 2GFEA 4C1UA 3EQ1A 1MXVA 2V3TA 4OTEA 2ZNUA 4F3GA 1N7XA 2H99A 1XS5A 3PPNA 5FHMA 3LSFB 4RYAA 3MWBA 4E0WA 1BIYA 3QK6A 4R72A 3T96B 3QXMA 5JEIA 1URSA 1B3GA 1MH3A 4U1OA 2XXWA 2XXPA 3PUXE 3THIA 4FORA 4QFOA 1UTHB 1P99A 1UTBB 4ND9A 3DP6A 5H8NB 3C34A 3PPPA 4QFNA 3R26A 2Z22A 1B0LA 3U72A 3RGYA 3F11A 4LVQA 4ECFA 1JEVA 3I6VA 3G3KA 5I56B 5BUUA 2Q2CA 5AA1A 4F31B 2A5SA 2ZYNA 3BFTA 1B6HA 5DTBA 1TFDA 1LAXA 1XVXA 3VVEA 1DTZA 3V8XB 4YKKA 3FJ7A 2F7BA 3VXCA 1ATGA 3MP6A 4OZ9A 4FIMA 4NF6B 3G3JA 5H8FB 1MM6A 1MY4A 3HN0A 4ZZAA 2X7QA 2YPNA 4QRZA 1B7UA 1QUKA 1N3WA 3D4GA 5I2NB 5A5XA 3HPIA 3ECRA 3SEUA 3IOTA 1IXGA 4KCCA 3I3VA 4GD5A 1OLAA 5CI5A 3MVZA 1MH4A 3TQLA 4JWOA 1PB7A 5H8SA 1VR5A 3N26A 2HAVA 2KLFA 3FVGA 3Q27A 1ZJLA 3OELA 5JTYB 1XHYA 2ZXTA 3RNNA 4YMAA 1FTKA 3TDJA 2ONRA 1B05A 3GXAA 4NWDA 4Q30B 1MY0A 3SETA 1LAFE 2OWTA 4OENA 4KQPA 4QHQA 1B32A 1VFDA 2IA4A 3VLUA 3FXRA 2ABHA 3UORA 4M4GA 3AXFA 4NMYA 3IOUA 4OERA 4DCYA 1B5JA 1LFGA 5DVIA 2DWAA 3HHGA 3M3KA 2AL5A 5FTHA 3UA8A 4N13A 1JW4A 4R73A 2W7YA 2RCBA 3O97A 2O6AA 4H1XA 3U92A 4NTLA 3VXBA 1SW4A 4C1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NED A;  5TU0 A;  3TAJ A;  4OFL A;  2H4I A;  4PFU A;  3SKP A;  4GQO A;  1I69 A;  1H45 A;  4C0R A;  2RC9 A;  5L9S A;  2Y7K A;  3IAZ A;  3LSX A;  5CBR A;  1N84 A;  4YIC A;  1ZIU A;  1FQD A;  3WAE A;  3SER A;  3V83 A;  2NVU B;  2IEE A;  2R71 A;  3K01 A;  3T9U A;  3KSX A;  4XXU A;  1NFT A;  4F18 A;  1TXF A;  4Z0I A;  1LAH E;  4R2F A;  3IO4 A;  5H8H B;  4G77 A;  3C36 A;  1XC1 A;  3RN8 A;  1B3H A;  2OBG A;  3PUZ E;  3TTL A;  1Z7M E;  2Y7I A;  3CFZ A;  3EHT A;  4PFT A;  3HST A;  3C4M A;  2HFB A;  3OO9 A;  2BJJ X;  3LSL A;  5H8Q A;  4LAT A;  5FHO A;  3HCQ A;  4BDR A;  3MPL A;  2GRV A;  1P1O A;  4EF2 A;  1MXU A;  1IUD A;  4U4X A;  2I48 A;  1HSE A;  3IL1 B;  5I57 A;  2X7P A;  3FZV A;  5BWJ A;  1N0T A;  1EZO A;  5I58 B;  3IJX B;  4WED A;  4AB6 A;  2RCA A;  3G3I A;  1Y20 A;  2DSF A;  4F22 A;  2NOO A;  3O2A A;  3Q25 A;  4YB7 A;  2XXQ A;  1OLC A;  2HAU A;  3PMW A;  3U93 A;  1QKA A;  3H7M A;  5L8D A;  1YPN A;  3T9H B;  1LCF A;  3IB0 A;  3CG1 A;  4R2B A;  3SEX A;  4R75 A;  1B3F A;  4ISU A;  4XKR A;  3BFU A;  1CE2 A;  3MZ9 A;  2QS4 A;  5CMM A;  1RYO A;  4IO6 A;  3PPR A;  3LBS A;  3CIJ A;  1MXZ A;  3M3F A;  1Q1K A;  1IIT A;  4JSD A;  4ZE8 A;  1IXI A;  3G3H A;  4R74 A;  2QRY A;  1MDP 1;  1OVB A;  3RLF E;  3TTM A;  3KN8 A;  2Y7P A;  2HXW A;  1F9B A;  4NF8 B;  4RA1 A;  2NWJ A;  3O6G A;  3E3K A;  4XKQ A;  4TLL B;  4JWX A;  2PVU A;  3S9N C;  4ZEK A;  3FXU A;  3QYT A;  1GR2 A;  1JW1 A;  1VSO A;  3TFL A;  1DSN A;  5ITO A;  3MVW A;  2ALU A;  1QUL A;  5HPQ A;  4IO5 A;  1S9T A;  1M5E A;  3B6Q A;  4JBZ A;  1B3L A;  4G68 B;  4TLM B;  4EQ7 A;  4R6H A;  1JET A;  3DM0 A;  4YZZ A;  4FEB A;  1SBP A;  3PU5 A;  1URG A;  3B6W A;  3ZSF A;  3MQ9 A;  3FD3 A;  4DXU A;  2PYY A;  3CSG A;  3MJN A;  1B52 A;  2F6G A;  4QSE A;  1M5D A;  1SW1 A;  1Y3Q A;  3IOR A;  1MDQ A;  5CM6 A;  1LFH A;  3GBA A;  5K2Y A;  1VFE A;  3RQT A;  4UA8 A;  1EH3 A;  3K00 A;  1XOC A;  4ZEB A;  2ZYO A;  4OET A;  4R6Y A;  4KD5 A;  4RNS A;  4ONY A;  2Q8J A;  3FVK A;  1M5B A;  3OOA A;  4F1Y A;  1Y4T A;  4LZ7 A;  3PD9 A;  4EF1 A;  4GWO A;  4QFK A;  3C35 A;  2H25 A;  1ZMG A;  4HCY A;  4YMB A;  1T0K A;  1IXH A;  3MW0 A;  3LUY A;  4KFQ A;  1EZP A;  4RY1 A;  1YCJ A;  2XD3 A;  4E0X A;  4FAT A;  1B3E A;  3OD7 A;  1II5 A;  3QUF A;  3SES A;  2VD3 A;  5KCJ A;  4KI0 E;  4PET A;  2OCU A;  4L17 A;  2F5X A;  4K3F A;  3S4U A;  2O69 A;  3KN3 A;  4F19 A;  5DVJ A;  4BDM A;  4P0I A;  1LST A;  1OQG A;  2P0S A;  5I2K B;  4G4P A;  5L9O A;  1UIU A;  2XXR A;  3PUY E;  4KYD A;  3TCG A;  2F78 A;  4RPN A;  1O63 A;  3EN3 A;  2OWS A;  2HCA A;  4XIG Q;  4TOZ A;  1DMB A;  4OHN A;  3FJG A;  3K1P A;  3S2V A;  1FQB A;  1HSJ A;  2X26 A;  1JVY A;  1B1H A;  2Z8E A;  2VP1 A;  4ZZE A;  2VGQ A;  3WAF A;  4H67 A;  4IB2 A;  1GV8 A;  3SEY A;  2DQV A;  1WOD A;  3TCH A;  2CZL A;  5TPA A;  4NF5 A;  5CC2 A;  4DZ1 A;  2HQ0 A;  1FTJ A;  3IX1 A;  1L5T A;  2PX1 A;  5M2V A;  3PMV A;  4OEU A;  4F3S A;  5AA2 A;  1IZ1 A;  3D4C A;  5JK4 A;  4ZS9 A;  2DWJ A;  3MPK A;  1GGG A;  3T93 B;  2XD2 A;  2V84 A;  1UIV A;  1A55 A;  2OLB A;  1A40 A;  4MF3 A;  4F3B A;  1FTM A;  3OO6 A;  4BDN A;  4FEC A;  4GVO A;  3VLV A;  2Z8D A;  1OIB A;  1MS7 A;  1PBP A;  5H8Q B;  1Y3N A;  3VVD A;  3G3G A;  2XX9 A;  2ZNT A;  2O1M A;  4YAH X;  3BKI B;  4IO7 A;  2NXO A;  4F3P A;  3MZB A;  2QS1 A;  3ILT B;  1AH5 A;  4U23 A;  1SI1 A;  2DS9 A;  1MY3 A;  3QUJ A;  3K4U A;  4ELR A;  2D21 A;  3IOW A;  3TTK A;  5AE4 A;  4NE4 A;  1VE4 A;  3ONM A;  5I59 B;  2PT1 A;  2DVC A;  3TYH A;  5CMB A;  3CRB A;  3KOS A;  1S7Y A;  3JV9 A;  2DVZ A;  4GXA A;  1IEJ A;  3O9P A;  4YKI A;  1FQC A;  4AB5 A;  3K0V A;  1J1N A;  4LZ8 A;  5I84 A;  3DP8 A;  4P11 A;  3HV1 A;  4PFY A;  5ELV A;  1N7W A;  4RK2 A;  3K1M A;  2GHA A;  3U1O A;  5DEX A;  1BP5 A;  1SI0 A;  3RUM A;  3K6W A;  3UGW A;  4O3A A;  4I9D A;  3KGC A;  2DE2 A;  3MZ1 A;  1I6A A;  3LR1 A;  4H5G A;  4FED A;  