1OIBA

Phosphate-binding protein mutant t141d
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGDSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphate transport
molecule keywords PHOSPHATE-BINDING PROTEIN
total genus 105
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oibA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oibA02
2NUVA 1O64A 2XXIA 3O6GA 3PUZE 3RT6B 2V93A 3P7IA 4DXBA 3SERA 1PEBA 4P0GA 2ONKE 2WKYA 3K6XA 1Q1KA 3OENA 1BKAA 1AIVA 1CE2A 3IB0A 3Q28A 1FQEA 1QVSA 3ILTB 4G77A 1MG1A 3WAEA 1LFIA 1JNFA 3A09A 1YCJA 2HEUA 4O3CA 5HBCA 1BIYA 2V3QA 4ZZEA 4IGRA 1ANFA 3V83A 4NF6A 3CRBA 3SEXA 3TQWA 4RPNA 3C33A 4L17A 1P1OA 2Q2AA 5CMBA 2Z8DA 1MY1A 4E0WA 1MQJA 4X9TA 2XXUA 1A7LA 3FJMA 1D3KA 4R6YA 2ESNA 1GR2A 1ZTYA 1EZ9A 1A54A 2E1SA 1JEVA 4GIZA 3H6WA 4IO5A 4LUBA 5FTHA 3L6GA 5I56B 1US4A 1B3EA 2D3IA 3KFMA 3FXUA 2H9BA 3UK4A 3SEUA 1MXXA 1IUDA 2AIXA 2OWSA 2P1SA 2X7PA 2QPQA 3OSQA 4P0IA 2QJEA 4NF6B 4ZEDA 4G68B 4ZE9A 5HPQA 3HSTA 3K02A 1LLSA 1MXVA 3G3JA 3QUJA 3W9WA 4F1YA 1MXUA 4ZE8A 5AA2A 5I2NA 1IXGA 5KDTA 3CG3A 5H8FB 1PC3A 4ELRA 2PT1A 2Q9TA 3K1MA 3CI8A 3TZAA 3SEYA 5L9MA 2HAVA 4NE4A 3G3FA 3SDFA 2NVUB 3HHFA 1I6AA 2YJPA 3GBBA 4DXUA 2O68A 1MM6A 2ZYKA 3IOWA 4YAHX 4QRZA 4MLVA 2OBGA 4HS7A 1MQHA 4F39A 1N04A 2V3TA 3CFLA 3JV9A 1P1UA 1SVXB 1M5FA 1MPDA 4QFNA 2UYEA 3MQ9A 2DWHA 3PGFA 3Q25A 3CVGA 1URDA 5JTYB 4G8NA 1B7ZA 4FEDA 1MPCA 3CR9A 4ELPA 4H67A 4E0XA 3FXRA 3FD3A 3DP8A 3IJXB 1UIUA 1UIVA 2Y7PA 2OJTA 2ALUA 4JWYA 3RPWA 1LCFA 3DLNA 1NKXA 3FVKA 3OXNA 3K2DA 1B4ZA 5IAIA 3OELA 2CMOA 2X26A 4U4SA 2UVGA 4PP0A 4BDLA 3S9LC 4GXSB 3PUVE 1A55A 1PBQA 1M5BA 3HO7A 3EF7A 3MAMA 5CMMA 2Q2CA 4KYEA 2FA7A 2XX9A 1B5JA 3BFUA 4LA9A 4MLQA 4I62A 4XTCQ 2PYYA 4ZEKA 4RK2A 2QS3A 2YLNA 2O84X 1EH3A 3G3IA 1DPPA 3Q29A 4GF8A 4OFOA 1B32A 3MWBA 3KZGA 1Y20A 2DXRA 3D4CA 3PMVA 3TQLA 3CIJA 3KSXA 4G4PA 2UVIA 2R9JA 3FUZA 4KCCA 4LONB 5EYFA 3H03A 5I2KB 4ELOA 1M5DA 5K2YA 1LAHE 3Q26A 4KQPA 5AA1A 3UP9A 2DWJA 2ZNUA 3MJNA 1B58A 1MDQA 4NMYA 1Y3NA 2I0BA 2UVJA 3MPLA 4YKPA 4GL0A 3EN3A 3OO6A 3ODBA 3IO4A 2REJA 4Q30B 1MRPA 4JXIA 1JEUA 1ZMGA 1USYE 2XXVA 1RKMA 4DCYA 5AA4B 2F36A 5CI5A 1H45A 1NNTA 4OYVA 4Z0IA 1NH8A 2P0SA 3K1PA 4NWCA 4R9GA 1DSNA 4TOZA 3UN6A 1OLCA 2I58A 3KN8A 5CMCA 3OEMA 3V8XB 4ECFA 5AA2D 1J1NA 2ANJA 1B52A 1B1XA 3KSJA 4QHQA 1P1QA 4YU0A 3CFZA 4P11A 4ND9A 2D5WA 2O6AA 4RK9A 3FZVA 3OO9A 4ZS9A 5DVFA 5I57A 3FV2A 1RYOA 2I3VA 2W7YA 3FVGA 3KBRA 4IO3A 4JSDA 2DVCA 4FJPA 4UACA 3VLWA 2DYXA 2F7AA 2R6GE 2ONSA 1DPEA 2OWTA 1B9JA 4HCYA 4JWXA 1I6BA 3UA8A 1EU8A 2DP8A 4M4GA 2DWAA 2E0SA 3LC8A 4H8IA 2G29A 3TYHA 4EXLA 2QMWA 3FVOA 1B5HA 1NFTA 3VLUA 2F8DA 4KCDA 2QS2A 2XX7A 3T9VA 2HFBA 4YICA 3ZKLA 2RKMA 3IL1B 1B5IA 3B6TA 2ZYNA 3OMBA 2GH9A 1B7UA 2Q89A 1I69A 2ABHA 1AMFA 3N5LA 4F19A 3HHGA 4AQ4A 1SDXA 1XS5A 3FJGA 4FATA 3OSRA 5JK4A 3K6WA 4ZEFA 3UGWA 1TT1A 3H4ZA 4C1TA 1UTBA 3C36A 2D21A 3O28A 3G3KA 5H8NA 2BJJX 4DLDA 3IR1A 5CRYA 3A3CA 1WVJA 2O1LA 1NNPA 2Q88A 3M3LA 3PV0E 3KEIA 5AA4A 2XX8A 3MUQA 3H6VA 3DELB 5FHOA 2I48A 4KD5A 1PBPA 3MPKA 2DE4A 3S4UA 4PFWA 4U1ZA 3V89B 1BP5A 1Y4TA 4ISUA 4NF4A 1B51A 2RCAA 1AH5A 1NH7A 5I59B 1AOVA 4OENA 4F3BA 2VHAA 1PDAA 4PQJA 1S9TA 3C34A 3FIRA 1DOTA 1B0LA 2QL3A 4GL8A 1OVTA 2THIA 3T66A 4DE8A 2QS1A 1VR5A 3HPIA 3H6TA 3RTFB 3MVZA 3QUFA 3A3UA 2I4CA 4QSCA 5CM6A 4O3AA 3QYTA 3U1OA 3VDFA 1B46A 4X1BA 1GTKA 4H65A 3ZS6A 2F78A 4F3GA 2GHAA 1DTGA 2FYIA 3AXFA 5HM4B 3CFXA 3JZJA 1FTKA 1P1WA 4MH5A 4QFKA 3PUYE 3TELA 4ESXA 4F1UA 1D9VA 1JETA 2PT2A 3IB2A 3KG2A 4G2ZA 4QSDA 5DEXA 1IXHA 1SW2A 3I5OA 1R9LA 3OO8A 4JDFA 3B6QA 4IY5A 4R6KA 1B3HA 1UTBB 4FIMA 3MP8A 1B6HA 2O1MA 2F6PA 2Y84A 2PVUA 3HV1A 4GOTA 3T9HB 1MQDA 1F9BA 1UTHB 1TWYA 2AL5A 5H8HB 4ZEBA 1FTLA 4KYDA 3K1NA 5I58B 1FCKA 2HAUA 4YZZA 3KN7A 3O9PA 1OLAA 3RTWB 4H5FA 3UIFA 2ZYMA 5J1DA 3S9NC 3IO6A 3B6WA 3IORA 2ONRA 3O29A 3LSFB 5JTYA 1YAEA 4OVJA 3PD8A 2XXRA 3MZBA 4R75A 5L8DA 4U22A 4KFQA 1URGA 5F1QA 1XVYA 2F5XA 2RCBA 4XIGQ 1IZ1A 1LB9A 4HTGA 3VVEA 3TCFA 4QF9A 3SETA 1S7YA 2H4IA 1YPNA 3C4MA 4KPTA 5FHMA 4EQBA 4KI0E 5I59A 1MY2A 1JW1A 2DOJA 3VVDA 5A5XB 3C31A 2M8CA 3KOSA 5DYHA 5TP9B 1B40A 3RN8A 1QULA 4XKRA 1A8EA 4H6DA 4TLMB 4JB7A 4ONYA 2HZLA 5ELVA 1LSTA 1POTA 2F7BA 5EHMA 4F3PA 3RLFE 4ELQA 4X48A 3TTNA 1MY0A 4R74A 4FECA 5DEXB 1NNFA 4QFPA 1HSLA 1QUJA 1R6ZA 3QK6A 4G8HA 4AB5A 3S9MC 5TPAB 3G3GA 4LQ2A 3U92A 4ZECA 3T96B 4FAJA 2CZLA 1MQIA 4FE8A 3GZGA 1DTZA 1MM7A 3BBRA 1SW5A 2F97A 3ECRA 4PFUA 4R73A 4RA1A 4XKNA 3SEWA 4BDNA 4XKQA 4GXAA 4RYAA 1N3XA 2VP1A 3RUMA 4F22A 1FTJA 1M5EA 4RNSA 4WKMA 1N3WA 4Q8RA 2HCAA 3KJTA 2XXWA 4H1XA 3F11A 2QRYA 4YB5A 4NF8A 2I3WA 2REGA 2RC8A 5DTBA 2NXOA 4DCXA 2GFEA 1ELJA 3ONMA 3O6IA 1LBBA 2I6EA 5CBSA 4JSOA 1WODA 4PETA 4OFLA 2DE2A 1D9YA 3PPRA 2XXHA 5CBRA 3M3KA 1IXIA 1B3LA 4K3FA 4NTLA 2XD2A 1USYH 3Q27A 3TTLA 4DDDA 2ZXTA 4OQOA 4UA8A 4F3SA 2VD3A 5LOMA 3U8QA 1HSEA 3C35A 4NF8B 4DXCA 2FNCA 2R71A 1B3GA 5A5XA 3TAJA 1PB8A 5H8FA 3G7WA 1JW4A 5JEIA 4YB6A 2RINA 3IAZA 3MVYA 1I6QA 2XD3A 2AYSA 4NF5B 2F34A 4H0WA 1EZOA 4Q5TA 4BDMA 3W9VA 4KR5A 1SI1A 3TTMA 1VFDA 2Y7KA 5FHNA 4TLLB 3SESA 3QAXA 1B7HA 1FQAA 1GVCA 3MZ1A 1FQFA 1PB9A 3S9EA 5AA2B 4M1VA 1MXYA 1UQWA 3TMGA 3MZ9A 3EHUA 1XVXA 2V25A 2B3BA 1LCTA 2DS9A 3M8UA 3FATA 3FGSA 1OVBA 3PUXE 4GQOA 2OK2A 4R2FA 1D4NA 2O69A 4WEPA 1VFEA 1WDNA 1DMBA 1P1NA 4ZEIA 3RNNA 3ZKKA 5ITPA 3PPQA 1M5CA 4XXUA 1LB8A 1MY3A 1IIWA 2UVHA 3OOAA 2XXXA 3T9XB 3TFLA 4IO7A 1FQBA 4OFJA 4YKKA 5TPAA 1OQHA 2RF1A 3BKIB 3MW0A 4EF2A 1POY1 1GV8A 2I49A 1FTMA 5AA3A 1B3FA 1B1HA 2O7UA 1N7XA 1MH3A 2I4BA 2QMXA 4U2RA 3LSWA 3DP6A 1Y3QA 2F35A 5H8SA 2VOZA 2B65A 1VE4A 3FASA 3TTRA 1MXZA 3KGCA 1QUKA 1OIBA 5H8NB 4ZDMA 5I84A 5CMKA 4N07A 4OESA 4IGTA 2KLFA 1PB7A 1LAXA 3LSXA 1B0HA 5EHSA 3TTKA 3OD7A 4RPOA 3U93A 2Y7WA 1MY4A 4KHZE 4WXJA 3SKPA 2ZNTA 2V3UA 1TXFA 2Y7IA 4U1OA 5H8QB 2DQVA 4H5GA 4NF5A 1ZJLA 4OEVA 1SI0A 1Z7ME 3K4UA 3EHSA 2ZNSA 1JW5A 2H98A 1L5TA 1JQFA 5TU0A 3MVWA 4THIA 1T0KA 4EXKA 1H76A 1ZKBA 3PMWA 2UYFA 2XXPA 1HSJA 1XHYA 5H8HA 1A40A 1NL5A 4OETA 3R26A 2NWJA 3VXBA 4LZ8A 1ZU0A 2PMSA 1IQ7A 2PX1A 3O66A 1FW0A 1B05A 1IITA 3L6HA 1URSA 4LP2B 2HQ0A 3E4RA 1Z7NE 3PPOA 1LAGE 3K0VA 3K6UA 4YMAA 4U21A 1H44A 3T22A 4IY6A 4C1UA 3HN0A 5H8QA 4R9FA 2Z8FA 4EQ9A 2F7CA 1NMUA 2X7QA 1LFHA 3GXAA 1QKBA 4FEBA 5BUUA 1Y4CA 2Q8JA 1UTHA 5DVIA 2LAOA 1BLFA 1SYIA 3RY3A 4F29A 2H5YA 2OLBA 1R1NA 2OZZA 3DM0A 1XC1A 3PU5A 3LUYA 4I1DA 1LBCA 3C9HA 1TFDA 3KJ7A 2VGQA 4LQ5A 5DVJA 4GD5A 1H43A 3G3HA 5TP9A 4F18A 5KCJA 3I6VA 4X1DA 4IO4A 4XKPA 3OEKA 4LATA 1GGGA 1O7TA 2F6GA 4DZ1A 4OEUA 3EQ1A 4EQ7A 1JVXA 4OERA 1MS7A 3KN3A 4HW8A 2VD2A 3KOTA 2Z22A 4NEDA 3RGYA 3RQTA 2YPNA 4OWDA 3MVXA 3FV1A 5ITOA 5B7DA 3MC2A 1MXWA 4C0RA 1Y1ZA 4JBZA 1A99A 4O3BA 3PD9A 5IKBA 1OQGA 1N0TA 1SBPA 3IB1A 1Y9UA 4POXA 5L9SA 1AL3A 3MP6A 3VVFA 4OXVA 4ESWA 2DWIA 3CSGA 3N6TA 3R6UA 3TCHA 4MBPA 3IK6B 5ICQA 1QJMA 1S50A 3C32A 3M3FA 3QXMA 4F2QA 4YB7A 2O51A 3N26A 4Q0CA 1B2HA 4N6PA 2ZMBA 1MQGA 2AL4A 4RJZA 2DVZA 5CC2A 2UXAA 3MP1A 3E9XA 4I9DA 4TQUQ 5AE4A 3PMXA 2IEEA 2H25A 3SEVA 4KYSA 4MFIA 3T9UA 1P99A 2NOOA 3O2AA 3FVNA 2GHBA 4N13A 3W15C 1ZBMA 3IOTA 3IX1A 3VE1B 1H3DA 2HZKA 2Y7RA 1QW0A 2I0CA 3H3GA 3R7XA 4FORA 3I3VA 2IA4A 2XXQA 3BFTA 2A5TA 3ILUB 3H7MA 4HCWA 3CSBA 4F1VA 5K2XA 3THIA 4OTEA 1CB6A 1LAFE 2PBWA 4GLIA 1II5A 4GVOA 4OMBA 5B70A 3TDJA 5KCJB 4GFRA 3B7DA 5DT6A 1QKAA 3K01A 1FQDA 1SW1A 3H06B 3OO7A 2H99A 1ZIUA 2Z23A 3FJ7A 4NF4B 1B4HA 2DE3A 4G8MA 3PPPA 4IO2A 5KZTA 4LZ7A 5L9OA 4PE5B 4RXLA 3PUWE 3D4GA 3U94A 1NNKA 3EHTA 3E13X 2XXTA 4F31B 5M2VA 4YKIA 3K6VA 4LZ5A 1RYXA 1XT8A 2P2AA 3O97A 4POWA 4R6HA 3TKDA 2ZYOA 4EDPA 3N6UA 1JVYA 4IB2A 3VXCA 4Z7EA 5I58A 2GRVA 1MH4A 2RC7A 1SQYA 1N76A 3VV5A 4F2OA 4IO6A 2RC9A 4LVQA 1IXCA 1A8FA 3VFJA 4RY1A 1TFAA 3GBAA 2Z8EA 3PPNA 4QFOA 1N84A 2XHDA 3IJOB 4WEDA 3CG1A 3DP4A 3LSLA 5I56A 3LR1A 2B3FA 4BDRA 3U72A 1SD3A 2A5SA 3QSLA 1VSOA 3ZSFA 2A5TB 4OHNA 3O6HA 2V84A 4R72A 1MDP1 3TPAA 3WAFA 4BDQA 4YMBA 5I2KA 4G68A 1BTJA 1US5A 3TCGA 3FXQA 3GLBA 4BLAA 2OCUA 2XXYA 4U4XA 3TODA 3S2VA 1R9QA 4YKJA 4EUOA 5I2NB 5KDTB 4U23A 3HCQA 1FQCA 2QS4A 5F7VA 1SW4A 3EPEA 3H6UA 1LFGA 4GWOA 3RT8A 3UORA 3E3KA 3V5AA 4BDOA 2DSFA 4NWDA 1Q35A 4G68C 3TUSA 3MBPA 4DIGA 1QUIA 2G93A 2HXWA 4MF3A 3T93B 3K00A 3QIMA 4PFTA 5ISUA 1IEJA 1OMPA 5I57B 4GRKA 3IOVA 1FTOA 5FTIA 2DXYA 4PFYA 4OZ9A 4QFLA 4EF1A 3USDA 4QSEA 5BWJA 1O63A 1KWHA 3IOUA 3LBSA 3JYRA 1MPBA 4H8JA 1EZPA 1ATGA 1ZLQA 5ICTA 1Y1MA 1LGBC 4R2BA 1SYHA 2O7IA 2QSXA 1Y3PA 1YTVA 3N94A 4JWOA 3VLVA 1N7WA 4AB6A 4ZZAA 1XOCA 3TEPA 4I8CA
