1OIBA

Phosphate-binding protein mutant t141d
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGDSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphate transport
molecule keywords PHOSPHATE-BINDING PROTEIN
total genus 105
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oibA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1oibA02
2OWSA 3ONMA 3FVKA 1ANFA 1LBCA 1RKMA 1NNTA 3K01A 5I84A 4QFPA 1B7ZA 1GGGA 1NFTA 1Q35A 2Z8DA 1L5TA 2DS9A 3I5OA 4KCCA 2DOJA 2UVJA 3OO7A 3TTMA 4QFNA 4DXBA 3LR1A 5CMBA 4F3GA 5I56B 1S9TA 2DVZA 2QS3A 2I3VA 2YLNA 5TP9A 4F22A 3QIMA 1AIVA 1DPEA 5ITPA 1WDNA 1USYH 3HO7A 3MP6A 4L17A 1A55A 3RT6B 4U23A 3O66A 4XXUA 1A8EA 1MM6A 1J1NA 2M8CA 3C32A 3H03A 3B6QA 1US4A 3FATA 3K6WA 4ZEIA 4EQ7A 3OO8A 4H5FA 3Q26A 3A09A 1MG1A 1PC3A 4R74A 5TPAA 3U94A 1JW4A 1MXYA 1QJMA 3AXFA 3HSTA 1D9VA 1XHYA 3LSWA 5KCJA 1NKXA 4FAJA 1EZPA 3W9VA 2I48A 3CI8A 4FE8A 4ND9A 3TQWA 4R6KA 4P11A 1MPBA 5DYHA 3S2VA 3UORA 4H65A 3JYRA 1D3KA 4KPTA 4NF5B 3RY3A 4FATA 4QRZA 1MY2A 2ZYKA 2ONKE 1TFDA 3TYHA 5H8HA 3K2DA 5I2NA 4U22A 4JBZA 4LZ7A 2Y7IA 4JWYA 4POXA 4XTCQ 3RLFE 3T66A 1JVXA 1B52A 3MJNA 3Q28A 1B40A 1BIYA 1SI0A 3TMGA 2A5SA 3KSXA 4O3AA 1MXUA 4EXLA 5CBSA 2VD2A 4WEDA 3C9HA 4H5GA 1FW0A 5ICTA 4HS7A 3H06B 4KI0E 1JW1A 1B3HA 2LAOA 1ZLQA 3UP9A 3USDA 4ESWA 1B3FA 4RK2A 4H0WA 5K2YA 2XX7A 4XIGQ 1UIUA 1SQYA 1B3LA 2W7YA 5KDTB 1ZIUA 3FV2A 1LCFA 3MAMA 3QAXA 3FJGA 2F7BA 3FXRA 1M5EA 2ZYNA 3MVWA 3A3CA 4JWXA 3TTLA 3SETA 4C0RA 3DELB 1Y1ZA 4N6PA 1LFIA 3Q29A 5HBCA 5CRYA 3EQ1A 5CMKA 2OLBA 3RT8A 4ELPA 3IO4A 4IO2A 1B7HA 1NH7A 1N0TA 2OCUA 1H43A 4OETA 3SDFA 3R7XA 3GXAA 3PPPA 4BDRA 2OK2A 1S50A 2I0CA 4MLQA 4QSCA 4ISUA 2O7IA 2E0SA 1FTKA 4DXCA 2O1MA 5TU0A 1LCTA 5EHSA 1MDQA 4KD5A 1SW4A 3V5AA 3G3JA 3F11A 4TOZA 2GFEA 3CSBA 3VXCA 2XXHA 2QSXA 4IY6A 1ELJA 1DTGA 2X7PA 1B3GA 3FV1A 1N76A 4O3CA 1F9BA 4X1BA 3SEUA 5AA3A 4TLMB 1QKAA 4U2RA 2UYFA 1O64A 2AL5A 2ZNSA 2O51A 1IZ1A 4KYSA 3K1PA 2B3FA 1BLFA 4I62A 2NWJA 3RPWA 3U92A 1QW0A 4I1DA 4R9GA 4XKNA 1UQWA 3TELA 5BWJA 3BFUA 1QKBA 4BDMA 4DXUA 4QSDA 3VFJA 2XD3A 3OO6A 3IO6A 1DTZA 3WAEA 4NMYA 4BDOA 1MY4A 1M5BA 3H4ZA 3N94A 3QXMA 2V93A 4C1TA 4F3PA 3VXBA 5AE4A 4YU0A 4GWOA 4LA9A 2HEUA 3T9XB 4IGTA 2A5TA 3GLBA 1T0KA 2KLFA 3KN7A 2XXIA 3S9LC 3KN3A 4OMBA 3O6HA 1AL3A 3PUXE 5I58A 1P1UA 2AL4A 1SDXA 3I6VA 3K1NA 2ONRA 3GBBA 3OEKA 1I69A 2ONSA 2XXXA 4RJZA 2RCBA 3VDFA 3CR9A 3V89B 3PMVA 1ZBMA 2DQVA 2PBWA 3V8XB 4PQJA 4FJPA 1MM7A 4UACA 1O63A 1B7UA 3N5LA 5DVJA 3MPKA 3EHUA 3K02A 2QPQA 4F2QA 3U1OA 1VE4A 2RKMA 2YPNA 1AOVA 4G4PA 4XKRA 1IXGA 3RTWB 3TCHA 4OFOA 4H8JA 1RYXA 2XXPA 2O69A 3DM0A 2Q2CA 4RPNA 4OFLA 4UA8A 1A8FA 2ANJA 3TCFA 3DP4A 4OQOA 4HW8A 3CVGA 2BJJX 3LSXA 5K2XA 5BUUA 1B2HA 2F7AA 4YB7A 1LFHA 5ITOA 1H45A 1Y1MA 1JVYA 2VHAA 3FJMA 2P2AA 1QUKA 1Y20A 3D4GA 3IK6B 4GRKA 4HTGA 5AA4A 1B5JA 1LSTA 2AYSA 2F78A 1B1XA 1LAGE 3FIRA 5FTIA 3UN6A 1IIWA 3S9MC 3VVEA 2O1LA 5L9SA 4PFTA 2H99A 1MRPA 2ABHA 3IB0A 1SVXB 1SW5A 3U93A 1URDA 3EHTA 2NOOA 1FTLA 3KBRA 1Q1KA 4NF6B 4EQ9A 4MH5A 5KDTA 4POWA 1PB8A 3ILTB 3MBPA 1IEJA 5H8QB 1MY0A 3U8QA 4H67A 3TTNA 2G29A 3E9XA 3WAFA 3C33A 3SERA 1GVCA 4ELOA 3O6IA 4OEUA 3CFZA 4OTEA 2YJPA 2HFBA 3T9VA 3VVFA 1POTA 2QS1A 4Z0IA 3FD3A 1MPCA 4R75A 1XVXA 3BBRA 1UIVA 2XXUA 1XC1A 3A3UA 4RY1A 4KYDA 1SI1A 3EF7A 1IQ7A 3BFTA 4JWOA 5I57A 2I3WA 1B51A 3O29A 4FIMA 1QUJA 3TKDA 1MQDA 1B05A 2HAVA 4LZ8A 1NNPA 4G68B 5FHNA 3K6VA 4RNSA 1P1QA 2D3IA 1B32A 1TXFA 1LB9A 1Z7ME 2QS4A 4XKPA 5CMCA 4ZS9A 4QHQA 1JEVA 3P7IA 1EU8A 4LZ5A 4ELQA 4LONB 3O9PA 1MH3A 1A7LA 1AMFA 2UXAA 3G3GA 3S9EA 3CG1A 3TCGA 2Z8EA 5F1QA 5H8FB 4EUOA 4EQBA 3Q25A 3R26A 4OFJA 4IO5A 2QMXA 4O3BA 1I6BA 4RA1A 4I9DA 5CMMA 3UIFA 2F35A 2Q89A 3H7MA 3N26A 4H1XA 2XXWA 1FTJA 3ZKKA 5JEIA 4DDDA 4F3SA 4YKIA 4F18A 1Y3NA 3IB2A 4ONYA 2F36A 3PMWA 4F1UA 2H25A 4IO6A 1NNKA 4U4XA 3PV0E 1A54A 1I6AA 4G68C 3TQLA 2HZLA 1US5A 3OXNA 3PPQA 4GOTA 2OWTA 3PGFA 4JDFA 1ZJLA 1IITA 5HPQA 2ESNA 3DP8A 2XHDA 1EH3A 5DEXA 3FXQA 3GZGA 1USYE 2CZLA 2REJA 5H8QA 3TODA 1P1NA 2UYEA 4QFOA 2OBGA 1B6HA 3FGSA 5JTYB 2RINA 2R6GE 5L8DA 2HCAA 1EZOA 1VFDA 2X26A 2XXTA 5JTYA 3MVZA 2F7CA 4YKPA 2NUVA 2ZNUA 5H8SA 3PUWE 1WVJA 3KG2A 3TUSA 3QUJA 4MFIA 4YMAA 3PD9A 2QMWA 4DIGA 4Z7EA 1AH5A 4PETA 4KR5A 5L9MA 2RC8A 3SKPA 3T96B 2QS2A 4N13A 2O68A 4Q30B 1FQDA 3CFLA 4EF1A 2I49A 1A99A 1I6QA 1CB6A 2DE3A 3EPEA 3TPAA 2Y84A 4JB7A 3L6HA 1B0HA 1LB8A 1JETA 5KCJB 3N6UA 3KGCA 2F6PA 2I4CA 3E4RA 2DWHA 2R71A 4G8MA 2Y7WA 4GXSB 1YPNA 2OZZA 2VOZA 3G7WA 3MVXA 3MZ9A 4GQOA 4OENA 5ELVA 1ZKBA 2HXWA 2VP1A 4KQPA 3ZSFA 1DOTA 3MP8A 1S7YA 3D4CA 4NTLA 4MBPA 1N3WA 4OVJA 1QVSA 3K0VA 2F97A 4LVQA 1M5DA 3FASA 1SW2A 4YKJA 2I4BA 1MQGA 2NXOA 4LATA 1MH4A 4GIZA 2PX1A 2XX8A 4R2BA 1PEBA 1SW1A 3ILUB 5TP9B 4PP0A 1LAFE 3JZJA 3OO9A 2ZXTA 1R6ZA 2THIA 4X48A 4U1ZA 5A5XB 2A5TB 3MPLA 4YB5A 1ATGA 5M2VA 1TT1A 2PVUA 1PDAA 4LUBA 1N04A 3FZVA 4OERA 3VLWA 1M5CA 5KZTA 3KOTA 4G77A 3KSJA 1FQBA 1PBPA 1VFEA 4ZZAA 5HM4B 1MPDA 3S9NC 5JK4A 2DWIA 3TDJA 1MQHA 1ZTYA 3U72A 1QUIA 1Y3PA 2F5XA 2IA4A 5EYFA 4JXIA 1JNFA 1H76A 1N3XA 2DE2A 2I6EA 2Z8FA 2ZYMA 1R9QA 1P99A 3OENA 4PFUA 3M8UA 4R9FA 4MLVA 1BP5A 4ECFA 5CC2A 1MY1A 3T93B 1D9YA 4M1VA 3IL1B 1MXZA 4KYEA 1OIBA 3LBSA 4FECA 4NF6A 5I56A 1TFAA 5B70A 2GHAA 2IEEA 3HN0A 4M4GA 3PUYE 2DWJA 1Z7NE 3OSQA 4QSEA 3M3FA 4TQUQ 2F8DA 5CI5A 1H44A 3V83A 4THIA 1YAEA 1OVTA 3H6WA 4ZEFA 2GRVA 3GBAA 1H3DA 1XT8A 4E0WA 2G93A 3TEPA 4E0XA 4ZECA 1JW5A 3L6GA 3Q27A 4MF3A 3SESA 5I2KA 5IAIA 5AA4B 3RUMA 5FHMA 2PT2A 4NE4A 4ZDMA 3FVGA 4H8IA 1SYIA 3LSFB 2RCAA 4YICA 4IGRA 1TWYA 3TTKA 1LFGA 3K00A 4FEBA 1MQIA 1Y4CA 3IJXB 3MQ9A 4JSDA 1Y3QA 2DSFA 1LAHE 4FEDA 3HHGA 4PFWA 4DCXA 4GXAA 1OVBA 3QK6A 4R6HA 2FYIA 1BKAA 4OESA 3O2AA 4R72A 2Q8JA 1D4NA 2REGA 3KZGA 3BKIB 4P0IA 4WKMA 3IX1A 3TAJA 5CBRA 4G2ZA 4RYAA 2XD2A 4TLLB 1DSNA 1POY1 2Y7RA 3TTRA 4GL0A 2P0SA 4ESXA 4N07A 3I3VA 3OD7A 4ZEKA 1KWHA 1YCJA 1N7WA 5I59A 2VGQA 5ISUA 1PB9A 2Z23A 2ZNTA 1P1WA 2Y7PA 3DLNA 3PPRA 4NF4B 3RNNA 1VSOA 4AB5A 4OZ9A 2O84X 4RXLA 4BDNA 1M5FA 2ALUA 3KOSA 4NWDA 1HSLA 4IO4A 3THIA 1GV8A 3CFXA 3ECRA 4IB2A 4NF8A 1LLSA 3MC2A 5F7VA 4ZE9A 4NF8B 3K6XA 1NNFA 4FORA 1B46A 4QFKA 1R1NA 2DP8A 3IR1A 3RQTA 5AA2A 1B1HA 1B58A 1P1OA 1IXHA 3IOVA 1XOCA 1SD3A 3G3IA 4R73A 2RC9A 4PFYA 5H8NA 4DZ1A 1FQFA 1PB7A 2QL3A 2Y7KA 2DVCA 3FJ7A 3KN8A 1HSEA 3R6UA 3KJTA 2X7QA 3MWBA 4I8CA 5I59B 3C4MA 4G8NA 1LAXA 2XXRA 3PD8A 3VLUA 2Q9TA 5AA2B 5AA2D 3PU5A 5L9OA 2QRYA 2RC7A 1VR5A 4GD5A 4P0GA 5B7DA 1WODA 3O6GA 4EDPA 2ZMBA 3O97A 1NMUA 2QJEA 2UVGA 1FTMA 3QSLA 4IY5A 1JEUA 2P1SA 3C34A 1IXIA 3OMBA 3LUYA 3UA8A 3SEWA 4GLIA 3TZAA 4DE8A 3FUZA 1EZ9A 4GFRA 2Q88A 3M3KA 2PT1A 1URSA 5H8FA 3T9UA 2V25A 1MXXA 4BDLA 2V3QA 2XXQA 3SEXA 3HPIA 2FNCA 1B4ZA 1UTHA 3K4UA 1SBPA 2RF1A 4K3FA 4ZEDA 4OWDA 1B4HA 3MZ1A 2DWAA 1MY3A 3QYTA 4DCYA 4F19A 1CE2A 3B6TA 1XVYA 3VV5A 3C36A 1UTBB 5FHOA 4KFQA 3TFLA 3PPOA 1MXWA 1YTVA 1ZMGA 3H6TA 3C35A 3IORA 2H5YA 3QUFA 2D5WA 4LQ2A 4GF8A 3DP6A 4NF4A 2NVUB 3UGWA 4BLAA 1A40A 1LBBA 4YAHX 4C1UA 4X1DA 4U4SA 1OMPA 4OXVA 3S4UA 1R9LA 4R6YA 3T22A 3VLVA 4YKKA 4KCDA 5DT6A 2XXYA 2V84A 3IJOB 5EHMA 2AIXA 4YMBA 1ZU0A 3KJ7A 1MS7A 3K6UA 3PUVE 2HZKA 2R9JA 4NF5A 5IKBA 3IOTA 4LP2B 2O6AA 4U1OA 3MP1A 1B0LA 4R2FA 3FXUA 1UTHB 1JQFA 2F6GA 2HAUA 3C31A 4OYVA 5FTHA 5A5XA 3MUQA 2UVIA 3H6VA 4ZE8A 5I2KB 4HCYA 3HV1A 4PE5B 3IAZA 4RPOA 3OEMA 3IB1A 5AA1A 4F3BA 1BTJA 5TPAB 5DVFA 1OQGA 3B7DA 3SEYA 4OEVA 3VE1B 3EHSA 4ZZEA 5I57B 2XXVA 1FQAA 2UVHA 1Y9UA 1XS5A 4F29A 5CM6A 3O28A 3LC8A 2V3UA 3ODBA 3MW0A 1MXVA 1OQHA 4Q8RA 3UK4A 1B5HA 2O7UA 5ICQA 3IOWA 1IUDA 1MDP1 3CSGA 3OELA 1B3EA 2PMSA 3B6WA 2DXRA 3HHFA 4XKQA 2F34A 2WKYA 4Q0CA 4EF2A 3E3KA 3PPNA 4YB6A 4F31B 5DTBA 2H4IA 3EN3A 3JV9A 3E13X 4GVOA 4IO7A 5H8NB 1NL5A 3OSRA 3H6UA 2CMOA 1MQJA 1UTBA 2FA7A 3CG3A 3M3LA 3G3FA 1FCKA 4X9TA 2D21A 4G8HA 1DMBA 1B9JA 1LGBC 1OLCA 1FQCA 3K1MA 4OHNA 1FTOA 1SYHA 4Q5TA 4RK9A 4YZZA 3T9HB 1N84A 2ZYOA 1FQEA 1GTKA 4NWCA 4F2OA 3KFMA 4QF9A 4HCWA 4H6DA 3W9WA 1IXCA 2Q2AA 3N6TA 3G3HA 5DEXB 3H3GA 4BDQA 2H98A 3FVNA 2GH9A 2H9BA 2DXYA 3RGYA 4G68A 4JSOA 2B3BA 3PMXA 3HCQA 3PUZE 4WEPA 5DVIA 1NH8A 3CIJA 2I0BA 4IO3A 5J1DA 4U21A 1RYOA 3LSLA 2V3TA 4NEDA 1Y4TA 2GHBA 4WXJA 4ELRA 1N7XA 1OLAA 3MVYA 1GR2A 3SEVA 5H8HB 3CRBA 3IOUA 2DYXA 1B5IA 4QFLA 4F39A 3ZS6A 5I2NB 2OJTA 3ZKLA 4KHZE 2E1SA 2B65A 1O7TA 1URGA 1PBQA 3RN8A 4AQ4A 5I58B 2XX9A 2DE4A 3W15C 3MZBA 4DLDA 4EXKA 1QULA 3FVOA 4GL8A 2PYYA 4LQ5A 3VVDA 4F1YA 1DPPA 1II5A 2VD3A 5LOMA 3KEIA 1HSJA 4F1VA 4AB6A 2I58A 3G3KA 4ZEBA 3OOAA 2Z22A 3RTFB 2HQ0A