4U2R A;  1D9V A;  3TPA A;  1QUI A;  1B1X A;  3H6V A;  5EYF A;  2V93 A;  3OO7 A;  3C33 A;  1MPC A;  1XVY A;  4OYV A;  1LAG E;  2I3V A;  4GL8 A;  4IY6 A;  3SDF A;  1A7L A;  1LB8 A;  3K2D A;  3HO7 A;  5ICQ A;  1PB8 A;  2FNC A;  2F8D A;  1JNF A;  3PUV E;  1H3D A;  5H8N A;  2A5T A;  1FQE A;  3MP1 A;  5AA4 B;  2REG A;  4QFL A;  1HSL A;  5LOM A;  1SYI A;  3ILU B;  3E9X A;  3MVY A;  3RT8 A;  3U8Q A;  1B5H A;  4OES A;  2V25 A;  5I56 A;  1LFI A;  3QSL A;  2RF1 A;  3V5A A;  3T22 A;  1JEU A;  1B46 A;  2I4B A;  2R9J A;  3TCF A;  2F35 A;  5HBC A;  2H98 A;  2G93 A;  4NF4 B;  3USD A;  1B4Z A;  4XKP A;  1SYH A;  1OVT A;  2UVH A;  2B3F A;  1DPE A;  3OMB A;  1AMF A;  1H44 A;  4DE8 A;  3W15 C;  3FVN A;  5TP9 A;  3ZS6 A;  4BLA A;  1B5I A;  2XXH A;  1Y3P A;  3QIM A;  3FV2 A;  2UVG A;  1B9J A;  4MBP A;  2DP8 A;  3SEV A;  2CMO A;  3O6I A;  3VLW A;  1MY1 A;  5DVF A;  2REJ A;  2ONK E;  1YAE A;  1YTV A;  1MPD A;  3GZG A;  3ZKK A;  1M5C A;  3TQW A;  2P2A A;  1Y4C A;  4OFJ A;  4OFO A;  4KCD A;  1US5 A;  1N04 A;  3A09 A;  4F2Q A;  3TTR A;  1B4H A;  4ZDM A;  2D5W A;  2ZMB A;  1ZBM A;  1CB6 A;  5KCJ B;  2DOJ A;  2VHA A;  4OEV A;  3DLN A;  2QS3 A;  1GVC A;  2VD2 A;  3KBR A;  2XXI A;  1S50 A;  1B51 A;  1USY E;  3RPW A;  1QVS A;  1GTK A;  3MC2 A;  3Q29 A;  5CBS A;  1WDN A;  2DXY A;  2UVJ A;  3H03 A;  4RXL A;  4R9F A;  1AOV A;  4QFP A;  5ICT A;  5B70 A;  3C9H A;  1N3X A;  4H8J A;  3CG3 A;  3EHU A;  4ZED A;  4EXL A;  1B58 A;  1QW0 A;  1EZ9 A;  4EUO A;  1FW0 A;  1OQH A;  1PBQ A;  1MQH A;  4ZEI A;  4IGR A;  3CFX A;  4X48 A;  4QSD A;  5L9M A;  4R6K A;  3BBR A;  2E1S A;  4ZEF A;  2FA7 A;  4HW8 A;  4NF5 B;  2XHD A;  3T66 A;  1P1Q A;  5ISU A;  4OVJ A;  1BTJ A;  2DYX A;  1MG1 A;  5AA2 B;  4FAJ A;  2ZYK A;  2V3Q A;  2ESN A;  4F1U A;  1JW5 A;  2Z23 A;  3MUQ A;  3H6T A;  1USY H;  1JQF A;  5AA3 A;  5J1D A;  3RTF B;  3JYR A;  3VVF A;  3L6G A;  4JWY A;  4LQ5 A;  4GIZ A;  1MPB A;  3B7D A;  4HTG A;  4PP0 A;  3C31 A;  1ZKB A;  3I5O A;  3A3U A;  2OK2 A;  3FGS A;  4DXB A;  1JVX A;  2ANJ A;  4BDL A;  2I6E A;  5KZT A;  1SQY A;  2Y84 A;  1I6Q A;  1US4 A;  2Z8F A;  3TTN A;  4OQO A;  4HS7 A;  4I62 A;  3HHF A;  5A5X B;  3T9X B;  3H06 B;  2F36 A;  2I0B A;  4POX A;  2Q88 A;  5K2X A;  4LQ2 A;  3U94 A;  1H43 A;  3OEN A;  2RC8 A;  4YB6 A;  4YB5 A;  4R9G A;  4ELO A;  4Q0C A;  1B7Z A;  3KEI A;  3TEL A;  4THI A;  4MH5 A;  4EQ9 A;  1FQA A;  3C32 A;  2V3U A;  4WEP A;  1R6Z A;  4XTC Q;  1TT1 A;  3FXQ A;  1ZLQ A;  1XT8 A;  2I0C A;  1MQG A;  2QL3 A;  2PBW A;  3OEM A;  3LSW A;  4DIG A;  2HZK A;  4DCX A;  3N6U A;  1A54 A;  3CR9 A;  2YJP A;  2DE4 A;  2RC7 A;  2AYS A;  5EHS A;  1POY 1;  2F7C A;  2I3W A;  4X1D A;  5IAI A;  3M8U A;  3H4Z A;  4H5F A;  4RPO A;  4GOT A;  4LA9 A;  1SVX B;  4U22 A;  1O7T A;  1PDA A;  4JDF A;  5KDT A;  3N6T A;  2Q89 A;  1FTO A;  2Q9T A;  4NF8 A;  1IIW A;  1LB9 A;  2OJT A;  2I58 A;  3PV0 E;  3O66 A;  2ZYM A;  4IO3 A;  4Q8R A;  1MXW A;  2Y7W A;  4ELQ A;  4GL0 A;  4JXI A;  4XKN A;  2O68 A;  3VE1 B;  3KJ7 A;  4DDD A;  3OSR A;  4N6P A;  2A5T B;  4KHZ E;  5DT6 A;  3OXN A;  1A99 A;  3FVO A;  4G68 A;  4IO4 A;  1LGB C;  3G7W A;  1MM7 A;  3GLB A;  4TQU Q;  2M8C A;  2XX7 A;  1ELJ A;  3UP9 A;  3FIR A;  2WKY A;  4EXK A;  3ODB A;  2UYE A;  4BDQ A;  3H6W A;  4Q5T A;  2G29 A;  2GHB A;  5DYH A;  3VV5 A;  2XX8 A;  1B40 A;  1AIV A;  4DLD A;  3DP4 A;  1Z7N E;  1I6B A;  3SEW A;  3EPE A;  5TP9 B;  5I57 B;  3A3C A;  4U4S A;  3S9L C;  2RIN A;  2UXA A;  2QPQ A;  1POT A;  5IKB A;  3E4R A;  3OSQ A;  3PGF A;  5FHN A;  1PC3 A;  4LUB A;  5CRY A;  5F7V A;  3Q26 A;  4F29 A;  2DWH A;  1PEB A;  1FQF A;  1A8F A;  5ITP A;  1NMU A;  1KWH A;  4YKJ A;  4DXC A;  3GBB A;  4O3C A;  3VDF A;  1OMP A;  1RYX A;  4I8C A;  3QAX A;  1DOT A;  1NKX A;  1DTG A;  4RK9 A;  2P1S A;  3FJM A;  4P0G A;  4EDP A;  3TEP A;  5CMC A;  2VOZ A;  1PB9 A;  2THI A;  3S9M C;  4QF9 A;  5I2K A;  3IOV A;  1D3K A;  4U1Z A;  4OMB A;  4KR5 A;  3K1N A;  5EHM A;  3K02 A;  1FTL A;  1URD A;  4HCW A;  1MXX A;  1N76 A;  3KG2 A;  4MFI A;  3MP8 A;  2DE3 A;  1MQJ A;  3K6U A;  4G2Z A;  3MAM A;  3KJT A;  2OZZ A;  2XXX A;  5FTI A;  1D4N A;  2F34 A;  3IJO B;  3CVG A;  4IY5 A;  1B7H A;  1UTH A;  1UTB A;  4BDO A;  3K6V A;  3KSJ A;  3UN6 A;  5HM4 B;  3TZA A;  3B6T A;  1MRP A;  2RKM A;  3OEK A;  1R9L A;  2AL4 A;  4Z7E A;  3OO8 A;  4PE5 B;  3PPO A;  2QJE A;  1SDX A;  2ZNS A;  3RT6 B;  4KPT A;  1IQ7 A;  3EHS A;  3O28 A;  3O6H A;  2DWI A;  2HEU A;  2FYI A;  3TKD A;  4PFW A;  3UIF A;  2UYF A;  3FUZ A;  3PPQ A;  1TWY A;  3DEL B;  1LCT A;  2XXV A;  2F97 A;  4NF6 A;  4GRK A;  1D9Y A;  3N94 A;  1P1W A;  5H8F A;  4MLQ A;  2GH9 A;  4YU0 A;  4G8N A;  3MBP A;  3CI8 A;  4H8I A;  1FCK A;  3G3F A;  4ELP A;  3PUW E;  5I2N A;  1NNT A;  3P7I A;  1A8E A;  1LBC A;  4KYE A;  1Y9U A;  3UK4 A;  1P1N A;  1SW2 A;  1MXY A;  1WVJ A;  4MLV A;  2O51 A;  1B0H A;  4ESW A;  1Q35 A;  4F1V A;  3V89 B;  1P1U A;  3MVX A;  5I59 A;  4M1V A;  3R7X A;  3IB1 A;  5JTY A;  4O3B A;  3TUS A;  4FJP A;  3L6H A;  2HZL A;  