chains in the Genus database with same CATH superfamily
3RT6B 2XXIA 1PEBA 4O7MA 1AIVA 1CE2A 1FQEA 3ILTB 4G77A 4I3EA 1JNFA 1YCJA 1DK4A 4O3CA 4ZZEA 3V83A 3TQWA 4RPNA 1MY1A 1MQJA 2VPOA 4X9TA 2XXUA 4R6YA 4MIJA 2E1SA 5FTHA 5I56B 3FXUA 2OWSA 2P1SA 2X7PA 3D1RA 4NF6B 1LLSA 4F1YA 5AA2A 1MXUA 5I2NA 1PC3A 4ELRA 3CI8A 3SEYA 3SDFA 1I6AA 1EYIA 3GBBA 4DXUA 1MM6A 4HXVA 4NGUA 1P1UA 2DWHA 3CVGA 4G8NA 1B7ZA 5EQ8A 4E0XA 3FD3A 3DP8A 3IJXB 1UIVA 2ALUA 1NKXA 3FVKA 2WEFA 3K2DA 3OELA 2CMOA 2X26A 4BDLA 2UVGA 4GXSB 1K9ZA 1M5BA 3MAMA 3EF7A 2Q2CA 2FA7A 3BFUA 4LA9A 4MLQA 2MKZA 4XTCQ 2YLNA 3MWBA 1Y20A 4PBHA 3TQLA 3CIJA 4KCCA 2UVIA 5I2KB 2Y5KA 5K2YA 1LAHE 4PBQA 3UP9A 1IMDA 4MMPA 2I0BA 3CHGA 2UVJA 4GL0A 1ZMGA 1USYE 2F36A 1NH8A 4NWCA 4R9GA 4PDHA 3V8XB 1J1NA 1B52A 3U65A 1P1QA 4RK9A 5DW8A 3FZVA 1LEVA 2DVCA 4FJPA 4UACA 5IM2A 2ONSA 4JWXA 1EU8A 2DWAA 3LC8A 4H8IA 3VLUA 3ZKLA 4YICA 3B6TA 2ZYNA 1I69A 2KR0A 4F19A 3HHGA 1SDXA 4MNIA 2BJJX 3PV0E 5ET6A 5AA4A 2DE4A 5IZ3B 3T1BA 3S4UA 4PFWA 1BP5A 1Y4TA 2RCAA 1AH5A 5I59B 1AOVA 4F3BA 1DBZA 1VR5A 5LDZA 3QUFA 1LBVA 3QYTA 3VDFA 4OVRA 1GTKA 4H65A 1P1WA 4ESXA 1LBZA 1JETA 1FPGA 2PT2A 3KG2A 4GWUA 3B6QA 2Y84A 4GOTA 2AL5A 1TWYA 4PC9A 4YZZA 3IO6A 3IORA 2ONRA 5JTYA 3MZBA 1URGA 4PAFA 2RCBA 4XIGQ 3TCFA 4QF9A 5IGAA 2DOJA 3C31A 3KOSA 3RN8A 4H6DA 4TLMB 2HZLA 4F3PA 4R74A 1NNFA 4G8HA 3S9MC 5TPAB 3G3GA 1MQIA 4FE8A 1DTZA 2WBDA 1AWBA 3RUMA 4RNSA 4WKMA 3MYUA 4P8BA 3F11A 2GFEA 3O6IA 3PPRA 4K3FA 3Q27A 3BIHA 3TTLA 4F3SA 4OQOA 4UA8A 1NUXA 1HSEA 4DXCA 3G7WA 4H0WA 1G0IA 4KR5A 1VFDA 5FHNA 3QAXA 3S9EA 5AA2B 1MXYA 2KQZA 4AS4A 2V25A 2DS9A 3M8UA 3PUXE 4WEPA 2OK2A 2O69A 1VFEA 2WX9A 1M5CA 1OQHA 1POY1 1K9YA 5EYGA 2I4BA 2QVVA 4XEQA 3FASA 2B65A 3KGCA 1QUKA 5H8NB 5I84A 5CMKA 3E79A 1LAXA 3LSXA 1B0HA 1RDYA 2XA5A 4KHZE 2V3UA 1TXFA 3RPLB 1ZJLA 1SPIA 1SI0A 3EHSA 1JW5A 4NN3A 1H76A 1ZKBA 1NL5A 4OETA 3VXBA 1ZU0A 3L6HA 1IITA 1URSA 4LP2B 2HQ0A 1LAGE 4U21A 1NI9A 3HN0A 2Z8FA 4EQ9A 1NMUA 2X7QA 1LFHA 4N8YA 4F29A 3RY3A 2QVUA 3T0JA 1LBCA 1TFDA 5TP9A 4X1DA 3OEKA 4EQ7A 1O7TA 4DZ1A 3EQ1A 1JVXA 3KOTA 5ITOA 1Y1ZA 1A99A 1N0TA 3MP6A 2DWIA 3CSGA 3N6TA 4MBPA 5ICQA 1S50A 3C32A 3M3FA 3QXMA 4RJZA 5CC2A 2UXAA 2IEEA 3T9UA 4N13A 2GHBA 1H3DA 4PFBA 2XXQA 3B50A 2A5TA 4F1VA 5K2XA 3THIA 2PBWA 4PCDA 4OVQA 1FSAA 3B7DA 4N6DA 3K01A 1FPLA 4PFRA 2DE3A 4RXLA 3D4GA 5M2VA 4PAKA 4LZ5A 1RYXA 3O97A 4POWA 4R6HA 4EDPA 5I58A 1N76A 4QFOA 3GBAA 1FBCA 1N84A 2FVZA 3LSLA 2A5SA 3QSLA 2OWZA 5I2KA 3TPAA 3B8BA 3FXQA 1R9QA 4JVCA 5F7VA 1LFGA 3E3KA 3T93B 3K00A 4PFTA 1OMPA 5FTIA 1FJ6A 2DXYA 4OZ9A 5IZ1A 3USDA 1BK4A 1ATGA 3PTYA 1NV4A 1Y1MA 1SYHA 2O7IA 2QSXA 5LTCA 1YTVA 4JWOA 5ET7A 3VLVA 1FPEA 4DXBA 3P7IA 3SERA 1Q1KA 3IB0A 3Q28A 1QVSA 1MG1A 4PDDA 1BIYA 1D9QA 2V3QA 1P1OA 2Z8DA 4MNPA 1GR2A 1ZTYA 1EZ9A 4NX1A 3H6WA 3SEUA 1IUDA 4P0IA 3K02A 3G3JA 1MXVA 4OA4A 5FBPA 4ZE8A 1IXGA 3CG3A 5H8FB 3K1MA 3TZAA 1FPFA 2YJPA 4GWZA 4G61A 4KXPA 2ZYKA 3IOWA 4HS7A 4F39A 2V3TA 3JV9A 4QFNA 2UYEA 3MQ9A 2XWOA 5JTYB 3CR9A 4ELPA 4H67A 1UIUA 4JWYA 3RPWA 4U4SA 3KC0A 1A55A 1PBQA 4I62A 4ZEKA 2PYYA 3G3IA 2O84X 1EH3A 1DPPA 3FBPA 2FIEA 3E78A 4ELOA 1B58A 2Q8MA 1FPKA 3ODBA 4GBWA 2REJA 4Q30B 1MRPA 4JXIA 1RKMA 5AA4B 1NNTA 4Z0IA 3K1PA 1OLCA 5CMCA 4ECFA 5AA2D 4QHQA 2D5WA 2O6AA 1NV3A 3UA8A 3TYHA 2QS2A 2XX7A 4OVPA 3IL1B 1LBYA 2ABHA 1AMFA 3N5LA 5JK4A 2XWVA 3FJGA 3K6WA 3UGWA 2O1LA 2Q88A 3KEIA 3MUQA 3DELB 5FHOA 3V89B 1NH7A 4OENA 2VHAA 4PQJA 3FIRA 2QL3A 1OVTA 4X8RA 3T66A 3MVZA 4QSCA 5CM6A 5J1DA 3U1OA 1B46A 4X1BA 3ZS6A 2F78A 3AXFA 4MH5A 4QFKA 4GX4A 2VT5A 3I5OA 3OO8A 4IY5A 1UTBB 3MP8A 2ZZXA 2PVUA 3HV1A 4QXDA 3T9HB 5H8HB 4ZEBA 1IMEA 1FCKA 3S9NC 3O9PA 1OLAA 4H5FA 4OVJA 4GWWA 2BJIA 3QMFA 1LB9A 4HTGA 4MNCA 1S7YA 4KPTA 4EQBA 5I59A 1JW1A 5A5XB 2M8CA 4P56A 2V4CA 4JB7A 1POTA 5ET5A 1MY0A 4NQ8A 5DEXB 2CZKA 3QK6A 1R6ZA 4AB5A 4LQ2A 3U92A 3T96B 4FAJA 1MM7A 4P9KA 2F97A 4OANA 4BDNA 4XKQA 4GXAA 1N3XA 1FTJA 1NV5A 3KJTA 1NV7A 2XXWA 4YB5A 2I3WA 2RC8A 5T3JA 1ELJA 5CBSA 1WODA 4PETA 2XXHA 1B3LA 4NTLA 4N8GA 4DDDA 3C35A 4NF8B 2L5VA 2FNCA 2R71A 1B3GA 1IMBA 4YB6A 3MVYA 1I6QA 4NF5B 4BDMA 1KZ8A 1SI1A 4TLLB 4N17A 1GVCA 3MZ1A 5DYHA 2B3BA 4GQOA 3FGSA 1D4NA 1P1NA 4ZEIA 4P3LA 3RNNA 3ZKKA 3PPQA 4XXUA 1FJ9A 4YKKA 2RF1A 1GV8A 1FTMA 1B3FA 1B1HA 1N7XA 4U2RA 1VE4A 5F24A 1OIBA 4N07A 2ZZWA 4OESA 4IGTA 5EHSA 3TTKA 1NV0A 3OD7A 1FTAA 2Y7WA 4WXJA 5H8QB 4H5GA 3K4UA 4NF0A 3MSTA 1L5TA 1JQFA 4THIA 3R26A 4LZ8A 2PMSA 1IQ7A 3O66A 3E4RA 3PPOA 3K6UA 4YMAA 1H44A 2FBPA 3GXAA 5BUUA 1Y4CA 1BLFA 1SYIA 1IMFA 3DM0A 2OLBA 1R1NA 3PU5A 3SKPA 3LUYA 4LQ5A 4GWSA 3KJ7A 4I1DA 4GD5A 4XKPA 1GGGA 4OERA 3KN3A 3BIGA 3FV1A 1MXWA 1RDZA 4POXA 3IB1A 1Y9UA 4O94A 3VVFA 3TCHA 1QJMA 1FPIA 2O51A 4YB7A 4N6PA 2AL4A 4TQUQ 3PMXA 3O2AA 3W15C 3FVNA 4P1EA 1ZBMA 3IX1A 2HZKA 3H3GA 4HCWA 4OTEA 4GVOA 5B70A 2FIXA 2WYPA 4P47A 1FQDA 3H06B 5KZTA 4LZ7A 5L9OA 1NNKA 3EHTA 2XXTA 4F31B 4YKIA 3K6VA 2P2AA 2ZYOA 3N6UA 4IO6A 1NUZA 4RY1A 1TFAA 3PPNA 4GBVA 5I56A 2B3FA 3ZSFA 2A5TB 3O6HA 2V84A 4BDQA 4YMBA 1FBPA 1BTJA 3GLBA 3S2VA 4U23A 3UORA 3TUSA 4DIGA 2HXWA 2G93A 4MF3A 5ISUA 1NV6A 4GRKA 3ROJA 4PFYA 4QSEA 1KWHA 3IOUA 1LGBC 1XOCA 4I8CA 2NUVA 1O64A 3O6GA 3PUZE 2V93A 5ET8A 4P0GA 3K6XA 2WKYA 1BKAA 3ISPA 3WAEA 2CZIA 1LFIA 4PGNA 5HBCA 4N6KA 4JVIA 4NF6A 3SEXA 4I3YA 2Q2AA 1A7LA 3FJMA 1D3KA 1JEVA 4IO5A 4LUBA 2D3IA 1B3EA 3UK4A 1MXXA 3OSQA 4ZE9A 3HSTA 3QUJA 5A5LA 5L9MA 3G3FA 2NVUB 3HHFA 2O68A 5I7IA 4YAHX 4QRZA 4MLVA 2OBGA 1MQHA 4N15A 2F3DA 3CFLA 2R8TA 1URDA 4FEDA 1MPCA 2Y7PA 2OJTA 3DLNA 3OXNA 3S9LC 3PUVE 2CEXA 4RK2A 2QS3A 4GF8A 4OFOA 1B32A 3KZGA 3KSXA 4LONB 3FUZA 5EYFA 3H03A 4XF5A 4IR8A 2DWJA 2ZNUA 2PCRA 4NMYA 3EN3A 3OO6A 1JEUA 2XXVA 5CI5A 2P0SA 1DSNA 4TOZA 3UN6A 4N4UA 2B4LA 2I58A 3KN8A 4FBPA 1LBXA 1FRPA 2ANJA 1JP4A 3KSJA 4YU0A 3CFZA 5I57A 3OO9A 2Q74A 3FV2A 2I3VA 2W7YA 3KBRA 4JSDA 2DYXA 2OWTA 2DP8A 2E0SA 2QMWA 1NFTA 4KCDA 5EQ7A 3T9VA 2HFBA 4DI4B 1B5IA 4PAIA 1FBHA 4FATA 1IMAA 4C1TA 3H4ZA 1UTBA 2D21A 5H8NA 3IR1A 3M3LA 2XX8A 3H6VA 4KD5A 1PBPA 1DCUA 3LUZA 3MPKA 4U1ZA 4UABA 4ISUA 4NF4A 1B51A 1PDAA 1B0LA 2QS1A 3HPIA 3H6TA 4N81A 4O3AA 4F3GA 1DTGA 5IZ3A 3JZJA 4Q8RA 1D9VA 4G2ZA 1VDWA 3KC1A 4QSDA 5DEXA 1SW2A 2Y5LA 4R6KA 1B3HA 2O1MA 2F6PA 1FPDA 1FTLA 4KYDA 3RTWB 3UIFA 2ZYMA 3B6WA 3O29A 3LSFB 2XXRA 4U22A 4KFQA 1XVYA 2F5XA 1IZ1A 3SETA 4NAPA 1YPNA 4LN5A 3VVDA 4XKRA 4ONYA 1LSTA 2F7BA 5EHMA 3RLFE 4ELQA 4X48A 4FECA 4QFPA 2CZHA 1QUJA 4ZECA 2CZLA 4PFUA 3GZGA 4DCXA 1SW5A 4RA1A 4XKNA 3IFAA 4QBAA 4RYAA 1M5EA 2HCAA 2QRYA 2QVRA 1LBBA 4OFLA 5CBRA 3M3KA 1IXIA 2XD2A 1USYH 1NV2A 3U8QA 5A5XA 5H8FA 1JW4A 5JEIA 3IAZA 4HE0A 2F34A 1EZOA 2XXKA 1NUWA 3W9VA 3SESA 1B7HA 1FQFA 1PB9A 1NV1A 1UQWA 3TMGA 3MZ9A 3EHUA 1LCTA 4R2FA 3TEPA 1OVBA 1WDNA 3TFLA 1MY3A 1IIWA 4BDOA 2XXXA 4IO7A 1FQBA 4OFJA 5TPAA 4N91A 3BKIB 4EF2A 2WYKA 2O7UA 2QMXA 4MAGA 3LSWA 3DP6A 5EQAA 2VOZA 3TTRA 1MXZA 2KLFA 1LBWA 3GYYA 3U93A 1MY4A 4PF8A 4U1OA 4NF5A 4OEVA 5TU0A 3PMWA 5H8HA 4AS5A 2DDKA 4I40A 3T22A 1FBGA 4GWXA 2F7CA 1QKBA 4FEBA 5DVIA 3KBZA 4MFIA 2VGQA 4F18A 1H43A 4MEVA 4NEDA 3RGYA 3RQTA 2YPNA 4OWDA 3MC2A 4O3BA 3PD9A 1OQGA 1FPJA 1AL3A 3IK6B 5EYHA 4F2QA 1B2HA 2ZMBA 3SEVA 4KYSA 2NOOA 3VE1B 1QW0A 2I0CA 3R7XA 3BFTA 3ILUB 3H7MA 2CEYA 1CB6A 1KA1A 1II5A 3TDJA 5KCJB 4GFRA 4NF4B 1SW1A 4IO2A 4G8MA 3PPPA 4PE5B 3E13X 2PFZA 1XT8A 3TKDA 4Z7EA 1MH4A 2RC7A 4F2OA 3VV5A 4LVQA 1IXCA 1A8FA 4WEDA 3CG1A 3DP4A 3U72A 1SD3A 4OHNA 1INPA 4G68A 4U4XA 5KDTB 3HCQA 1SW4A 3EPEA 3RT8A 4GWOA 2DSFA 1Q35A 2GQ1A 3MBPA 3QIMA 1IEJA 2ZZVA 5I57B 3IOVA 4QFLA 4EF1A 1O63A 3LBSA 3JYRA 4PTKA 5ICTA 3N94A 4AB6A 4ZZAA 4KI0E 1G0HA 2ONKE 3OENA 2P3VA 3A09A 4MX6A 2HEUA 4IGRA 1ANFA 3CRBA 3C33A 4L17A 5CMBA 4E0WA 4HE1A 4GX6A 2ESNA 5J16A 1A54A 2WBBA 4GIZA 3L6GA 1US4A 3IFCA 2FHYA 3KFMA 2H9BA 2AIXA 2QPQA 2QJEA 4ZEDA 5HPQA 4G68B 3W9WA 5KDTA 2PT1A 2Q9TA 2HAVA 4NE4A 2F3BA 1N04A 1SVXB 1M5FA 1MPDA 3PGFA 3Q25A 3FXRA 1LCFA 1B4ZA 5IAIA 4PP0A 1FBFA 3HO7A 5CMMA 4MCOA 4KYEA 2XX9A 1B5JA 2JJKA 3Q29A 2DXRA 3D4CA 1Q9DA 3PMVA 4G4PA 2R9JA 1M5DA 5AA1A 3Q26A 4KQPA 4OVSA 3MJNA 1MDQA 1Y3NA 3MPLA 4YKPA 4JVDA 3IO4A 4H46A 4DCYA 4GWYA 1H45A 4OYVA 3OEMA 1EYKA 1B1XA 