chains in the Genus database with same CATH superfamily
2OWSA 1RKMA 5A5LA 1L5TA 4I3YA 3TTMA 4F3GA 4QFNA 3QIMA 4P9KA 4GX4A 3MP6A 4U23A 4XXUA 1A8EA 1J1NA 3FATA 3K6WA 3OO8A 3A09A 4R74A 5LTCA 2QVVA 2I48A 3TQWA 4P11A 5DYHA 3JYRA 4KPTA 4NF5B 3RY3A 1MY2A 1TFDA 3TYHA 3K2DA 3RLFE 3MJNA 1BIYA 1SI0A 4EXLA 1LBYA 3C9HA 1JW1A 4RK2A 2XX7A 2W7YA 3FV2A 3MAMA 3A3CA 3SETA 1LFIA 5CRYA 3RT8A 1N0TA 1H43A 4OETA 1FBGA 3SDFA 3GXAA 3FXBA 2O1MA 5EHSA 4KD5A 1RDZA 2R8TA 1SW4A 4QBAA 3F11A 3NOHA 2AL5A 3RPWA 4I1DA 4P8BA 4R9GA 4XKNA 5BWJA 1QKBA 4QSDA 3VFJA 3OO6A 3H4ZA 5AE4A 4LA9A 2HEUA 2A5TA 3RPLA 2XXIA 5EYGA 1P1UA 2AL4A 3GBBA 3VDFA 3PMVA 2DQVA 2PBWA 4FJPA 1O63A 4PE3A 1B7UA 5DVJA 3MPKA 3K02A 1VE4A 2RKMA 4H8JA 4RPNA 2O69A 3TCFA 4OQOA 2BJJX 1B2HA 5ITOA 2P2AA 3IK6B 3FBPA 4GRKA 4HTGA 1B5JA 3FIRA 1EYIA 2H99A 3IB0A 3EHTA 1FTLA 1Q1KA 1QGXA 4NF6B 4EQ9A 2V4CA 1BK4A 3ILTB 5H8QB 3U8QA 2G29A 1NV2A 1GVCA 1NV4A 5DW8A 4MNCA 4OTEA 2YJPA 3VVFA 2QS1A 1XC1A 3A3UA 4RY1A 1SI1A 3EF7A 3BFTA 3TKDA 2HAVA 4G68B 3K6VA 1NUYA 1LB9A 2QS4A 4XKPA 3P7IA 1MH3A 2UXAA 4H45A 5F1QA 4EQBA 3R26A 4GWSA 4RA1A 3UIFA 2F35A 2Q89A 3H7MA 3N26A 1FTJA 4YKIA 4F1UA 2F36A 3PMWA 4DI4B 2HZLA 1US5A 3PPQA 4GOTA 1EH3A 5DEXA 3FXQA 2WEFA 2OBGA 2RINA 1VFDA 2X26A 4YKPA 4PETA 4KR5A 3SKPA 4Q30B 1FQDA 1I6QA 1B0HA 4G8MA 4KFQA 2R71A 3G7WA 4P3LA 2HXWA 2XWIA 1S7YA 4OVJA 2VPNA 4MBPA 1M5DA 3FASA 3IFAA 2NXOA 2XX8A 4R2BA 3ILUB 1LAFE 3JZJA 3OO9A 1YZ0A 1LEVA 2THIA 1NV6A 1PDAA 1N04A 3VLWA 3KOTA 3S9NC 5HM4B 1PBPA 1MQHA 5IZZA 3U72A 1JNFA 1N3XA 2DE2A 1R9QA 4MLVA 4ECFA 3IL1B 1OIBA 4NF6A 1TFAA 2GHAA 2IEEA 3HN0A 3PUYE 3H6WA 4ZEFA 4E0WA 1H3DA 1XT8A 4E0XA 1JW5A 3Q27A 5IAIA 1SYIA 2ZZVA 3LSFB 2RCAA 1TWYA 2XXKA 1LFGA 3K00A 1MQIA 1Y3QA 3QK6A 2FYIA 4PF6A 1D4NA 2REGA 4GL0A 3I3VA 4ZEKA 1NI9A 5I59A 4MEVA 3DLNA 2ZNTA 4NF4B 4OZ9A 4PAFA 4BDNA 1M5FA 1GV8A 3ECRA 4IB2A 4QFKA 1NNFA 1B58A 3IOVA 4I40A 1SD3A 5H8NA 4DZ1A 1FQFA 2QL3A 2Y7KA 5I59B 3C4MA 2WX9A 1IMEA 3VLUA 2Q9TA 3PU5A 4P0GA 5B7DA 1WODA 2KQZA 5I3SA 3O97A 2UVGA 3C34A 2Q88A 3T9UA 1FBFA 1FBEA 3SEXA 3HPIA 1SBPA 2RF1A 1B4HA 3T1BA 1MY3A 3QYTA 1DCUA 1CE2A 1FPKA 3B6TA 3VV5A 3C36A 1UTBB 5FHOA 1ZMGA 3C35A 2H5YA 1A40A 4YAHX 4C1UA 4U4SA 1OMPA 4OXVA 3S4UA 1R9LA 4YKKA 3IJOB 3KJ7A 3IOTA 3A29A 3FXUA 2F6GA 2HAUA 4PGPA 3OEMA 4F3BA 1BTJA 5DVFA 3SEYA 3VE1B 2FIEA 1FQAA 2UVHA 4PAIA 3LC8A 3MW0A 2O7UA 3IOWA 4HE2A 3CSGA 1DBZA 4Q0CA 3E3KA 3PPNA 4YB6A 4F31B 3JV9A 4GX6A 1NL5A 1UTBA 2FA7A 3HFUA 3G3FA 4X9TA 4OANA 2WBBA 1FQCA 3K1MA 3IFCA 1GTKA 4H6DA 4OVTA 3N6TA 1K9ZA 5DEXB 2H98A 4JVIA 2DXYA 3PMXA 4WEPA 1NH8A 3KC1A 2I0BA 2V3TA 4WXJA 4ELRA 3MVYA 4F39A 3CRBA 3IOUA 5I2NB 3ZKLA 1IMFA 2XX9A 3RPLB 4DLDA 4GL8A 2PYYA 4F1YA 5LOMA 4F1VA 2CEXA 4ZEBA 3OOAA 2VPOA 3RTFB 3ONMA 3K01A 1ANFA 5I84A 3I5OA 2DOJA 4DXBA 5CMBA 1S9TA 5ITPA 1USYH 4L17A 1US4A 4H5FA 3U94A 1MG1A 1PC3A 3QMFA 1JW4A 1IMBA 1QJMA 1XHYA 5KCJA 4DI3D 4R6KA 4H65A 4FATA 4UABA 5I2NA 4U22A 4LZ7A 4POXA 4XTCQ 1JVXA 1B52A 4O3AA 2VD2A 3H06B 1ZLQA 3USDA 3MSTA 4ESWA 5K2YA 3FXRA 3DELB 1Y1ZA 3EQ1A 4ELPA 4IO2A 3PPPA 1S50A 2E0SA 1LCTA 1MDQA 2OWZA 3V5AA 3G3JA 3VXCA 2GFEA 3CSBA 4KXPA 2QSXA 3FV1A 4O3CA 3SEUA 2UYFA 4OA4A 2O51A 4KYSA 3T0JA 4PBHA 3K1PA 4FBPA 4MCOA 4DXUA 2XD3A 1MY4A 4X8RA 3N94A 4F3PA 2V93A 4YU0A 4O94A 2KLFA 3KN3A 3PUXE 3K1NA 2ONRA 1I69A 2XXXA 4RJZA 3CR9A 1ZBMA 1FJ9A 3CHGA 1MM7A 3N5LA 4X04A 1AOVA 4G4PA 3TCHA 1IXGA 4OFOA 1RYXA 2XA5A 1NV1A 4OFLA 4UA8A 1A8FA 2WYPA 3DP4A 3LSXA 5BUUA 1H45A 3FJMA 1Y20A 5AA4A 2F78A 3VVEA 5L9SA 4PFTA 1SVXB 1URDA 1FRPA 3KBRA 1NUZA 4H67A 3E9XA 3SERA 2F3BA 4OVQA 4Z0IA 3FD3A 1UIVA 4JWOA 4FIMA 1QUJA 5FHNA 1NNPA 2D3IA 1Z7ME 4ZS9A 1JEVA 4LONB 1AMFA 3S9EA 1AWBA 3G3GA 3TCGA 5H8FB 5ET7A 4IO5A 4O3BA 4MMPA 5JEIA 3KBZA 3U65A 4F18A 4U4XA 4G68C 3TQLA 2OWTA 1IITA 5HPQA 3GZGA 3TODA 4PF8A 1P1NA 4QFOA 1B6HA 2HCAA 2XXTA 3MVZA 3PUWE 3KG2A 4MFIA 1AH5A 4N13A 3CFLA 1CB6A 1JETA 3N6UA 4GXSB 2Y7WA 2OZZA 2VOZA 4OENA 4GX3A 2VP1A 4KQPA 1KZ8A 4YKJA 2F97A 1MQGA 4GIZA 1PEBA 5TP9B 2FIXA 1TT1A 3FZVA 4OERA 4G77A 3KSJA 1VFEA 5EYFA 1QUIA 2IA4A 4JXIA 1NUXA 3OENA 4R9FA 1BP5A 1MXZA 1RDXA 2JJKA 2PFYA 4M4GA 5CI5A 2DWJA 4QSEA 1OVTA 4PCDA 3GBAA 4MF3A 4ZDMA 2ZZXA 4YICA 4ELQA 4FEBA 1LAHE 3HHGA 2Q8JA 4R72A 4PFBA 3BKIB 1NUWA 4G2ZA 4P56A 4TLLB 1DSNA 2Y7RA 2DDKA 4N07A 1N7WA 3LV0A 4O7IA 3PPRA 2Y7PA 3RNNA 4AB5A 2O84X 4LN5A 3KC0A 3THIA 4NWDA 4NF8A 5F7VA 4ZE9A 3K6XA 4FORA 1B46A 2DP8A 4NX1A 1B1HA 3EKIA 4MJOA 2RC9A 3KN8A 3R6UA 3KJTA 4I8CA 1LAXA 3PD8A 5AA2D 3ISPA 4GD5A 1K9YA 3O6GA 1NMUA 4DE8A 2QFLA 1URSA 2V25A 2V3QA 1B4ZA 1UTHA 3MZ1A 4F19A 1YTVA 3H6TA 3QUFA 1LBXA 4LQ2A 4BLAA 4R6YA 2AIXA 3PTYA 2HZKA 2R9JA 4U1OA 3MP1A 1UTHB 1JP4A 4OYVA 5FTHA 4MNPA 1D9QA 2UVIA 5I2KB 4RPOA 1NV0A 3IB1A 2XXVA 1Y9UA 4F29A 5CM6A 5IGAA 1MXVA 3UK4A 4HXVA 1MDP1 2DXRA 3HHFA 4IO7A 3E13X 5H8NB 3OSRA 2CMOA 3M3LA 1FCKA 2F3DA 4G8HA 1LGBC 2Y5LA 1OLCA 4OHNA 4NWCA 4QF9A 3H3GA 4BDQA 4JSOA 3HCQA 4IO3A 4NAPA 1Y4TA 4IR8A 2DYXA 1FPIA 2L5VA 4KHZE 2E1SA 4GWWA 4MHFA 4AQ4A 5I58B 2CZKA 2DE4A 1FTAA 4EXKA 1QULA 4OVSA 3VVDA 1DPPA 2VD3A 3KEIA 1HSJA 4P47A 4AB6A 3G3KA 2Z22A 4PGNA 5IM2A 1B7ZA 1GGGA 1NFTA 4KCCA 4NGUA 2UVJA 5I7IA 2DVZA 2I3VA 1DPEA 3RT6B 1MM6A 2M8CA 3B6QA 4EQ7A 5TPAA 3D1RA 1D9VA 1NKXA 1EZPA 3W9VA 3CI8A 4ND9A 1MPBA 2ZYKA 2CZIA 2ONKE 5H8HA 1FSAA 3T66A 2Y7IA 2BJIA 4JWYA 3ROJA 1B40A 5CBSA 4WEDA 4H5GA 5ICTA 4HS7A 4N17A 2LAOA 4JVDA 4H0WA 4O8MA 1UIUA 4XIGQ 5KDTB 1LCFA 3FJGA 1M5EA 3Q29A 5HBCA 5CMKA 2OLBA 1B7HA 2OCUA 3R7XA 4MLQA 4QSCA 4ISUA 1FTKA 4DXCA 3GYYA 5TU0A 4IY6A 3MYUA 1ELJA 1DTGA 2X7PA 1B3GA 4N6KA 1N76A 5AA3A 4TLMB 1QKAA 3E78A 4U2RA 1O64A 2ZNSA 2B3FA 2NWJA 3U92A 1UQWA 1M5BA 4C1TA 2OX3A 1T0KA 4OMBA 5I58A 3V89B 3EHUA 4OVRA 2YPNA 4XKRA 3RTWB 5EQ9A 2ANJA 2FVZA 3CVGA 2QVRA 2PCRA 4NHBA 4YB7A 1JVYA 2VHAA 1LSTA 1B1XA 1IIWA 1IMCA 1SW5A 2CEYA 3MBPA 1MY0A 2B4LA 3TTNA 3C33A 1FBPA 4OEUA 2HFBA 3T9VA 1POTA 4R75A 1XVXA 2XXUA 4KYDA 5I57A 2I3WA 1B51A 4GBVA 5J16A 1MQDA 4LZ8A 4MIJA 1YXIA 5CMCA 4QHQA 4LZ5A 3O9PA 2Z8EA 4EUOA 3Q25A 2QMXA 4I9DA 5CMMA 4PAKA 4H1XA 2XXWA 3ZKKA 3BIHA 1Y3NA 4ONYA 2H25A 1FJ6A 1NNKA 3PGFA 2XHDA 1FBCA 1USYE 2CZLA 2REJA 5H8QA 5JTYB 3FGSA 2R6GE 1EZOA 4MX6A 2XWOA 2ZZWA 5H8SA 1WVJA 3TUSA 3QUJA 4YMAA 4Z7EA 3PD9A 2QMWA 4DIGA 5L9MA 3T96B 2RC8A 2I49A 2DE3A 2XWKA 2Y84A 2KR0A 3L6HA 1VDWA 3KGCA 2F6PA 2I4CA 2DWHA 4H8IA 4GQOA 5ELVA 1ZKBA 3MP8A 4RXLA 1N3WA 1QVSA 3K0VA 4LVQA 4N81A 2I4BA 1MH4A 2PX1A 5ET8A 1SW1A 2ZXTA 1R6ZA 4X48A 4U1ZA 5A5XB 2A5TB 2WYKA 4YB5A 5M2VA 2QVUA 3B50A 1FQBA 1MPDA 5JK4A 2DWIA 3TDJA 1ZTYA 2PFZA 2VT5A 1H76A 3V8XB 4PFUA 1YYZA 3LBSA 4FECA 1Z7NE 3OSQA 3M3FA 2F8DA 3V83A 2GRVA 3TEPA 1KA0A 3L6GA 3RUMA 2PT2A 4NE4A 4XFEA 4N8GA 4IGRA 1Y4CA 3UGWA 4JSDA 2DSFA 4FEDA 4PFWA 4P0IA 3KZGA 4WKMA 3SZPA 3TAJA 5CBRA 1LBWA 2XD2A 2VGQA 4GBWA 2Z23A 1P1WA 3KOSA 1HSLA 2XWVA 3CFXA 3MC2A 3IR1A 1FPGA 1IXHA 1XOCA 4R73A 3G3IA 4PFYA 1PB7A 2DVCA 2X7QA 4G8NA 5L9OA 2RC7A 4EDPA 2ZMBA 3QSLA 2P1SA 3UA8A 3TZAA 3FUZA 1EZ9A 5H8FA 1EYKA 4BDLA 2XXQA 2FNCA 3K4UA 4ZEDA 1NV7A 2P3NA 1XVYA 3TFLA 1Q9DA 2D5WA 2NVUB 1FPJA 1FPBA 1MS7A 3PUVE 5IZ3A 2O6AA 1B0LA 4NQ8A 4R2FA 2Q74A 1NV3A 3C31A 4G61A 5A5XA 3H6VA 1FPFA 4ZE8A 4PE5B 3IAZA 5AA1A 5TPAB 5I5PA 1OQGA 1INPA 4OEVA 4ZZEA 5I57B 2WBDA 5EQ7A 1OQHA 5ICQA 1IUDA 3OELA 1B3EA 2PMSA 2F34A 2WKYA 3E79A 4EF2A 5DTBA 2H4IA 3EN3A 3H6UA 4N8YA 1DMBA 4PBQA 1B9JA 1SYHA 4RK9A 2FHYA 4OVPA 2GQ1A 3W9WA 1EYJA 5IZ3B 3RGYA 2B4MA 3PUZE 4MAGA 3CIJA 4N91A 4NEDA 1N7XA 3B8BA 1GR2A 1B5IA 5FBPA 2OJTA 2B65A 1URGA 3RN8A 2Y5KA 3MZBA 4LQ5A 2I58A 5JTYA 4QFLA 2HQ0A 3FVKA 1LBCA 1NNTA 4QFPA 1Q35A 2Z8DA 2DS9A 3OO7A 5I56B 3LR1A 5TP9A 2QS3A 2YLNA 1AIVA 1WDNA 3HO7A 1A55A 3O66A 3C32A 3H03A 4ZEIA 4GWYA 3Q26A 1MXYA 3AXFA 3HSTA 4PC9A 3LSWA 4FAJA 4NN3A 4FE8A 3S2VA 2HHMA 2HPGA 3UORA 1D3KA 4QRZA 4JBZA 4F22A 3Q28A 3TMGA 2A5SA 3KSXA 1MXUA 1FW0A 4KI0E 1B3HA 3UP9A 1B3FA 1SQYA 1B3LA 4AS5A 1ZIUA 3QAXA 2F7BA 2ZYNA 3MVWA 4JWXA 3TTLA 4C0RA 4N6PA 3IO4A 1NH7A 4P1LA 4BDRA 2OK2A 2I0CA 2O7IA 1DK4A 1IMAA 4TOZA 4GWXA 2XXHA 4X1BA 1F9BA 1FBHA 1IZ1A 1BLFA 4I62A 1QW0A 4O7MA 3TELA 3BFUA 4BDMA 3IO6A 1DTZA 3WAEA 4JVCA 4NMYA 3QXMA 4BDOA 