4U21 A;  1QJM A;  2XXU A;  2Y7R A;  1LBB A;  1BKA A;  2I4C A;  1IXC A;  4H65 A;  3IB2 A;  3KFM A;  3KN7 A;  2UVI A;  4X1B A;  2QS2 A;  4GXS B;  3E13 X;  2D3I A;  4OWD A;  2NUV A;  3IK6 B;  3JZJ A;  2QMX A;  5AA2 D;  1NNF A;  5CMK A;  2O7U A;  2PMS A;  2H9B A;  4GF8 A;  1NNK A;  1Y1Z A;  2H5Y A;  2DXR A;  4ZE9 A;  1AL3 A;  3CSB A;  4X9T A;  3IR1 A;  5KDT B;  4IO2 A;  3O29 A;  1NH7 A;  4WXJ A;  1ANF A;  4G68 C;  4UAC A;  4I1D A;  4YKP A;  5TPA B;  3VFJ A;  3R6U A;  4QSC A;  3PD8 A;  3KZG A;  3RTW B;  3IO6 A;  1NH8 A;  1ZTY A;  3K6X A;  4RJZ A;  3M3L A;  4WKM A;  4F2O A;  1O64 A;  3W9W A;  4AQ4 A;  3RY3 A;  5F1Q A;  5AA4 A;  1NL5 A;  5B7D A;  1NNP A;  4H6D A;  3KOT A;  4NWC A;  5H8H A;  4LP2 B;  1TFA A;  4GLI A;  2F7A A;  2R6G E;  1QUJ A;  1B2H A;  3S9E A;  1MY2 A;  2F6P A;  1SW5 A;  4FE8 A;  2YLN A;  4H0W A;  2B65 A;  4LZ5 A;  4NF4 A;  4KYS A;  4JB7 A;  2QMW A;  1MQI A;  2E0S A;  4IGT A;  4JSO A;  1H76 A;  3FV1 A;  2O1L A;  3T9V A;  3TOD A;  1Y1M A;  2Q2A A;  4LON B;  3H3G A;  5I58 A;  1UQW A;  4OXV A;  3CFL A;  3PMX A;  1DPP A;  3Q28 A;  2LAO A;  2XXY A;  2ONS A;  1R9Q A;  3LC8 A;  1R1N A;  1RKM A;  2O84 X;  3TMG A;  4N07 A;  4F39 A;  1LLS A;  2B3B A;  1MQD A;  2PT2 A;  4ZEC A;  2AIX A;  1QKB A;  3FAT A;  1SD3 A;  4POW A;  3ZKL A;  4PQJ A;  3EF7 A;  4ESX A;  3H6U A;  5DEX B;  1EU8 A;  1M5F A;  1BLF A;  1ZU0 A;  4GFR A;  2QSX A;  3W9V A;  2XXT A;  2O7I A;  3N5L A;  2I49 A;  4EQB A;  4G8H A;  4G8M A;  3FAS A;  2GFE A;  4C1U A;  3EQ1 A;  1MXV A;  2V3T A;  4OTE A;  2ZNU A;  4F3G A;  1N7X A;  2H99 A;  1XS5 A;  3PPN A;  5FHM A;  3LSF B;  4RYA A;  3MWB A;  4E0W A;  1BIY A;  3QK6 A;  4R72 A;  3T96 B;  3QXM A;  5JEI A;  1URS A;  1B3G A;  1MH3 A;  4U1O A;  2XXW A;  2XXP A;  3PUX E;  3THI A;  4FOR A;  4QFO A;  1UTH B;  1P99 A;  1UTB B;  4ND9 A;  3DP6 A;  5H8N B;  3C34 A;  3PPP A;  4QFN A;  3R26 A;  2Z22 A;  1B0L A;  3U72 A;  3RGY A;  3F11 A;  4LVQ A;  4ECF A;  1JEV A;  3I6V A;  3G3K A;  5I56 B;  5BUU A;  2Q2C A;  5AA1 A;  4F31 B;  2A5S A;  2ZYN A;  3BFT A;  1B6H A;  5DTB A;  1TFD A;  1LAX A;  1XVX A;  3VVE A;  1DTZ A;  3V8X B;  4YKK A;  3FJ7 A;  2F7B A;  3VXC A;  1ATG A;  3MP6 A;  4OZ9 A;  4FIM A;  4NF6 B;  3G3J A;  5H8F B;  1MM6 A;  1MY4 A;  3HN0 A;  4ZZA A;  2X7Q A;  2YPN A;  4QRZ A;  1B7U A;  1QUK A;  1N3W A;  3D4G A;  5I2N B;  5A5X A;  3HPI A;  3ECR A;  3SEU A;  3IOT A;  1IXG A;  4KCC A;  3I3V A;  4GD5 A;  1OLA A;  5CI5 A;  3MVZ A;  1MH4 A;  3TQL A;  4JWO A;  1PB7 A;  5H8S A;  1VR5 A;  3N26 A;  2HAV A;  2KLF A;  3FVG A;  3Q27 A;  1ZJL A;  3OEL A;  5JTY B;  1XHY A;  2ZXT A;  3RNN A;  4YMA A;  1FTK A;  3TDJ A;  2ONR A;  1B05 A;  3GXA A;  4NWD A;  4Q30 B;  1MY0 A;  3SET A;  1LAF E;  2OWT A;  4OEN A;  4KQP A;  4QHQ A;  1B32 A;  1VFD A;  2IA4 A;  3VLU A;  3FXR A;  2ABH A;  3UOR A;  4M4G A;  3AXF A;  4NMY A;  3IOU A;  4OER A;  4DCY A;  1B5J A;  1LFG A;  5DVI A;  2DWA A;  3HHG A;  3M3K A;  2AL5 A;  5FTH A;  3UA8 A;  4N13 A;  1JW4 A;  4R73 A;  2W7Y A;  2RCB A;  3O97 A;  2O6A A;  4H1X A;  3U92 A;  4NTL A;  3VXB A;  1SW4 A;  4C1T A; 
#chains in the Genus database with same CATH topology
 4NED A;  5TU0 A;  3TAJ A;  4OFL A;  2H4I A;  4PFU A;  3SKP A;  4GQO A;  1I69 A;  1H45 A;  4C0R A;  2RC9 A;  5L9S A;  2Y7K A;  3IAZ A;  3LSX A;  5CBR A;  1N84 A;  4YIC A;  1ZIU A;  1FQD A;  2KR0 A;  3SER A;  3WAE A;  3V83 A;  1RDZ A;  2NVU B;  2IEE A;  2R71 A;  3K01 A;  3T9U A;  4MIJ A;  4NG7 A;  3KSX A;  4XXU A;  1NFT A;  2DDK A;  2PCR A;  4F18 A;  1TXF A;  4Z0I A;  1LAH E;  4R2F A;  3IO4 A;  5H8H B;  4G77 A;  3C36 A;  1FBH A;  1XC1 A;  3RN8 A;  1B3H A;  2OBG A;  3PUZ E;  3TTL A;  1Z7M E;  2Y7I A;  3CFZ A;  3EHT A;  4PFT A;  3HST A;  4QXD A;  3C4M A;  2HFB A;  3OO9 A;  2BJJ X;  3MYU A;  3SZP A;  1KZ8 A;  3LSL A;  4JVD A;  5H8Q A;  4LAT A;  5FHO A;  3HCQ A;  4BDR A;  3MPL A;  2GRV A;  1P1O A;  4EF2 A;  1MXU A;  1IUD A;  4U4X A;  2I48 A;  1HSE A;  3IL1 B;  5I57 A;  2X7P A;  3FZV A;  4N15 A;  4MNI A;  3D1R A;  5BWJ A;  1N0T A;  1EZO A;  5I58 B;  3IJX B;  4QBA A;  4WED A;  4AB6 A;  2RCA A;  3G3I A;  1Y20 A;  2DSF A;  4F22 A;  2NOO A;  3O2A A;  3Q25 A;  1Q9D A;  4YB7 A;  2XXQ A;  1OLC A;  2HAU A;  3PMW A;  3U93 A;  2CZI A;  1QKA A;  3H7M A;  5L8D A;  1FSA A;  1YPN A;  3T9H B;  1LCF A;  3IB0 A;  3CG1 A;  4R2B A;  4OVP A;  3SEX A;  4R75 A;  1B3F A;  2FHY A;  4ISU A;  4XKR A;  3BFU A;  1CE2 A;  3MZ9 A;  2QS4 A;  5CMM A;  1RYO A;  4IO6 A;  3PPR A;  3LBS A;  3CIJ A;  1MXZ A;  5A5L A;  3M3F A;  1Q1K A;  1IIT A;  4JSD A;  4ZE8 A;  1IXI A;  3G3H A;  4R74 A;  2QRY A;  1MDP 1;  3RPL B;  2KQZ A;  1OVB A;  3RLF E;  3TTM A;  2VPO A;  3KN8 A;  2Y7P A;  2HXW A;  1F9B A;  5ESY A;  4NF8 B;  4RA1 A;  2NWJ A;  3O6G A;  3E3K A;  1IMA A;  4XKQ A;  4TLL B;  3LV0 A;  4JWX A;  2PVU A;  3S9N C;  4ZEK A;  3FXU A;  3QYT A;  1GR2 A;  5FBP A;  1JW1 A;  1VSO A;  3TFL A;  1DSN A;  5ITO A;  3MVW A;  2PFZ A;  2ALU A;  1QUL A;  1NUX A;  5HPQ A;  4IO5 A;  1S9T A;  1M5E A;  3B6Q A;  4JBZ A;  1B3L A;  4G68 