1OIDA

5'-nucleotidase (e. coli) with an engineered disulfide bridge (s228c, p513c)
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
525
structure length
525
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGCNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKCGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trapping a 96 Degree Domain Rotation in Two Distinct Conformations by Engineered Disulfide Bridges
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN USHA
total genus 172
structure length 525
sequence length 525
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1oidA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1oidA02
4UT2A 2Z72A 3GVEA 3H69A 4J6OA 4JA7A 4FBQA 4UT3B 1TCOA 1FJMA 1S8EA 4HD0A 5B8IA 4ORBA 3RQZA 3QFNA 1S3MA 3JYFA 3RL4A 2ZBMA 4WWLA 4UT3A 2WDEA 3PSOA 4MP0A 3K7WC 4M0VA 5IOHA 4V0WA 3DW8C 4KKZA 2BDXA 4OR9A 2JOGA 1OIEA 3DSCA 3QFMA 5DNYA 1T71A 4H1YP 3P71C 2BQ8X 3E7BA 3T1IA 3AV0A 4YKEA 3TGHA 4H2FA 4B2OA 4KBPA 3QG5C 1HP1A 1V73A 3H63A 3H66A 1S3LA 4O5GA 3DSDA 3C5WC 1T70A 1IT6A 4I5LC 4DHLA 3IB8A 4H2IA 4ORAA 3RL3A 3LL8A 4IL1A 3ZTVA 4IYPC 5GTUA 2NPPC 1USHA 3QFOA 5HPEA 1NNWA 2NXFA 2QJCA 1U32A 3H64A 4ORCA 1SU1A 1Z2XA 2CV9A 4I5NC 2O8GA 3H61A 3V4YA 4O43A 3THOB 3H67A 1M63A 4H2GA 2Z1AA 2P6BA 4LACC 5JJTA 2IE3C 4FBWA 5F3WA 3IVDA 1KBPA 4NZVA 1AUIA 5J28A 1UF3A 1XM7A 4ZX2A 4LU9A 4MOYA 1S95A 1WAO1 1II7A 5JPEA 3PSNA 4LTYA 4Q7FA 3N5UA 4V0VA 4XPNA 4O4KA 2DFJA 2IE4C 1UTEA 3KBPA 1Z2WA 2HY1A 1QHWA 1WARA 1S3NA 1JK7A 5INBA 2QFPA 2NYLC 3EGGA 4H2BA 3ZU0A 3RL5A 2A22A 2WDFA 3E7AA 2Z06A 4G9JA 4TUIA 2HYPA 3H60A 2AHDA 4FCXA 1QFCA 1S70A 2GJUA 2KKNA 2Q8UA 4F0ZA 4DSYA 4O24A 2HYOA 4TUGA 4V0XA 4FBKA 3K7VC 1XZWA 2IAEC 2QFRA 2XMOA 1MF8A 3QFKA 3IVEA 1W24A 1HO5A 5JPFA 4MOVA 1OIDA 3H68A 2WDCA 3IB7A 2USHA 2YVTA 2WDDA 3CK2A 4UWQA 3THNA 3ICFA 4JA9A 3FGAC 4DT2A 1OI8A 5EQVA 4H1SA 3H62B 1G5BA 1HPUA 2O8AA 3HVQA 2R17A 3AUZA 3EGHA 5C1VA 3C9FA 2NYMC 2BCDA 4ZVZA
chains in the Genus database with same CATH superfamily
4UT2A 2Z72A 3GVEA 3H69A 4J6OA 4JA7A 4FBQA 4UT3B 1TCOA 1FJMA 1S8EA 4HD0A 5B8IA 4ORBA 2DXNA 3RQZA 3QFNA 1S3MA 3JYFA 3RL4A 2ZBMA 4WWLA 4UT3A 2WDEA 3PSOA 4MP0A 3K7WC 4M0VA 5IOHA 4V0WA 3DW8C 4KKZA 2BDXA 4OR9A 2JOGA 1OIEA 3DSCA 3QFMA 5DNYA 1T71A 4H1YP 3P71C 2BQ8X 3E7BA 3T1IA 3AV0A 4YKEA 3TGHA 4H2FA 4B2OA 4KBPA 3QG5C 1HP1A 1V73A 3H63A 3H66A 1S3LA 4O5GA 3DSDA 3C5WC 1T70A 1IT6A 4I5LC 4DHLA 3IB8A 4H2IA 4ORAA 3RL3A 3LL8A 4IL1A 3ZTVA 4IYPC 5GTUA 2NPPC 1USHA 3QFOA 5HPEA 1NNWA 2NXFA 2QJCA 1U32A 3H64A 4ORCA 1SU1A 1Z2XA 2CV9A 4I5NC 2O8GA 3H61A 3V4YA 4O43A 3THOB 3H67A 1M63A 4H2GA 2Z1AA 2P6BA 4LACC 5JJTA 2ZO9B 2IE3C 4FBWA 5F3WA 3IVDA 1KBPA 4NZVA 1AUIA 5J28A 1UF3A 1XM7A 4ZX2A 4LU9A 4MOYA 1S95A 1WAO1 1II7A 5JPEA 3PSNA 4LTYA 4Q7FA 3N5UA 4V0VA 4XPNA 4O4KA 2DFJA 