3VXBA 4GWOA 3T9XB 4IGTA 3GLBA 3KN7A 3S9LC 3O6HA 1AL3A 1SDXA 3I6VA 3OEKA 4PDHA 2ONSA 2RCBA 2MKZA 4PQJA 4F2QA 2QPQA 4MNIA 1XI6A 3U1OA 2XXPA 3DM0A 5AA2A 2Q2CA 5K2XA 2F7AA 1LFHA 1Y1MA 1QUKA 1IMDA 3D4GA 2AYSA 3UN6A 1LAGE 1FPEA 5FTIA 3S9MC 2O1LA 1MRPA 2ABHA 2CZHA 3U93A 2NOOA 4PTKA 5KDTA 4MH5A 4POWA 1PB8A 1IEJA 1NV5A 3WAFA 3O6IA 4XF5A 3CFZA 4PFRA 1MPCA 3BBRA 1IQ7A 3O29A 1B05A 4RNSA 1P1QA 1B32A 1TXFA 4GWZA 1EU8A 1A7LA 3CG1A 1KA1A 4OFJA 1I6BA 5LDZA 4DDDA 4F3SA 3IB2A 4IO6A 3PV0E 1A54A 1I6AA 3OXNA 4JDFA 5ET6A 1ZJLA 4GWUA 2ESNA 3DP8A 2UYEA 5L8DA 4PFIA 4QXDA 2F7CA 2NUVA 2ZNUA 2QS2A 4EF1A 2O68A 1A99A 1G0IA 3EPEA 4NG7A 4HE1A 3TPAA 4JB7A 1LB8A 5KCJB 4DCXA 4UACA 3E4RA 4HW8A 1YPNA 3MZ9A 3MVXA 3ZSFA 1DOTA 3D4CA 4NTLA 4ELOA 1SW2A 4LATA 4PP0A 4N6DA 1FBDA 3MPLA 1ATGA 1FPDA 2PVUA 4LUBA 1M5CA 5KZTA 1FPLA 4ZZAA 3LUZA 1Y3PA 2F5XA 5ET5A 2I6EA 5F24A 1CNQA 2Z8FA 5ISUA 2ZYMA 5EQAA 1P99A 5CC2A 3M8UA 1MY1A 3T93B 1D9YA 2FBPA 4KYEA 4M1VA 5I56A 5B70A 4TQUQ 1H44A 4THIA 1YAEA 1LBZA 2G93A 4ZECA 3SESA 5I2KA 5AA4B 4HE0A 5FHMA 3FVGA 2Q8MA 3TTKA 3MQ9A 3IJXB 4NF0A 4P1EA 4GXAA 1OVBA 4R6HA 3RYDA 1BKAA 4OESA 3O2AA 3IX1A 4RYAA 3TTRA 1POY1 2P0SA 4ESXA 4XEQA 3OD7A 1KWHA 1YCJA 4N15A 1PB9A 2P3VA 1VSOA 2ALUA 4IO4A 1RDYA 1LLSA 4NF8B 5T3JA 1R1NA 3RQTA 1P1OA 3FJ7A 1HSEA 3MWBA 2XXRA 5AA2B 2QRYA 1VR5A 2QJEA 4IY5A 1FTMA 1JEUA 3OMBA 5ESYA 1IXIA 3LUYA 3SEWA 4GLIA 1SPIA 4GFRA 3M3KA 2PT1A 1MXXA 4K3FA 4OWDA 2DWAA 4DCYA 3PPOA 1MXWA 3IORA 4PDDA 1LBVA 4NF4A 4GF8A 3DP6A 1LBBA 4X1DA 3VLVA 3T22A 5IZ1A 4I3EA 4KCDA 5DT6A 2XXYA 2V84A 5EHMA 4YMBA 1ZU0A 3K6UA 4NF5A 4N4UA 4LP2B 5IKBA 1JQFA 4H46A 3MUQA 4HCYA 3HV1A 5EQ8A 3B7DA 5EYHA 3EHSA 1XS5A 3O28A 2V3UA 3ODBA 4Q8RA 1B5HA 3B6WA 4XKQA 2HXRA 4GVOA 1MQJA 3CG3A 2D21A 1FTOA 4Q5TA 4YZZA 3T9HB 1N84A 2ZYOA 1FQEA 4F2OA 1G0HA 3KFMA 4HCWA 1IXCA 2Q2AA 3G3HA 3FVNA 2GH9A 2H9BA 4G68A 2B3BA 5DVIA 5J1DA 4U21A 1RYOA 3LSLA 2GHBA 1OLAA 3SEVA 3BIGA 5H8HB 3ZS6A 1O7TA 1PBQA 3W15C 3FVOA 4AS4A 1II5A
chains in the Genus database with same CATH topology
2OWSA 3ONMA 3FVKA 1ANFA 1LBCA 1RKMA 1NNTA 3K01A 5I84A 4QFPA 1B7ZA 1GGGA 1NFTA 1Q35A 2Z8DA 1L5TA 2DS9A 3I5OA 4KCCA 2DOJA 2UVJA 3OO7A 3TTMA 4QFNA 4DXBA 3LR1A 5CMBA 4F3GA 5I56B 1S9TA 2DVZA 2QS3A 2I3VA 2YLNA 5TP9A 4F22A 3QIMA 1AIVA 1DPEA 5ITPA 1WDNA 1USYH 3HO7A 3MP6A 4L17A 1A55A 3RT6B 4U23A 3O66A 4XXUA 1A8EA 1MM6A 1J1NA 2M8CA 3C32A 3H03A 3B6QA 1US4A 3FATA 3K6WA 4ZEIA 4EQ7A 3OO8A 4H5FA 3Q26A 3A09A 1MG1A 1PC3A 4R74A 5TPAA 3U94A 1JW4A 1MXYA 1QJMA 3AXFA 3HSTA 1D9VA 1XHYA 3LSWA 5KCJA 1NKXA 4FAJA 1EZPA 3W9VA 2I48A 3CI8A 4FE8A 4ND9A 3TQWA 4R6KA 4P11A 1MPBA 5DYHA 3S2VA 3UORA 4H65A 3JYRA 1D3KA 4KPTA 4NF5B 3RY3A 4FATA 4QRZA 1MY2A 2ZYKA 2ONKE 1TFDA 3TYHA 5H8HA 3K2DA 5I2NA 4U22A 4JBZA 4LZ7A 2Y7IA 4JWYA 4POXA 4XTCQ 3RLFE 3T66A 1JVXA 1B52A 3MJNA 3Q28A 1B40A 1BIYA 1SI0A 3TMGA 2A5SA 3KSXA 4O3AA 1MXUA 4EXLA 5CBSA 2VD2A 4WEDA 3C9HA 4H5GA 1FW0A 5ICTA 4HS7A 3H06B 4KI0E 1JW1A 1B3HA 2LAOA 1ZLQA 3UP9A 3USDA 4ESWA 1B3FA 4RK2A 4H0WA 5K2YA 2XX7A 4XIGQ 1UIUA 1SQYA 1B3LA 2W7YA 5KDTB 1ZIUA 3FV2A 1LCFA 3MAMA 3QAXA 3FJGA 2F7BA 3FXRA 1M5EA 2ZYNA 3MVWA 3A3CA 4JWXA 3TTLA 3SETA 4C0RA 3DELB 1Y1ZA 4N6PA 1LFIA 3Q29A 5HBCA 5CRYA 3EQ1A 5CMKA 2OLBA 3RT8A 4ELPA 3IO4A 4IO2A 1B7HA 1NH7A 1N0TA 2OCUA 1H43A 4OETA 3SDFA 3R7XA 3GXAA 3PPPA 4BDRA 2OK2A 1S50A 2I0CA 4MLQA 4QSCA 4ISUA 2O7IA 2E0SA 1FTKA 4DXCA 2O1MA 5TU0A 1LCTA 5EHSA 1MDQA 4KD5A 1SW4A 3V5AA 3G3JA 3F11A 4TOZA 2GFEA 3CSBA 3VXCA 2XXHA 2QSXA 4IY6A 1ELJA 1DTGA 2X7PA 1B3GA 3FV1A 1N76A 4O3CA 1F9BA 4X1BA 3SEUA 5AA3A 4TLMB 1QKAA 4U2RA 2UYFA 1O64A 2AL5A 2ZNSA 2O51A 1IZ1A 4KYSA 3K1PA 2B3FA 1BLFA 4I62A 2NWJA 3RPWA 3U92A 1QW0A 4I1DA 4R9GA 4XKNA 1UQWA 3TELA 5BWJA 3BFUA 1QKBA 4BDMA 4DXUA 4QSDA 3VFJA 2XD3A 3OO6A 3IO6A 1DTZA 3WAEA 4NMYA 4BDOA 1MY4A 1M5BA 3H4ZA 3N94A 3QXMA 2V93A 4C1TA 4F3PA 3VXBA 5AE4A 4YU0A 4GWOA 4LA9A 2HEUA 3T9XB 4IGTA 2A5TA 3GLBA 1T0KA 2KLFA 3KN7A 2XXIA 3S9LC 3KN3A 4OMBA 3O6HA 1AL3A 3PUXE 5I58A 1P1UA 2AL4A 1SDXA 3I6VA 3K1NA 2ONRA 3GBBA 3OEKA 1I69A 2ONSA 2XXXA 4RJZA 2RCBA 3VDFA 3CR9A 3V89B 3PMVA 1ZBMA 2DQVA 2PBWA 3V8XB 4PQJA 4FJPA 1MM7A 4UACA 1O63A 1B7UA 3N5LA 5DVJA 3MPKA 3EHUA 3K02A 2QPQA 4F2QA 3U1OA 1VE4A 2RKMA 2YPNA 1AOVA 4G4PA 4XKRA 1IXGA 3RTWB 3TCHA 4OFOA 4H8JA 1RYXA 2XXPA 2O69A 3DM0A 2Q2CA 4RPNA 4OFLA 4UA8A 1A8FA 2ANJA 3TCFA 3DP4A 4OQOA 4HW8A 3CVGA 2BJJX 3LSXA 5K2XA 5BUUA 1B2HA 2F7AA 4YB7A 1LFHA 5ITOA 1H45A 1Y1MA 1JVYA 2VHAA 3FJMA 2P2AA 1QUKA 1Y20A 3D4GA 3IK6B 4GRKA 4HTGA 5AA4A 1B5JA 1LSTA 2AYSA 2F78A 1B1XA 1LAGE 3FIRA 5FTIA 3UN6A 1IIWA 3S9MC 3VVEA 2O1LA 5L9SA 4PFTA 2H99A 1MRPA 2ABHA 3IB0A 1SVXB 1SW5A 3U93A 1URDA 3EHTA 2NOOA 1FTLA 3KBRA 1Q1KA 4NF6B 4EQ9A 4MH5A 5KDTA 4POWA 1PB8A 3ILTB 3MBPA 1IEJA 5H8QB 1MY0A 3U8QA 4H67A 3TTNA 2G29A 3E9XA 3WAFA 3C33A 3SERA 1GVCA 4ELOA 3O6IA 4OEUA 3CFZA 4OTEA 2YJPA 2HFBA 3T9VA 3VVFA 1POTA 2QS1A 4Z0IA 3FD3A 1MPCA 4R75A 1XVXA 3BBRA 1UIVA 2XXUA 1XC1A 3A3UA 4RY1A 4KYDA 1SI1A 3EF7A 1IQ7A 3BFTA 4JWOA 5I57A 2I3WA 1B51A 3O29A 4FIMA 1QUJA 3TKDA 1MQDA 1B05A 2HAVA 4LZ8A 1NNPA 4G68B 5FHNA 3K6VA 4RNSA 1P1QA 2D3IA 1B32A 1TXFA 1LB9A 1Z7ME 2QS4A 4XKPA 5CMCA 4ZS9A 4QHQA 1JEVA 3P7IA 1EU8A 4LZ5A 4ELQA 4LONB 3O9PA 1MH3A 1A7LA 1AMFA 2UXAA 3G3GA 3S9EA 3CG1A 3TCGA 2Z8EA 5F1QA 5H8FB 4EUOA 4EQBA 3Q25A 3R26A 4OFJA 4IO5A 2QMXA 4O3BA 1I6BA 4RA1A 4I9DA 5CMMA 3UIFA 2F35A 2Q89A 3H7MA 3N26A 4H1XA 2XXWA 1FTJA 3ZKKA 5JEIA 4DDDA 4F3SA 4YKIA 4F18A 1Y3NA 3IB2A 4ONYA 2F36A 3PMWA 4F1UA 2H25A 4IO6A 1NNKA 4U4XA 3PV0E 1A54A 1I6AA 4G68C 3TQLA 2HZLA 1US5A 3OXNA 3PPQA 4GOTA 2OWTA 3PGFA 4JDFA 1ZJLA 1IITA 5HPQA 2ESNA 3DP8A 2XHDA 1EH3A 5DEXA 3FXQA 3GZGA 1USYE 2CZLA 2REJA 5H8QA 3TODA 1P1NA 2UYEA 4QFOA 2OBGA 1B6HA 3FGSA 5JTYB 2RINA 2R6GE 5L8DA 2HCAA 1EZOA 1VFDA 2X26A 2XXTA 5JTYA 3MVZA 2F7CA 4YKPA 2NUVA 2ZNUA 5H8SA 3PUWE 1WVJA 3KG2A 3TUSA 3QUJA 4MFIA 4YMAA 3PD9A 2QMWA 4DIGA 4Z7EA 1AH5A 4PETA 4KR5A 5L9MA 2RC8A 3SKPA 3T96B 2QS2A 4N13A 2O68A 4Q30B 1FQDA 3CFLA 4EF1A 2I49A 1A99A 1I6QA 1CB6A 2DE3A 3EPEA 3TPAA 2Y84A 4JB7A 3L6HA 1B0HA 1LB8A 1JETA 5KCJB 3N6UA 3KGCA 2F6PA 2I4CA 3E4RA 2DWHA 2R71A 4G8MA 2Y7WA 4GXSB 1YPNA 2OZZA 2VOZA 3G7WA 3MVXA 3MZ9A 4GQOA 4OENA 5ELVA 1ZKBA 2HXWA 2VP1A 4KQPA 3ZSFA 1DOTA 3MP8A 1S7YA 3D4CA 4NTLA 4MBPA 1N3WA 4OVJA 1QVSA 3K0VA 2F97A 4LVQA 1M5DA 3FASA 1SW2A 4YKJA 2I4BA 1MQGA 2NXOA 4LATA 1MH4A 4GIZA 2PX1A 2XX8A 4R2BA 1PEBA 1SW1A 3ILUB 5TP9B 4PP0A 1LAFE 3JZJA 3OO9A 2ZXTA 1R6ZA 2THIA 4X48A 4U1ZA 5A5XB 2A5TB 3MPLA 4YB5A 1ATGA 5M2VA 1TT1A 2PVUA 1PDAA 4LUBA 1N04A 3FZVA 4OERA 3VLWA 1M5CA 5KZTA 3KOTA 4G77A 3KSJA 1FQBA 1PBPA 1VFEA 4ZZAA 5HM4B 1MPDA 3S9NC 5JK4A 2DWIA 3TDJA 1MQHA 1ZTYA 3U72A 1QUIA 1Y3PA 2F5XA 2IA4A 5EYFA 4JXIA 1JNFA 1H76A 1N3XA 2DE2A 2I6EA 2Z8FA 2ZYMA 1R9QA 1P99A 3OENA 4PFUA 3M8UA 4R9FA 4MLVA 1BP5A 4ECFA 5CC2A 1MY1A 3T93B 1D9YA 4M1VA 3IL1B 1MXZA 4KYEA 1OIBA 3LBSA 4FECA 4NF6A 5I56A 1TFAA 5B70A 2GHAA 2IEEA 3HN0A 4M4GA 3PUYE 2DWJA 1Z7NE 3OSQA 4QSEA 3M3FA 4TQUQ 2F8DA 5CI5A 1H44A 3V83A 4THIA 1YAEA 1OVTA 3H6WA 4ZEFA 2GRVA 3GBAA 1H3DA 1XT8A 4E0WA 2G93A 3TEPA 4E0XA 4ZECA 1JW5A 3L6GA 3Q27A 4MF3A 3SESA 5I2KA 5IAIA 5AA4B 3RUMA 5FHMA 2PT2A 4NE4A 4ZDMA 3FVGA 4H8IA 1SYIA 3LSFB 2RCAA 4YICA 4IGRA 1TWYA 3TTKA 1LFGA 3K00A 4FEBA 1MQIA 1Y4CA 3IJXB 3MQ9A 4JSDA 1Y3QA 2DSFA 1LAHE 4FEDA 3HHGA 4PFWA 4DCXA 4GXAA 1OVBA 3QK6A 4R6HA 2FYIA 1BKAA 4OESA 3O2AA 4R72A 2Q8JA 1D4NA 2REGA 3KZGA 3BKIB 4P0IA 4WKMA 3IX1A 3TAJA 5CBRA 4G2ZA 4RYAA 2XD2A 4TLLB 1DSNA 1POY1 2Y7RA 3TTRA 4GL0A 2P0SA 4ESXA 4N07A 3I3VA 3OD7A 4ZEKA 1KWHA 1YCJA 1N7WA 5I59A 2VGQA 5ISUA 1PB9A 2Z23A 2ZNTA 1P1WA 2Y7PA 3DLNA 3PPRA 4NF4B 3RNNA 1VSOA 4AB5A 4OZ9A 2O84X 4RXLA 4BDNA 1M5FA 2ALUA 3KOSA 4NWDA 1HSLA 4IO4A 3THIA 1GV8A 3CFXA 3ECRA 4IB2A 4NF8A 1LLSA 3MC2A 5F7VA 4ZE9A 4NF8B 3K6XA 1NNFA 4FORA 1B46A 4QFKA 1R1NA 2DP8A 3IR1A 3RQTA 5AA2A 1B1HA 1B58A 1P1OA 1IXHA 3IOVA 1XOCA 1SD3A 3G3IA 4R73A 2RC9A 4PFYA 5H8NA 4DZ1A 1FQFA 1PB7A 2QL3A 2Y7KA 2DVCA 3FJ7A 3KN8A 1HSEA 3R6UA 3KJTA 2X7QA 3MWBA 4I8CA 5I59B 3C4MA 4G8NA 1LAXA 2XXRA 3PD8A 3VLUA 2Q9TA 5AA2B 5AA2D 3PU5A 5L9OA 2QRYA 2RC7A 1VR5A 4GD5A 4P0GA 5B7DA 1WODA 3O6GA 4EDPA 2ZMBA 3O97A 1NMUA 2QJEA 2UVGA 1FTMA 3QSLA 4IY5A 1JEUA 2P1SA 3C34A 1IXIA 3OMBA 3LUYA 3UA8A 3SEWA 4GLIA 3TZAA 4DE8A 3FUZA 1EZ9A 4GFRA 2Q88A 3M3KA 2PT1A 1URSA 5H8FA 