B;  4TLM B;  4EQ7 A;  4IR8 A;  1NV4 A;  4R6H A;  2FIX A;  1JET A;  3DM0 A;  4YZZ A;  4FEB A;  1SBP A;  2WYP A;  3PU5 A;  4N6D A;  1URG A;  3B6W A;  3ZSF A;  3MQ9 A;  3FD3 A;  4DXU A;  2PYY A;  3CSG A;  3MJN A;  1B52 A;  4P56 A;  2F6G A;  4QSE A;  1M5D A;  1SW1 A;  4PE3 A;  1Y3Q A;  3IOR A;  1MDQ A;  1LBY A;  4P47 A;  5CM6 A;  1LFH A;  3GBA A;  5K2Y A;  1VFE A;  3RQT A;  4UA8 A;  1NV2 A;  1EH3 A;  3K00 A;  1XOC A;  4ZEB A;  2ZYO A;  4OET A;  4R6Y A;  4KD5 A;  4RNS A;  4ONY A;  2Q8J A;  3FVK A;  1M5B A;  3OOA A;  4F1Y A;  1Y4T A;  4LZ7 A;  3PD9 A;  4EF1 A;  4GWO A;  4QFK A;  3C35 A;  2H25 A;  1ZMG A;  4HCY A;  4YMB A;  1T0K A;  1IXH A;  3MW0 A;  3LUY A;  4KFQ A;  1EZP A;  4RY1 A;  1NUY A;  1YCJ A;  2XD3 A;  4E0X A;  3IFA A;  4MX6 A;  4FAT A;  1B3E A;  3OD7 A;  1II5 A;  3QUF A;  3SES A;  2VD3 A;  5KCJ A;  4KI0 E;  4PET A;  4XFE A;  3KBZ A;  4PFR A;  2OCU A;  3IFC A;  4L17 A;  2F5X A;  4K3F A;  5ET5 A;  3S4U A;  2O69 A;  3KN3 A;  4F19 A;  5DVJ A;  4BDM A;  4P0I A;  1LST A;  1OQG A;  2P0S A;  5I2K B;  4G4P A;  5L9O A;  1UIU A;  3B50 A;  2XXR A;  2L5V A;  3PUY E;  4KYD A;  3TCG A;  2F78 A;  4O7M A;  4RPN A;  4LN5 A;  1O63 A;  3EN3 A;  2OWS A;  3LUZ A;  4GWU A;  2HCA A;  4XIG Q;  4AS4 A;  4TOZ A;  1DMB A;  4OHN A;  3FJG A;  3K1P A;  3S2V A;  1FQB A;  1HSJ A;  2X26 A;  1JVY A;  1B1H A;  2Z8E A;  2VP1 A;  4ZZE A;  2VGQ A;  3WAF A;  4H67 A;  4IB2 A;  1GV8 A;  3SEY A;  2DQV A;  1WOD A;  3TCH A;  2CZL A;  5TPA A;  4NF5 A;  5CC2 A;  5J16 A;  4DZ1 A;  2HQ0 A;  3ISP A;  2QVU A;  1FTJ A;  3IX1 A;  4PDH A;  1L5T A;  2PX1 A;  5M2V A;  2PFY A;  3PMV A;  4OA4 A;  4OEU A;  4F3S A;  5AA2 A;  1IZ1 A;  1YXI A;  2WEF A;  4I3E A;  3D4C A;  5JK4 A;  4ZS9 A;  2DWJ A;  3MPK A;  1GGG A;  3T93 B;  2XD2 A;  2V84 A;  1UIV A;  1A55 A;  2OLB A;  4OVS A;  1A40 A;  4MF3 A;  4F3B A;  1FTM A;  3OO6 A;  4BDN A;  4FBP A;  4FEC A;  2FVZ A;  4GVO A;  3VLV A;  1IMC A;  2Z8D A;  1OIB A;  1MS7 A;  1PBP A;  2Y5K A;  5H8Q B;  1Y3N A;  3VVD A;  4I3Y A;  3G3G A;  2XX9 A;  2ZNT A;  2O1M A;  4YAH X;  3BKI B;  4IO7 A;  2NXO A;  4F3P A;  3MZB A;  2QS1 A;  3ILT B;  1AH5 A;  4N91 A;  4U23 A;  1SI1 A;  4GWW A;  2B4L A;  2XWO A;  5EQ7 A;  2DS9 A;  1MY3 A;  3QUJ A;  1IMB A;  3K4U A;  4ELR A;  2D21 A;  3IOW A;  3TTK A;  4PC9 A;  5AE4 A;  4NE4 A;  1VE4 A;  3ONM A;  5I59 B;  2PT1 A;  2DVC A;  3TYH A;  5CMB A;  3CRB A;  3KOS A;  5T3J A;  1S7Y A;  3JV9 A;  2DVZ A;  4GXA A;  1IEJ A;  3O9P A;  4YKI A;  1FQC A;  4GBW A;  4AB5 A;  3K0V A;  1J1N A;  4LZ8 A;  5I84 A;  3DP8 A;  4P11 A;  4PF8 A;  3HV1 A;  4PFY A;  5ELV A;  1N7W A;  4RK2 A;  3K1M A;  2GHA A;  4HE2 A;  5DEX A;  3U1O A;  1BP5 A;  1SI0 A;  3RUM A;  3K6W A;  3UGW A;  4O3A A;  4I9D A;  4PGP A;  3PTY A;  3KGC A;  2DE2 A;  3MZ1 A;  1I6A A;  3LR1 A;  1FPE A;  4H5G A;  4DI4 B;  4FED A;  4U2R A;  1D9V A;  3TPA A;  1QUI A;  1B1X A;  3H6V A;  5EYF A;  2V93 A;  3OO7 A;  3C33 A;  1MPC A;  1XVY A;  4OYV A;  1LAG E;  2I3V A;  4GL8 A;  4IY6 A;  3SDF A;  1A7L A;  1LB8 A;  1LBX A;  3K2D A;  2QVV A;  3HO7 A;  5ICQ A;  1PB8 A;  2FNC A;  1FPB A;  4PTK A;  2F8D A;  1JNF A;  1FJ6 A;  3PUV E;  1H3D A;  5H8N A;  2A5T A;  1FQE A;  3MP1 A;  5AA4 B;  2REG A;  4QFL A;  1HSL A;  5LOM A;  1SYI A;  3MST A;  3ILU B;  3E9X A;  3MVY A;  3RT8 A;  3U8Q A;  1B5H A;  4OES A;  2V25 A;  5I56 A;  1LFI A;  3QSL A;  2RF1 A;  3V5A A;  3T22 A;  1JEU A;  1B46 A;  2I4B A;  2R9J A;  2F35 A;  3TCF A;  1FPL A;  4NF0 A;  5HBC A;  5IZ3 A;  2H98 A;  2G93 A;  4NF4 B;  3USD A;  1B4Z A;  4XKP A;  1SYH A;  1OVT A;  2UVH A;  2B3F A;  1DPE A;  3OMB A;  1AMF A;  1H44 A;  4DE8 A;  3W15 C;  3FVN A;  1K9Y A;  5TP9 A;  3ZS6 A;  4BLA A;  1B5I A;  2XXH A;  1Y3P A;  3QIM A;  3FV2 A;  2UVG A;  1B9J A;  4MBP A;  2DP8 A;  3SEV A;  2CMO A;  5EQA A;  3O6I A;  3VLW A;  1MY1 A;  5DVF A;  2REJ A;  2ONK E;  1YAE A;  1YTV A;  1MPD A;  3GZG A;  3ZKK A;  1M5C A;  2ZZW A;  4UAB A;  3TQW A;  2P2A A;  1NV3 A;  1Y4C A;  4OFJ A;  4OFO A;  4KCD A;  4PDD A;  1US5 A;  1N04 A;  3A09 A;  4F2Q A;  3TTR A;  1B4H A;  4ZDM A;  2D5W A;  2ZMB A;  1ZBM A;  1CB6 A;  5KCJ B;  2DOJ A;  2VHA A;  2FBP A;  4OEV A;  3DLN A;  2QS3 A;  1GVC A;  2VD2 A;  3KBR A;  2XXI A;  1S50 A;  1B51 A;  1USY E;  3RPW A;  1QVS A;  1GTK A;  3MC2 A;  3Q29 A;  5IM2 A;  5CBS A;  1WDN A;  2DXY A;  2UVJ A;  3H03 A;  4GX3 A;  4RXL A;  4R9F A;  1AOV A;  4QFP A;  4OVQ A;  5ICT A;  5B70 A;  4NN3 A;  5I5P A;  3C9H A;  1N3X A;  4H8J A;  3CG3 A;  3EHU A;  4ZED A;  1BK4 A;  4EXL A;  1B58 A;  1QW0 A;  1EZ9 A;  4EUO A;  1G0H A;  1FJ9 A;  1FW0 A;  1OQH A;  1PBQ A;  1FPG A;  3T0J A;  2QFL A;  1MQH A;  4ZEI A;  4IGR A;  3CFX A;  4X48 A;  1NV5 A;  4O7I A;  4QSD A;  4HE1 A;  5L9M A;  4R6K A;  3BBR A;  4MNC A;  4PBQ A;  2E1S A;  4ZEF A;  2FA7 A;  4O8M A;  1IMF A;  4HW8 A;  4NF5 B;  2XHD A;  3T66 A;  1P1Q A;  4PGN A;  1FRP A;  1KA1 A;  4OVJ A;  1AWB A;  1BTJ A;  5ISU A;  2DYX A;  1MG1 A;  4N6K A;  5AA2 B;  4FAJ A;  2ZYK A;  2V3Q A;  1SPI A;  2ESN A;  4PBH A;  4F1U A;  1JW5 A;  2Z23 