4NHBA 4P11A 4ND9A 5EQ9A 4ZS9A 5DVFA 1RYOA 3FVGA 4IO3A 2PFYA 3VLWA 2F7AA 2R6GE 4H45A 1DPEA 1B9JA 4HCYA 1I6BA 4M4GA 2G29A 4EXLA 3FVOA 1B5HA 2F8DA 2P3NA 2RKMA 2XWKA 3OMBA 2GH9A 1B7UA 2Q89A 2HXRA 4AQ4A 1XS5A 3OSRA 4ZEFA 1TT1A 3C36A 3O28A 3G3KA 4DLDA 5CRYA 3A3CA 1YZ0A 1WVJA 1NNPA 2VPNA 2I48A 1S9TA 3C34A 1QGXA 4DI3D 1DOTA 4GL8A 2THIA 4DE8A 3RTFB 3A3UA 2I4CA 4PF6A 1NUYA 2GHAA 1YYZA 2FYIA 5HM4B 3CFXA 1FTKA 4F1UA 3TELA 3PUYE 3IB2A 1KA0A 2XWIA 1IXHA 4JDFA 1R9LA 4FIMA 1B6HA 1YXIA 1MQDA 1UTHB 1F9BA 3K1NA 5I58B 2HAUA 3KN7A 4OVTA 4O8MA 1YAEA 1XI6A 3PD8A 4R75A 5L8DA 5F1QA 3VVEA 2H4IA 3C4MA 3LV0A 5FHMA 1MY2A 4GX3A 5TP9B 1B40A 1QULA 1A8EA 5ELVA 3TCGA 3TTNA 4MHFA 1HSLA 5LOMA 3BBRA 3ECRA 4R73A 3SEWA 2VP1A 4F22A 1N3WA 4H1XA 4NF8A 2REGA 5DTBA 2NXOA 3ONMA 2I6EA 4JSOA 2DE2A 1D9YA 2ZXTA 2VD3A 4XFEA 1EYJA 4NG7A 3TAJA 1PB8A 2HHMA 2RINA 2XD3A 3RPLA 2AYSA 5I3SA 4Q5TA 3TTMA 2Y7KA 1FQAA 4M1VA 3A29A 1XVXA 3FATA 1DMBA 5ITPA 3T9XB 1LB8A 3OOAA 2UVHA 3MW0A 2I49A 5AA3A 1MH3A 1FBEA 1Y3QA 2F35A 5H8SA 4ZDMA 3FXBA 2QFLA 1PB7A 4RPOA 2ZNTA 2Y7IA 2DQVA 1Z7ME 2ZNSA 2H98A 3MVWA 1T0KA 4EXKA 2UYFA 2XXPA 1HSJA 1XHYA 1A40A 2NWJA 2PX1A 4P1LA 1FW0A 1B05A 3NOHA 2B4MA 1Z7NE 3K0VA 4IY6A 4C1UA 5H8QA 4R9FA 2Q8JA 1UTHA 3HFUA 2LAOA 2H5YA 2OZZA 1XC1A 3SZPA 3C9HA 5DVJA 5KCJA 3G3HA 3I6VA 4IO4A 1RDXA 2F6GA 4LATA 4OEUA 4HW8A 1MS7A 2VD2A 2Z22A 3EKIA 3MVXA 5B7DA 4C0RA 1FPBA 4JBZA 5IKBA 4HE2A 1SBPA 5L9SA 4ESWA 4OXVA 3R6UA 5I5PA 2OX3A 3N26A 4Q0CA 1MQGA 2DVZA 3MP1A 3E9XA 4I9DA 5AE4A 2H25A 1P99A 3IOTA 2Y7RA 4FORA 3I3VA 2IA4A 3CSBA 1LAFE 4GLIA 4OMBA 5DT6A 1QKAA 4X04A 3OO7A 2H99A 1ZIUA 2Z23A 3FJ7A 1B4HA 3PUWE 4PE3A 3U94A 4PFIA 4O7IA 1JVYA 4IB2A 5ESYA 3VXCA 1FBDA 2GRVA 1SQYA 2RC9A 3VFJA 2Z8EA 2XHDA 3IJOB 3LR1A 4BDRA 1VSOA 4R72A 1MDP1 3WAFA 1US5A 4MJOA 4BLAA 2OCUA 2XXYA 3TODA 4EUOA 5I2NB 4YKJA 1FQCA 2QS4A 1IMCA 3H6UA 3V5AA 3RYDA 4PGPA 4NWDA 4G68C 1QUIA 1CNQA 1FTOA 5BWJA 2HPGA 5IZZA 1MPBA 4H8JA 1EZPA 1ZLQA 4R2BA 1Y3PA 1N7WA
chains in the Genus database with same CATH topology
2NUVA 1O64A 2XXIA 3O6GA 3PUZE 3RT6B 2V93A 3P7IA 4DXBA 3SERA 1PEBA 4P0GA 2ONKE 2WKYA 3K6XA 1Q1KA 3OENA 1BKAA 1AIVA 1CE2A 3IB0A 3Q28A 1FQEA 1QVSA 3ILTB 4G77A 1MG1A 3WAEA 1LFIA 1JNFA 3A09A 1YCJA 2HEUA 4O3CA 5HBCA 1BIYA 2V3QA 4ZZEA 4IGRA 1ANFA 3V83A 4NF6A 3CRBA 3SEXA 3TQWA 4RPNA 3C33A 4L17A 1P1OA 2Q2AA 5CMBA 2Z8DA 1MY1A 4E0WA 1MQJA 4X9TA 2XXUA 1A7LA 3FJMA 1D3KA 4R6YA 2ESNA 1GR2A 1ZTYA 1EZ9A 1A54A 2E1SA 1JEVA 4GIZA 3H6WA 4IO5A 4LUBA 5FTHA 3L6GA 5I56B 1US4A 1B3EA 2D3IA 3KFMA 3FXUA 2H9BA 3UK4A 3SEUA 1MXXA 1IUDA 2AIXA 2OWSA 2P1SA 2X7PA 2QPQA 3OSQA 4P0IA 2QJEA 4NF6B 4ZEDA 4G68B 4ZE9A 5HPQA 3HSTA 3K02A 1LLSA 1MXVA 3G3JA 3QUJA 3W9WA 4F1YA 1MXUA 4ZE8A 5AA2A 5I2NA 1IXGA 5KDTA 3CG3A 5H8FB 1PC3A 4ELRA 2PT1A 2Q9TA 3K1MA 3CI8A 3TZAA 3SEYA 5L9MA 2HAVA 4NE4A 3G3FA 3SDFA 2NVUB 3HHFA 1I6AA 2YJPA 3GBBA 4DXUA 2O68A 1MM6A 2ZYKA 3IOWA 4YAHX 4QRZA 4MLVA 2OBGA 4HS7A 1MQHA 4F39A 1N04A 2V3TA 3CFLA 3JV9A 1P1UA 1SVXB 1M5FA 1MPDA 4QFNA 2UYEA 3MQ9A 2DWHA 3PGFA 3Q25A 3CVGA 1URDA 5JTYB 4G8NA 1B7ZA 4FEDA 1MPCA 3CR9A 4ELPA 4H67A 4E0XA 3FXRA 3FD3A 3DP8A 3IJXB 1UIUA 1UIVA 2Y7PA 2OJTA 2ALUA 4JWYA 3RPWA 1LCFA 3DLNA 1NKXA 3FVKA 3OXNA 3K2DA 1B4ZA 5IAIA 3OELA 2CMOA 2X26A 4U4SA 2UVGA 4PP0A 4BDLA 3S9LC 4GXSB 3PUVE 1A55A 1PBQA 1M5BA 3HO7A 3EF7A 3MAMA 5CMMA 2Q2CA 4KYEA 2FA7A 2XX9A 1B5JA 3BFUA 4LA9A 4MLQA 4I62A 4XTCQ 2PYYA 4ZEKA 4RK2A 2QS3A 2YLNA 2O84X 1EH3A 3G3IA 1DPPA 3Q29A 4GF8A 4OFOA 1B32A 3MWBA 3KZGA 1Y20A 2DXRA 3D4CA 3PMVA 3TQLA 3CIJA 3KSXA 4G4PA 2UVIA 2R9JA 3FUZA 4KCCA 4LONB 5EYFA 3H03A 5I2KB 4ELOA 1M5DA 5K2YA 1LAHE 3Q26A 4KQPA 5AA1A 3UP9A 2DWJA 2ZNUA 3MJNA 1B58A 1MDQA 4NMYA 1Y3NA 2I0BA 2UVJA 3MPLA 4YKPA 4GL0A 3EN3A 3OO6A 3ODBA 3IO4A 2REJA 4Q30B 1MRPA 4JXIA 1JEUA 1ZMGA 1USYE 2XXVA 1RKMA 4DCYA 5AA4B 2F36A 5CI5A 1H45A 1NNTA 4OYVA 4Z0IA 1NH8A 2P0SA 3K1PA 4NWCA 4R9GA 1DSNA 4TOZA 3UN6A 1OLCA 2I58A 3KN8A 5CMCA 3OEMA 3V8XB 4ECFA 5AA2D 1J1NA 2ANJA 1B52A 1B1XA 3KSJA 4QHQA 1P1QA 4YU0A 3CFZA 4P11A 4ND9A 2D5WA 2O6AA 4RK9A 3FZVA 3OO9A 4ZS9A 5DVFA 5I57A 3FV2A 1RYOA 2I3VA 2W7YA 3FVGA 3KBRA 4IO3A 4JSDA 2DVCA 4FJPA 4UACA 3VLWA 2DYXA 2F7AA 2R6GE 2ONSA 1DPEA 2OWTA 1B9JA 4HCYA 4JWXA 1I6BA 3UA8A 1EU8A 2DP8A 4M4GA 2DWAA 2E0SA 3LC8A 4H8IA 2G29A 3TYHA 4EXLA 2QMWA 3FVOA 1B5HA 1NFTA 3VLUA 2F8DA 4KCDA 2QS2A 2XX7A 3T9VA 2HFBA 4YICA 3ZKLA 2RKMA 3IL1B 1B5IA 3B6TA 2ZYNA 3OMBA 2GH9A 1B7UA 2Q89A 1I69A 2ABHA 1AMFA 3N5LA 4F19A 3HHGA 4AQ4A 1SDXA 1XS5A 3FJGA 4FATA 3OSRA 5JK4A 3K6WA 4ZEFA 3UGWA 1TT1A 3H4ZA 4C1TA 1UTBA 3C36A 2D21A 3O28A 3G3KA 5H8NA 2BJJX 4DLDA 3IR1A 5CRYA 3A3CA 1WVJA 2O1LA 1NNPA 2Q88A 3M3LA 3PV0E 3KEIA 5AA4A 2XX8A 3MUQA 3H6VA 3DELB 5FHOA 2I48A 4KD5A 1PBPA 3MPKA 2DE4A 3S4UA 4PFWA 4U1ZA 3V89B 1BP5A 1Y4TA 4ISUA 4NF4A 1B51A 2RCAA 1AH5A 1NH7A 5I59B 1AOVA 4OENA 4F3BA 2VHAA 1PDAA 4PQJA 1S9TA 3C34A 3FIRA 1DOTA 1B0LA 2QL3A 4GL8A 1OVTA 2THIA 3T66A 4DE8A 2QS1A 1VR5A 3HPIA 3H6TA 3RTFB 3MVZA 3QUFA 3A3UA 2I4CA 4QSCA 5CM6A 4O3AA 3QYTA 3U1OA 3VDFA 1B46A 4X1BA 1GTKA 4H65A 3ZS6A 2F78A 4F3GA 2GHAA 1DTGA 2FYIA 3AXFA 5HM4B 3CFXA 3JZJA 1FTKA 1P1WA 4MH5A 4QFKA 3PUYE 3TELA 4ESXA 4F1UA 1D9VA 1JETA 2PT2A 3IB2A 3KG2A 4G2ZA 4QSDA 5DEXA 1IXHA 1SW2A 3I5OA 1R9LA 3OO8A 4JDFA 3B6QA 4IY5A 4R6KA 1B3HA 1UTBB 4FIMA 3MP8A 1B6HA 2O1MA 2F6PA 2Y84A 2PVUA 3HV1A 4GOTA 3T9HB 1MQDA 1F9BA 1UTHB 1TWYA 2AL5A 5H8HB 4ZEBA 1FTLA 4KYDA 3K1NA 5I58B 1FCKA 2HAUA 4YZZA 3KN7A 3O9PA 1OLAA 3RTWB 4H5FA 3UIFA 2ZYMA 5J1DA 3S9NC 3IO6A 3B6WA 3IORA 2ONRA 3O29A 3LSFB 5JTYA 1YAEA 4OVJA 3PD8A 2XXRA 3MZBA 4R75A 5L8DA 4U22A 4KFQA 1URGA 5F1QA 1XVYA 2F5XA 2RCBA 4XIGQ 1IZ1A 1LB9A 4HTGA 3VVEA 3TCFA 4QF9A 3SETA 1S7YA 2H4IA 1YPNA 3C4MA 4KPTA 5FHMA 4EQBA 4KI0E 5I59A 1MY2A 1JW1A 2DOJA 3VVDA 5A5XB 3C31A 2M8CA 3KOSA 5DYHA 5TP9B 1B40A 3RN8A 1QULA 4XKRA 1A8EA 4H6DA 4TLMB 4JB7A 4ONYA 2HZLA 5ELVA 1LSTA 1POTA 2F7BA 5EHMA 4F3PA 3RLFE 4ELQA 4X48A 3TTNA 1MY0A 4R74A 4FECA 5DEXB 1NNFA 4QFPA 1HSLA 1QUJA 1R6ZA 3QK6A 4G8HA 4AB5A 3S9MC 5TPAB 3G3GA 4LQ2A 3U92A 4ZECA 3T96B 4FAJA 2CZLA 1MQIA 4FE8A 3GZGA 1DTZA 1MM7A 3BBRA 1SW5A 2F97A 3ECRA 4PFUA 4R73A 4RA1A 4XKNA 3SEWA 4BDNA 4XKQA 4GXAA 4RYAA 1N3XA 2VP1A 3RUMA 4F22A 1FTJA 1M5EA 4RNSA 4WKMA 1N3WA 4Q8RA 2HCAA 3KJTA 2XXWA 4H1XA 3F11A 2QRYA 4YB5A 4NF8A 2I3WA 2REGA 2RC8A 5DTBA 2NXOA 4DCXA 2GFEA 1ELJA 3ONMA 3O6IA 1LBBA 2I6EA 5CBSA 4JSOA 1WODA 4PETA 4OFLA 2DE2A 1D9YA 3PPRA 2XXHA 5CBRA 3M3KA 1IXIA 1B3LA 4K3FA 4NTLA 2XD2A 1USYH 3Q27A 3TTLA 4DDDA 2ZXTA 4OQOA 4UA8A 4F3SA 2VD3A 5LOMA 3U8QA 1HSEA 3C35A 4NF8B 4DXCA 2FNCA 2R71A 1B3GA 5A5XA 3TAJA 1PB8A 5H8FA 3G7WA 1JW4A 5JEIA 4YB6A 2RINA 3IAZA 3MVYA 1I6QA 2XD3A 2AYSA 4NF5B 2F34A 4H0WA 1EZOA 4Q5TA 4BDMA 3W9VA 4KR5A 1SI1A 3TTMA 1VFDA 2Y7KA 5FHNA 4TLLB 3SESA 3QAXA 1B7HA 1FQAA 1GVCA 3MZ1A 1FQFA 1PB9A 3S9EA 5AA2B 4M1VA 1MXYA 1UQWA 3TMGA 3MZ9A 3EHUA 1XVXA 2V25A 2B3BA 1LCTA 2DS9A 3M8UA 3FATA 3FGSA 1OVBA 3PUXE 4GQOA 2OK2A 4R2FA 1D4NA 2O69A 4WEPA 1VFEA 1WDNA 1DMBA 1P1NA 4ZEIA 3RNNA 3ZKKA 5ITPA 3PPQA 1M5CA 4XXUA 1LB8A 1MY3A 1IIWA 2UVHA 3OOAA 2XXXA 3T9XB 3TFLA 4IO7A 1FQBA 4OFJA 4YKKA 5TPAA 1OQHA 2RF1A 3BKIB 3MW0A 4EF2A 1POY1 1GV8A 2I49A 1FTMA 5AA3A 1B3FA 1B1HA 2O7UA 1N7XA 1MH3A 2I4BA 2QMXA 4U2RA 3LSWA 3DP6A 1Y3QA 2F35A 5H8SA 2VOZA 2B65A 1VE4A 3FASA 3TTRA 1MXZA 3KGCA 1QUKA 1OIBA 5H8NB 4ZDMA 5I84A 5CMKA 4N07A 4OESA 4IGTA 2KLFA 1PB7A 1LAXA 3LSXA 1B0HA 5EHSA 3TTKA 3OD7A 4RPOA 3U93A 2Y7WA 1MY4A 4KHZE 4WXJA 3SKPA 2ZNTA 2V3UA 1TXFA 2Y7IA 4U1OA 5H8QB 2DQVA 4H5GA 4NF5A 1ZJLA 4OEVA 1SI0A 1Z7ME 3K4UA 3EHSA 2ZNSA 1JW5A 2H98A 1L5TA 1JQFA 5TU0A 3MVWA 4THIA 1T0KA 4EXKA 1H76A 1ZKBA 3PMWA 2UYFA 2XXPA 1HSJA 1XHYA 5H8HA 1A40A 1NL5A 4OETA 3R26A 2NWJA 3VXBA 4LZ8A 1ZU0A 2PMSA 1IQ7A 2PX1A 3O66A 1FW0A 1B05A 1IITA 3L6HA 1URSA 4LP2B 2HQ0A 3E4RA 1Z7NE 3PPOA 1LAGE 3K0VA 3K6UA 4YMAA 4U21A 1H44A 3T22A 4IY6A 4C1UA 3HN0A 5H8QA 4R9FA 2Z8FA 4EQ9A 2F7CA 1NMUA 2X7QA 1LFHA 3GXAA 1QKBA 4FEBA 5BUUA 1Y4CA 2Q8JA 1UTHA 5DVIA 2LAOA 1BLFA 1SYIA 3RY3A 4F29A 2H5YA 2OLBA 1R1NA 2OZZA 3DM0A 1XC1A 3PU5A 3LUYA 4I1DA 1LBCA 3C9HA 1TFDA 3KJ7A 2VGQA 4LQ5A 5DVJA 4GD5A 1H43A 3G3HA 5TP9A 4F18A 5KCJA 3I6VA 4X1DA 4IO4A 4XKPA 3OEKA 4LATA 1GGGA 1O7TA 2F6GA 4DZ1A 4OEUA 3EQ1A 4EQ7A 1JVXA 4OERA 1MS7A 3KN3A 4HW8A 2VD2A 3KOTA 2Z22A 4NEDA 3RGYA 3RQTA 2YPNA 4OWDA 3MVXA 