3T9UA 2V25A 1MXXA 4BDLA 2V3QA 2XXQA 3SEXA 3HPIA 2FNCA 1B4ZA 1UTHA 3K4UA 1SBPA 2RF1A 4K3FA 4ZEDA 4OWDA 1B4HA 3MZ1A 2DWAA 1MY3A 3QYTA 4DCYA 4F19A 1CE2A 3B6TA 1XVYA 3VV5A 3C36A 1UTBB 5FHOA 4KFQA 3TFLA 3PPOA 1MXWA 1YTVA 1ZMGA 3H6TA 3C35A 3IORA 2H5YA 3QUFA 2D5WA 4LQ2A 4GF8A 3DP6A 4NF4A 2NVUB 3UGWA 4BLAA 1A40A 1LBBA 4YAHX 4C1UA 4X1DA 4U4SA 1OMPA 4OXVA 3S4UA 1R9LA 4R6YA 3T22A 3VLVA 4YKKA 4KCDA 5DT6A 2XXYA 2V84A 3IJOB 5EHMA 2AIXA 4YMBA 1ZU0A 3KJ7A 1MS7A 3K6UA 3PUVE 2HZKA 2R9JA 4NF5A 5IKBA 3IOTA 4LP2B 2O6AA 4U1OA 3MP1A 1B0LA 4R2FA 3FXUA 1UTHB 1JQFA 2F6GA 2HAUA 3C31A 4OYVA 5FTHA 5A5XA 3MUQA 2UVIA 3H6VA 4ZE8A 5I2KB 4HCYA 3HV1A 4PE5B 3IAZA 4RPOA 3OEMA 3IB1A 5AA1A 4F3BA 1BTJA 5TPAB 5DVFA 1OQGA 3B7DA 3SEYA 4OEVA 3VE1B 3EHSA 4ZZEA 5I57B 2XXVA 1FQAA 2UVHA 1Y9UA 1XS5A 4F29A 5CM6A 3O28A 3LC8A 2V3UA 3ODBA 3MW0A 1MXVA 1OQHA 4Q8RA 3UK4A 1B5HA 2O7UA 5ICQA 3IOWA 1IUDA 1MDP1 3CSGA 3OELA 1B3EA 2PMSA 3B6WA 2DXRA 3HHFA 4XKQA 2F34A 2WKYA 4Q0CA 4EF2A 3E3KA 3PPNA 4YB6A 4F31B 5DTBA 2H4IA 3EN3A 3JV9A 3E13X 4GVOA 4IO7A 5H8NB 1NL5A 3OSRA 3H6UA 2CMOA 1MQJA 1UTBA 2FA7A 3CG3A 3M3LA 3G3FA 1FCKA 4X9TA 2D21A 4G8HA 1DMBA 1B9JA 1LGBC 1OLCA 1FQCA 3K1MA 4OHNA 1FTOA 1SYHA 4Q5TA 4RK9A 4YZZA 3T9HB 1N84A 2ZYOA 1FQEA 1GTKA 4NWCA 4F2OA 3KFMA 4QF9A 4HCWA 4H6DA 3W9WA 1IXCA 2Q2AA 3N6TA 3G3HA 5DEXB 3H3GA 4BDQA 2H98A 3FVNA 2GH9A 2H9BA 2DXYA 3RGYA 4G68A 4JSOA 2B3BA 3PMXA 3HCQA 3PUZE 4WEPA 5DVIA 1NH8A 3CIJA 2I0BA 4IO3A 5J1DA 4U21A 1RYOA 3LSLA 2V3TA 4NEDA 1Y4TA 2GHBA 4WXJA 4ELRA 1N7XA 1OLAA 3MVYA 1GR2A 3SEVA 5H8HB 3CRBA 3IOUA 2DYXA 1B5IA 4QFLA 4F39A 3ZS6A 5I2NB 2OJTA 3ZKLA 4KHZE 2E1SA 2B65A 1O7TA 1URGA 1PBQA 3RN8A 4AQ4A 5I58B 2XX9A 2DE4A 3W15C 3MZBA 4DLDA 4EXKA 1QULA 3FVOA 4GL8A 2PYYA 4LQ5A 3VVDA 4F1YA 1DPPA 1II5A 2VD3A 5LOMA 3KEIA 1HSJA 4F1VA 4AB6A 2I58A 3G3KA 4ZEBA 3OOAA 2Z22A 3RTFB 2HQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWS A;  3ONM A;  3FVK A;  1ANF A;  1LBC A;  1RKM A;  1NNT A;  3K01 A;  5I84 A;  4QFP A;  1B7Z A;  1GGG A;  1NFT A;  1Q35 A;  2Z8D A;  1L5T A;  2DS9 A;  3I5O A;  4KCC A;  2DOJ A;  2UVJ A;  3OO7 A;  3TTM A;  4QFN A;  4DXB A;  3LR1 A;  5CMB A;  4F3G A;  5I56 B;  1S9T A;  2DVZ A;  2QS3 A;  2I3V A;  2YLN A;  5TP9 A;  4F22 A;  3QIM A;  1AIV A;  1DPE A;  5ITP A;  1WDN A;  1USY H;  3HO7 A;  3MP6 A;  4L17 A;  1A55 A;  3RT6 B;  4U23 A;  3O66 A;  4XXU A;  1A8E A;  1MM6 A;  1J1N A;  2M8C A;  3C32 A;  3H03 A;  3B6Q A;  1US4 A;  3FAT A;  3K6W A;  4ZEI A;  4EQ7 A;  3OO8 A;  4H5F A;  3Q26 A;  3A09 A;  1MG1 A;  1PC3 A;  4R74 A;  5TPA A;  3U94 A;  1JW4 A;  1MXY A;  1QJM A;  3AXF A;  3HST A;  1D9V A;  1XHY A;  3LSW A;  5KCJ A;  1NKX A;  4FAJ A;  1EZP A;  3W9V A;  2I48 A;  3CI8 A;  4FE8 A;  4ND9 A;  3TQW A;  4R6K A;  4P11 A;  1MPB A;  5DYH A;  3S2V A;  3UOR A;  4H65 A;  3JYR A;  1D3K A;  4KPT A;  4NF5 B;  3RY3 A;  4FAT A;  4QRZ A;  1MY2 A;  2ZYK A;  2ONK E;  1TFD A;  3TYH A;  5H8H A;  3K2D A;  5I2N A;  4U22 A;  4JBZ A;  4LZ7 A;  2Y7I A;  4JWY A;  4POX A;  4XTC Q;  3RLF E;  3T66 A;  1JVX A;  1B52 A;  3MJN A;  3Q28 A;  1B40 A;  1BIY A;  1SI0 A;  3TMG A;  2A5S A;  3KSX A;  4O3A A;  1MXU A;  4EXL A;  5CBS A;  2VD2 A;  4WED A;  3C9H A;  4H5G A;  1FW0 A;  5ICT A;  4HS7 A;  3H06 B;  4KI0 E;  1JW1 A;  1B3H A;  2LAO A;  1ZLQ A;  3UP9 A;  3USD A;  4ESW A;  1B3F A;  4RK2 A;  4H0W A;  5K2Y A;  2XX7 A;  4XIG Q;  1UIU A;  1SQY A;  1B3L A;  2W7Y A;  5KDT B;  1ZIU A;  3FV2 A;  1LCF A;  3MAM A;  3QAX A;  3FJG A;  2F7B A;  3FXR A;  1M5E A;  2ZYN A;  3MVW A;  3A3C A;  4JWX A;  3TTL A;  3SET A;  4C0R A;  3DEL B;  1Y1Z A;  4N6P A;  1LFI A;  3Q29 A;  5HBC A;  5CRY A;  3EQ1 A;  5CMK A;  2OLB A;  3RT8 A;  4ELP A;  3IO4 A;  4IO2 A;  1B7H A;  1NH7 A;  1N0T A;  2OCU A;  1H43 A;  4OET A;  3SDF A;  3R7X A;  3GXA A;  3PPP A;  4BDR A;  2OK2 A;  1S50 A;  2I0C A;  4MLQ A;  4QSC A;  4ISU A;  2O7I A;  2E0S A;  1FTK A;  4DXC A;  2O1M A;  5TU0 A;  1LCT A;  5EHS A;  1MDQ A;  4KD5 A;  1SW4 A;  3V5A A;  3G3J A;  3F11 A;  4TOZ A;  2GFE A;  3CSB A;  3VXC A;  2XXH A;  2QSX A;  4IY6 A;  1ELJ A;  1DTG A;  2X7P A;  1B3G A;  3FV1 A;  1N76 A;  4O3C A;  1F9B A;  4X1B A;  3SEU A;  5AA3 A;  4TLM B;  1QKA A;  4U2R A;  2UYF A;  1O64 A;  2AL5 A;  2ZNS A;  2O51 A;  1IZ1 A;  4KYS A;  3K1P A;  2B3F A;  1BLF A;  4I62 A;  2NWJ A;  3RPW A;  3U92 A;  1QW0 A;  4I1D A;  4R9G A;  4XKN A;  1UQW A;  3TEL A;  5BWJ A;  3BFU A;  1QKB A;  4BDM A;  4DXU A;  4QSD A;  3VFJ A;  2XD3 A;  3OO6 A;  3IO6 A;  1DTZ A;  3WAE A;  4NMY A;  4BDO A;  1MY4 A;  1M5B A;  3H4Z A;  3N94 A;  3QXM A;  2V93 A;  4C1T A;  4F3P A;  3VXB A;  5AE4 A;  4YU0 A;  4GWO A;  4LA9 A;  2HEU A;  3T9X B;  4IGT A;  2A5T A;  3GLB A;  1T0K A;  2KLF A;  3KN7 A;  2XXI A;  3S9L C;  3KN3 A;  4OMB A;  3O6H A;  1AL3 A;  3PUX E;  5I58 A;  1P1U A;  2AL4 A;  1SDX A;  3I6V A;  3K1N A;  2ONR A;  3GBB A;  3OEK A;  1I69 A;  2ONS A;  2XXX A;  4RJZ A;  2RCB A;  3VDF A;  3CR9 A;  3V89 B;  3PMV A;  1ZBM A;  2DQV A;  2PBW A;  3V8X B;  4PQJ A;  4FJP A;  1MM7 A;  4UAC A;  1O63 A;  1B7U A;  3N5L A;  5DVJ A;  3MPK A;  3EHU A;  3K02 A;  2QPQ A;  4F2Q A;  3U1O A;  1VE4 A;  2RKM A;  2YPN A;  1AOV A;  4G4P A;  4XKR A;  1IXG A;  3RTW B;  3TCH A;  4OFO A;  4H8J A;  1RYX A;  2XXP A;  2O69 A;  3DM0 A;  2Q2C A;  4RPN A;  4OFL A;  4UA8 A;  1A8F A;  2ANJ A;  3TCF A;  3DP4 A;  4OQO A;  4HW8 A;  3CVG A;  2BJJ X;  3LSX A;  5K2X A;  5BUU A;  1B2H A;  2F7A A;  4YB7 A;  1LFH A;  5ITO A;  1H45 A;  1Y1M A;  1JVY A;  2VHA A;  3FJM A;  2P2A A;  1QUK A;  1Y20 A;  3D4G A;  3IK6 B;  4GRK A;  4HTG A;  5AA4 A;  1B5J A;  1LST A;  2AYS A;  2F78 A;  1B1X A;  1LAG E;  3FIR A;  5FTI A;  3UN6 A;  1IIW A;  3S9M C;  3VVE A;  2O1L A;  5L9S A;  4PFT A;  2H99 A;  1MRP A;  2ABH A;  3IB0 A;  1SVX B;  1SW5 A;  3U93 A;  1URD A;  3EHT A;  2NOO A;  1FTL A;  3KBR A;  1Q1K A;  4NF6 B;  4EQ9 A;  4MH5 A;  5KDT A;  4POW A;  1PB8 A;  3ILT B;  3MBP A;  1IEJ A;  5H8Q B;  1MY0 A;  3U8Q A;  4H67 A;  3TTN A;  2G29 A;  3E9X A;  3WAF A;  3C33 A;  3SER A;  1GVC A;  4ELO A;  3O6I A;  4OEU A;  3CFZ A;  4OTE A;  2YJP A;  2HFB A;  3T9V A;  3VVF A;  1POT A;  2QS1 A;  4Z0I A;  3FD3 A;  1MPC A;  4R75 A;  1XVX A;  3BBR A;  1UIV A;  2XXU A;  1XC1 A;  3A3U A;  4RY1 A;  4KYD A;  1SI1 A;  3EF7 A;  1IQ7 A;  3BFT A;  4JWO A;  5I57 A;  2I3W A;  1B51 A;  3O29 A;  4FIM A;  1QUJ A;  3TKD A;  1MQD A;  1B05 A;  2HAV A;  4LZ8 A;  1NNP A;  4G68 B;  5FHN A;  3K6V A;  4RNS A;  1P1Q A;  2D3I A;  1B32 A;  1TXF A;  1LB9 A;  1Z7M E;  2QS4 A;  4XKP A;  5CMC A;  4ZS9 A;  4QHQ A;  1JEV A;  3P7I A;  1EU8 A;  4LZ5 A;  4ELQ A;  4LON B;  3O9P A;  1MH3 A;  1A7L A;  1AMF A;  2UXA A;  3G3G A;  3S9E A;  3CG1 A;  3TCG A;  2Z8E A;  5F1Q A;  5H8F B;  4EUO A;  4EQB A;  3Q25 A;  3R26 A;  4OFJ A;  4IO5 A;  2QMX A;  4O3B A;  1I6B A;  4RA1 A;  4I9D A;  5CMM A;  3UIF A;  2F35 A;  2Q89 A;  3H7M A;  3N26 A;  4H1X A;  2XXW A;  1FTJ A;  3ZKK A;  5JEI A;  4DDD A;  4F3S A;  4YKI A;  4F18 A;  1Y3N A;  3IB2 A;  4ONY A;  2F36 A;  3PMW A;  4F1U A;  2H25 A;  4IO6 A;  1NNK A;  4U4X A;  3PV0 E;  1A54 A;  1I6A A;  4G68 C;  3TQL A;  2HZL A;  1US5 A;  3OXN A;  3PPQ A;  4GOT A;  2OWT A;  3PGF A;  4JDF A;  1ZJL A;  1IIT A;  5HPQ A;  2ESN A;  3DP8 A;  2XHD A;  1EH3 A;  5DEX A;  3FXQ A;  3GZG A;  1USY E;  2CZL A;  2REJ A;  5H8Q A;  3TOD A;  1P1N A;  2UYE A;  4QFO A;  2OBG A;  1B6H A;  3FGS A;  5JTY B;  2RIN A;  2R6G E;  5L8D A;  2HCA A;  1EZO A;  1VFD A;  2X26 A;  2XXT A;  5JTY A;  3MVZ A;  2F7C A;  4YKP A;  2NUV A;  2ZNU A;  5H8S A;  3PUW E;  1WVJ A;  3KG2 A;  3TUS A;  3QUJ A;  4MFI A;  4YMA A;  3PD9 A;  2QMW A;  4DIG A;  4Z7E A;  1AH5 A;  4PET A;  4KR5 A;  5L9M A;  2RC8 A;  3SKP A;  3T96 B;  2QS2 A;  4N13 A;  2O68 A;  4Q30 B;  1FQD A;  3CFL A;  4EF1 A;  2I49 A;  1A99 A;  1I6Q A;  1CB6 A;  2DE3 A;  3EPE A;  3TPA A;  2Y84 A;  4JB7 A;  3L6H A;  1B0H A;  1LB8 A;  1JET A;  5KCJ B;  3N6U A;  3KGC A;  2F6P A;  2I4C A;  3E4R A;  2DWH A;  2R71 A;  4G8M A;  2Y7W A;  4GXS B;  1YPN A;  2OZZ A;  2VOZ A;  3G7W A;  3MVX A;  3MZ9 A;  4GQO A;  4OEN A;  5ELV A;  1ZKB A;  2HXW A;  2VP1 A;  4KQP A;  3ZSF A;  1DOT A;  3MP8 A;  1S7Y A;  3D4C A;  4NTL A;  4MBP A;  1N3W A;  4OVJ A;  1QVS A;  3K0V A;  2F97 A;  4LVQ A;  1M5D A;  