A;  3MUQ A;  1VDW A;  3H6T A;  1USY H;  1JQF A;  5AA3 A;  5J1D A;  3RTF B;  3JYR A;  3VVF A;  3L6G A;  4JWY A;  4LQ5 A;  4GIZ A;  1MPB A;  3B7D A;  4HTG A;  4PP0 A;  3C31 A;  1ZKB A;  3I5O A;  3A3U A;  2OK2 A;  3FGS A;  4DXB A;  1JVX A;  3U65 A;  2ANJ A;  2XA5 A;  4BDL A;  2I6E A;  2F3B A;  2OX3 A;  5KZT A;  1SQY A;  2Y84 A;  1I6Q A;  1US4 A;  2Z8F A;  3TTN A;  4NX1 A;  4OQO A;  4XF5 A;  4HS7 A;  4I62 A;  3HHF A;  5A5X B;  2VPN A;  3FBP A;  3T9X B;  3H06 B;  2F36 A;  2I0B A;  1FPI A;  4POX A;  4DI3 D;  1EYK A;  2Q88 A;  5K2X A;  2XXK A;  4LQ2 A;  3U94 A;  1H43 A;  3OEN A;  2RC8 A;  4YB6 A;  4YB5 A;  4R9G A;  4ELO A;  4Q0C A;  1B7Z A;  3KEI A;  3TEL A;  4THI A;  4MH5 A;  4EQ9 A;  1FQA A;  3C32 A;  3QMF A;  2P3V A;  2V3U A;  4WEP A;  1R6Z A;  4XTC Q;  1TT1 A;  3FXQ A;  1ZLQ A;  2QVR A;  1XT8 A;  3KC1 A;  2I0C A;  1MQG A;  2QL3 A;  5EQ9 A;  2PBW A;  3OEM A;  3LSW A;  4DIG A;  2HZK A;  4JVI A;  4DCX A;  3N6U A;  1K9Z A;  1A54 A;  4OAN A;  3CR9 A;  2YJP A;  2DE4 A;  2RC7 A;  2AYS A;  5EHS A;  1POY 1;  4PAI A;  2F7C A;  2I3W A;  4X1D A;  5IAI A;  4MJO A;  2XWK A;  3M8U A;  3H4Z A;  3RPL A;  4H5F A;  4RPO A;  4GOT A;  4LA9 A;  1SVX B;  4U22 A;  1O7T A;  4O94 A;  1PDA A;  4JDF A;  1G0I A;  5KDT A;  2HXR A;  3N6T A;  2Q89 A;  1FTO A;  2Q9T A;  3T1B A;  4NF8 A;  4GWX A;  1IIW A;  1LB9 A;  2OJT A;  2I58 A;  3PV0 E;  3O66 A;  2ZYM A;  4IO3 A;  4KXP A;  4Q8R A;  1MXW A;  2Y7W A;  4ELQ A;  4GL0 A;  4JXI A;  4XKN A;  2O68 A;  3VE1 B;  5LTC A;  3KJ7 A;  4DDD A;  3OSR A;  4N6P A;  2A5T B;  2Y5L A;  4KHZ E;  5DT6 A;  1NV6 A;  3OXN A;  1A99 A;  3FVO A;  4G68 A;  4I40 A;  4IO4 A;  1LGB C;  3G7W A;  1LBW A;  1MM7 A;  3GLB A;  4TQU Q;  2M8C A;  2XX7 A;  1ELJ A;  3UP9 A;  3FIR A;  4PFB A;  2WKY A;  4EXK A;  3ODB A;  2UYE A;  4BDQ A;  3H6W A;  4Q5T A;  1FPJ A;  2G29 A;  2HHM A;  2GHB A;  5DYH A;  3VV5 A;  2XX8 A;  4N4U A;  1B40 A;  1AIV A;  1DCU A;  4DLD A;  3DP4 A;  1Z7N E;  3BIH A;  1I6B A;  1LBV A;  4JVC A;  3SEW A;  3EPE A;  5TP9 B;  5I57 B;  3A3C A;  4U4S A;  1INP A;  4OVR A;  3S9L C;  1EYJ A;  4GBV A;  2RIN A;  2UXA A;  2QPQ A;  1POT A;  5IKB A;  2XWV A;  3E4R A;  3OSQ A;  3PGF A;  5FHN A;  1PC3 A;  4LUB A;  5CRY A;  5F7V A;  3Q26 A;  4F29 A;  2FIE A;  2DWH A;  1PEB A;  4PFI A;  1FQF A;  1A8F A;  3BIG A;  1NMU A;  5ITP A;  1KWH A;  2XWI A;  4YKJ A;  4DXC A;  3GBB A;  4MMP A;  4O3C A;  3KC0 A;  3VDF A;  1OMP A;  3ROJ A;  1RYX A;  1LBZ A;  4I8C A;  3QAX A;  1DOT A;  1NKX A;  1DTG A;  4RK9 A;  2P1S A;  3FJM A;  4NGU A;  4P0G A;  4MHF A;  4EDP A;  3TEP A;  1NUW A;  2Q74 A;  4MAG A;  5CMC A;  2VOZ A;  4MCO A;  1PB9 A;  4AS5 A;  2THI A;  3S9M C;  4QF9 A;  1FBE A;  5I2K A;  4P3L A;  3IOV A;  1D3K A;  4U1Z A;  4OMB A;  4KR5 A;  1NI9 A;  3K1N A;  5EHM A;  3K02 A;  1FTL A;  1URD A;  4HCW A;  1MXX A;  1N76 A;  3KG2 A;  4MFI A;  3MP8 A;  2DE3 A;  1MQJ A;  3K6U A;  4G2Z A;  3MAM A;  3KJT A;  2OZZ A;  2XXX A;  5FTI A;  1D4N A;  2F34 A;  5IGA A;  3IJO B;  3CVG A;  4IY5 A;  1B7H A;  3NOH A;  1UTH A;  2B4M A;  1UTB A;  4BDO A;  4HE0 A;  3K6V A;  3KSJ A;  3UN6 A;  5HM4 B;  3TZA A;  3B6T A;  1MRP A;  2HPG A;  2RKM A;  3OEK A;  1R9L A;  2AL4 A;  4GX6 A;  4Z7E A;  3OO8 A;  3E79 A;  4PE5 B;  1FTA A;  3PPO A;  2QJE A;  3EKI A;  1SDX A;  2ZNS A;  3A29 A;  3RT6 B;  4KPT A;  1IQ7 A;  3EHS A;  3O28 A;  3O6H A;  2DWI A;  2HEU A;  2FYI A;  3TKD A;  4PFW A;  3UIF A;  2UYF A;  3FUZ A;  3PPQ A;  1TWY A;  3DEL B;  4N8Y A;  1LCT A;  4XEQ A;  1FPF A;  2XXV A;  2F97 A;  4NF6 A;  4GRK A;  1D9Y A;  3N94 A;  1P1W A;  5H8F A;  4MLQ A;  4NQ8 A;  2GH9 A;  4YU0 A;  4G8N A;  3MBP A;  3CI8 A;  4H8I A;  1FCK A;  3G3F A;  4ELP A;  1FBG A;  2CEY A;  2CEX A;  4MEV A;  3PUW E;  5I2N A;  1NNT A;  3P7I A;  1A8E A;  5ET6 A;  1LBC A;  1NV0 A;  4KYE A;  1Y9U A;  3UK4 A;  1P1N A;  5EQ8 A;  1SW2 A;  1MXY A;  1WVJ A;  4MLV A;  2O51 A;  1B0H A;  4OVT A;  4ESW A;  1Q35 A;  4F1V A;  3V89 B;  1P1U A;  3MVX A;  5I59 A;  4M1V A;  3R7X A;  3IB1 A;  5JTY A;  4O3B A;  3TUS A;  4FJP A;  3L6H A;  2HZL A;  4U21 A;  1QJM A;  1DBZ A;  2XXU A;  5F24 A;  2Y7R A;  4NAP A;  4PF6 A;  4N17 A;  1LBB A;  1BKA A;  2I4C A;  1IXC A;  4H65 A;  2V4C A;  3IB2 A;  3KFM A;  3KN7 A;  2UVI A;  1FBP A;  4X1B A;  2WYK A;  2QS2 A;  4GXS B;  3E13 X;  2D3I A;  4OWD A;  2NUV A;  4N81 A;  3IK6 B;  3JZJ A;  2JJK A;  2QMX A;  5AA2 D;  3CHG A;  1NNF A;  5CMK A;  2O7U A;  1QGX A;  2PMS A;  2H9B A;  4GF8 A;  1NNK A;  1Y1Z A;  2H5Y A;  2DXR A;  4ZE9 A;  1AL3 A;  3CSB A;  4X9T A;  3IR1 A;  5KDT B;  4IO2 A;  3O29 A;  1NH7 A;  4WXJ A;  1ANF A;  4G68 C;  1RDX A;  1JP4 A;  2ZZV A;  4UAC A;  4I1D A;  4YKP A;  2VT5 A;  3B8B A;  5TPA B;  3VFJ A;  1IMD A;  3R6U A;  1FBC A;  3FXB A;  4QSC A;  2P3N A;  5IZZ A;  3PD8 A;  2Q8M A;  3KZG A;  3RTW B;  3IO6 A;  1NH8 A;  1ZTY A;  3K6X A;  4RJZ A;  3M3L A;  4WKM A;  4F2O A;  1O64 A;  3W9W A;  1IME A;  4AQ4 A;  3RY3 A;  4GWY A;  5F1Q A;  5AA4 A;  1NL5 A;  5B7D A;  3RYD A;  1NNP A;  4H6D A;  3KOT A;  4NWC A;  5H8H A;  4LP2 