3FV1A 5ITOA 5B7DA 3MC2A 1MXWA 4C0RA 1Y1ZA 4JBZA 1A99A 4O3BA 3PD9A 5IKBA 1OQGA 1N0TA 1SBPA 3IB1A 1Y9UA 4POXA 5L9SA 1AL3A 3MP6A 3VVFA 4OXVA 4ESWA 2DWIA 3CSGA 3N6TA 3R6UA 3TCHA 4MBPA 3IK6B 5ICQA 1QJMA 1S50A 3C32A 3M3FA 3QXMA 4F2QA 4YB7A 2O51A 3N26A 4Q0CA 1B2HA 4N6PA 2ZMBA 1MQGA 2AL4A 4RJZA 2DVZA 5CC2A 2UXAA 3MP1A 3E9XA 4I9DA 4TQUQ 5AE4A 3PMXA 2IEEA 2H25A 3SEVA 4KYSA 4MFIA 3T9UA 1P99A 2NOOA 3O2AA 3FVNA 2GHBA 4N13A 3W15C 1ZBMA 3IOTA 3IX1A 3VE1B 1H3DA 2HZKA 2Y7RA 1QW0A 2I0CA 3H3GA 3R7XA 4FORA 3I3VA 2IA4A 2XXQA 3BFTA 2A5TA 3ILUB 3H7MA 4HCWA 3CSBA 4F1VA 5K2XA 3THIA 4OTEA 1CB6A 1LAFE 2PBWA 4GLIA 1II5A 4GVOA 4OMBA 5B70A 3TDJA 5KCJB 4GFRA 3B7DA 5DT6A 1QKAA 3K01A 1FQDA 1SW1A 3H06B 3OO7A 2H99A 1ZIUA 2Z23A 3FJ7A 4NF4B 1B4HA 2DE3A 4G8MA 3PPPA 4IO2A 5KZTA 4LZ7A 5L9OA 4PE5B 4RXLA 3PUWE 3D4GA 3U94A 1NNKA 3EHTA 3E13X 2XXTA 4F31B 5M2VA 4YKIA 3K6VA 4LZ5A 1RYXA 1XT8A 2P2AA 3O97A 4POWA 4R6HA 3TKDA 2ZYOA 4EDPA 3N6UA 1JVYA 4IB2A 3VXCA 4Z7EA 5I58A 2GRVA 1MH4A 2RC7A 1SQYA 1N76A 3VV5A 4F2OA 4IO6A 2RC9A 4LVQA 1IXCA 1A8FA 3VFJA 4RY1A 1TFAA 3GBAA 2Z8EA 3PPNA 4QFOA 1N84A 2XHDA 3IJOB 4WEDA 3CG1A 3DP4A 3LSLA 5I56A 3LR1A 2B3FA 4BDRA 3U72A 1SD3A 2A5SA 3QSLA 1VSOA 3ZSFA 2A5TB 4OHNA 3O6HA 2V84A 4R72A 1MDP1 3TPAA 3WAFA 4BDQA 4YMBA 5I2KA 4G68A 1BTJA 1US5A 3TCGA 3FXQA 3GLBA 4BLAA 2OCUA 2XXYA 4U4XA 3TODA 3S2VA 1R9QA 4YKJA 4EUOA 5I2NB 5KDTB 4U23A 3HCQA 1FQCA 2QS4A 5F7VA 1SW4A 3EPEA 3H6UA 1LFGA 4GWOA 3RT8A 3UORA 3E3KA 3V5AA 4BDOA 2DSFA 4NWDA 1Q35A 4G68C 3TUSA 3MBPA 4DIGA 1QUIA 2G93A 2HXWA 4MF3A 3T93B 3K00A 3QIMA 4PFTA 5ISUA 1IEJA 1OMPA 5I57B 4GRKA 3IOVA 1FTOA 5FTIA 2DXYA 4PFYA 4OZ9A 4QFLA 4EF1A 3USDA 4QSEA 5BWJA 1O63A 1KWHA 3IOUA 3LBSA 3JYRA 1MPBA 4H8JA 1EZPA 1ATGA 1ZLQA 5ICTA 1Y1MA 1LGBC 4R2BA 1SYHA 2O7IA 2QSXA 1Y3PA 1YTVA 3N94A 4JWOA 3VLVA 1N7WA 4AB6A 4ZZAA 1XOCA 3TEPA 4I8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUV A;  1O64 A;  2XXI A;  3O6G A;  3PUZ E;  3RT6 B;  2V93 A;  3P7I A;  4DXB A;  3SER A;  1PEB A;  4P0G A;  2ONK E;  2WKY A;  3K6X A;  1Q1K A;  3OEN A;  1BKA A;  1AIV A;  1CE2 A;  3IB0 A;  3Q28 A;  1FQE A;  1QVS A;  3ILT B;  4G77 A;  1MG1 A;  3WAE A;  1LFI A;  1JNF A;  3A09 A;  1YCJ A;  2HEU A;  4O3C A;  5HBC A;  1BIY A;  2V3Q A;  4ZZE A;  4IGR A;  1ANF A;  3V83 A;  4NF6 A;  3CRB A;  3SEX A;  3TQW A;  4RPN A;  3C33 A;  4L17 A;  1P1O A;  2Q2A A;  5CMB A;  2Z8D A;  1MY1 A;  4E0W A;  1MQJ A;  4X9T A;  2XXU A;  1A7L A;  3FJM A;  1D3K A;  4R6Y A;  2ESN A;  1GR2 A;  1ZTY A;  1EZ9 A;  1A54 A;  2E1S A;  1JEV A;  4GIZ A;  3H6W A;  4IO5 A;  4LUB A;  5FTH A;  3L6G A;  5I56 B;  1US4 A;  1B3E A;  2D3I A;  3KFM A;  3FXU A;  2H9B A;  3UK4 A;  3SEU A;  1MXX A;  1IUD A;  2AIX A;  2OWS A;  2P1S A;  2X7P A;  2QPQ A;  3OSQ A;  4P0I A;  2QJE A;  4NF6 B;  4ZED A;  4G68 B;  4ZE9 A;  5HPQ A;  3HST A;  3K02 A;  1LLS A;  1MXV A;  3G3J A;  3QUJ A;  3W9W A;  4F1Y A;  1MXU A;  4ZE8 A;  5AA2 A;  5I2N A;  1IXG A;  5KDT A;  3CG3 A;  5H8F B;  1PC3 A;  4ELR A;  2PT1 A;  2Q9T A;  3K1M A;  3CI8 A;  3TZA A;  3SEY A;  5L9M A;  2HAV A;  4NE4 A;  3G3F A;  3SDF A;  2NVU B;  3HHF A;  1I6A A;  2YJP A;  3GBB A;  4DXU A;  2O68 A;  1MM6 A;  2ZYK A;  3IOW A;  4YAH X;  4QRZ A;  4MLV A;  2OBG A;  4HS7 A;  1MQH A;  4F39 A;  1N04 A;  2V3T A;  3CFL A;  3JV9 A;  1P1U A;  1SVX B;  1M5F A;  1MPD A;  4QFN A;  2UYE A;  3MQ9 A;  2DWH A;  3PGF A;  3Q25 A;  3CVG A;  1URD A;  5JTY B;  4G8N A;  1B7Z A;  4FED A;  1MPC A;  3CR9 A;  4ELP A;  4H67 A;  4E0X A;  3FXR A;  3FD3 A;  3DP8 A;  3IJX B;  1UIU A;  1UIV A;  2Y7P A;  2OJT A;  2ALU A;  4JWY A;  3RPW A;  1LCF A;  3DLN A;  1NKX A;  3FVK A;  3OXN A;  3K2D A;  1B4Z A;  5IAI A;  3OEL A;  2CMO A;  2X26 A;  4U4S A;  2UVG A;  4PP0 A;  4BDL A;  3S9L C;  4GXS B;  3PUV E;  1A55 A;  1PBQ A;  1M5B A;  3HO7 A;  3EF7 A;  3MAM A;  5CMM A;  2Q2C A;  4KYE A;  2FA7 A;  2XX9 A;  1B5J A;  3BFU A;  4LA9 A;  4MLQ A;  4I62 A;  4XTC Q;  2PYY A;  4ZEK A;  4RK2 A;  2QS3 A;  2YLN A;  2O84 X;  1EH3 A;  3G3I A;  1DPP A;  3Q29 A;  4GF8 A;  4OFO A;  1B32 A;  3MWB A;  3KZG A;  1Y20 A;  2DXR A;  3D4C A;  3PMV A;  3TQL A;  3CIJ A;  3KSX A;  4G4P A;  2UVI A;  2R9J A;  3FUZ A;  4KCC A;  4LON B;  5EYF A;  3H03 A;  5I2K B;  4ELO A;  1M5D A;  5K2Y A;  1LAH E;  3Q26 A;  4KQP A;  5AA1 A;  3UP9 A;  2DWJ A;  2ZNU A;  3MJN A;  1B58 A;  1MDQ A;  4NMY A;  1Y3N A;  2I0B A;  2UVJ A;  3MPL A;  4YKP A;  4GL0 A;  3EN3 A;  3OO6 A;  3ODB A;  3IO4 A;  2REJ A;  4Q30 B;  1MRP A;  4JXI A;  1JEU A;  1ZMG A;  1USY E;  2XXV A;  1RKM A;  4DCY A;  5AA4 B;  2F36 A;  5CI5 A;  1H45 A;  1NNT A;  4OYV A;  4Z0I A;  1NH8 A;  2P0S A;  3K1P A;  4NWC A;  4R9G A;  1DSN A;  4TOZ A;  3UN6 A;  1OLC A;  2I58 A;  3KN8 A;  5CMC A;  3OEM A;  3V8X B;  4ECF A;  5AA2 D;  1J1N A;  2ANJ A;  1B52 A;  1B1X A;  3KSJ A;  4QHQ A;  1P1Q A;  4YU0 A;  3CFZ A;  4P11 A;  4ND9 A;  2D5W A;  2O6A A;  4RK9 A;  3FZV A;  3OO9 A;  4ZS9 A;  5DVF A;  5I57 A;  3FV2 A;  1RYO A;  2I3V A;  2W7Y A;  3FVG A;  3KBR A;  4IO3 A;  4JSD A;  2DVC A;  4FJP A;  4UAC A;  3VLW A;  2DYX A;  2F7A A;  2R6G E;  2ONS A;  1DPE A;  2OWT A;  1B9J A;  4HCY A;  4JWX A;  1I6B A;  3UA8 A;  1EU8 A;  2DP8 A;  4M4G A;  2DWA A;  2E0S A;  3LC8 A;  4H8I A;  2G29 A;  3TYH A;  4EXL A;  2QMW A;  3FVO A;  1B5H A;  1NFT A;  3VLU A;  2F8D A;  4KCD A;  2QS2 A;  2XX7 A;  3T9V A;  2HFB A;  4YIC A;  3ZKL A;  2RKM A;  3IL1 B;  1B5I A;  3B6T A;  2ZYN A;  3OMB A;  2GH9 A;  1B7U A;  2Q89 A;  1I69 A;  2ABH A;  1AMF A;  3N5L A;  4F19 A;  3HHG A;  4AQ4 A;  1SDX A;  1XS5 A;  3FJG A;  4FAT A;  3OSR A;  5JK4 A;  3K6W A;  4ZEF A;  3UGW A;  1TT1 A;  3H4Z A;  4C1T A;  1UTB A;  3C36 A;  2D21 A;  3O28 A;  3G3K A;  5H8N A;  2BJJ X;  4DLD A;  3IR1 A;  5CRY A;  3A3C A;  1WVJ A;  2O1L A;  1NNP A;  2Q88 A;  3M3L A;  3PV0 E;  3KEI A;  5AA4 A;  2XX8 A;  3MUQ A;  3H6V A;  3DEL B;  5FHO A;  2I48 A;  4KD5 A;  1PBP A;  3MPK A;  2DE4 A;  3S4U A;  4PFW A;  4U1Z A;  3V89 B;  1BP5 A;  1Y4T A;  4ISU A;  4NF4 A;  1B51 A;  2RCA A;  1AH5 A;  1NH7 A;  5I59 B;  1AOV A;  4OEN A;  4F3B A;  2VHA A;  1PDA A;  4PQJ A;  1S9T A;  3C34 A;  3FIR A;  1DOT A;  1B0L A;  2QL3 A;  4GL8 A;  1OVT A;  2THI A;  3T66 A;  4DE8 A;  2QS1 A;  1VR5 A;  3HPI A;  3H6T A;  3RTF B;  3MVZ A;  3QUF A;  3A3U A;  2I4C A;  4QSC A;  5CM6 A;  4O3A A;  3QYT A;  3U1O A;  3VDF A;  1B46 A;  4X1B A;  1GTK A;  4H65 A;  3ZS6 A;  2F78 A;  4F3G A;  2GHA A;  1DTG A;  2FYI A;  3AXF A;  5HM4 B;  3CFX A;  3JZJ A;  1FTK A;  1P1W A;  4MH5 A;  4QFK A;  3PUY E;  3TEL A;  4ESX A;  4F1U A;  1D9V A;  1JET A;  2PT2 A;  3IB2 A;  3KG2 A;  4G2Z A;  4QSD A;  5DEX A;  1IXH A;  1SW2 A;  3I5O A;  1R9L A;  3OO8 A;  4JDF A;  3B6Q A;  4IY5 A;  4R6K A;  1B3H A;  1UTB B;  4FIM A;  3MP8 A;  1B6H A;  2O1M A;  2F6P A;  2Y84 A;  2PVU A;  3HV1 A;  4GOT A;  3T9H B;  1MQD A;  1F9B A;  1UTH B;  1TWY A;  2AL5 A;  5H8H B;  4ZEB A;  1FTL A;  4KYD A;  3K1N A;  5I58 B;  1FCK A;  2HAU A;  4YZZ A;  3KN7 A;  3O9P A;  1OLA A;  3RTW B;  4H5F A;  3UIF A;  2ZYM A;  5J1D A;  3S9N C;  3IO6 A;  3B6W A;  3IOR A;  2ONR A;  3O29 A;  3LSF B;  5JTY A;  1YAE A;  4OVJ A;  3PD8 A;  2XXR A;  3MZB A;  4R75 A;  5L8D A;  4U22 A;  4KFQ A;  1URG A;  5F1Q A;  1XVY A;  2F5X A;  2RCB A;  4XIG Q;  1IZ1 A;  1LB9 A;  4HTG A;  3VVE A;  3TCF A;  4QF9 A;  3SET A;  1S7Y A;  2H4I A;  1YPN A;  3C4M A;  4KPT A;  5FHM A;  4EQB A;  4KI0 E;  5I59 A;  1MY2 A;  1JW1 A;  2DOJ A;  3VVD A;  5A5X B;  3C31 A;  2M8C A;  3KOS A;  5DYH A;  5TP9 B;  1B40 A;  3RN8 A;  1QUL A;  4XKR A;  1A8E A;  4H6D A;  4TLM B;  4JB7 A;  4ONY A;  2HZL A;  5ELV A;  1LST A;  1POT A;  2F7B A;  5EHM A;  4F3P A;  3RLF E;  4ELQ A;  4X48 A;  3TTN A;  1MY0 A;  4R74 A;  4FEC A;  5DEX B;  1NNF A;  4QFP A;  1HSL A;  1QUJ A;  1R6Z A;  3QK6 A;  4G8H A;  4AB5 A;  3S9M C;  5TPA B;  3G3G A;  4LQ2 A;  3U92 A;  4ZEC A;  3T96 B;  4FAJ A;  2CZL A;  1MQI A;  4FE8 A;  3GZG A;  1DTZ A;  1MM7 A;  3BBR A;  1SW5 A;  2F97 A;  3ECR A;  4PFU A;  4R73 A;  4RA1 A;  4XKN A;  3SEW A;  4BDN A;  4XKQ A;  4GXA A;  4RYA A;  1N3X A;  2VP1 A;  3RUM A;  4F22 A;  1FTJ A;  1M5E A;  4RNS A;  4WKM A;  1N3W A;  4Q8R A;  2HCA A;  3KJT A;  2XXW A;  4H1X A;  3F11 A;  2QRY A;  4YB5 A;  4NF8 A;  2I3W A;  2REG A;  2RC8 A;  5DTB