3FAS A;  1SW2 A;  4YKJ A;  2I4B A;  1MQG A;  2NXO A;  4LAT A;  1MH4 A;  4GIZ A;  2PX1 A;  2XX8 A;  4R2B A;  1PEB A;  1SW1 A;  3ILU B;  5TP9 B;  4PP0 A;  1LAF E;  3JZJ A;  3OO9 A;  2ZXT A;  1R6Z A;  2THI A;  4X48 A;  4U1Z A;  5A5X B;  2A5T B;  3MPL A;  4YB5 A;  1ATG A;  5M2V A;  1TT1 A;  2PVU A;  1PDA A;  4LUB A;  1N04 A;  3FZV A;  4OER A;  3VLW A;  1M5C A;  5KZT A;  3KOT A;  4G77 A;  3KSJ A;  1FQB A;  1PBP A;  1VFE A;  4ZZA A;  5HM4 B;  1MPD A;  3S9N C;  5JK4 A;  2DWI A;  3TDJ A;  1MQH A;  1ZTY A;  3U72 A;  1QUI A;  1Y3P A;  2F5X A;  2IA4 A;  5EYF A;  4JXI A;  1JNF A;  1H76 A;  1N3X A;  2DE2 A;  2I6E A;  2Z8F A;  2ZYM A;  1R9Q A;  1P99 A;  3OEN A;  4PFU A;  3M8U A;  4R9F A;  4MLV A;  1BP5 A;  4ECF A;  5CC2 A;  1MY1 A;  3T93 B;  1D9Y A;  4M1V A;  3IL1 B;  1MXZ A;  4KYE A;  1OIB A;  3LBS A;  4FEC A;  4NF6 A;  5I56 A;  1TFA A;  5B70 A;  2GHA A;  2IEE A;  3HN0 A;  4M4G A;  3PUY E;  2DWJ A;  1Z7N E;  3OSQ A;  4QSE A;  3M3F A;  4TQU Q;  2F8D A;  5CI5 A;  1H44 A;  3V83 A;  4THI A;  1YAE A;  1OVT A;  3H6W A;  4ZEF A;  2GRV A;  3GBA A;  1H3D A;  1XT8 A;  4E0W A;  2G93 A;  3TEP A;  4E0X A;  4ZEC A;  1JW5 A;  3L6G A;  3Q27 A;  4MF3 A;  3SES A;  5I2K A;  5IAI A;  5AA4 B;  3RUM A;  5FHM A;  2PT2 A;  4NE4 A;  4ZDM A;  3FVG A;  4H8I A;  1SYI A;  3LSF B;  2RCA A;  4YIC A;  4IGR A;  1TWY A;  3TTK A;  1LFG A;  3K00 A;  4FEB A;  1MQI A;  1Y4C A;  3IJX B;  3MQ9 A;  4JSD A;  1Y3Q A;  2DSF A;  1LAH E;  4FED A;  3HHG A;  4PFW A;  4DCX A;  4GXA A;  1OVB A;  3QK6 A;  4R6H A;  2FYI A;  1BKA A;  4OES A;  3O2A A;  4R72 A;  2Q8J A;  1D4N A;  2REG A;  3KZG A;  3BKI B;  4P0I A;  4WKM A;  3IX1 A;  3TAJ A;  5CBR A;  4G2Z A;  4RYA A;  2XD2 A;  4TLL B;  1DSN A;  1POY 1;  2Y7R A;  3TTR A;  4GL0 A;  2P0S A;  4ESX A;  4N07 A;  3I3V A;  3OD7 A;  4ZEK A;  1KWH A;  1YCJ A;  1N7W A;  5I59 A;  2VGQ A;  5ISU A;  1PB9 A;  2Z23 A;  2ZNT A;  1P1W A;  2Y7P A;  3DLN A;  3PPR A;  4NF4 B;  3RNN A;  1VSO A;  4AB5 A;  4OZ9 A;  2O84 X;  4RXL A;  4BDN A;  1M5F A;  2ALU A;  3KOS A;  4NWD A;  1HSL A;  4IO4 A;  3THI A;  1GV8 A;  3CFX A;  3ECR A;  4IB2 A;  4NF8 A;  1LLS A;  3MC2 A;  5F7V A;  4ZE9 A;  4NF8 B;  3K6X A;  1NNF A;  4FOR A;  1B46 A;  4QFK A;  1R1N A;  2DP8 A;  3IR1 A;  3RQT A;  5AA2 A;  1B1H A;  1B58 A;  1P1O A;  1IXH A;  3IOV A;  1XOC A;  1SD3 A;  3G3I A;  4R73 A;  2RC9 A;  4PFY A;  5H8N A;  4DZ1 A;  1FQF A;  1PB7 A;  2QL3 A;  2Y7K A;  2DVC A;  3FJ7 A;  3KN8 A;  1HSE A;  3R6U A;  3KJT A;  2X7Q A;  3MWB A;  4I8C A;  5I59 B;  3C4M A;  4G8N A;  1LAX A;  2XXR A;  3PD8 A;  3VLU A;  2Q9T A;  5AA2 B;  5AA2 D;  3PU5 A;  5L9O A;  2QRY A;  2RC7 A;  1VR5 A;  4GD5 A;  4P0G A;  5B7D A;  1WOD A;  3O6G A;  4EDP A;  2ZMB A;  3O97 A;  1NMU A;  2QJE A;  2UVG A;  1FTM A;  3QSL A;  4IY5 A;  1JEU A;  2P1S A;  3C34 A;  1IXI A;  3OMB A;  3LUY A;  3UA8 A;  3SEW A;  4GLI A;  3TZA A;  4DE8 A;  3FUZ A;  1EZ9 A;  4GFR A;  2Q88 A;  3M3K A;  2PT1 A;  1URS A;  5H8F A;  3T9U A;  2V25 A;  1MXX A;  4BDL A;  2V3Q A;  2XXQ A;  3SEX A;  3HPI A;  2FNC A;  1B4Z A;  1UTH A;  3K4U A;  1SBP A;  2RF1 A;  4K3F A;  4ZED A;  4OWD A;  1B4H A;  3MZ1 A;  2DWA A;  1MY3 A;  3QYT A;  4DCY A;  4F19 A;  1CE2 A;  3B6T A;  1XVY A;  3VV5 A;  3C36 A;  1UTB B;  5FHO A;  4KFQ A;  3TFL A;  3PPO A;  1MXW A;  1YTV A;  1ZMG A;  3H6T A;  3C35 A;  3IOR A;  2H5Y A;  3QUF A;  2D5W A;  4LQ2 A;  4GF8 A;  3DP6 A;  4NF4 A;  2NVU B;  3UGW A;  4BLA A;  1A40 A;  1LBB A;  4YAH X;  4C1U A;  4X1D A;  4U4S A;  1OMP A;  4OXV A;  3S4U A;  1R9L A;  4R6Y A;  3T22 A;  3VLV A;  4YKK A;  4KCD A;  5DT6 A;  2XXY A;  2V84 A;  3IJO B;  5EHM A;  2AIX A;  4YMB A;  1ZU0 A;  3KJ7 A;  1MS7 A;  3K6U A;  3PUV E;  2HZK A;  2R9J A;  4NF5 A;  5IKB A;  3IOT A;  4LP2 B;  2O6A A;  4U1O A;  3MP1 A;  1B0L A;  4R2F A;  3FXU A;  1UTH B;  1JQF A;  2F6G A;  2HAU A;  3C31 A;  4OYV A;  5FTH A;  5A5X A;  3MUQ A;  2UVI A;  3H6V A;  4ZE8 A;  5I2K B;  4HCY A;  3HV1 A;  4PE5 B;  3IAZ A;  4RPO A;  3OEM A;  3IB1 A;  5AA1 A;  4F3B A;  1BTJ A;  5TPA B;  5DVF A;  1OQG A;  3B7D A;  3SEY A;  4OEV A;  3VE1 B;  3EHS A;  4ZZE A;  5I57 B;  2XXV A;  1FQA A;  2UVH A;  1Y9U A;  1XS5 A;  4F29 A;  5CM6 A;  3O28 A;  3LC8 A;  2V3U A;  3ODB A;  3MW0 A;  1MXV A;  1OQH A;  4Q8R A;  3UK4 A;  1B5H A;  2O7U A;  5ICQ A;  3IOW A;  1IUD A;  1MDP 1;  3CSG A;  3OEL A;  1B3E A;  2PMS A;  3B6W A;  2DXR A;  3HHF A;  4XKQ A;  2F34 A;  2WKY A;  4Q0C A;  4EF2 A;  3E3K A;  3PPN A;  4YB6 A;  4F31 B;  5DTB A;  2H4I A;  3EN3 A;  3JV9 A;  3E13 X;  4GVO A;  4IO7 A;  5H8N B;  1NL5 A;  3OSR A;  3H6U A;  2CMO A;  1MQJ A;  1UTB A;  2FA7 A;  3CG3 A;  3M3L A;  3G3F A;  1FCK A;  4X9T A;  2D21 A;  4G8H A;  1DMB A;  1B9J A;  1LGB C;  1OLC A;  1FQC A;  3K1M A;  4OHN A;  1FTO A;  1SYH A;  4Q5T A;  4RK9 A;  4YZZ A;  3T9H B;  1N84 A;  2ZYO A;  1FQE A;  1GTK A;  4NWC A;  4F2O A;  3KFM A;  4QF9 A;  4HCW A;  4H6D A;  3W9W A;  1IXC A;  2Q2A A;  3N6T A;  3G3H A;  5DEX B;  3H3G A;  4BDQ A;  2H98 A;  3FVN A;  2GH9 A;  2H9B A;  2DXY A;  3RGY A;  4G68 A;  4JSO A;  2B3B A;  3PMX A;  3HCQ A;  3PUZ E;  4WEP A;  5DVI A;  1NH8 A;  3CIJ A;  2I0B A;  4IO3 A;  5J1D A;  4U21 A;  1RYO A;  3LSL A;  2V3T A;  4NED A;  1Y4T A;  2GHB A;  4WXJ A;  4ELR A;  1N7X A;  1OLA A;  3MVY A;  1GR2 A;  3SEV A;  5H8H B;  3CRB A;  3IOU A;  2DYX A;  1B5I A;  4QFL A;  4F39 A;  3ZS6 A;  5I2N B;  2OJT A;  3ZKL A;  4KHZ E;  2E1S A;  2B65 A;  1O7T A;  1URG A;  1PBQ A;  3RN8 A;  4AQ4 A;  5I58 B;  2XX9 A;  2DE4 A;  3W15 C;  3MZB A;  4DLD A;  4EXK A;  1QUL A;  3FVO A;  4GL8 A;  2PYY A;  4LQ5 A;  3VVD A;  4F1Y A;  1DPP A;  1II5 A;  2VD3 A;  5LOM A;  3KEI A;  1HSJ A;  4F1V A;  4AB6 A;  2I58 A;  3G3K A;  4ZEB A;  3OOA A;  2Z22 A;  3RTF B;  2HQ0 A; 
#chains in the Genus database with same CATH topology
 2OWS A;  1RKM A;  5A5L A;  1L5T A;  4I3Y A;  3TTM A;  4F3G A;  4QFN A;  3QIM A;  4P9K A;  4GX4 A;  3MP6 A;  4U23 A;  4XXU A;  1A8E A;  1J1N A;  3FAT A;  3K6W A;  3OO8 A;  3A09 A;  4R74 A;  5LTC A;  2QVV A;  2I48 A;  3TQW A;  4P11 A;  5DYH A;  3JYR A;  4KPT A;  4NF5 B;  3RY3 A;  1MY2 A;  1TFD A;  3TYH A;  3K2D A;  3RLF E;  3MJN A;  1BIY A;  1SI0 A;  4EXL A;  1LBY A;  3C9H A;  1JW1 A;  4RK2 A;  2XX7 A;  2W7Y A;  3FV2 A;  3MAM A;  3A3C A;  3SET A;  1LFI A;  5CRY A;  3RT8 A;  1N0T A;  1H43 A;  4OET A;  1FBG A;  3SDF A;  3GXA A;  3FXB A;  2O1M A;  5EHS A;  4KD5 A;  1RDZ A;  2R8T A;  1SW4 A;  4QBA A;  3F11 A;  3NOH A;  2AL5 A;  3RPW A;  4I1D A;  4P8B A;  4R9G A;  4XKN A;  5BWJ A;  1QKB A;  4QSD A;  3VFJ A;  3OO6 A;  3H4Z A;  5AE4 A;  4LA9 A;  2HEU A;  2A5T A;  3RPL A;  2XXI A;  5EYG A;  1P1U A;  2AL4 A;  3GBB A;  3VDF A;  3PMV A;  2DQV A;  2PBW A;  4FJP A;  1O63 A;  4PE3 A;  1B7U A;  5DVJ A;  3MPK A;  3K02 A;  1VE4 A;  2RKM A;  4H8J A;  4RPN A;  2O69 A;  3TCF A;  4OQO A;  2BJJ X;  1B2H A;  5ITO A;  2P2A A;  3IK6 B;  3FBP A;  4GRK A;  4HTG A;  1B5J A;  3FIR A;  1EYI A;  2H99 A;  3IB0 A;  3EHT A;  1FTL A;  1Q1K A;  1QGX A;  4NF6 B;  4EQ9 A;  2V4C A;  1BK4 A;  3ILT B;  5H8Q B;  3U8Q A;  2G29 A;  1NV2 A;  1GVC A;  1NV4 A;  5DW8 A;  4MNC A;  4OTE A;  2YJP A;  3VVF A;  2QS1 A;  1XC1 A;  3A3U A;  4RY1 A;  1SI1 A;  3EF7 A;  3BFT A;  3TKD A;  2HAV A;  4G68 B;  3K6V A;  1NUY A;  1LB9 A;  2QS4 A;  4XKP A;  3P7I A;  1MH3 A;  2UXA A;  4H45 A;  5F1Q A;  4EQB A;  3R26 A;  4GWS A;  4RA1 A;  3UIF A;  2F35 A;  2Q89 A;  3H7M A;  3N26 A;  1FTJ A;  4YKI A;  4F1U A;  2F36 A;  3PMW A;  4DI4 B;  2HZL A;  1US5 A;  3PPQ A;  4GOT A;  1EH3 A;  5DEX A;  3FXQ A;  2WEF A;  2OBG A;  2RIN A;  1VFD A;  2X26 A;  4YKP A;  4PET A;  4KR5 A;  3SKP A;  4Q30 B;  1FQD A;  1I6Q A;  1B0H A;  4G8M A;  4KFQ A;  2R71 A;  3G7W A;  4P3L A;  2HXW A;  2XWI A;  1S7Y A;  4OVJ A;  2VPN A;  4MBP A;  1M5D A;  3FAS A;  3IFA A;  2NXO A;  2XX8 A;  4R2B A;  3ILU B;  1LAF E;  3JZJ A;  3OO9 A;  1YZ0 A;  1LEV A;  2THI A;  1NV6 A;  1PDA A;  1N04 A;  3VLW A;  3KOT A;  3S9N C;  5HM4 B;  1PBP A;  1MQH A;  5IZZ A;  3U72 A;  1JNF A;  1N3X A;  2DE2 A;  1R9Q A;  4MLV A;  4ECF A;  3IL1 B;  1OIB A;  4NF6 A;  1TFA A;  2GHA A;  2IEE A;  3HN0 A;  3PUY E;  3H6W A;  4ZEF A;  4E0W A;  1H3D A;  1XT8 A;  4E0X A;  1JW5 A;  3Q27 A;  5IAI A;  1SYI A;  2ZZV A;  3LSF B;  