B;  1TFA A;  4GLI A;  2F7A A;  2R6G E;  1QUJ A;  1B2H A;  2WBD A;  2ZZX A;  3S9E A;  1MY2 A;  2F6P A;  1SW5 A;  4FE8 A;  2YLN A;  4P9K A;  4H0W A;  2B65 A;  4LZ5 A;  5EYG A;  2OWZ A;  4NF4 A;  5ET8 A;  4KYS A;  1FBD A;  4JB7 A;  1KA0 A;  3HFU A;  4PAF A;  2QMW A;  1MQI A;  2E0S A;  4IGT A;  4JSO A;  1H76 A;  3FV1 A;  2O1L A;  3T9V A;  3TOD A;  1Y1M A;  2Q2A A;  4LON B;  3H3G A;  1YYZ A;  5I58 A;  1UQW A;  4OXV A;  3CFL A;  3PMX A;  1DPP A;  3Q28 A;  2LAO A;  2XXY A;  5IZ1 A;  5LDZ A;  2ONS A;  1R9Q A;  3LC8 A;  5ET7 A;  1R1N A;  1RKM A;  2O84 X;  3TMG A;  4N07 A;  4F39 A;  1LLS A;  2B3B A;  1MQD A;  2PT2 A;  4ZEC A;  2AIX A;  1QKB A;  4P1L A;  2CZH A;  3FAT A;  1SD3 A;  4POW A;  3ZKL A;  4PQJ A;  3EF7 A;  4ESX A;  3H6U A;  5DEX B;  1EU8 A;  1M5F A;  1BLF A;  4G61 A;  1ZU0 A;  4GFR A;  2QSX A;  3W9V A;  2XXT A;  4GWS A;  2O7I A;  3N5L A;  2I49 A;  4EQB A;  4G8H A;  4G8M A;  3FAS A;  2GFE A;  4C1U A;  3EQ1 A;  1MXV A;  2V3T A;  4OTE A;  2ZNU A;  4F3G A;  1N7X A;  2H99 A;  1XS5 A;  3PPN A;  5FHM A;  3E78 A;  4HXV A;  3LSF B;  1EYI A;  4RYA A;  3MWB A;  4E0W A;  1BIY A;  1NV1 A;  3QK6 A;  4R72 A;  3T96 B;  3QXM A;  5JEI A;  1URS A;  1B3G A;  2WX9 A;  1MH3 A;  4U1O A;  2XXW A;  2XXP A;  3PUX E;  3THI A;  4FOR A;  4QFO A;  1UTH B;  1P99 A;  1UTB B;  4ND9 A;  3DP6 A;  5H8N B;  3C34 A;  3PPP A;  4QFN A;  3R26 A;  2CZK A;  4X8R A;  2Z22 A;  1B0L A;  3U72 A;  3RGY A;  4GWZ A;  3F11 A;  4LVQ A;  4ECF A;  1JEV A;  1DK4 A;  3I6V A;  3G3K A;  5I56 B;  5BUU A;  2Q2C A;  5AA1 A;  4F31 B;  2A5S A;  2ZYN A;  3BFT A;  1B6H A;  5DTB A;  4GX4 A;  1TFD A;  2MKZ A;  5IZ3 B;  1LAX A;  1XVX A;  3VVE A;  1DTZ A;  3V8X B;  4NHB A;  1XI6 A;  4YKK A;  3FJ7 A;  1NV7 A;  2F7B A;  3VXC A;  1ATG A;  3MP6 A;  4OZ9 A;  4FIM A;  5I7I A;  4NF6 B;  2R8T A;  4PCD A;  3G3J A;  4P1E A;  5H8F B;  1MM6 A;  1MY4 A;  3HN0 A;  4ZZA A;  2X7Q A;  2YPN A;  1LEV A;  4QRZ A;  1B7U A;  1QUK A;  1N3W A;  3D4G A;  5I2N B;  5A5X A;  3HPI A;  3ECR A;  3SEU A;  3IOT A;  4N8G A;  1IXG A;  4KCC A;  3I3V A;  4GD5 A;  4H45 A;  1OLA A;  5CI5 A;  3MVZ A;  1MH4 A;  3TQL A;  4H46 A;  4JWO A;  1PB7 A;  5H8S A;  1VR5 A;  3N26 A;  2WBB A;  1FPK A;  2HAV A;  2KLF A;  3FVG A;  3Q27 A;  1ZJL A;  3OEL A;  5JTY B;  1FPD A;  1XHY A;  2ZXT A;  3RNN A;  4YMA A;  1YZ0 A;  1FTK A;  2F3D A;  5DW8 A;  1CNQ A;  3TDJ A;  5I3S A;  2ONR A;  1B05 A;  3GXA A;  4NWD A;  4Q30 B;  1MY0 A;  3SET A;  1LAF E;  2OWT A;  4OEN A;  4KQP A;  4QHQ A;  1B32 A;  1VFD A;  1NUZ A;  4PAK A;  2IA4 A;  3VLU A;  2GQ1 A;  3GYY A;  4X04 A;  3FXR A;  2ABH A;  3UOR A;  4M4G A;  1FBF A;  3AXF A;  4NMY A;  3IOU A;  4OER A;  4DCY A;  1B5J A;  1LFG A;  5EYH A;  5DVI A;  1RDY A;  2DWA A;  4P8B A;  3HHG A;  3M3K A;  2AL5 A;  5FTH A;  3UA8 A;  4MNP A;  4N13 A;  1JW4 A;  4R73 A;  2W7Y A;  2RCB A;  3O97 A;  2O6A A;  4H1X A;  3U92 A;  4NTL A;  3VXB A;  1SW4 A;  4C1T A;  1D9Q A;  2BJI A; 
#chains in the Genus database with same CATH homology
 4NED A;  5TU0 A;  3TAJ A;  4OFL A;  2H4I A;  4PFU A;  3SKP A;  4GQO A;  1I69 A;  1H45 A;  4C0R A;  2RC9 A;  5L9S A;  2Y7K A;  3IAZ A;  3LSX A;  5CBR A;  1N84 A;  4YIC A;  1ZIU A;  1FQD A;  3WAE A;  3SER A;  3V83 A;  2NVU B;  2IEE A;  2R71 A;  3K01 A;  3T9U A;  3KSX A;  4XXU A;  1NFT A;  4F18 A;  1TXF A;  4Z0I A;  1LAH E;  4R2F A;  3IO4 A;  5H8H B;  4G77 A;  3C36 A;  1XC1 A;  3RN8 A;  1B3H A;  2OBG A;  3PUZ E;  3TTL A;  1Z7M E;  2Y7I A;  3CFZ A;  3EHT A;  4PFT A;  3HST A;  3C4M A;  2HFB A;  3OO9 A;  2BJJ X;  3LSL A;  5H8Q A;  4LAT A;  5FHO A;  3HCQ A;  4BDR A;  3MPL A;  2GRV A;  1P1O A;  4EF2 A;  1MXU A;  1IUD A;  4U4X A;  2I48 A;  1HSE A;  3IL1 B;  5I57 A;  2X7P A;  3FZV A;  5BWJ A;  1N0T A;  1EZO A;  5I58 B;  3IJX B;  4WED A;  4AB6 A;  2RCA A;  3G3I A;  1Y20 A;  2DSF A;  4F22 A;  2NOO A;  3O2A A;  3Q25 A;  4YB7 A;  2XXQ A;  1OLC A;  2HAU A;  3PMW A;  3U93 A;  1QKA A;  3H7M A;  5L8D A;  1YPN A;  3T9H B;  1LCF A;  3IB0 A;  3CG1 A;  4R2B A;  3SEX A;  4R75 A;  1B3F A;  4ISU A;  4XKR A;  3BFU A;  1CE2 A;  3MZ9 A;  2QS4 A;  5CMM A;  1RYO A;  4IO6 A;  3PPR A;  3LBS A;  3CIJ A;  1MXZ A;  3M3F A;  1Q1K A;  1IIT A;  4JSD A;  4ZE8 A;  1IXI A;  3G3H A;  4R74 A;  2QRY A;  1MDP 1;  1OVB A;  3RLF E;  3TTM A;  3KN8 A;  2Y7P A;  2HXW A;  1F9B A;  4NF8 B;  4RA1 A;  2NWJ A;  3O6G A;  3E3K A;  4XKQ A;  4TLL B;  4JWX A;  2PVU A;  3S9N C;  4ZEK A;  3FXU A;  3QYT A;  1GR2 A;  1JW1 A;  1VSO A;  3TFL A;  1DSN A;  5ITO A;  3MVW A;  2ALU A;  1QUL A;  5HPQ A;  4IO5 A;  1S9T A;  1M5E A;  3B6Q A;  4JBZ A;  1B3L A;  4G68 B;  4TLM B;  4EQ7 A;  4R6H A;  1JET A;  3DM0 A;  4YZZ A;  4FEB A;  1SBP A;  3PU5 A;  1URG A;  3B6W A;  3ZSF A;  3MQ9 A;  3FD3 A;  4DXU A;  2PYY A;  3CSG A;  3MJN A;  1B52 A;  2F6G A;  4QSE A;  1M5D A;  1SW1 A;  1Y3Q A;  3IOR A;  1MDQ A;  5CM6 A;  1LFH A;  3GBA A;  5K2Y A;  1VFE A;  3RQT A;  4UA8 A;  1EH3 A;  3K00 A;  1XOC A;  4ZEB A;  2ZYO A;  4OET A;  4R6Y A;  4KD5 A;  4RNS A;  4ONY A;  2Q8J A;  3FVK A;  1M5B A;  3OOA A;  