A;  2NXO A;  4DCX A;  2GFE A;  1ELJ A;  3ONM A;  3O6I A;  1LBB A;  2I6E A;  5CBS A;  4JSO A;  1WOD A;  4PET A;  4OFL A;  2DE2 A;  1D9Y A;  3PPR A;  2XXH A;  5CBR A;  3M3K A;  1IXI A;  1B3L A;  4K3F A;  4NTL A;  2XD2 A;  1USY H;  3Q27 A;  3TTL A;  4DDD A;  2ZXT A;  4OQO A;  4UA8 A;  4F3S A;  2VD3 A;  5LOM A;  3U8Q A;  1HSE A;  3C35 A;  4NF8 B;  4DXC A;  2FNC A;  2R71 A;  1B3G A;  5A5X A;  3TAJ A;  1PB8 A;  5H8F A;  3G7W A;  1JW4 A;  5JEI A;  4YB6 A;  2RIN A;  3IAZ A;  3MVY A;  1I6Q A;  2XD3 A;  2AYS A;  4NF5 B;  2F34 A;  4H0W A;  1EZO A;  4Q5T A;  4BDM A;  3W9V A;  4KR5 A;  1SI1 A;  3TTM A;  1VFD A;  2Y7K A;  5FHN A;  4TLL B;  3SES A;  3QAX A;  1B7H A;  1FQA A;  1GVC A;  3MZ1 A;  1FQF A;  1PB9 A;  3S9E A;  5AA2 B;  4M1V A;  1MXY A;  1UQW A;  3TMG A;  3MZ9 A;  3EHU A;  1XVX A;  2V25 A;  2B3B A;  1LCT A;  2DS9 A;  3M8U A;  3FAT A;  3FGS A;  1OVB A;  3PUX E;  4GQO A;  2OK2 A;  4R2F A;  1D4N A;  2O69 A;  4WEP A;  1VFE A;  1WDN A;  1DMB A;  1P1N A;  4ZEI A;  3RNN A;  3ZKK A;  5ITP A;  3PPQ A;  1M5C A;  4XXU A;  1LB8 A;  1MY3 A;  1IIW A;  2UVH A;  3OOA A;  2XXX A;  3T9X B;  3TFL A;  4IO7 A;  1FQB A;  4OFJ A;  4YKK A;  5TPA A;  1OQH A;  2RF1 A;  3BKI B;  3MW0 A;  4EF2 A;  1POY 1;  1GV8 A;  2I49 A;  1FTM A;  5AA3 A;  1B3F A;  1B1H A;  2O7U A;  1N7X A;  1MH3 A;  2I4B A;  2QMX A;  4U2R A;  3LSW A;  3DP6 A;  1Y3Q A;  2F35 A;  5H8S A;  2VOZ A;  2B65 A;  1VE4 A;  3FAS A;  3TTR A;  1MXZ A;  3KGC A;  1QUK A;  1OIB A;  5H8N B;  4ZDM A;  5I84 A;  5CMK A;  4N07 A;  4OES A;  4IGT A;  2KLF A;  1PB7 A;  1LAX A;  3LSX A;  1B0H A;  5EHS A;  3TTK A;  3OD7 A;  4RPO A;  3U93 A;  2Y7W A;  1MY4 A;  4KHZ E;  4WXJ A;  3SKP A;  2ZNT A;  2V3U A;  1TXF A;  2Y7I A;  4U1O A;  5H8Q B;  2DQV A;  4H5G A;  4NF5 A;  1ZJL A;  4OEV A;  1SI0 A;  1Z7M E;  3K4U A;  3EHS A;  2ZNS A;  1JW5 A;  2H98 A;  1L5T A;  1JQF A;  5TU0 A;  3MVW A;  4THI A;  1T0K A;  4EXK A;  1H76 A;  1ZKB A;  3PMW A;  2UYF A;  2XXP A;  1HSJ A;  1XHY A;  5H8H A;  1A40 A;  1NL5 A;  4OET A;  3R26 A;  2NWJ A;  3VXB A;  4LZ8 A;  1ZU0 A;  2PMS A;  1IQ7 A;  2PX1 A;  3O66 A;  1FW0 A;  1B05 A;  1IIT A;  3L6H A;  1URS A;  4LP2 B;  2HQ0 A;  3E4R A;  1Z7N E;  3PPO A;  1LAG E;  3K0V A;  3K6U A;  4YMA A;  4U21 A;  1H44 A;  3T22 A;  4IY6 A;  4C1U A;  3HN0 A;  5H8Q A;  4R9F A;  2Z8F A;  4EQ9 A;  2F7C A;  1NMU A;  2X7Q A;  1LFH A;  3GXA A;  1QKB A;  4FEB A;  5BUU A;  1Y4C A;  2Q8J A;  1UTH A;  5DVI A;  2LAO A;  1BLF A;  1SYI A;  3RY3 A;  4F29 A;  2H5Y A;  2OLB A;  1R1N A;  2OZZ A;  3DM0 A;  1XC1 A;  3PU5 A;  3LUY A;  4I1D A;  1LBC A;  3C9H A;  1TFD A;  3KJ7 A;  2VGQ A;  4LQ5 A;  5DVJ A;  4GD5 A;  1H43 A;  3G3H A;  5TP9 A;  4F18 A;  5KCJ A;  3I6V A;  4X1D A;  4IO4 A;  4XKP A;  3OEK A;  4LAT A;  1GGG A;  1O7T A;  2F6G A;  4DZ1 A;  4OEU A;  3EQ1 A;  4EQ7 A;  1JVX A;  4OER A;  1MS7 A;  3KN3 A;  4HW8 A;  2VD2 A;  3KOT A;  2Z22 A;  4NED A;  3RGY A;  3RQT A;  2YPN A;  4OWD A;  3MVX A;  3FV1 A;  5ITO A;  5B7D A;  3MC2 A;  1MXW A;  4C0R A;  1Y1Z A;  4JBZ A;  1A99 A;  4O3B A;  3PD9 A;  5IKB A;  1OQG A;  1N0T A;  1SBP A;  3IB1 A;  1Y9U A;  4POX A;  5L9S A;  1AL3 A;  3MP6 A;  3VVF A;  4OXV A;  4ESW A;  2DWI A;  3CSG A;  3N6T A;  3R6U A;  3TCH A;  4MBP A;  3IK6 B;  5ICQ A;  1QJM A;  1S50 A;  3C32 A;  3M3F A;  3QXM A;  4F2Q A;  4YB7 A;  2O51 A;  3N26 A;  4Q0C A;  1B2H A;  4N6P A;  2ZMB A;  1MQG A;  2AL4 A;  4RJZ A;  2DVZ A;  5CC2 A;  2UXA A;  3MP1 A;  3E9X A;  4I9D A;  4TQU Q;  5AE4 A;  3PMX A;  2IEE A;  2H25 A;  3SEV A;  4KYS A;  4MFI A;  3T9U A;  1P99 A;  2NOO A;  3O2A A;  3FVN A;  2GHB A;  4N13 A;  3W15 C;  1ZBM A;  3IOT A;  3IX1 A;  3VE1 B;  1H3D A;  2HZK A;  2Y7R A;  1QW0 A;  2I0C A;  3H3G A;  3R7X A;  4FOR A;  3I3V A;  2IA4 A;  2XXQ A;  3BFT A;  2A5T A;  3ILU B;  3H7M A;  4HCW A;  3CSB A;  4F1V A;  5K2X A;  3THI A;  4OTE A;  1CB6 A;  1LAF E;  2PBW A;  4GLI A;  1II5 A;  4GVO A;  4OMB A;  5B70 A;  3TDJ A;  5KCJ B;  4GFR A;  3B7D A;  5DT6 A;  1QKA A;  3K01 A;  1FQD A;  1SW1 A;  3H06 B;  3OO7 A;  2H99 A;  1ZIU A;  2Z23 A;  3FJ7 A;  4NF4 B;  1B4H A;  2DE3 A;  4G8M A;  3PPP A;  4IO2 A;  5KZT A;  4LZ7 A;  5L9O A;  4PE5 B;  4RXL A;  3PUW E;  3D4G A;  3U94 A;  1NNK A;  3EHT A;  3E13 X;  2XXT A;  4F31 B;  5M2V A;  4YKI A;  3K6V A;  4LZ5 A;  1RYX A;  1XT8 A;  2P2A A;  3O97 A;  4POW A;  4R6H A;  3TKD A;  2ZYO A;  4EDP A;  3N6U A;  1JVY A;  4IB2 A;  3VXC A;  4Z7E A;  5I58 A;  2GRV A;  1MH4 A;  2RC7 A;  1SQY A;  1N76 A;  3VV5 A;  4F2O A;  4IO6 A;  2RC9 A;  4LVQ A;  1IXC A;  1A8F A;  3VFJ A;  4RY1 A;  1TFA A;  3GBA A;  2Z8E A;  3PPN A;  4QFO A;  1N84 A;  2XHD A;  3IJO B;  4WED A;  3CG1 A;  3DP4 A;  3LSL A;  5I56 A;  3LR1 A;  2B3F A;  4BDR A;  3U72 A;  1SD3 A;  2A5S A;  3QSL A;  1VSO A;  3ZSF A;  2A5T B;  4OHN A;  3O6H A;  2V84 A;  4R72 A;  1MDP 1;  3TPA A;  3WAF A;  4BDQ A;  4YMB A;  5I2K A;  4G68 A;  1BTJ A;  1US5 A;  3TCG A;  3FXQ A;  3GLB A;  4BLA A;  2OCU A;  2XXY A;  4U4X A;  3TOD A;  3S2V A;  1R9Q A;  4YKJ A;  4EUO A;  5I2N B;  5KDT B;  4U23 A;  3HCQ A;  1FQC A;  2QS4 A;  5F7V A;  1SW4 A;  3EPE A;  3H6U A;  1LFG A;  4GWO A;  3RT8 A;  3UOR A;  3E3K A;  3V5A A;  4BDO A;  2DSF A;  4NWD A;  1Q35 A;  4G68 C;  3TUS A;  3MBP A;  4DIG A;  1QUI A;  2G93 A;  2HXW A;  4MF3 A;  3T93 B;  3K00 A;  3QIM A;  4PFT A;  5ISU A;  1IEJ A;  1OMP A;  5I57 B;  4GRK A;  3IOV A;  1FTO A;  5FTI A;  2DXY A;  4PFY A;  4OZ9 A;  4QFL A;  4EF1 A;  3USD A;  4QSE A;  5BWJ A;  1O63 A;  1KWH A;  3IOU A;  3LBS A;  3JYR A;  1MPB A;  4H8J A;  1EZP A;  1ATG A;  1ZLQ A;  5ICT A;  1Y1M A;  1LGB C;  4R2B A;  1SYH A;  2O7I A;  2QSX A;  1Y3P A;  1YTV A;  3N94 A;  4JWO A;  3VLV A;  1N7W A;  4AB6 A;  4ZZA A;  1XOC A;  3TEP A;  4I8C A; 
#chains in the Genus database with same CATH topology
 3RT6 B;  2XXI A;  1PEB A;  4O7M A;  1AIV A;  1CE2 A;  1FQE A;  3ILT B;  4G77 A;  4I3E A;  1JNF A;  1YCJ A;  1DK4 A;  4O3C A;  4ZZE A;  3V83 A;  3TQW A;  4RPN A;  1MY1 A;  1MQJ A;  2VPO A;  4X9T A;  2XXU A;  4R6Y A;  4MIJ A;  2E1S A;  5FTH A;  5I56 B;  3FXU A;  2OWS A;  2P1S A;  2X7P A;  3D1R A;  4NF6 B;  1LLS A;  4F1Y A;  5AA2 A;  1MXU A;  5I2N A;  1PC3 A;  4ELR A;  3CI8 A;  3SEY A;  3SDF A;  1I6A A;  1EYI A;  3GBB A;  4DXU A;  1MM6 A;  4HXV A;  4NGU A;  1P1U A;  2DWH A;  3CVG A;  4G8N A;  1B7Z A;  5EQ8 A;  4E0X A;  3FD3 A;  3DP8 A;  3IJX B;  1UIV A;  2ALU A;  1NKX A;  3FVK A;  2WEF A;  3K2D A;  3OEL A;  2CMO A;  2X26 A;  4BDL A;  2UVG A;  4GXS B;  1K9Z A;  1M5B A;  3MAM A;  3EF7 A;  2Q2C A;  2FA7 A;  3BFU A;  4LA9 A;  4MLQ A;  2MKZ A;  4XTC Q;  2YLN A;  3MWB A;  1Y20 A;  4PBH A;  3TQL A;  3CIJ A;  4KCC A;  2UVI A;  5I2K B;  2Y5K A;  5K2Y A;  1LAH E;  4PBQ A;  3UP9 A;  1IMD A;  4MMP A;  2I0B A;  3CHG A;  2UVJ A;  4GL0 A;  1ZMG A;  1USY E;  2F36 A;  1NH8 A;  4NWC A;  4R9G A;  4PDH A;  3V8X B;  1J1N A;  1B52 A;  3U65 A;  1P1Q A;  4RK9 A;  5DW8 A;  3FZV A;  1LEV A;  2DVC A;  4FJP A;  4UAC A;  5IM2 A;  2ONS A;  4JWX A;  1EU8 A;  2DWA A;  3LC8 A;  4H8I A;  3VLU A;  3ZKL A;  4YIC A;  3B6T A;  2ZYN A;  1I69 A;  2KR0 A;  4F19 A;  3HHG A;  1SDX A;  4MNI A;  2BJJ X;  3PV0 E;  5ET6 A;  5AA4 A;  2DE4 A;  5IZ3 B;  3T1B A;  3S4U A;  4PFW A;  1BP5 A;  1Y4T A;  2RCA A;  1AH5 A;  5I59 B;  1AOV A;  4F3B A;  1DBZ A;  1VR5 A;  5LDZ A;  3QUF A;  1LBV A;  3QYT A;  3VDF A;  4OVR A;  1GTK A;  4H65 A;  1P1W A;  4ESX A;  1LBZ A;  1JET A;  1FPG A;  2PT2 A;  3KG2 A;  4GWU A;  3B6Q A;  2Y84 A;  4GOT A;  2AL5 A;  1TWY A;  4PC9 A;  4YZZ A;  3IO6 A;  3IOR A;  2ONR A;  5JTY A;  3MZB A;  1URG A;  4PAF A;  2RCB A;  4XIG Q;  3TCF A;  4QF9 A;  5IGA A;  2DOJ A;  3C31 A;  3KOS A;  3RN8 A;  4H6D A;  4TLM B;  2HZL A;  4F3P A;  4R74 A;  1NNF A;  4G8H A;  3S9M C;  5TPA B;  3G3G A;  1MQI A;  4FE8 A;  1DTZ A;  2WBD A;  1AWB A;  3RUM A;  4RNS A;  4WKM A;  3MYU A;  4P8B A;  3F11 A;  2GFE A;  3O6I A;  3PPR A;  4K3F A;  3Q27 A;  3BIH A;  3TTL A;  4F3S A;  4OQO A;  4UA8 A;  1NUX A;  1HSE A;  4DXC A;  3G7W A;  4H0W A;  1G0I A;  4KR5 A;  1VFD A;  5FHN A;  3QAX A;  3S9E A;  5AA2 B;  1MXY A;  2KQZ A;  4AS4 A;  2V25 A;  2DS9 A;  3M8U A;  3PUX E;  4WEP A;  2OK2 A;  2O69 A;  1VFE A;  2WX9 A;  1M5C A;  1OQH A;  1POY 1;  1K9Y A;  5EYG A;  