2RCA A;  1TWY A;  2XXK A;  1LFG A;  3K00 A;  1MQI A;  1Y3Q A;  3QK6 A;  2FYI A;  4PF6 A;  1D4N A;  2REG A;  4GL0 A;  3I3V A;  4ZEK A;  1NI9 A;  5I59 A;  4MEV A;  3DLN A;  2ZNT A;  4NF4 B;  4OZ9 A;  4PAF A;  4BDN A;  1M5F A;  1GV8 A;  3ECR A;  4IB2 A;  4QFK A;  1NNF A;  1B58 A;  3IOV A;  4I40 A;  1SD3 A;  5H8N A;  4DZ1 A;  1FQF A;  2QL3 A;  2Y7K A;  5I59 B;  3C4M A;  2WX9 A;  1IME A;  3VLU A;  2Q9T A;  3PU5 A;  4P0G A;  5B7D A;  1WOD A;  2KQZ A;  5I3S A;  3O97 A;  2UVG A;  3C34 A;  2Q88 A;  3T9U A;  1FBF A;  1FBE A;  3SEX A;  3HPI A;  1SBP A;  2RF1 A;  1B4H A;  3T1B A;  1MY3 A;  3QYT A;  1DCU A;  1CE2 A;  1FPK A;  3B6T A;  3VV5 A;  3C36 A;  1UTB B;  5FHO A;  1ZMG A;  3C35 A;  2H5Y A;  1A40 A;  4YAH X;  4C1U A;  4U4S A;  1OMP A;  4OXV A;  3S4U A;  1R9L A;  4YKK A;  3IJO B;  3KJ7 A;  3IOT A;  3A29 A;  3FXU A;  2F6G A;  2HAU A;  4PGP A;  3OEM A;  4F3B A;  1BTJ A;  5DVF A;  3SEY A;  3VE1 B;  2FIE A;  1FQA A;  2UVH A;  4PAI A;  3LC8 A;  3MW0 A;  2O7U A;  3IOW A;  4HE2 A;  3CSG A;  1DBZ A;  4Q0C A;  3E3K A;  3PPN A;  4YB6 A;  4F31 B;  3JV9 A;  4GX6 A;  1NL5 A;  1UTB A;  2FA7 A;  3HFU A;  3G3F A;  4X9T A;  4OAN A;  2WBB A;  1FQC A;  3K1M A;  3IFC A;  1GTK A;  4H6D A;  4OVT A;  3N6T A;  1K9Z A;  5DEX B;  2H98 A;  4JVI A;  2DXY A;  3PMX A;  4WEP A;  1NH8 A;  3KC1 A;  2I0B A;  2V3T A;  4WXJ A;  4ELR A;  3MVY A;  4F39 A;  3CRB A;  3IOU A;  5I2N B;  3ZKL A;  1IMF A;  2XX9 A;  3RPL B;  4DLD A;  4GL8 A;  2PYY A;  4F1Y A;  5LOM A;  4F1V A;  2CEX A;  4ZEB A;  3OOA A;  2VPO A;  3RTF B;  3ONM A;  3K01 A;  1ANF A;  5I84 A;  3I5O A;  2DOJ A;  4DXB A;  5CMB A;  1S9T A;  5ITP A;  1USY H;  4L17 A;  1US4 A;  4H5F A;  3U94 A;  1MG1 A;  1PC3 A;  3QMF A;  1JW4 A;  1IMB A;  1QJM A;  1XHY A;  5KCJ A;  4DI3 D;  4R6K A;  4H65 A;  4FAT A;  4UAB A;  5I2N A;  4U22 A;  4LZ7 A;  4POX A;  4XTC Q;  1JVX A;  1B52 A;  4O3A A;  2VD2 A;  3H06 B;  1ZLQ A;  3USD A;  3MST A;  4ESW A;  5K2Y A;  3FXR A;  3DEL B;  1Y1Z A;  3EQ1 A;  4ELP A;  4IO2 A;  3PPP A;  1S50 A;  2E0S A;  1LCT A;  1MDQ A;  2OWZ A;  3V5A A;  3G3J A;  3VXC A;  2GFE A;  3CSB A;  4KXP A;  2QSX A;  3FV1 A;  4O3C A;  3SEU A;  2UYF A;  4OA4 A;  2O51 A;  4KYS A;  3T0J A;  4PBH A;  3K1P A;  4FBP A;  4MCO A;  4DXU A;  2XD3 A;  1MY4 A;  4X8R A;  3N94 A;  4F3P A;  2V93 A;  4YU0 A;  4O94 A;  2KLF A;  3KN3 A;  3PUX E;  3K1N A;  2ONR A;  1I69 A;  2XXX A;  4RJZ A;  3CR9 A;  1ZBM A;  1FJ9 A;  3CHG A;  1MM7 A;  3N5L A;  4X04 A;  1AOV A;  4G4P A;  3TCH A;  1IXG A;  4OFO A;  1RYX A;  2XA5 A;  1NV1 A;  4OFL A;  4UA8 A;  1A8F A;  2WYP A;  3DP4 A;  3LSX A;  5BUU A;  1H45 A;  3FJM A;  1Y20 A;  5AA4 A;  2F78 A;  3VVE A;  5L9S A;  4PFT A;  1SVX B;  1URD A;  1FRP A;  3KBR A;  1NUZ A;  4H67 A;  3E9X A;  3SER A;  2F3B A;  4OVQ A;  4Z0I A;  3FD3 A;  1UIV A;  4JWO A;  4FIM A;  1QUJ A;  5FHN A;  1NNP A;  2D3I A;  1Z7M E;  4ZS9 A;  1JEV A;  4LON B;  1AMF A;  3S9E A;  1AWB A;  3G3G A;  3TCG A;  5H8F B;  5ET7 A;  4IO5 A;  4O3B A;  4MMP A;  5JEI A;  3KBZ A;  3U65 A;  4F18 A;  4U4X A;  4G68 C;  3TQL A;  2OWT A;  1IIT A;  5HPQ A;  3GZG A;  3TOD A;  4PF8 A;  1P1N A;  4QFO A;  1B6H A;  2HCA A;  2XXT A;  3MVZ A;  3PUW E;  3KG2 A;  4MFI A;  1AH5 A;  4N13 A;  3CFL A;  1CB6 A;  1JET A;  3N6U A;  4GXS B;  2Y7W A;  2OZZ A;  2VOZ A;  4OEN A;  4GX3 A;  2VP1 A;  4KQP A;  1KZ8 A;  4YKJ A;  2F97 A;  1MQG A;  4GIZ A;  1PEB A;  5TP9 B;  2FIX A;  1TT1 A;  3FZV A;  4OER A;  4G77 A;  3KSJ A;  1VFE A;  5EYF A;  1QUI A;  2IA4 A;  4JXI A;  1NUX A;  3OEN A;  4R9F A;  1BP5 A;  1MXZ A;  1RDX A;  2JJK A;  2PFY A;  4M4G A;  5CI5 A;  2DWJ A;  4QSE A;  1OVT A;  4PCD A;  3GBA A;  4MF3 A;  4ZDM A;  2ZZX A;  4YIC A;  4ELQ A;  4FEB A;  1LAH E;  3HHG A;  2Q8J A;  4R72 A;  4PFB A;  3BKI B;  1NUW A;  4G2Z A;  4P56 A;  4TLL B;  1DSN A;  2Y7R A;  2DDK A;  4N07 A;  1N7W A;  3LV0 A;  4O7I A;  3PPR A;  2Y7P A;  3RNN A;  4AB5 A;  2O84 X;  4LN5 A;  3KC0 A;  3THI A;  4NWD A;  4NF8 A;  5F7V A;  4ZE9 A;  3K6X A;  4FOR A;  1B46 A;  2DP8 A;  4NX1 A;  1B1H A;  3EKI A;  4MJO A;  2RC9 A;  3KN8 A;  3R6U A;  3KJT A;  4I8C A;  1LAX A;  3PD8 A;  5AA2 D;  3ISP A;  4GD5 A;  1K9Y A;  3O6G A;  1NMU A;  4DE8 A;  2QFL A;  1URS A;  2V25 A;  2V3Q A;  1B4Z A;  1UTH A;  3MZ1 A;  4F19 A;  1YTV A;  3H6T A;  3QUF A;  1LBX A;  4LQ2 A;  4BLA A;  4R6Y A;  2AIX A;  3PTY A;  2HZK A;  2R9J A;  4U1O A;  3MP1 A;  1UTH B;  1JP4 A;  4OYV A;  5FTH A;  4MNP A;  1D9Q A;  2UVI A;  5I2K B;  4RPO A;  1NV0 A;  3IB1 A;  2XXV A;  1Y9U A;  4F29 A;  5CM6 A;  5IGA A;  1MXV A;  3UK4 A;  4HXV A;  1MDP 1;  2DXR A;  3HHF A;  4IO7 A;  3E13 X;  5H8N B;  3OSR A;  2CMO A;  3M3L A;  1FCK A;  2F3D A;  4G8H A;  1LGB C;  2Y5L A;  1OLC A;  4OHN A;  4NWC A;  4QF9 A;  3H3G A;  4BDQ A;  4JSO A;  3HCQ A;  4IO3 A;  4NAP A;  1Y4T A;  4IR8 A;  2DYX A;  1FPI A;  2L5V A;  4KHZ E;  2E1S A;  4GWW A;  4MHF A;  4AQ4 A;  5I58 B;  2CZK A;  2DE4 A;  1FTA A;  4EXK A;  1QUL A;  4OVS A;  3VVD A;  1DPP A;  2VD3 A;  3KEI A;  1HSJ A;  4P47 A;  4AB6 A;  3G3K A;  2Z22 A;  4PGN A;  5IM2 A;  1B7Z A;  1GGG A;  1NFT A;  4KCC A;  4NGU A;  2UVJ A;  5I7I A;  2DVZ A;  2I3V A;  1DPE A;  3RT6 B;  1MM6 A;  2M8C A;  3B6Q A;  4EQ7 A;  5TPA A;  3D1R A;  1D9V A;  1NKX A;  1EZP A;  3W9V A;  3CI8 A;  4ND9 A;  1MPB A;  2ZYK A;  2CZI A;  2ONK E;  5H8H A;  1FSA A;  3T66 A;  2Y7I A;  2BJI A;  4JWY A;  3ROJ A;  1B40 A;  5CBS A;  4WED A;  4H5G A;  5ICT A;  4HS7 A;  4N17 A;  2LAO A;  4JVD A;  4H0W A;  4O8M A;  1UIU A;  4XIG Q;  5KDT B;  1LCF A;  3FJG A;  1M5E A;  3Q29 A;  5HBC A;  5CMK A;  2OLB A;  1B7H A;  2OCU A;  3R7X A;  4MLQ A;  4QSC A;  4ISU A;  1FTK A;  4DXC A;  3GYY A;  5TU0 A;  4IY6 A;  3MYU A;  1ELJ A;  1DTG A;  2X7P A;  1B3G A;  4N6K A;  1N76 A;  5AA3 A;  4TLM B;  1QKA A;  3E78 A;  4U2R A;  1O64 A;  2ZNS A;  2B3F A;  2NWJ A;  3U92 A;  1UQW A;  1M5B A;  4C1T A;  2OX3 A;  1T0K A;  4OMB A;  5I58 A;  3V89 B;  3EHU A;  4OVR A;  2YPN A;  4XKR A;  3RTW B;  5EQ9 A;  2ANJ A;  2FVZ A;  3CVG A;  2QVR A;  2PCR A;  4NHB A;  4YB7 A;  1JVY A;  2VHA A;  1LST A;  1B1X A;  1IIW A;  1IMC A;  1SW5 A;  2CEY A;  3MBP A;  1MY0 A;  2B4L A;  3TTN A;  3C33 A;  1FBP A;  4OEU A;  2HFB A;  3T9V A;  1POT A;  4R75 A;  1XVX A;  2XXU A;  4KYD A;  5I57 A;  2I3W A;  1B51 A;  4GBV A;  5J16 A;  1MQD A;  4LZ8 A;  4MIJ A;  1YXI A;  5CMC A;  4QHQ A;  4LZ5 A;  3O9P A;  2Z8E A;  4EUO A;  3Q25 A;  2QMX A;  4I9D A;  5CMM A;  4PAK A;  4H1X A;  2XXW A;  3ZKK A;  3BIH A;  1Y3N A;  4ONY A;  2H25 A;  1FJ6 A;  1NNK A;  3PGF A;  2XHD A;  1FBC A;  1USY E;  2CZL A;  2REJ A;  5H8Q A;  5JTY B;  3FGS A;  2R6G E;  1EZO A;  4MX6 A;  2XWO A;  2ZZW A;  5H8S A;  1WVJ A;  3TUS A;  3QUJ A;  4YMA A;  4Z7E A;  3PD9 A;  2QMW A;  4DIG A;  5L9M A;  3T96 B;  2RC8 A;  2I49 A;  2DE3 A;  2XWK A;  2Y84 A;  2KR0 A;  3L6H A;  1VDW A;  3KGC A;  2F6P A;  2I4C A;  2DWH A;  4H8I A;  4GQO A;  5ELV A;  1ZKB A;  3MP8 A;  4RXL A;  1N3W A;  1QVS A;  3K0V A;  4LVQ A;  4N81 A;  2I4B A;  1MH4 A;  2PX1 A;  5ET8 A;  1SW1 A;  2ZXT A;  1R6Z A;  4X48 A;  4U1Z A;  5A5X B;  2A5T B;  2WYK A;  4YB5 A;  5M2V A;  2QVU A;  3B50 A;  1FQB A;  1MPD A;  5JK4 A;  2DWI A;  3TDJ A;  1ZTY A;  2PFZ A;  2VT5 A;  1H76 A;  3V8X B;  4PFU A;  1YYZ A;  3LBS A;  4FEC A;  1Z7N E;  3OSQ A;  3M3F A;  2F8D A;  3V83 A;  2GRV A;  3TEP A;  1KA0 A;  3L6G A;  3RUM A;  2PT2 A;  4NE4 A;  4XFE A;  4N8G A;  4IGR A;  1Y4C A;  3UGW A;  4JSD A;  2DSF A;  4FED A;  4PFW A;  4P0I A;  3KZG A;  4WKM A;  3SZP A;  3TAJ A;  5CBR A;  1LBW A;  2XD2 A;  2VGQ A;  4GBW A;  2Z23 A;  1P1W A;  3KOS A;  1HSL A;  2XWV A;  3CFX A;  3MC2 A;  3IR1 A;  1FPG A;  1IXH A;  1XOC A;  4R73 A;  3G3I A;  4PFY A;  1PB7 A;  2DVC A;  2X7Q A;  4G8N A;  5L9O A;  2RC7 A;  4EDP A;  2ZMB A;  3QSL A;  2P1S A;  3UA8 A;  3TZA A;  3FUZ A;  1EZ9 A;  5H8F A;  1EYK A;  4BDL A;  2XXQ A;  2FNC A;  3K4U A;  4ZED A;  1NV7 A;  2P3N A;  1XVY A;  3TFL A;  1Q9D A;  2D5W A;  2NVU B;  1FPJ A;  1FPB A;  1MS7 A;  3PUV E;  5IZ3 A;  2O6A A;  1B0L A;  4NQ8 A;  4R2F A;  2Q74 A;  1NV3 A;  3C31 A;  4G61 A;  5A5X A;  3H6V A;  1FPF A;  4ZE8 A;  4PE5 B;  3IAZ A;  5AA1 A;  5TPA B;  5I5P A;  1OQG A;  1INP A;  4OEV A;  4ZZE A;  5I57 B;  2WBD A;  5EQ7 A;  1OQH