4F1Y A;  1Y4T A;  4LZ7 A;  3PD9 A;  4EF1 A;  4GWO A;  4QFK A;  3C35 A;  2H25 A;  1ZMG A;  4HCY A;  4YMB A;  1T0K A;  1IXH A;  3MW0 A;  3LUY A;  4KFQ A;  1EZP A;  4RY1 A;  1YCJ A;  2XD3 A;  4E0X A;  4FAT A;  1B3E A;  3OD7 A;  1II5 A;  3QUF A;  3SES A;  2VD3 A;  5KCJ A;  4KI0 E;  4PET A;  2OCU A;  4L17 A;  2F5X A;  4K3F A;  3S4U A;  2O69 A;  3KN3 A;  4F19 A;  5DVJ A;  4BDM A;  4P0I A;  1LST A;  1OQG A;  2P0S A;  5I2K B;  4G4P A;  5L9O A;  1UIU A;  2XXR A;  3PUY E;  4KYD A;  3TCG A;  2F78 A;  4RPN A;  1O63 A;  3EN3 A;  2OWS A;  2HCA A;  4XIG Q;  4TOZ A;  1DMB A;  4OHN A;  3FJG A;  3K1P A;  3S2V A;  1FQB A;  1HSJ A;  2X26 A;  1JVY A;  1B1H A;  2Z8E A;  2VP1 A;  4ZZE A;  2VGQ A;  3WAF A;  4H67 A;  4IB2 A;  1GV8 A;  3SEY A;  2DQV A;  1WOD A;  3TCH A;  2CZL A;  5TPA A;  4NF5 A;  5CC2 A;  4DZ1 A;  2HQ0 A;  1FTJ A;  3IX1 A;  1L5T A;  2PX1 A;  5M2V A;  3PMV A;  4OEU A;  4F3S A;  5AA2 A;  1IZ1 A;  3D4C A;  5JK4 A;  4ZS9 A;  2DWJ A;  3MPK A;  1GGG A;  3T93 B;  2XD2 A;  2V84 A;  1UIV A;  1A55 A;  2OLB A;  1A40 A;  4MF3 A;  4F3B A;  1FTM A;  3OO6 A;  4BDN A;  4FEC A;  4GVO A;  3VLV A;  2Z8D A;  1OIB A;  1MS7 A;  1PBP A;  5H8Q B;  1Y3N A;  3VVD A;  3G3G A;  2XX9 A;  2ZNT A;  2O1M A;  4YAH X;  3BKI B;  4IO7 A;  2NXO A;  4F3P A;  3MZB A;  2QS1 A;  3ILT B;  1AH5 A;  4U23 A;  1SI1 A;  2DS9 A;  1MY3 A;  3QUJ A;  3K4U A;  4ELR A;  2D21 A;  3IOW A;  3TTK A;  5AE4 A;  4NE4 A;  1VE4 A;  3ONM A;  5I59 B;  2PT1 A;  2DVC A;  3TYH A;  5CMB A;  3CRB A;  3KOS A;  1S7Y A;  3JV9 A;  2DVZ A;  4GXA A;  1IEJ A;  3O9P A;  4YKI A;  1FQC A;  4AB5 A;  3K0V A;  1J1N A;  4LZ8 A;  5I84 A;  3DP8 A;  4P11 A;  3HV1 A;  4PFY A;  5ELV A;  1N7W A;  4RK2 A;  3K1M A;  2GHA A;  3U1O A;  5DEX A;  1BP5 A;  1SI0 A;  3RUM A;  3K6W A;  3UGW A;  4O3A A;  4I9D A;  3KGC A;  2DE2 A;  3MZ1 A;  1I6A A;  3LR1 A;  4H5G A;  4FED A;  4U2R A;  1D9V A;  3TPA A;  1QUI A;  1B1X A;  3H6V A;  5EYF A;  2V93 A;  3OO7 A;  3C33 A;  1MPC A;  1XVY A;  4OYV A;  1LAG E;  2I3V A;  4GL8 A;  4IY6 A;  3SDF A;  1A7L A;  1LB8 A;  3K2D A;  3HO7 A;  5ICQ A;  1PB8 A;  2FNC A;  2F8D A;  1JNF A;  3PUV E;  1H3D A;  5H8N A;  2A5T A;  1FQE A;  3MP1 A;  5AA4 B;  2REG A;  4QFL A;  1HSL A;  5LOM A;  1SYI A;  3ILU B;  3E9X A;  3MVY A;  3RT8 A;  3U8Q A;  1B5H A;  4OES A;  2V25 A;  5I56 A;  1LFI A;  3QSL A;  2RF1 A;  3V5A A;  3T22 A;  1JEU A;  1B46 A;  2I4B A;  2R9J A;  3TCF A;  2F35 A;  5HBC A;  2H98 A;  2G93 A;  4NF4 B;  3USD A;  1B4Z A;  4XKP A;  1SYH A;  1OVT A;  2UVH A;  2B3F A;  1DPE A;  3OMB A;  1AMF A;  1H44 A;  4DE8 A;  3W15 C;  3FVN A;  5TP9 A;  3ZS6 A;  4BLA A;  1B5I A;  2XXH A;  1Y3P A;  3QIM A;  3FV2 A;  2UVG A;  1B9J A;  4MBP A;  2DP8 A;  3SEV A;  2CMO A;  3O6I A;  3VLW A;  1MY1 A;  5DVF A;  2REJ A;  2ONK E;  1YAE A;  1YTV A;  1MPD A;  3GZG A;  3ZKK A;  1M5C A;  3TQW A;  2P2A A;  1Y4C A;  4OFJ A;  4OFO A;  4KCD A;  1US5 A;  1N04 A;  3A09 A;  4F2Q A;  3TTR A;  1B4H A;  4ZDM A;  2D5W A;  2ZMB A;  1ZBM A;  1CB6 A;  5KCJ B;  2DOJ A;  2VHA A;  4OEV A;  3DLN A;  2QS3 A;  1GVC A;  2VD2 A;  3KBR A;  2XXI A;  1S50 A;  1B51 A;  1USY E;  3RPW A;  1QVS A;  1GTK A;  3MC2 A;  3Q29 A;  5CBS A;  1WDN A;  2DXY A;  2UVJ A;  3H03 A;  4RXL A;  4R9F A;  1AOV A;  4QFP A;  5ICT A;  5B70 A;  3C9H A;  1N3X A;  4H8J A;  3CG3 A;  3EHU A;  4ZED A;  4EXL A;  1B58 A;  1QW0 A;  1EZ9 A;  4EUO A;  1FW0 A;  1OQH A;  1PBQ A;  1MQH A;  4ZEI A;  4IGR A;  3CFX A;  4X48 A;  4QSD A;  5L9M A;  4R6K A;  3BBR A;  2E1S A;  4ZEF A;  2FA7 A;  4HW8 A;  4NF5 B;  2XHD A;  3T66 A;  1P1Q A;  5ISU A;  4OVJ A;  1BTJ A;  2DYX A;  1MG1 A;  5AA2 B;  4FAJ A;  2ZYK A;  2V3Q A;  2ESN A;  4F1U A;  1JW5 A;  2Z23 A;  3MUQ A;  3H6T A;  1USY H;  1JQF A;  5AA3 A;  5J1D A;  3RTF B;  3JYR A;  3VVF A;  3L6G A;  4JWY A;  4LQ5 A;  4GIZ A;  1MPB A;  3B7D A;  4HTG A;  4PP0 A;  3C31 A;  1ZKB A;  3I5O A;  3A3U A;  2OK2 A;  3FGS A;  4DXB A;  1JVX A;  2ANJ A;  4BDL A;  2I6E A;  5KZT A;  1SQY A;  2Y84 A;  1I6Q A;  1US4 A;  2Z8F A;  3TTN A;  4OQO A;  4HS7 A;  4I62 A;  3HHF A;  5A5X B;  3T9X B;  3H06 B;  2F36 A;  2I0B A;  4POX A;  2Q88 A;  5K2X A;  4LQ2 A;  3U94 A;  1H43 A;  3OEN A;  2RC8 A;  4YB6 A;  4YB5 A;  4R9G A;  4ELO A;  4Q0C A;  1B7Z A;  3KEI A;  3TEL A;  4THI A;  4MH5 A;  4EQ9 A;  1FQA A;  3C32 A;  2V3U A;  4WEP A;  1R6Z A;  4XTC Q;  1TT1 A;  3FXQ A;  1ZLQ A;  1XT8 A;  2I0C A;  1MQG A;  2QL3 A;  2PBW A;  3OEM A;  3LSW A;  4DIG A;  2HZK A;  4DCX A;  3N6U A;  1A54 A;  3CR9 A;  2YJP A;  2DE4 A;  2RC7 A;  2AYS A;  5EHS A;  1POY 1;  2F7C A;  2I3W A;  4X1D A;  5IAI A;  3M8U A;  3H4Z A;  4H5F A;  4RPO A;  4GOT A;  4LA9 A;  1SVX B;  4U22 A;  1O7T A;  1PDA A;  4JDF A;  5KDT A;  3N6T A;  2Q89 A;  1FTO A;  2Q9T A;  4NF8 A;  1IIW A;  1LB9 A;  2OJT A;  2I58 A;  3PV0 E;  3O66 A;  2ZYM A;  4IO3 A;  4Q8R A;  1MXW A;  2Y7W A;  4ELQ A;  4GL0 A;  4JXI A;  4XKN A;  2O68 A;  3VE1 B;  3KJ7 A;  4DDD A;  3OSR A;  4N6P A;  2A5T B;  4KHZ E;  5DT6 A;  3OXN A;  1A99 A;  3FVO A;  4G68 A;  4IO4 A;  1LGB C;  3G7W