2I4B A;  2QVV A;  4XEQ A;  3FAS A;  2B65 A;  3KGC A;  1QUK A;  5H8N B;  5I84 A;  5CMK A;  3E79 A;  1LAX A;  3LSX A;  1B0H A;  1RDY A;  2XA5 A;  4KHZ E;  2V3U A;  1TXF A;  3RPL B;  1ZJL A;  1SPI A;  1SI0 A;  3EHS A;  1JW5 A;  4NN3 A;  1H76 A;  1ZKB A;  1NL5 A;  4OET A;  3VXB A;  1ZU0 A;  3L6H A;  1IIT A;  1URS A;  4LP2 B;  2HQ0 A;  1LAG E;  4U21 A;  1NI9 A;  3HN0 A;  2Z8F A;  4EQ9 A;  1NMU A;  2X7Q A;  1LFH A;  4N8Y A;  4F29 A;  3RY3 A;  2QVU A;  3T0J A;  1LBC A;  1TFD A;  5TP9 A;  4X1D A;  3OEK A;  4EQ7 A;  1O7T A;  4DZ1 A;  3EQ1 A;  1JVX A;  3KOT A;  5ITO A;  1Y1Z A;  1A99 A;  1N0T A;  3MP6 A;  2DWI A;  3CSG A;  3N6T A;  4MBP A;  5ICQ A;  1S50 A;  3C32 A;  3M3F A;  3QXM A;  4RJZ A;  5CC2 A;  2UXA A;  2IEE A;  3T9U A;  4N13 A;  2GHB A;  1H3D A;  4PFB A;  2XXQ A;  3B50 A;  2A5T A;  4F1V A;  5K2X A;  3THI A;  2PBW A;  4PCD A;  4OVQ A;  1FSA A;  3B7D A;  4N6D A;  3K01 A;  1FPL A;  4PFR A;  2DE3 A;  4RXL A;  3D4G A;  5M2V A;  4PAK A;  4LZ5 A;  1RYX A;  3O97 A;  4POW A;  4R6H A;  4EDP A;  5I58 A;  1N76 A;  4QFO A;  3GBA A;  1FBC A;  1N84 A;  2FVZ A;  3LSL A;  2A5S A;  3QSL A;  2OWZ A;  5I2K A;  3TPA A;  3B8B A;  3FXQ A;  1R9Q A;  4JVC A;  5F7V A;  1LFG A;  3E3K A;  3T93 B;  3K00 A;  4PFT A;  1OMP A;  5FTI A;  1FJ6 A;  2DXY A;  4OZ9 A;  5IZ1 A;  3USD A;  1BK4 A;  1ATG A;  3PTY A;  1NV4 A;  1Y1M A;  1SYH A;  2O7I A;  2QSX A;  5LTC A;  1YTV A;  4JWO A;  5ET7 A;  3VLV A;  1FPE A;  4DXB A;  3P7I A;  3SER A;  1Q1K A;  3IB0 A;  3Q28 A;  1QVS A;  1MG1 A;  4PDD A;  1BIY A;  1D9Q A;  2V3Q A;  1P1O A;  2Z8D A;  4MNP A;  1GR2 A;  1ZTY A;  1EZ9 A;  4NX1 A;  3H6W A;  3SEU A;  1IUD A;  4P0I A;  3K02 A;  3G3J A;  1MXV A;  4OA4 A;  5FBP A;  4ZE8 A;  1IXG A;  3CG3 A;  5H8F B;  3K1M A;  3TZA A;  1FPF A;  2YJP A;  4GWZ A;  4G61 A;  4KXP A;  2ZYK A;  3IOW A;  4HS7 A;  4F39 A;  2V3T A;  3JV9 A;  4QFN A;  2UYE A;  3MQ9 A;  2XWO A;  5JTY B;  3CR9 A;  4ELP A;  4H67 A;  1UIU A;  4JWY A;  3RPW A;  4U4S A;  3KC0 A;  1A55 A;  1PBQ A;  4I62 A;  4ZEK A;  2PYY A;  3G3I A;  2O84 X;  1EH3 A;  1DPP A;  3FBP A;  2FIE A;  3E78 A;  4ELO A;  1B58 A;  2Q8M A;  1FPK A;  3ODB A;  4GBW A;  2REJ A;  4Q30 B;  1MRP A;  4JXI A;  1RKM A;  5AA4 B;  1NNT A;  4Z0I A;  3K1P A;  1OLC A;  5CMC A;  4ECF A;  5AA2 D;  4QHQ A;  2D5W A;  2O6A A;  1NV3 A;  3UA8 A;  3TYH A;  2QS2 A;  2XX7 A;  4OVP A;  3IL1 B;  1LBY A;  2ABH A;  1AMF A;  3N5L A;  5JK4 A;  2XWV A;  3FJG A;  3K6W A;  3UGW A;  2O1L A;  2Q88 A;  3KEI A;  3MUQ A;  3DEL B;  5FHO A;  3V89 B;  1NH7 A;  4OEN A;  2VHA A;  4PQJ A;  3FIR A;  2QL3 A;  1OVT A;  4X8R A;  3T66 A;  3MVZ A;  4QSC A;  5CM6 A;  5J1D A;  3U1O A;  1B46 A;  4X1B A;  3ZS6 A;  2F78 A;  3AXF A;  4MH5 A;  4QFK A;  4GX4 A;  2VT5 A;  3I5O A;  3OO8 A;  4IY5 A;  1UTB B;  3MP8 A;  2ZZX A;  2PVU A;  3HV1 A;  4QXD A;  3T9H B;  5H8H B;  4ZEB A;  1IME A;  1FCK A;  3S9N C;  3O9P A;  1OLA A;  4H5F A;  4OVJ A;  4GWW A;  2BJI A;  3QMF A;  1LB9 A;  4HTG A;  4MNC A;  1S7Y A;  4KPT A;  4EQB A;  5I59 A;  1JW1 A;  5A5X B;  2M8C A;  4P56 A;  2V4C A;  4JB7 A;  1POT A;  5ET5 A;  1MY0 A;  4NQ8 A;  5DEX B;  2CZK A;  3QK6 A;  1R6Z A;  4AB5 A;  4LQ2 A;  3U92 A;  3T96 B;  4FAJ A;  1MM7 A;  4P9K A;  2F97 A;  4OAN A;  4BDN A;  4XKQ A;  4GXA A;  1N3X A;  1FTJ A;  1NV5 A;  3KJT A;  1NV7 A;  2XXW A;  4YB5 A;  2I3W A;  2RC8 A;  5T3J A;  1ELJ A;  5CBS A;  1WOD A;  4PET A;  2XXH A;  1B3L A;  4NTL A;  4N8G A;  4DDD A;  3C35 A;  4NF8 B;  2L5V A;  2FNC A;  2R71 A;  1B3G A;  1IMB A;  4YB6 A;  3MVY A;  1I6Q A;  4NF5 B;  4BDM A;  1KZ8 A;  1SI1 A;  4TLL B;  4N17 A;  1GVC A;  3MZ1 A;  5DYH A;  2B3B A;  4GQO A;  3FGS A;  1D4N A;  1P1N A;  4ZEI A;  4P3L A;  3RNN A;  3ZKK A;  3PPQ A;  4XXU A;  1FJ9 A;  4YKK A;  2RF1 A;  1GV8 A;  1FTM A;  1B3F A;  1B1H A;  1N7X A;  4U2R A;  1VE4 A;  5F24 A;  1OIB A;  4N07 A;  2ZZW A;  4OES A;  4IGT A;  5EHS A;  3TTK A;  1NV0 A;  3OD7 A;  1FTA A;  2Y7W A;  4WXJ A;  5H8Q B;  4H5G A;  3K4U A;  4NF0 A;  3MST A;  1L5T A;  1JQF A;  4THI A;  3R26 A;  4LZ8 A;  2PMS A;  1IQ7 A;  3O66 A;  3E4R A;  3PPO A;  3K6U A;  4YMA A;  1H44 A;  2FBP A;  3GXA A;  5BUU A;  1Y4C A;  1BLF A;  1SYI A;  1IMF A;  3DM0 A;  2OLB A;  1R1N A;  3PU5 A;  3SKP A;  3LUY A;  4LQ5 A;  4GWS A;  3KJ7 A;  4I1D A;  4GD5 A;  4XKP A;  1GGG A;  4OER A;  3KN3 A;  3BIG A;  3FV1 A;  1MXW A;  1RDZ A;  4POX A;  3IB1 A;  1Y9U A;  4O94 A;  3VVF A;  3TCH A;  1QJM A;  1FPI A;  2O51 A;  4YB7 A;  4N6P A;  2AL4 A;  4TQU Q;  3PMX A;  3O2A A;  3W15 C;  3FVN A;  4P1E A;  1ZBM A;  3IX1 A;  2HZK A;  3H3G A;  4HCW A;  4OTE A;  4GVO A;  5B70 A;  2FIX A;  2WYP A;  4P47 A;  1FQD A;  3H06 B;  5KZT A;  4LZ7 A;  5L9O A;  1NNK A;  3EHT A;  2XXT A;  4F31 B;  4YKI A;  3K6V A;  2P2A A;  2ZYO A;  3N6U A;  4IO6 A;  1NUZ A;  4RY1 A;  1TFA A;  3PPN A;  4GBV A;  5I56 A;  2B3F A;  3ZSF A;  2A5T B;  3O6H A;  2V84 A;  4BDQ A;  4YMB A;  1FBP A;  1BTJ A;  3GLB A;  3S2V A;  4U23 A;  3UOR A;  3TUS A;  4DIG A;  2HXW A;  2G93 A;  4MF3 A;  5ISU A;  1NV6 A;  4GRK A;  3ROJ A;  4PFY A;  4QSE A;  1KWH A;  3IOU A;  1LGB C;  1XOC A;  4I8C A;  2NUV A;  1O64 A;  3O6G A;  3PUZ E;  2V93 A;  5ET8 A;  4P0G A;  3K6X A;  2WKY A;  1BKA A;  3ISP A;  3WAE A;  2CZI A;  1LFI A;  4PGN A;  5HBC A;  4N6K A;  4JVI A;  4NF6 A;  3SEX A;  4I3Y A;  2Q2A A;  1A7L A;  3FJM A;  1D3K A;  1JEV A;  4IO5 A;  4LUB A;  2D3I A;  1B3E A;  3UK4 A;  1MXX A;  3OSQ A;  4ZE9 A;  3HST A;  3QUJ A;  5A5L A;  5L9M A;  3G3F A;  2NVU B;  3HHF A;  2O68 A;  5I7I A;  4YAH X;  4QRZ A;  4MLV A;  2OBG A;  1MQH A;  4N15 A;  2F3D A;  3CFL A;  2R8T A;  1URD A;  4FED A;  1MPC A;  2Y7P A;  2OJT A;  3DLN A;  3OXN A;  3S9L C;  3PUV E;  2CEX A;  4RK2 A;  2QS3 A;  4GF8 A;  4OFO A;  1B32 A;  3KZG A;  3KSX A;  4LON B;  3FUZ A;  5EYF A;  3H03 A;  4XF5 A;  4IR8 A;  2DWJ A;  2ZNU A;  2PCR A;  4NMY A;  3EN3 A;  3OO6 A;  1JEU A;  2XXV A;  5CI5 A;  2P0S A;  1DSN A;  4TOZ A;  3UN6 A;  4N4U A;  2B4L A;  2I58 A;  3KN8 A;  4FBP A;  1LBX A;  1FRP A;  2ANJ A;  1JP4 A;  3KSJ A;  4YU0 A;  3CFZ A;  5I57 A;  3OO9 A;  2Q74 A;  3FV2 A;  2I3V A;  2W7Y A;  3KBR A;  4JSD A;  2DYX A;  2OWT A;  2DP8 A;  2E0S A;  2QMW A;  1NFT A;  4KCD A;  5EQ7 A;  3T9V A;  2HFB A;  4DI4 B;  1B5I A;  4PAI A;  1FBH A;  4FAT A;  1IMA A;  4C1T A;  3H4Z A;  1UTB A;  2D21 A;  5H8N A;  3IR1 A;  3M3L A;  2XX8 A;  3H6V A;  4KD5 A;  1PBP A;  1DCU A;  3LUZ A;  3MPK A;  4U1Z A;  4UAB A;  4ISU A;  4NF4 A;  1B51 A;  1PDA A;  1B0L A;  2QS1 A;  3HPI A;  3H6T A;  4N81 A;  4O3A A;  4F3G A;  1DTG A;  5IZ3 A;  3JZJ A;  4Q8R A;  1D9V A;  4G2Z A;  1VDW A;  3KC1 A;  4QSD A;  5DEX A;  1SW2 A;  2Y5L A;  4R6K A;  1B3H A;  2O1M A;  2F6P A;  1FPD A;  1FTL A;  4KYD A;  3RTW B;  3UIF A;  2ZYM A;  3B6W A;  3O29 A;  3LSF B;  2XXR A;  4U22 A;  4KFQ A;  1XVY A;  2F5X A;  1IZ1 A;  3SET A;  4NAP A;  1YPN A;  4LN5 A;  3VVD A;  4XKR A;  4ONY A;  1LST A;  2F7B A;  5EHM A;  3RLF E;  4ELQ A;  4X48 A;  4FEC A;  4QFP A;  2CZH A;  1QUJ A;  4ZEC A;  2CZL A;  4PFU A;  3GZG A;  4DCX A;  1SW5 A;  4RA1 A;  4XKN A;  3IFA A;  4QBA A;  4RYA A;  1M5E A;  2HCA A;  2QRY A;  2QVR A;  1LBB A;  4OFL A;  5CBR A;  3M3K A;  1IXI A;  2XD2 A;  1USY H;  1NV2 A;  3U8Q A;  5A5X A;  5H8F A;  1JW4 A;  5JEI A;  3IAZ A;  4HE0 A;  2F34 A;  1EZO A;  2XXK A;  1NUW A;  3W9V A;  3SES A;  1B7H A;  1FQF A;  1PB9 A;  1NV1 A;  1UQW A;  3TMG A;  3MZ9 A;  3EHU A;  1LCT A;  4R2F A;  3TEP A;  1OVB A;  1WDN A;  3TFL A;  1MY3 A;  1IIW A;  4BDO A;  2XXX A;  4IO7 A;  1FQB A;  4OFJ A;  5TPA A;  4N91 A;  3BKI B;  4EF2 A;  2WYK A;  2O7U A;  2QMX A;  4MAG A;  3LSW A;  3DP6 A;  5EQA A;  2VOZ A;  3TTR A;  1MXZ A;  2KLF A;  1LBW A;  3GYY A;  3U93 A;  1MY4 A;  4PF8 A;  4U1O A;  4NF5 A;  4OEV A;  5TU0 A;  3PMW A;  5H8H A;  4AS5 A;  2DDK A;  4I40 A;  3T22 A;  1FBG A;  4GWX A;  2F7C A;  1QKB A;  4FEB A;  5DVI A;  3KBZ A;  4MFI A;  2VGQ A;  4F18 A;  1H43 A;  4MEV A;  4NED A;  3RGY A;  3RQT A;  2YPN A;  4OWD A;  3MC2 A;  4O3B A;  3PD9 A;  1OQG A;  1FPJ A;  1AL3 A;  3IK6 B;  5EYH A;  4F2Q A;  1B2H A;  2ZMB A;  3SEV A;  4KYS A;  2NOO A;  3VE1 B;  1QW0 A;  2I0C A;  3R7X A;  3BFT A;  3ILU B;  3H7M A;  2CEY A;  1CB6 A;  1KA1 A;  1II5 A;  3TDJ A;  5KCJ B;  4GFR