A;  5ICQ A;  1IUD A;  3OEL A;  1B3E A;  2PMS A;  2F34 A;  2WKY A;  3E79 A;  4EF2 A;  5DTB A;  2H4I A;  3EN3 A;  3H6U A;  4N8Y A;  1DMB A;  4PBQ A;  1B9J A;  1SYH A;  4RK9 A;  2FHY A;  4OVP A;  2GQ1 A;  3W9W A;  1EYJ A;  5IZ3 B;  3RGY A;  2B4M A;  3PUZ E;  4MAG A;  3CIJ A;  4N91 A;  4NED A;  1N7X A;  3B8B A;  1GR2 A;  1B5I A;  5FBP A;  2OJT A;  2B65 A;  1URG A;  3RN8 A;  2Y5K A;  3MZB A;  4LQ5 A;  2I58 A;  5JTY A;  4QFL A;  2HQ0 A;  3FVK A;  1LBC A;  1NNT A;  4QFP A;  1Q35 A;  2Z8D A;  2DS9 A;  3OO7 A;  5I56 B;  3LR1 A;  5TP9 A;  2QS3 A;  2YLN A;  1AIV A;  1WDN A;  3HO7 A;  1A55 A;  3O66 A;  3C32 A;  3H03 A;  4ZEI A;  4GWY A;  3Q26 A;  1MXY A;  3AXF A;  3HST A;  4PC9 A;  3LSW A;  4FAJ A;  4NN3 A;  4FE8 A;  3S2V A;  2HHM A;  2HPG A;  3UOR A;  1D3K A;  4QRZ A;  4JBZ A;  4F22 A;  3Q28 A;  3TMG A;  2A5S A;  3KSX A;  1MXU A;  1FW0 A;  4KI0 E;  1B3H A;  3UP9 A;  1B3F A;  1SQY A;  1B3L A;  4AS5 A;  1ZIU A;  3QAX A;  2F7B A;  2ZYN A;  3MVW A;  4JWX A;  3TTL A;  4C0R A;  4N6P A;  3IO4 A;  1NH7 A;  4P1L A;  4BDR A;  2OK2 A;  2I0C A;  2O7I A;  1DK4 A;  1IMA A;  4TOZ A;  4GWX A;  2XXH A;  4X1B A;  1F9B A;  1FBH A;  1IZ1 A;  1BLF A;  4I62 A;  1QW0 A;  4O7M A;  3TEL A;  3BFU A;  4BDM A;  3IO6 A;  1DTZ A;  3WAE A;  4JVC A;  4NMY A;  3QXM A;  4BDO A;  3VXB A;  4GWO A;  3T9X B;  4IGT A;  3GLB A;  3KN7 A;  3S9L C;  3O6H A;  1AL3 A;  1SDX A;  3I6V A;  3OEK A;  4PDH A;  2ONS A;  2RCB A;  2MKZ A;  4PQJ A;  4F2Q A;  2QPQ A;  4MNI A;  1XI6 A;  3U1O A;  2XXP A;  3DM0 A;  5AA2 A;  2Q2C A;  5K2X A;  2F7A A;  1LFH A;  1Y1M A;  1QUK A;  1IMD A;  3D4G A;  2AYS A;  3UN6 A;  1LAG E;  1FPE A;  5FTI A;  3S9M C;  2O1L A;  1MRP A;  2ABH A;  2CZH A;  3U93 A;  2NOO A;  4PTK A;  5KDT A;  4MH5 A;  4POW A;  1PB8 A;  1IEJ A;  1NV5 A;  3WAF A;  3O6I A;  4XF5 A;  3CFZ A;  4PFR A;  1MPC A;  3BBR A;  1IQ7 A;  3O29 A;  1B05 A;  4RNS A;  1P1Q A;  1B32 A;  1TXF A;  4GWZ A;  1EU8 A;  1A7L A;  3CG1 A;  1KA1 A;  4OFJ A;  1I6B A;  5LDZ A;  4DDD A;  4F3S A;  3IB2 A;  4IO6 A;  3PV0 E;  1A54 A;  1I6A A;  3OXN A;  4JDF A;  5ET6 A;  1ZJL A;  4GWU A;  2ESN A;  3DP8 A;  2UYE A;  5L8D A;  4PFI A;  4QXD A;  2F7C A;  2NUV A;  2ZNU A;  2QS2 A;  4EF1 A;  2O68 A;  1A99 A;  1G0I A;  3EPE A;  4NG7 A;  4HE1 A;  3TPA A;  4JB7 A;  1LB8 A;  5KCJ B;  4DCX A;  4UAC A;  3E4R A;  4HW8 A;  1YPN A;  3MZ9 A;  3MVX A;  3ZSF A;  1DOT A;  3D4C A;  4NTL A;  4ELO A;  1SW2 A;  4LAT A;  4PP0 A;  4N6D A;  1FBD A;  3MPL A;  1ATG A;  1FPD A;  2PVU A;  4LUB A;  1M5C A;  5KZT A;  1FPL A;  4ZZA A;  3LUZ A;  1Y3P A;  2F5X A;  5ET5 A;  2I6E A;  5F24 A;  1CNQ A;  2Z8F A;  5ISU A;  2ZYM A;  5EQA A;  1P99 A;  5CC2 A;  3M8U A;  1MY1 A;  3T93 B;  1D9Y A;  2FBP A;  4KYE A;  4M1V A;  5I56 A;  5B70 A;  4TQU Q;  1H44 A;  4THI A;  1YAE A;  1LBZ A;  2G93 A;  4ZEC A;  3SES A;  5I2K A;  5AA4 B;  4HE0 A;  5FHM A;  3FVG A;  2Q8M A;  3TTK A;  3MQ9 A;  3IJX B;  4NF0 A;  4P1E A;  4GXA A;  1OVB A;  4R6H A;  3RYD A;  1BKA A;  4OES A;  3O2A A;  3IX1 A;  4RYA A;  3TTR A;  1POY 1;  2P0S A;  4ESX A;  4XEQ A;  3OD7 A;  1KWH A;  1YCJ A;  4N15 A;  1PB9 A;  2P3V A;  1VSO A;  2ALU A;  4IO4 A;  1RDY A;  1LLS A;  4NF8 B;  5T3J A;  1R1N A;  3RQT A;  1P1O A;  3FJ7 A;  1HSE A;  3MWB A;  2XXR A;  5AA2 B;  2QRY A;  1VR5 A;  2QJE A;  4IY5 A;  1FTM A;  1JEU A;  3OMB A;  5ESY A;  1IXI A;  3LUY A;  3SEW A;  4GLI A;  1SPI A;  4GFR A;  3M3K A;  2PT1 A;  1MXX A;  4K3F A;  4OWD A;  2DWA A;  4DCY A;  3PPO A;  1MXW A;  3IOR A;  4PDD A;  1LBV A;  4NF4 A;  4GF8 A;  3DP6 A;  1LBB A;  4X1D A;  3VLV A;  3T22 A;  5IZ1 A;  4I3E A;  4KCD A;  5DT6 A;  2XXY A;  2V84 A;  5EHM A;  4YMB A;  1ZU0 A;  3K6U A;  4NF5 A;  4N4U A;  4LP2 B;  5IKB A;  1JQF A;  4H46 A;  3MUQ A;  4HCY A;  3HV1 A;  5EQ8 A;  3B7D A;  5EYH A;  3EHS A;  1XS5 A;  3O28 A;  2V3U A;  3ODB A;  4Q8R A;  1B5H A;  3B6W A;  4XKQ A;  2HXR A;  4GVO A;  1MQJ A;  3CG3 A;  2D21 A;  1FTO A;  4Q5T A;  4YZZ A;  3T9H B;  1N84 A;  2ZYO A;  1FQE A;  4F2O A;  1G0H A;  3KFM A;  4HCW A;  1IXC A;  2Q2A A;  3G3H A;  3FVN A;  2GH9 A;  2H9B A;  4G68 A;  2B3B A;  5DVI A;  5J1D A;  4U21 A;  1RYO A;  3LSL A;  2GHB A;  1OLA A;  3SEV A;  3BIG A;  5H8H B;  3ZS6 A;  1O7T A;  1PBQ A;  3W15 C;  3FVO A;  4AS4 A;  1II5 A; 
#chains in the Genus database with same CATH homology
 2OWS A;  3ONM A;  3FVK A;  1ANF A;  1LBC A;  1RKM A;  1NNT A;  3K01 A;  5I84 A;  4QFP A;  1B7Z A;  1GGG A;  1NFT A;  1Q35 A;  2Z8D A;  1L5T A;  2DS9 A;  3I5O A;  4KCC A;  2DOJ A;  2UVJ A;  3OO7 A;  3TTM A;  4QFN A;  4DXB A;  3LR1 A;  5CMB A;  4F3G A;  5I56 B;  1S9T A;  2DVZ A;  2QS3 A;  2I3V A;  2YLN A;  5TP9 A;  4F22 A;  3QIM A;  1AIV A;  1DPE A;  5ITP A;  1WDN A;  1USY H;  3HO7 A;  3MP6 A;  4L17 A;  1A55 A;  3RT6 B;  4U23 A;  3O66 A;  4XXU A;  1A8E A;  1MM6 A;  1J1N A;  2M8C A;  3C32 A;  3H03 A;  3B6Q A;  1US4 A;  3FAT A;  3K6W A;  4ZEI A;  4EQ7 A;  3OO8 A;  4H5F A;  3Q26 A;  3A09 A;  1MG1 A;  1PC3 A;  4R74 A;  5TPA A;  3U94 A;  1JW4 A;  1MXY A;  1QJM A;  3AXF A;  3HST A;  1D9V A;  1XHY A;  3LSW A;  5KCJ A;  1NKX A;  4FAJ A;  1EZP A;  3W9V A;  2I48 A;  3CI8 A;  4FE8 A;  4ND9 A;  3TQW A;  4R6K A;  4P11 A;  1MPB A;  5DYH A;  3S2V A;  3UOR A;  4H65 A;  3JYR A;  1D3K A;  4KPT A;  4NF5 B;  3RY3 A;  4FAT A;  4QRZ A;  1MY2 A;  2ZYK A;  2ONK E;  1TFD A;  3TYH A;  5H8H A;  3K2D A;  5I2N A;  4U22 A;  4JBZ A;  4LZ7 A;  2Y7I A;  4JWY A;  4POX A;  4XTC Q;  3RLF E;  3T66 A;  1JVX A;  1B52 A;  3MJN A;  3Q28 A;  1B40 A;  1BIY A;  1SI0 A;  3TMG A;  2A5S A;  3KSX A;  4O3A A;  1MXU A;  4EXL A;  5CBS A;  2VD2 A;  4WED A;  3C9H A;  4H5G A;  1FW0 A;  5ICT A;  4HS7 A;  3H06 B;  4KI0 E;  1JW1 A;  1B3H A;  2LAO A;  1ZLQ A;  3UP9 A;  3USD A;  4ESW A;  1B3F A;  4RK2 A;  4H0W A;  5K2Y A;  2XX7 A;  4XIG Q;  1UIU A;  1SQY A;  1B3L A;  2W7Y A;  5KDT B;  1ZIU A;  3FV2 A;  1LCF A;  3MAM A;  3QAX A;  3FJG A;  2F7B A;  3FXR A;  1M5E A;  2ZYN A;  3MVW A;  3A3C A;  4JWX A;  3TTL A;  3SET A;  4C0R A;  3DEL B;  1Y1Z A;  4N6P A;  1LFI A;  3Q29 A;  5HBC A;  5CRY A;  3EQ1 A;  5CMK A;  2OLB A;  3RT8 A;  4ELP A;  3IO4 A;  4IO2 A;  1B7H A;  1NH7 A;  1N0T A;  2OCU A;  1H43 A;  4OET A;  3SDF A;  3R7X A;  3GXA A;  3PPP A;  4BDR A;  2OK2 A;  1S50 A;  2I0C A;  4MLQ A;  4QSC A;  4ISU A;  2O7I A;  2E0S A;  1FTK A;  4DXC A;  2O1M A;  5TU0 A;  1LCT A;  5EHS A;  1MDQ A;  4KD5 A;  1SW4 A;  3V5A A;  3G3J A;  3F11 A;  4TOZ A;  2GFE A;  3CSB A;  3VXC A;  2XXH A;  2QSX A;  4IY6 A;  1ELJ A;  1DTG A;  2X7P A;  1B3G A;  3FV1 A;  1N76 A;  4O3C A;  1F9B A;  4X1B A;  3SEU A;  5AA3 A;  4TLM B;  1QKA A;  4U2R A;  2UYF A;  1O64 A;  2AL5 A;  2ZNS A;  2O51 A;  1IZ1 A;  4KYS A;  3K1P A;  2B3F A;  1BLF A;  4I62 A;  2NWJ A;  3RPW A;  3U92 A;  1QW0 A;  4I1D A;  4R9G A;  4XKN A;  1UQW A;  3TEL A;  5BWJ A;  3BFU A;  1QKB A;  4BDM A;  4DXU A;  4QSD A;  3VFJ A;  2XD3 A;  3OO6 A;  3IO6 A;  1DTZ A;  3WAE A;  4NMY A;  4BDO A;  1MY4 A;  1M5B A;  3H4Z A;  3N94 A;  3QXM A;  2V93 A;  4C1T A;  4F3P A;  3VXB A;  5AE4 A;  4YU0 A;  4GWO A;  4LA9 A;  2HEU A;  3T9X B;  4IGT A;  2A5T A;  3GLB A;  1T0K A;  2KLF A;  3KN7 A;  2XXI A;  3S9L C;  3KN3 A;  4OMB A;  3O6H A;  1AL3 A;  3PUX E;  5I58 A;  1P1U A;  2AL4 A;  1SDX A;  3I6V A;  3K1N A;  2ONR A;  3GBB A;  3OEK A;  1I69 A;  2ONS A;  2XXX A;  4RJZ A;  2RCB A;  3VDF A;  3CR9 A;  3V89 B;  3PMV A;  1ZBM A;  2DQV A;  2PBW A;  3V8X B;  4PQJ A;  4FJP A;  1MM7 A;  4UAC A;  1O63 A;  1B7U A;  3N5L A;  5DVJ A;  3MPK A;  3EHU A;  3K02 A;  2QPQ A;  4F2Q A;  3U1O A;  1VE4 A;  2RKM A;  2YPN A;  1AOV A;  4G4P A;  4XKR A;  1IXG A;  3RTW B;  3TCH A;  4OFO A;  4H8J A;  1RYX A;  2XXP A;  2O69 A;  3DM0 A;  2Q2C A;  4RPN A;  4OFL A;  4UA8 A;  1A8F A;  2ANJ A;  3TCF A;  3DP4 A;  4OQO A;  4HW8 A;  3CVG A;  2BJJ X;  3LSX A;  5K2X A;  5BUU A;  1B2H A;  2F7A A;  4YB7 A;  1LFH A;  5ITO A;  1H45 A;  1Y1M A;  1JVY A;  2VHA A;  3FJM A;  2P2A A;  1QUK A;  1Y20 A;  3D4G A;  3IK6 B;  4GRK A;  4HTG A;  5AA4 A;  1B5J A;  1LST A;  2AYS A;  2F78 A;  1B1X A;  1LAG E;  3FIR A;  5FTI A;  3UN6 A;  1IIW A;  3S9M C;  3VVE A;  2O1L A;  5L9S A;  4PFT A;  2H99 A;  1MRP A;  2ABH A;  3IB0 A;  1SVX B;  1SW5 A;  3U93 A;  1URD A;  3EHT A;  2NOO A;  