A;  1MM7 A;  3GLB A;  4TQU Q;  2M8C A;  2XX7 A;  1ELJ A;  3UP9 A;  3FIR A;  2WKY A;  4EXK A;  3ODB A;  2UYE A;  4BDQ A;  3H6W A;  4Q5T A;  2G29 A;  2GHB A;  5DYH A;  3VV5 A;  2XX8 A;  1B40 A;  1AIV A;  4DLD A;  3DP4 A;  1Z7N E;  1I6B A;  3SEW A;  3EPE A;  5TP9 B;  5I57 B;  3A3C A;  4U4S A;  3S9L C;  2RIN A;  2UXA A;  2QPQ A;  1POT A;  5IKB A;  3E4R A;  3OSQ A;  3PGF A;  5FHN A;  1PC3 A;  4LUB A;  5CRY A;  5F7V A;  3Q26 A;  4F29 A;  2DWH A;  1PEB A;  1FQF A;  1A8F A;  5ITP A;  1NMU A;  1KWH A;  4YKJ A;  4DXC A;  3GBB A;  4O3C A;  3VDF A;  1OMP A;  1RYX A;  4I8C A;  3QAX A;  1DOT A;  1NKX A;  1DTG A;  4RK9 A;  2P1S A;  3FJM A;  4P0G A;  4EDP A;  3TEP A;  5CMC A;  2VOZ A;  1PB9 A;  2THI A;  3S9M C;  4QF9 A;  5I2K A;  3IOV A;  1D3K A;  4U1Z A;  4OMB A;  4KR5 A;  3K1N A;  5EHM A;  3K02 A;  1FTL A;  1URD A;  4HCW A;  1MXX A;  1N76 A;  3KG2 A;  4MFI A;  3MP8 A;  2DE3 A;  1MQJ A;  3K6U A;  4G2Z A;  3MAM A;  3KJT A;  2OZZ A;  2XXX A;  5FTI A;  1D4N A;  2F34 A;  3IJO B;  3CVG A;  4IY5 A;  1B7H A;  1UTH A;  1UTB A;  4BDO A;  3K6V A;  3KSJ A;  3UN6 A;  5HM4 B;  3TZA A;  3B6T A;  1MRP A;  2RKM A;  3OEK A;  1R9L A;  2AL4 A;  4Z7E A;  3OO8 A;  4PE5 B;  3PPO A;  2QJE A;  1SDX A;  2ZNS A;  3RT6 B;  4KPT A;  1IQ7 A;  3EHS A;  3O28 A;  3O6H A;  2DWI A;  2HEU A;  2FYI A;  3TKD A;  4PFW A;  3UIF A;  2UYF A;  3FUZ A;  3PPQ A;  1TWY A;  3DEL B;  1LCT A;  2XXV A;  2F97 A;  4NF6 A;  4GRK A;  1D9Y A;  3N94 A;  1P1W A;  5H8F A;  4MLQ A;  2GH9 A;  4YU0 A;  4G8N A;  3MBP A;  3CI8 A;  4H8I A;  1FCK A;  3G3F A;  4ELP A;  3PUW E;  5I2N A;  1NNT A;  3P7I A;  1A8E A;  1LBC A;  4KYE A;  1Y9U A;  3UK4 A;  1P1N A;  1SW2 A;  1MXY A;  1WVJ A;  4MLV A;  2O51 A;  1B0H A;  4ESW A;  1Q35 A;  4F1V A;  3V89 B;  1P1U A;  3MVX A;  5I59 A;  4M1V A;  3R7X A;  3IB1 A;  5JTY A;  4O3B A;  3TUS A;  4FJP A;  3L6H A;  2HZL A;  4U21 A;  1QJM A;  2XXU A;  2Y7R A;  1LBB A;  1BKA A;  2I4C A;  1IXC A;  4H65 A;  3IB2 A;  3KFM A;  3KN7 A;  2UVI A;  4X1B A;  2QS2 A;  4GXS B;  3E13 X;  2D3I A;  4OWD A;  2NUV A;  3IK6 B;  3JZJ A;  2QMX A;  5AA2 D;  1NNF A;  5CMK A;  2O7U A;  2PMS A;  2H9B A;  4GF8 A;  1NNK A;  1Y1Z A;  2H5Y A;  2DXR A;  4ZE9 A;  1AL3 A;  3CSB A;  4X9T A;  3IR1 A;  5KDT B;  4IO2 A;  3O29 A;  1NH7 A;  4WXJ A;  1ANF A;  4G68 C;  4UAC A;  4I1D A;  4YKP A;  5TPA B;  3VFJ A;  3R6U A;  4QSC A;  3PD8 A;  3KZG A;  3RTW B;  3IO6 A;  1NH8 A;  1ZTY A;  3K6X A;  4RJZ A;  3M3L A;  4WKM A;  4F2O A;  1O64 A;  3W9W A;  4AQ4 A;  3RY3 A;  5F1Q A;  5AA4 A;  1NL5 A;  5B7D A;  1NNP A;  4H6D A;  3KOT A;  4NWC A;  5H8H A;  4LP2 B;  1TFA A;  4GLI A;  2F7A A;  2R6G E;  1QUJ A;  1B2H A;  3S9E A;  1MY2 A;  2F6P A;  1SW5 A;  4FE8 A;  2YLN A;  4H0W A;  2B65 A;  4LZ5 A;  4NF4 A;  4KYS A;  4JB7 A;  2QMW A;  1MQI A;  2E0S A;  4IGT A;  4JSO A;  1H76 A;  3FV1 A;  2O1L A;  3T9V A;  3TOD A;  1Y1M A;  2Q2A A;  4LON B;  3H3G A;  5I58 A;  1UQW A;  4OXV A;  3CFL A;  3PMX A;  1DPP A;  3Q28 A;  2LAO A;  2XXY A;  2ONS A;  1R9Q A;  3LC8 A;  1R1N A;  1RKM A;  2O84 X;  3TMG A;  4N07 A;  4F39 A;  1LLS A;  2B3B A;  1MQD A;  2PT2 A;  4ZEC A;  2AIX A;  1QKB A;  3FAT A;  1SD3 A;  4POW A;  3ZKL A;  4PQJ A;  3EF7 A;  4ESX A;  3H6U A;  5DEX B;  1EU8 A;  1M5F A;  1BLF A;  1ZU0 A;  4GFR A;  2QSX A;  3W9V A;  2XXT A;  2O7I A;  3N5L A;  2I49 A;  4EQB A;  4G8H A;  4G8M A;  3FAS A;  2GFE A;  4C1U A;  3EQ1 A;  1MXV A;  2V3T A;  4OTE A;  2ZNU A;  4F3G A;  1N7X A;  2H99 A;  1XS5 A;  3PPN A;  5FHM A;  3LSF B;  4RYA A;  3MWB A;  4E0W A;  1BIY A;  3QK6 A;  4R72 A;  3T96 B;  3QXM A;  5JEI A;  1URS A;  1B3G A;  1MH3 A;  4U1O A;  2XXW A;  2XXP A;  3PUX E;  3THI A;  4FOR A;  4QFO A;  1UTH B;  1P99 A;  1UTB B;  4ND9 A;  3DP6 A;  5H8N B;  3C34 A;  3PPP A;  4QFN A;  3R26 A;  2Z22 A;  1B0L A;  3U72 A;  3RGY A;  3F11 A;  4LVQ A;  4ECF A;  1JEV A;  3I6V A;  3G3K A;  5I56 B;  5BUU A;  2Q2C A;  5AA1 A;  4F31 B;  2A5S A;  2ZYN A;  3BFT A;  1B6H A;  5DTB A;  1TFD A;  1LAX A;  1XVX A;  3VVE A;  1DTZ A;  3V8X B;  4YKK A;  3FJ7 A;  2F7B A;  3VXC A;  1ATG A;  3MP6 A;  4OZ9 A;  4FIM A;  4NF6 B;  3G3J A;  5H8F B;  1MM6 A;  1MY4 A;  3HN0 A;  4ZZA A;  2X7Q A;  2YPN A;  4QRZ A;  1B7U A;  1QUK A;  1N3W A;  3D4G A;  5I2N B;  5A5X A;  3HPI A;  3ECR A;  3SEU A;  3IOT A;  1IXG A;  4KCC A;  3I3V A;  4GD5 A;  1OLA A;  5CI5 A;  3MVZ A;  1MH4 A;  3TQL A;  4JWO A;  1PB7 A;  5H8S A;  1VR5 A;  3N26 A;  2HAV A;  2KLF A;  3FVG A;  3Q27 A;  1ZJL A;  3OEL A;  5JTY B;  1XHY A;  2ZXT A;  3RNN A;  4YMA A;  1FTK A;  3TDJ A;  2ONR A;  1B05 A;  3GXA A;  4NWD A;  4Q30 B;  1MY0 A;  3SET A;  1LAF E;  2OWT A;  4OEN A;  4KQP A;  4QHQ A;  1B32 A;  1VFD A;  2IA4 A;  3VLU A;  3FXR A;  2ABH A;  3UOR A;  4M4G A;  3AXF A;  4NMY A;  3IOU A;  4OER A;  4DCY A;  1B5J A;  1LFG A;  5DVI A;  2DWA A;  3HHG A;  3M3K A;  2AL5 A;  5FTH A;  3UA8 A;  4N13 A;  1JW4 A;  4R73 A;  2W7Y A;  2RCB A;  3O97 A;  2O6A A;  4H1X A;  3U92 A;  4NTL A;  3VXB A;  1SW4 A;  4C1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...