A;  4NF4 B;  1SW1 A;  4IO2 A;  4G8M A;  3PPP A;  4PE5 B;  3E13 X;  2PFZ A;  1XT8 A;  3TKD A;  4Z7E A;  1MH4 A;  2RC7 A;  4F2O A;  3VV5 A;  4LVQ A;  1IXC A;  1A8F A;  4WED A;  3CG1 A;  3DP4 A;  3U72 A;  1SD3 A;  4OHN A;  1INP A;  4G68 A;  4U4X A;  5KDT B;  3HCQ A;  1SW4 A;  3EPE A;  3RT8 A;  4GWO A;  2DSF A;  1Q35 A;  2GQ1 A;  3MBP A;  3QIM A;  1IEJ A;  2ZZV A;  5I57 B;  3IOV A;  4QFL A;  4EF1 A;  1O63 A;  3LBS A;  3JYR A;  4PTK A;  5ICT A;  3N94 A;  4AB6 A;  4ZZA A;  4KI0 E;  1G0H A;  2ONK E;  3OEN A;  2P3V A;  3A09 A;  4MX6 A;  2HEU A;  4IGR A;  1ANF A;  3CRB A;  3C33 A;  4L17 A;  5CMB A;  4E0W A;  4HE1 A;  4GX6 A;  2ESN A;  5J16 A;  1A54 A;  2WBB A;  4GIZ A;  3L6G A;  1US4 A;  3IFC A;  2FHY A;  3KFM A;  2H9B A;  2AIX A;  2QPQ A;  2QJE A;  4ZED A;  5HPQ A;  4G68 B;  3W9W A;  5KDT A;  2PT1 A;  2Q9T A;  2HAV A;  4NE4 A;  2F3B A;  1N04 A;  1SVX B;  1M5F A;  1MPD A;  3PGF A;  3Q25 A;  3FXR A;  1LCF A;  1B4Z A;  5IAI A;  4PP0 A;  1FBF A;  3HO7 A;  5CMM A;  4MCO A;  4KYE A;  2XX9 A;  1B5J A;  2JJK A;  3Q29 A;  2DXR A;  3D4C A;  1Q9D A;  3PMV A;  4G4P A;  2R9J A;  1M5D A;  5AA1 A;  3Q26 A;  4KQP A;  4OVS A;  3MJN A;  1MDQ A;  1Y3N A;  3MPL A;  4YKP A;  4JVD A;  3IO4 A;  4H46 A;  4DCY A;  4GWY A;  1H45 A;  4OYV A;  3OEM A;  1EYK A;  1B1X A;  4NHB A;  4P11 A;  4ND9 A;  5EQ9 A;  4ZS9 A;  5DVF A;  1RYO A;  3FVG A;  4IO3 A;  2PFY A;  3VLW A;  2F7A A;  2R6G E;  4H45 A;  1DPE A;  1B9J A;  4HCY A;  1I6B A;  4M4G A;  2G29 A;  4EXL A;  3FVO A;  1B5H A;  2F8D A;  2P3N A;  2RKM A;  2XWK A;  3OMB A;  2GH9 A;  1B7U A;  2Q89 A;  2HXR A;  4AQ4 A;  1XS5 A;  3OSR A;  4ZEF A;  1TT1 A;  3C36 A;  3O28 A;  3G3K A;  4DLD A;  5CRY A;  3A3C A;  1YZ0 A;  1WVJ A;  1NNP A;  2VPN A;  2I48 A;  1S9T A;  3C34 A;  1QGX A;  4DI3 D;  1DOT A;  4GL8 A;  2THI A;  4DE8 A;  3RTF B;  3A3U A;  2I4C A;  4PF6 A;  1NUY A;  2GHA A;  1YYZ A;  2FYI A;  5HM4 B;  3CFX A;  1FTK A;  4F1U A;  3TEL A;  3PUY E;  3IB2 A;  1KA0 A;  2XWI A;  1IXH A;  4JDF A;  1R9L A;  4FIM A;  1B6H A;  1YXI A;  1MQD A;  1UTH B;  1F9B A;  3K1N A;  5I58 B;  2HAU A;  3KN7 A;  4OVT A;  4O8M A;  1YAE A;  1XI6 A;  3PD8 A;  4R75 A;  5L8D A;  5F1Q A;  3VVE A;  2H4I A;  3C4M A;  3LV0 A;  5FHM A;  1MY2 A;  4GX3 A;  5TP9 B;  1B40 A;  1QUL A;  1A8E A;  5ELV A;  3TCG A;  3TTN A;  4MHF A;  1HSL A;  5LOM A;  3BBR A;  3ECR A;  4R73 A;  3SEW A;  2VP1 A;  4F22 A;  1N3W A;  4H1X A;  4NF8 A;  2REG A;  5DTB A;  2NXO A;  3ONM A;  2I6E A;  4JSO A;  2DE2 A;  1D9Y A;  2ZXT A;  2VD3 A;  4XFE A;  1EYJ A;  4NG7 A;  3TAJ A;  1PB8 A;  2HHM A;  2RIN A;  2XD3 A;  3RPL A;  2AYS A;  5I3S A;  4Q5T A;  3TTM A;  2Y7K A;  1FQA A;  4M1V A;  3A29 A;  1XVX A;  3FAT A;  1DMB A;  5ITP A;  3T9X B;  1LB8 A;  3OOA A;  2UVH A;  3MW0 A;  2I49 A;  5AA3 A;  1MH3 A;  1FBE A;  1Y3Q A;  2F35 A;  5H8S A;  4ZDM A;  3FXB A;  2QFL A;  1PB7 A;  4RPO A;  2ZNT A;  2Y7I A;  2DQV A;  1Z7M E;  2ZNS A;  2H98 A;  3MVW A;  1T0K A;  4EXK A;  2UYF A;  2XXP A;  1HSJ A;  1XHY A;  1A40 A;  2NWJ A;  2PX1 A;  4P1L A;  1FW0 A;  1B05 A;  3NOH A;  2B4M A;  1Z7N E;  3K0V A;  4IY6 A;  4C1U A;  5H8Q A;  4R9F A;  2Q8J A;  1UTH A;  3HFU A;  2LAO A;  2H5Y A;  2OZZ A;  1XC1 A;  3SZP A;  3C9H A;  5DVJ A;  5KCJ A;  3G3H A;  3I6V A;  4IO4 A;  1RDX A;  2F6G A;  4LAT A;  4OEU A;  4HW8 A;  1MS7 A;  2VD2 A;  2Z22 A;  3EKI A;  3MVX A;  5B7D A;  4C0R A;  1FPB A;  4JBZ A;  5IKB A;  4HE2 A;  1SBP A;  5L9S A;  4ESW A;  4OXV A;  3R6U A;  5I5P A;  2OX3 A;  3N26 A;  4Q0C A;  1MQG A;  2DVZ A;  3MP1 A;  3E9X A;  4I9D A;  5AE4 A;  2H25 A;  1P99 A;  3IOT A;  2Y7R A;  4FOR A;  3I3V A;  2IA4 A;  3CSB A;  1LAF E;  4GLI A;  4OMB A;  5DT6 A;  1QKA A;  4X04 A;  3OO7 A;  2H99 A;  1ZIU A;  2Z23 A;  3FJ7 A;  1B4H A;  3PUW E;  4PE3 A;  3U94 A;  4PFI A;  4O7I A;  1JVY A;  4IB2 A;  5ESY A;  3VXC A;  1FBD A;  2GRV A;  1SQY A;  2RC9 A;  3VFJ A;  2Z8E A;  2XHD A;  3IJO B;  3LR1 A;  4BDR A;  1VSO A;  4R72 A;  1MDP 1;  3WAF A;  1US5 A;  4MJO A;  4BLA A;  2OCU A;  2XXY A;  3TOD A;  4EUO A;  5I2N B;  4YKJ A;  1FQC A;  2QS4 A;  1IMC A;  3H6U A;  3V5A A;  3RYD A;  4PGP A;  4NWD A;  4G68 C;  1QUI A;  1CNQ A;  1FTO A;  5BWJ A;  2HPG A;  5IZZ A;  1MPB A;  4H8J A;  1EZP A;  1ZLQ A;  4R2B A;  1Y3P A;  1N7W A; 
#chains in the Genus database with same CATH homology
 2NUV A;  1O64 A;  2XXI A;  3O6G A;  3PUZ E;  3RT6 B;  2V93 A;  3P7I A;  4DXB A;  3SER A;  1PEB A;  4P0G A;  2ONK E;  2WKY A;  3K6X A;  1Q1K A;  3OEN A;  1BKA A;  1AIV A;  1CE2 A;  3IB0 A;  3Q28 A;  1FQE A;  1QVS A;  3ILT B;  4G77 A;  1MG1 A;  3WAE A;  1LFI A;  1JNF A;  3A09 A;  1YCJ A;  2HEU A;  4O3C A;  5HBC A;  1BIY A;  2V3Q A;  4ZZE A;  4IGR A;  1ANF A;  3V83 A;  4NF6 A;  3CRB A;  3SEX A;  3TQW A;  4RPN A;  3C33 A;  4L17 A;  1P1O A;  2Q2A A;  5CMB A;  2Z8D A;  1MY1 A;  4E0W A;  1MQJ A;  4X9T A;  2XXU A;  1A7L A;  3FJM A;  1D3K A;  4R6Y A;  2ESN A;  1GR2 A;  1ZTY A;  1EZ9 A;  1A54 A;  2E1S A;  1JEV A;  4GIZ A;  3H6W A;  4IO5 A;  4LUB A;  5FTH A;  3L6G A;  5I56 B;  1US4 A;  1B3E A;  2D3I A;  3KFM A;  3FXU A;  2H9B A;  3UK4 A;  3SEU A;  1MXX A;  1IUD A;  2AIX A;  2OWS A;  2P1S A;  2X7P A;  2QPQ A;  3OSQ A;  4P0I A;  2QJE A;  4NF6 B;  4ZED A;  4G68 B;  4ZE9 A;  5HPQ A;  3HST A;  3K02 A;  1LLS A;  1MXV A;  3G3J A;  3QUJ A;  3W9W A;  4F1Y A;  1MXU A;  4ZE8 A;  5AA2 A;  5I2N A;  1IXG A;  5KDT A;  3CG3 A;  5H8F B;  1PC3 A;  4ELR A;  2PT1 A;  2Q9T A;  3K1M A;  3CI8 A;  3TZA A;  3SEY A;  5L9M A;  2HAV A;  4NE4 A;  3G3F A;  3SDF A;  2NVU B;  3HHF A;  1I6A A;  2YJP A;  3GBB A;  4DXU A;  2O68 A;  1MM6 A;  2ZYK A;  3IOW A;  4YAH X;  4QRZ A;  4MLV A;  2OBG A;  4HS7 A;  1MQH A;  4F39 A;  1N04 A;  2V3T A;  3CFL A;  3JV9 A;  1P1U A;  1SVX B;  1M5F A;  1MPD A;  4QFN A;  2UYE A;  3MQ9 A;  2DWH A;  3PGF A;  3Q25 A;  3CVG A;  1URD A;  5JTY B;  4G8N A;  1B7Z A;  4FED A;  1MPC A;  3CR9 A;  4ELP A;  4H67 A;  4E0X A;  3FXR A;  3FD3 A;  3DP8 A;  3IJX B;  1UIU A;  1UIV A;  2Y7P A;  2OJT A;  2ALU A;  4JWY A;  3RPW A;  1LCF A;  3DLN A;  1NKX A;  3FVK A;  3OXN A;  3K2D A;  1B4Z A;  5IAI A;  3OEL A;  2CMO A;  2X26 A;  4U4S A;  2UVG A;  4PP0 A;  4BDL A;  3S9L C;  4GXS B;  3PUV E;  1A55 A;  1PBQ A;  1M5B A;  3HO7 A;  3EF7 A;  3MAM A;  5CMM A;  2Q2C A;  4KYE A;  2FA7 A;  2XX9 A;  1B5J A;  3BFU A;  4LA9 A;  4MLQ A;  4I62 A;  4XTC Q;  2PYY A;  4ZEK A;  4RK2 A;  2QS3 A;  2YLN A;  2O84 X;  1EH3 A;  3G3I A;  1DPP A;  3Q29 A;  4GF8 A;  4OFO A;  1B32 A;  3MWB A;  3KZG A;  1Y20 A;  2DXR A;  3D4C A;  3PMV A;  3TQL A;  3CIJ A;  3KSX A;  4G4P A;  2UVI A;  2R9J A;  3FUZ A;  4KCC A;  4LON B;  5EYF A;  3H03 A;  5I2K B;  4ELO A;  1M5D A;  5K2Y A;  1LAH E;  3Q26 A;  4KQP A;  5AA1 A;  3UP9 A;  2DWJ A;  2ZNU A;  3MJN A;  1B58 A;  1MDQ A;  4NMY A;  1Y3N A;  2I0B A;  2UVJ A;  3MPL A;  4YKP A;  4GL0 A;  3EN3 A;  3OO6 A;  3ODB A;  3IO4 A;  2REJ A;  4Q30 B;  1MRP A;  4JXI A;  1JEU A;  1ZMG A;  1USY E;  2XXV A;  1RKM A;  4DCY A;  5AA4 B;  2F36 A;  5CI5 A;  1H45 A;  1NNT A;  4OYV A;  4Z0I A;  1NH8 A;  2P0S A;  3K1P A;  4NWC A;  4R9G A;  1DSN A;  4TOZ A;  3UN6 A;  1OLC A;  2I58 A;  3KN8 A;  5CMC A;  3OEM A;  3V8X B;  4ECF A;  5AA2 D;  1J1N A;  2ANJ A;  1B52 A;  1B1X A;  3KSJ A;  4QHQ A;  1P1Q A;  4YU0 A;  3CFZ A;  4P11 A;  4ND9 A;  2D5W A;  2O6A A;  4RK9 A;  3FZV A;  3OO9 A;  4ZS9 A;  5DVF A;  5I57 A;  3FV2 A;  1RYO A;  2I3V A;  2W7Y A;  3FVG A;  3KBR A;  4IO3 A;  4JSD A;  2DVC A;  4FJP A;  4UAC A;  3VLW A;  2DYX A;  2F7A A;  2R6G E;  2ONS A;  1DPE A;  2OWT A;  1B9J A;  4HCY A;  4JWX A;  1I6B A;  3UA8 A;  1EU8 A;  2DP8 A;  4M4G A;  2DWA A;  2E0S A;  3LC8 A;  4H8I A;  2G29 A;  3TYH A;  4EXL A;  2QMW A;  3FVO A;  1B5H A;  1NFT A;  3VLU A;  2F8D A;  4KCD A;  2QS2 A;  2XX7 A;  3T9V A;  2HFB A;  4YIC A;  3ZKL A;  2RKM A;  3IL1 B;  1B5I A;  3B6T A;  2ZYN A;  3OMB A;  2GH9 A;  1B7U A;  2Q89 A;  1I69 A;  2ABH A;  1AMF A;  3N5L A;  4F19 A;  3HHG A;  4AQ4 A;  1SDX A;  1XS5 A;  3FJG A;  4FAT A;  3OSR A;  5JK4 A;  3K6W A;  4ZEF A;  3UGW A;  1TT1 A;  3H4Z A;  4C1T A;  1UTB A;  3C36 A;  2D21 A;  3O28 A;  3G3K A;  5H8N A;  2BJJ X;  4DLD A;  3IR1 A;  5CRY A;  3A3C A;  1WVJ A;  2O1L A;  1NNP A;  2Q88 A;  3M3L A;  3PV0 E;  3KEI A;  