1FTL A;  3KBR A;  1Q1K A;  4NF6 B;  4EQ9 A;  4MH5 A;  5KDT A;  4POW A;  1PB8 A;  3ILT B;  3MBP A;  1IEJ A;  5H8Q B;  1MY0 A;  3U8Q A;  4H67 A;  3TTN A;  2G29 A;  3E9X A;  3WAF A;  3C33 A;  3SER A;  1GVC A;  4ELO A;  3O6I A;  4OEU A;  3CFZ A;  4OTE A;  2YJP A;  2HFB A;  3T9V A;  3VVF A;  1POT A;  2QS1 A;  4Z0I A;  3FD3 A;  1MPC A;  4R75 A;  1XVX A;  3BBR A;  1UIV A;  2XXU A;  1XC1 A;  3A3U A;  4RY1 A;  4KYD A;  1SI1 A;  3EF7 A;  1IQ7 A;  3BFT A;  4JWO A;  5I57 A;  2I3W A;  1B51 A;  3O29 A;  4FIM A;  1QUJ A;  3TKD A;  1MQD A;  1B05 A;  2HAV A;  4LZ8 A;  1NNP A;  4G68 B;  5FHN A;  3K6V A;  4RNS A;  1P1Q A;  2D3I A;  1B32 A;  1TXF A;  1LB9 A;  1Z7M E;  2QS4 A;  4XKP A;  5CMC A;  4ZS9 A;  4QHQ A;  1JEV A;  3P7I A;  1EU8 A;  4LZ5 A;  4ELQ A;  4LON B;  3O9P A;  1MH3 A;  1A7L A;  1AMF A;  2UXA A;  3G3G A;  3S9E A;  3CG1 A;  3TCG A;  2Z8E A;  5F1Q A;  5H8F B;  4EUO A;  4EQB A;  3Q25 A;  3R26 A;  4OFJ A;  4IO5 A;  2QMX A;  4O3B A;  1I6B A;  4RA1 A;  4I9D A;  5CMM A;  3UIF A;  2F35 A;  2Q89 A;  3H7M A;  3N26 A;  4H1X A;  2XXW A;  1FTJ A;  3ZKK A;  5JEI A;  4DDD A;  4F3S A;  4YKI A;  4F18 A;  1Y3N A;  3IB2 A;  4ONY A;  2F36 A;  3PMW A;  4F1U A;  2H25 A;  4IO6 A;  1NNK A;  4U4X A;  3PV0 E;  1A54 A;  1I6A A;  4G68 C;  3TQL A;  2HZL A;  1US5 A;  3OXN A;  3PPQ A;  4GOT A;  2OWT A;  3PGF A;  4JDF A;  1ZJL A;  1IIT A;  5HPQ A;  2ESN A;  3DP8 A;  2XHD A;  1EH3 A;  5DEX A;  3FXQ A;  3GZG A;  1USY E;  2CZL A;  2REJ A;  5H8Q A;  3TOD A;  1P1N A;  2UYE A;  4QFO A;  2OBG A;  1B6H A;  3FGS A;  5JTY B;  2RIN A;  2R6G E;  5L8D A;  2HCA A;  1EZO A;  1VFD A;  2X26 A;  2XXT A;  5JTY A;  3MVZ A;  2F7C A;  4YKP A;  2NUV A;  2ZNU A;  5H8S A;  3PUW E;  1WVJ A;  3KG2 A;  3TUS A;  3QUJ A;  4MFI A;  4YMA A;  3PD9 A;  2QMW A;  4DIG A;  4Z7E A;  1AH5 A;  4PET A;  4KR5 A;  5L9M A;  2RC8 A;  3SKP A;  3T96 B;  2QS2 A;  4N13 A;  2O68 A;  4Q30 B;  1FQD A;  3CFL A;  4EF1 A;  2I49 A;  1A99 A;  1I6Q A;  1CB6 A;  2DE3 A;  3EPE A;  3TPA A;  2Y84 A;  4JB7 A;  3L6H A;  1B0H A;  1LB8 A;  1JET A;  5KCJ B;  3N6U A;  3KGC A;  2F6P A;  2I4C A;  3E4R A;  2DWH A;  2R71 A;  4G8M A;  2Y7W A;  4GXS B;  1YPN A;  2OZZ A;  2VOZ A;  3G7W A;  3MVX A;  3MZ9 A;  4GQO A;  4OEN A;  5ELV A;  1ZKB A;  2HXW A;  2VP1 A;  4KQP A;  3ZSF A;  1DOT A;  3MP8 A;  1S7Y A;  3D4C A;  4NTL A;  4MBP A;  1N3W A;  4OVJ A;  1QVS A;  3K0V A;  2F97 A;  4LVQ A;  1M5D A;  3FAS A;  1SW2 A;  4YKJ A;  2I4B A;  1MQG A;  2NXO A;  4LAT A;  1MH4 A;  4GIZ A;  2PX1 A;  2XX8 A;  4R2B A;  1PEB A;  1SW1 A;  3ILU B;  5TP9 B;  4PP0 A;  1LAF E;  3JZJ A;  3OO9 A;  2ZXT A;  1R6Z A;  2THI A;  4X48 A;  4U1Z A;  5A5X B;  2A5T B;  3MPL A;  4YB5 A;  1ATG A;  5M2V A;  1TT1 A;  2PVU A;  1PDA A;  4LUB A;  1N04 A;  3FZV A;  4OER A;  3VLW A;  1M5C A;  5KZT A;  3KOT A;  4G77 A;  3KSJ A;  1FQB A;  1PBP A;  1VFE A;  4ZZA A;  5HM4 B;  1MPD A;  3S9N C;  5JK4 A;  2DWI A;  3TDJ A;  1MQH A;  1ZTY A;  3U72 A;  1QUI A;  1Y3P A;  2F5X A;  2IA4 A;  5EYF A;  4JXI A;  1JNF A;  1H76 A;  1N3X A;  2DE2 A;  2I6E A;  2Z8F A;  2ZYM A;  1R9Q A;  1P99 A;  3OEN A;  4PFU A;  3M8U A;  4R9F A;  4MLV A;  1BP5 A;  4ECF A;  5CC2 A;  1MY1 A;  3T93 B;  1D9Y A;  4M1V A;  3IL1 B;  1MXZ A;  4KYE A;  1OIB A;  3LBS A;  4FEC A;  4NF6 A;  5I56 A;  1TFA A;  5B70 A;  2GHA A;  2IEE A;  3HN0 A;  4M4G A;  3PUY E;  2DWJ A;  1Z7N E;  3OSQ A;  4QSE A;  3M3F A;  4TQU Q;  2F8D A;  5CI5 A;  1H44 A;  3V83 A;  4THI A;  1YAE A;  1OVT A;  3H6W A;  4ZEF A;  2GRV A;  3GBA A;  1H3D A;  1XT8 A;  4E0W A;  2G93 A;  3TEP A;  4E0X A;  4ZEC A;  1JW5 A;  3L6G A;  3Q27 A;  4MF3 A;  3SES A;  5I2K A;  5IAI A;  5AA4 B;  3RUM A;  5FHM A;  2PT2 A;  4NE4 A;  4ZDM A;  3FVG A;  4H8I A;  1SYI A;  3LSF B;  2RCA A;  4YIC A;  4IGR A;  1TWY A;  3TTK A;  1LFG A;  3K00 A;  4FEB A;  1MQI A;  1Y4C A;  3IJX B;  3MQ9 A;  4JSD A;  1Y3Q A;  2DSF A;  1LAH E;  4FED A;  3HHG A;  4PFW A;  4DCX A;  4GXA A;  1OVB A;  3QK6 A;  4R6H A;  2FYI A;  1BKA A;  4OES A;  3O2A A;  4R72 A;  2Q8J A;  1D4N A;  2REG A;  3KZG A;  3BKI B;  4P0I A;  4WKM A;  3IX1 A;  3TAJ A;  5CBR A;  4G2Z A;  4RYA A;  2XD2 A;  4TLL B;  1DSN A;  1POY 1;  2Y7R A;  3TTR A;  4GL0 A;  2P0S A;  4ESX A;  4N07 A;  3I3V A;  3OD7 A;  4ZEK A;  1KWH A;  1YCJ A;  1N7W A;  5I59 A;  2VGQ A;  5ISU A;  1PB9 A;  2Z23 A;  2ZNT A;  1P1W A;  2Y7P A;  3DLN A;  3PPR A;  4NF4 B;  3RNN A;  1VSO A;  4AB5 A;  4OZ9 A;  2O84 X;  4RXL A;  4BDN A;  1M5F A;  2ALU A;  3KOS A;  4NWD A;  1HSL A;  4IO4 A;  3THI A;  1GV8 A;  3CFX A;  3ECR A;  4IB2 A;  4NF8 A;  1LLS A;  3MC2 A;  5F7V A;  4ZE9 A;  4NF8 B;  3K6X A;  1NNF A;  4FOR A;  1B46 A;  4QFK A;  1R1N A;  2DP8 A;  3IR1 A;  3RQT A;  5AA2 A;  1B1H A;  1B58 A;  1P1O A;  1IXH A;  3IOV A;  1XOC A;  1SD3 A;  3G3I A;  4R73 A;  2RC9 A;  4PFY A;  5H8N A;  4DZ1 A;  1FQF A;  1PB7 A;  2QL3 A;  2Y7K A;  2DVC A;  3FJ7 A;  3KN8 A;  1HSE A;  3R6U A;  3KJT A;  2X7Q A;  3MWB A;  4I8C A;  5I59 B;  3C4M A;  4G8N A;  1LAX A;  2XXR A;  3PD8 A;  3VLU A;  2Q9T A;  5AA2 B;  5AA2 D;  3PU5 A;  5L9O A;  2QRY A;  2RC7 A;  1VR5 A;  4GD5 A;  4P0G A;  5B7D A;  1WOD A;  3O6G A;  4EDP A;  2ZMB A;  3O97 A;  1NMU A;  2QJE A;  2UVG A;  1FTM A;  3QSL A;  4IY5 A;  1JEU A;  2P1S A;  3C34 A;  1IXI A;  3OMB A;  3LUY A;  3UA8 A;  3SEW A;  4GLI A;  3TZA A;  4DE8 A;  3FUZ A;  1EZ9 A;  4GFR A;  2Q88 A;  3M3K A;  2PT1 A;  1URS A;  5H8F A;  3T9U A;  2V25 A;  1MXX A;  4BDL A;  2V3Q A;  2XXQ A;  3SEX A;  3HPI A;  2FNC A;  1B4Z A;  1UTH A;  3K4U A;  1SBP A;  2RF1 A;  4K3F A;  4ZED A;  4OWD A;  1B4H A;  3MZ1 A;  2DWA A;  1MY3 A;  3QYT A;  4DCY A;  4F19 A;  1CE2 A;  3B6T A;  1XVY A;  3VV5 A;  3C36 A;  1UTB B;  5FHO A;  4KFQ A;  3TFL A;  3PPO A;  1MXW A;  1YTV A;  1ZMG A;  3H6T A;  3C35 A;  3IOR A;  2H5Y A;  3QUF A;  2D5W A;  4LQ2 A;  4GF8 A;  3DP6 A;  4NF4 A;  2NVU B;  3UGW A;  4BLA A;  1A40 A;  1LBB A;  4YAH X;  4C1U A;  4X1D A;  4U4S A;  1OMP A;  4OXV A;  3S4U A;  1R9L A;  4R6Y A;  3T22 A;  3VLV A;  4YKK A;  4KCD A;  5DT6 A;  2XXY A;  2V84 A;  3IJO B;  5EHM A;  2AIX A;  4YMB A;  1ZU0 A;  3KJ7 A;  1MS7 A;  3K6U A;  3PUV E;  2HZK A;  2R9J A;  4NF5 A;  5IKB A;  3IOT A;  4LP2 B;  2O6A A;  4U1O A;  3MP1 A;  1B0L A;  4R2F A;  3FXU A;  1UTH B;  1JQF A;  2F6G A;  2HAU A;  3C31 A;  4OYV A;  5FTH A;  5A5X A;  3MUQ A;  2UVI A;  3H6V A;  4ZE8 A;  5I2K B;  4HCY A;  3HV1 A;  4PE5 B;  3IAZ A;  4RPO A;  3OEM A;  3IB1 A;  5AA1 A;  4F3B A;  1BTJ A;  5TPA B;  5DVF A;  1OQG A;  3B7D A;  3SEY A;  4OEV A;  3VE1 B;  3EHS A;  4ZZE A;  5I57 B;  2XXV A;  1FQA A;  2UVH A;  1Y9U A;  1XS5 A;  4F29 A;  5CM6 A;  3O28 A;  3LC8 A;  2V3U A;  3ODB A;  3MW0 A;  1MXV A;  1OQH A;  4Q8R A;  3UK4 A;  1B5H A;  2O7U A;  5ICQ A;  3IOW A;  1IUD A;  1MDP 1;  3CSG A;  3OEL A;  1B3E A;  2PMS A;  3B6W A;  2DXR A;  3HHF A;  4XKQ A;  2F34 A;  2WKY A;  4Q0C A;  4EF2 A;  3E3K A;  3PPN A;  4YB6 A;  4F31 B;  5DTB A;  2H4I A;  3EN3 A;  3JV9 A;  3E13 X;  4GVO A;  4IO7 A;  5H8N B;  1NL5 A;  3OSR A;  3H6U A;  2CMO A;  1MQJ A;  1UTB A;  2FA7 A;  3CG3 A;  3M3L A;  3G3F A;  1FCK A;  4X9T A;  2D21 A;  4G8H A;  1DMB A;  1B9J A;  1LGB C;  1OLC A;  1FQC A;  3K1M A;  4OHN A;  1FTO A;  1SYH A;  4Q5T A;  4RK9 A;  4YZZ A;  3T9H B;  1N84 A;  2ZYO A;  1FQE A;  1GTK A;  4NWC A;  4F2O A;  3KFM A;  4QF9 A;  4HCW A;  4H6D A;  3W9W A;  1IXC A;  2Q2A A;  3N6T A;  3G3H A;  5DEX B;  3H3G A;  4BDQ A;  2H98 A;  3FVN A;  2GH9 A;  2H9B A;  2DXY A;  3RGY A;  4G68 A;  4JSO A;  2B3B A;  3PMX A;  3HCQ A;  3PUZ E;  4WEP A;  5DVI A;  1NH8 A;  3CIJ A;  2I0B A;  4IO3 A;  5J1D A;  4U21 A;  1RYO A;  3LSL A;  2V3T A;  4NED A;  1Y4T A;  2GHB A;  4WXJ A;  4ELR A;  1N7X A;  1OLA A;  3MVY A;  1GR2 A;  3SEV A;  5H8H B;  3CRB A;  3IOU A;  2DYX A;  1B5I A;  4QFL A;  4F39 A;  3ZS6 A;  5I2N B;  2OJT A;  3ZKL A;  4KHZ E;  2E1S A;  2B65 A;  1O7T A;  1URG A;  1PBQ A;  3RN8 A;  4AQ4 A;  5I58 B;  2XX9 A;  2DE4 A;  3W15 C;  3MZB A;  4DLD A;  4EXK A;  1QUL A;  3FVO A;  4GL8 A;  2PYY A;  4LQ5 A;  3VVD A;  4F1Y A;  1DPP A;  1II5 A;  2VD3 A;  5LOM A;  3KEI A;  1HSJ A;  4F1V A;  4AB6 A;  2I58 A;  3G3K A;  4ZEB A;  3OOA A;  2Z22 A;  3RTF B;  2HQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...