5AA4 A;  2XX8 A;  3MUQ A;  3H6V A;  3DEL B;  5FHO A;  2I48 A;  4KD5 A;  1PBP A;  3MPK A;  2DE4 A;  3S4U A;  4PFW A;  4U1Z A;  3V89 B;  1BP5 A;  1Y4T A;  4ISU A;  4NF4 A;  1B51 A;  2RCA A;  1AH5 A;  1NH7 A;  5I59 B;  1AOV A;  4OEN A;  4F3B A;  2VHA A;  1PDA A;  4PQJ A;  1S9T A;  3C34 A;  3FIR A;  1DOT A;  1B0L A;  2QL3 A;  4GL8 A;  1OVT A;  2THI A;  3T66 A;  4DE8 A;  2QS1 A;  1VR5 A;  3HPI A;  3H6T A;  3RTF B;  3MVZ A;  3QUF A;  3A3U A;  2I4C A;  4QSC A;  5CM6 A;  4O3A A;  3QYT A;  3U1O A;  3VDF A;  1B46 A;  4X1B A;  1GTK A;  4H65 A;  3ZS6 A;  2F78 A;  4F3G A;  2GHA A;  1DTG A;  2FYI A;  3AXF A;  5HM4 B;  3CFX A;  3JZJ A;  1FTK A;  1P1W A;  4MH5 A;  4QFK A;  3PUY E;  3TEL A;  4ESX A;  4F1U A;  1D9V A;  1JET A;  2PT2 A;  3IB2 A;  3KG2 A;  4G2Z A;  4QSD A;  5DEX A;  1IXH A;  1SW2 A;  3I5O A;  1R9L A;  3OO8 A;  4JDF A;  3B6Q A;  4IY5 A;  4R6K A;  1B3H A;  1UTB B;  4FIM A;  3MP8 A;  1B6H A;  2O1M A;  2F6P A;  2Y84 A;  2PVU A;  3HV1 A;  4GOT A;  3T9H B;  1MQD A;  1F9B A;  1UTH B;  1TWY A;  2AL5 A;  5H8H B;  4ZEB A;  1FTL A;  4KYD A;  3K1N A;  5I58 B;  1FCK A;  2HAU A;  4YZZ A;  3KN7 A;  3O9P A;  1OLA A;  3RTW B;  4H5F A;  3UIF A;  2ZYM A;  5J1D A;  3S9N C;  3IO6 A;  3B6W A;  3IOR A;  2ONR A;  3O29 A;  3LSF B;  5JTY A;  1YAE A;  4OVJ A;  3PD8 A;  2XXR A;  3MZB A;  4R75 A;  5L8D A;  4U22 A;  4KFQ A;  1URG A;  5F1Q A;  1XVY A;  2F5X A;  2RCB A;  4XIG Q;  1IZ1 A;  1LB9 A;  4HTG A;  3VVE A;  3TCF A;  4QF9 A;  3SET A;  1S7Y A;  2H4I A;  1YPN A;  3C4M A;  4KPT A;  5FHM A;  4EQB A;  4KI0 E;  5I59 A;  1MY2 A;  1JW1 A;  2DOJ A;  3VVD A;  5A5X B;  3C31 A;  2M8C A;  3KOS A;  5DYH A;  5TP9 B;  1B40 A;  3RN8 A;  1QUL A;  4XKR A;  1A8E A;  4H6D A;  4TLM B;  4JB7 A;  4ONY A;  2HZL A;  5ELV A;  1LST A;  1POT A;  2F7B A;  5EHM A;  4F3P A;  3RLF E;  4ELQ A;  4X48 A;  3TTN A;  1MY0 A;  4R74 A;  4FEC A;  5DEX B;  1NNF A;  4QFP A;  1HSL A;  1QUJ A;  1R6Z A;  3QK6 A;  4G8H A;  4AB5 A;  3S9M C;  5TPA B;  3G3G A;  4LQ2 A;  3U92 A;  4ZEC A;  3T96 B;  4FAJ A;  2CZL A;  1MQI A;  4FE8 A;  3GZG A;  1DTZ A;  1MM7 A;  3BBR A;  1SW5 A;  2F97 A;  3ECR A;  4PFU A;  4R73 A;  4RA1 A;  4XKN A;  3SEW A;  4BDN A;  4XKQ A;  4GXA A;  4RYA A;  1N3X A;  2VP1 A;  3RUM A;  4F22 A;  1FTJ A;  1M5E A;  4RNS A;  4WKM A;  1N3W A;  4Q8R A;  2HCA A;  3KJT A;  2XXW A;  4H1X A;  3F11 A;  2QRY A;  4YB5 A;  4NF8 A;  2I3W A;  2REG A;  2RC8 A;  5DTB A;  2NXO A;  4DCX A;  2GFE A;  1ELJ A;  3ONM A;  3O6I A;  1LBB A;  2I6E A;  5CBS A;  4JSO A;  1WOD A;  4PET A;  4OFL A;  2DE2 A;  1D9Y A;  3PPR A;  2XXH A;  5CBR A;  3M3K A;  1IXI A;  1B3L A;  4K3F A;  4NTL A;  2XD2 A;  1USY H;  3Q27 A;  3TTL A;  4DDD A;  2ZXT A;  4OQO A;  4UA8 A;  4F3S A;  2VD3 A;  5LOM A;  3U8Q A;  1HSE A;  3C35 A;  4NF8 B;  4DXC A;  2FNC A;  2R71 A;  1B3G A;  5A5X A;  3TAJ A;  1PB8 A;  5H8F A;  3G7W A;  1JW4 A;  5JEI A;  4YB6 A;  2RIN A;  3IAZ A;  3MVY A;  1I6Q A;  2XD3 A;  2AYS A;  4NF5 B;  2F34 A;  4H0W A;  1EZO A;  4Q5T A;  4BDM A;  3W9V A;  4KR5 A;  1SI1 A;  3TTM A;  1VFD A;  2Y7K A;  5FHN A;  4TLL B;  3SES A;  3QAX A;  1B7H A;  1FQA A;  1GVC A;  3MZ1 A;  1FQF A;  1PB9 A;  3S9E A;  5AA2 B;  4M1V A;  1MXY A;  1UQW A;  3TMG A;  3MZ9 A;  3EHU A;  1XVX A;  2V25 A;  2B3B A;  1LCT A;  2DS9 A;  3M8U A;  3FAT A;  3FGS A;  1OVB A;  3PUX E;  4GQO A;  2OK2 A;  4R2F A;  1D4N A;  2O69 A;  4WEP A;  1VFE A;  1WDN A;  1DMB A;  1P1N A;  4ZEI A;  3RNN A;  3ZKK A;  5ITP A;  3PPQ A;  1M5C A;  4XXU A;  1LB8 A;  1MY3 A;  1IIW A;  2UVH A;  3OOA A;  2XXX A;  3T9X B;  3TFL A;  4IO7 A;  1FQB A;  4OFJ A;  4YKK A;  5TPA A;  1OQH A;  2RF1 A;  3BKI B;  3MW0 A;  4EF2 A;  1POY 1;  1GV8 A;  2I49 A;  1FTM A;  5AA3 A;  1B3F A;  1B1H A;  2O7U A;  1N7X A;  1MH3 A;  2I4B A;  2QMX A;  4U2R A;  3LSW A;  3DP6 A;  1Y3Q A;  2F35 A;  5H8S A;  2VOZ A;  2B65 A;  1VE4 A;  3FAS A;  3TTR A;  1MXZ A;  3KGC A;  1QUK A;  1OIB A;  5H8N B;  4ZDM A;  5I84 A;  5CMK A;  4N07 A;  4OES A;  4IGT A;  2KLF A;  1PB7 A;  1LAX A;  3LSX A;  1B0H A;  5EHS A;  3TTK A;  3OD7 A;  4RPO A;  3U93 A;  2Y7W A;  1MY4 A;  4KHZ E;  4WXJ A;  3SKP A;  2ZNT A;  2V3U A;  1TXF A;  2Y7I A;  4U1O A;  5H8Q B;  2DQV A;  4H5G A;  4NF5 A;  1ZJL A;  4OEV A;  1SI0 A;  1Z7M E;  3K4U A;  3EHS A;  2ZNS A;  1JW5 A;  2H98 A;  1L5T A;  1JQF A;  5TU0 A;  3MVW A;  4THI A;  1T0K A;  4EXK A;  1H76 A;  1ZKB A;  3PMW A;  2UYF A;  2XXP A;  1HSJ A;  1XHY A;  5H8H A;  1A40 A;  1NL5 A;  4OET A;  3R26 A;  2NWJ A;  3VXB A;  4LZ8 A;  1ZU0 A;  2PMS A;  1IQ7 A;  2PX1 A;  3O66 A;  1FW0 A;  1B05 A;  1IIT A;  3L6H A;  1URS A;  4LP2 B;  2HQ0 A;  3E4R A;  1Z7N E;  3PPO A;  1LAG E;  3K0V A;  3K6U A;  4YMA A;  4U21 A;  1H44 A;  3T22 A;  4IY6 A;  4C1U A;  3HN0 A;  5H8Q A;  4R9F A;  2Z8F A;  4EQ9 A;  2F7C A;  1NMU A;  2X7Q A;  1LFH A;  3GXA A;  1QKB A;  4FEB A;  5BUU A;  1Y4C A;  2Q8J A;  1UTH A;  5DVI A;  2LAO A;  1BLF A;  1SYI A;  3RY3 A;  4F29 A;  2H5Y A;  2OLB A;  1R1N A;  2OZZ A;  3DM0 A;  1XC1 A;  3PU5 A;  3LUY A;  4I1D A;  1LBC A;  3C9H A;  1TFD A;  3KJ7 A;  2VGQ A;  4LQ5 A;  5DVJ A;  4GD5 A;  1H43 A;  3G3H A;  5TP9 A;  4F18 A;  5KCJ A;  3I6V A;  4X1D A;  4IO4 A;  4XKP A;  3OEK A;  4LAT A;  1GGG A;  1O7T A;  2F6G A;  4DZ1 A;  4OEU A;  3EQ1 A;  4EQ7 A;  1JVX A;  4OER A;  1MS7 A;  3KN3 A;  4HW8 A;  2VD2 A;  3KOT A;  2Z22 A;  4NED A;  3RGY A;  3RQT A;  2YPN A;  4OWD A;  3MVX A;  3FV1 A;  5ITO A;  5B7D A;  3MC2 A;  1MXW A;  4C0R A;  1Y1Z A;  4JBZ A;  1A99 A;  4O3B A;  3PD9 A;  5IKB A;  1OQG A;  1N0T A;  1SBP A;  3IB1 A;  1Y9U A;  4POX A;  5L9S A;  1AL3 A;  3MP6 A;  3VVF A;  4OXV A;  4ESW A;  2DWI A;  3CSG A;  3N6T A;  3R6U A;  3TCH A;  4MBP A;  3IK6 B;  5ICQ A;  1QJM A;  1S50 A;  3C32 A;  3M3F A;  3QXM A;  4F2Q A;  4YB7 A;  2O51 A;  3N26 A;  4Q0C A;  1B2H A;  4N6P A;  2ZMB A;  1MQG A;  2AL4 A;  4RJZ A;  2DVZ A;  5CC2 A;  2UXA A;  3MP1 A;  3E9X A;  4I9D A;  4TQU Q;  5AE4 A;  3PMX A;  2IEE A;  2H25 A;  3SEV A;  4KYS A;  4MFI A;  3T9U A;  1P99 A;  2NOO A;  3O2A A;  3FVN A;  2GHB A;  4N13 A;  3W15 C;  1ZBM A;  3IOT A;  3IX1 A;  3VE1 B;  1H3D A;  2HZK A;  2Y7R A;  1QW0 A;  2I0C A;  3H3G A;  3R7X A;  4FOR A;  3I3V A;  2IA4 A;  2XXQ A;  3BFT A;  2A5T A;  3ILU B;  3H7M A;  4HCW A;  3CSB A;  4F1V A;  5K2X A;  3THI A;  4OTE A;  1CB6 A;  1LAF E;  2PBW A;  4GLI A;  1II5 A;  4GVO A;  4OMB A;  5B70 A;  3TDJ A;  5KCJ B;  4GFR A;  3B7D A;  5DT6 A;  1QKA A;  3K01 A;  1FQD A;  1SW1 A;  3H06 B;  3OO7 A;  2H99 A;  1ZIU A;  2Z23 A;  3FJ7 A;  4NF4 B;  1B4H A;  2DE3 A;  4G8M A;  3PPP A;  4IO2 A;  5KZT A;  4LZ7 A;  5L9O A;  4PE5 B;  4RXL A;  3PUW E;  3D4G A;  3U94 A;  1NNK A;  3EHT A;  3E13 X;  2XXT A;  4F31 B;  5M2V A;  4YKI A;  3K6V A;  4LZ5 A;  1RYX A;  1XT8 A;  2P2A A;  3O97 A;  4POW A;  4R6H A;  3TKD A;  2ZYO A;  4EDP A;  3N6U A;  1JVY A;  4IB2 A;  3VXC A;  4Z7E A;  5I58 A;  2GRV A;  1MH4 A;  2RC7 A;  1SQY A;  1N76 A;  3VV5 A;  4F2O A;  4IO6 A;  2RC9 A;  4LVQ A;  1IXC A;  1A8F A;  3VFJ A;  4RY1 A;  1TFA A;  3GBA A;  2Z8E A;  3PPN A;  4QFO A;  1N84 A;  2XHD A;  3IJO B;  4WED A;  3CG1 A;  3DP4 A;  3LSL A;  5I56 A;  3LR1 A;  2B3F A;  4BDR A;  3U72 A;  1SD3 A;  2A5S A;  3QSL A;  1VSO A;  3ZSF A;  2A5T B;  4OHN A;  3O6H A;  2V84 A;  4R72 A;  1MDP 1;  3TPA A;  3WAF A;  4BDQ A;  4YMB A;  5I2K A;  4G68 A;  1BTJ A;  1US5 A;  3TCG A;  3FXQ A;  3GLB A;  4BLA A;  2OCU A;  2XXY A;  4U4X A;  3TOD A;  3S2V A;  1R9Q A;  4YKJ A;  4EUO A;  5I2N B;  5KDT B;  4U23 A;  3HCQ A;  1FQC A;  2QS4 A;  5F7V A;  1SW4 A;  3EPE A;  3H6U A;  1LFG A;  4GWO A;  3RT8 A;  3UOR A;  3E3K A;  3V5A A;  4BDO A;  2DSF A;  4NWD A;  1Q35 A;  4G68 C;  3TUS A;  3MBP A;  4DIG A;  1QUI A;  2G93 A;  2HXW A;  4MF3 A;  3T93 B;  3K00 A;  3QIM A;  4PFT A;  5ISU A;  1IEJ A;  1OMP A;  5I57 B;  4GRK A;  3IOV A;  1FTO A;  5FTI A;  2DXY A;  4PFY A;  4OZ9 A;  4QFL A;  4EF1 A;  3USD A;  4QSE A;  5BWJ A;  1O63 A;  1KWH A;  3IOU A;  3LBS A;  3JYR A;  1MPB A;  4H8J A;  1EZP A;  1ATG A;  1ZLQ A;  5ICT A;  1Y1M A;  1LGB C;  4R2B A;  1SYH A;  2O7I A;  2QSX A;  1Y3P A;  1YTV A;  3N94 A;  4JWO A;  3VLV A;  1N7W A;  4AB6 A;  4ZZA A;  1XOC A;  3TEP A;  4I8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...