2YEQA 2IE4C 2DXLA 1UTEA 3KBPA 1Z2WA 2HY1A 1QHWA 1WARA 1S3NA 3FLOA 1JK7A 5INBA 2QFPA 2NYLC 3EGGA 4H2BA 3ZU0A 3RL5A 2A22A 2WDFA 3E7AA 2Z06A 4G9JA 4TUIA 3E0JA 2HYPA 3H60A 2AHDA 4FCXA 1QFCA 1S70A 2GJUA 2KKNA 2Q8UA 4F0ZA 4DSYA 4O24A 2HYOA 4TUGA 4V0XA 4FBKA 3K7VC 1XZWA 2ZOAA 2IAEC 2QFRA 2XMOA 1MF8A 3QFKA 3IVEA 1W24A 1HO5A 5JPFA 4MOVA 1OIDA 3H68A 2WDCA 3IB7A 2USHA 2YVTA 2WDDA 3CK2A 4UWQA 3THNA 3ICFA 4JA9A 3FGAC 4DT2A 1OI8A 5EQVA 4H1SA 3H62B 1G5BA 1HPUA 2O8AA 3HVQA 2R17A 3AUZA 3EGHA 3D03A 5C1VA 3C9FA 2NYMC 2BCDA 4ZVZA
chains in the Genus database with same CATH topology
4UT2A 2Z72A 3GVEA 3H69A 4J6OA 4JA7A 4FBQA 4UT3B 1TCOA 1FJMA 1S8EA 4HD0A 5B8IA 4ORBA 2DXNA 3RQZA 3QFNA 1S3MA 3JYFA 3RL4A 2ZBMA 4WWLA 4UT3A 2WDEA 3PSOA 4MP0A 3K7WC 4M0VA 5IOHA 4V0WA 3DW8C 4KKZA 2BDXA 4OR9A 2JOGA 1OIEA 3DSCA 3QFMA 5DNYA 1T71A 4H1YP 3P71C 2BQ8X 3E7BA 3T1IA 3AV0A 4YKEA 3TGHA 4H2FA 4B2OA 4KBPA 3QG5C 1HP1A 1V73A 3H63A 3H66A 1S3LA 4O5GA 3DSDA 3C5WC 1T70A 1IT6A 4I5LC 4DHLA 3IB8A 4H2IA 4ORAA 3RL3A 3LL8A 4IL1A 3ZTVA 4IYPC 5GTUA 2NPPC 1USHA 3QFOA 5HPEA 1NNWA 2NXFA 2QJCA 1U32A 3H64A 4ORCA 1SU1A 1Z2XA 2CV9A 4I5NC 2O8GA 3H61A 3V4YA 4O43A 3THOB 3H67A 1M63A 4H2GA 2Z1AA 2P6BA 4LACC 5JJTA 2ZO9B 2IE3C 4FBWA 5F3WA 3IVDA 1KBPA 4NZVA 1AUIA 5J28A 1UF3A 1XM7A 4ZX2A 4LU9A 4MOYA 1S95A 1WAO1 1II7A 5JPEA 3PSNA 4LTYA 4Q7FA 3N5UA 4V0VA 4XPNA 4O4KA 2DFJA 2YEQA 2IE4C 2DXLA 1UTEA 3KBPA 1Z2WA 2HY1A 1QHWA 1WARA 1S3NA 3FLOA 1JK7A 5INBA 2QFPA 2NYLC 3EGGA 4H2BA 3ZU0A 3RL5A 2A22A 2WDFA 3E7AA 2Z06A 4G9JA 4TUIA 3E0JA 2HYPA 3H60A 2AHDA 4FCXA 1QFCA 1S70A 2GJUA 2KKNA 2Q8UA 4F0ZA 4DSYA 4O24A 2HYOA 4TUGA 4V0XA 4FBKA 3K7VC 1XZWA 2ZOAA 2IAEC 2QFRA 2XMOA 1MF8A 3QFKA 3IVEA 1W24A 1HO5A 5JPFA 4MOVA 1OIDA 3H68A 2WDCA 3IB7A 2USHA 2YVTA 2WDDA 3CK2A 4UWQA 3THNA 3ICFA 4JA9A 3FGAC 4DT2A 1OI8A 5EQVA 4H1SA 3H62B 1G5BA 1HPUA 2O8AA 3HVQA 2R17A 3AUZA 3EGHA 3D03A 5C1VA 3C9FA 2NYMC 2BCDA 4ZVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UT2 A;  2Z72 A;  3GVE A;  3H69 A;  4J6O A;  4JA7 A;  4FBQ A;  4UT3 B;  1TCO A;  1FJM A;  1S8E A;  4HD0 A;  5B8I A;  4ORB A;  3RQZ A;  3QFN A;  1S3M A;  3JYF A;  3RL4 A;  2ZBM A;  4WWL A;  4UT3 A;  2WDE A;  3PSO A;  4MP0 A;  3K7W C;  4M0V A;  5IOH A;  4V0W A;  3DW8 C;  4KKZ A;  2BDX A;  4OR9 A;  2JOG A;  1OIE A;  3DSC A;  3QFM A;  5DNY A;  1T71 A;  4H1Y P;  3P71 C;  2BQ8 X;  3E7B A;  3T1I A;  3AV0 A;  4YKE A;  3TGH A;  4H2F A;  4B2O A;  4KBP A;  3QG5 C;  1HP1 A;  1V73 A;  3H63 A;  3H66 A;  1S3L A;  4O5G A;  3DSD A;  3C5W C;  1T70 A;  1IT6 A;  4I5L C;  4DHL A;  3IB8 A;  4H2I A;  4ORA A;  3RL3 A;  3LL8 A;  4IL1 A;  3ZTV A;  4IYP C;  5GTU A;  2NPP C;  1USH A;  3QFO A;  5HPE A;  1NNW A;  2NXF A;  2QJC A;  1U32 A;  3H64 A;  4ORC A;  1SU1 A;  1Z2X A;  2CV9 A;  4I5N C;  2O8G A;  3H61 A;  3V4Y A;  4O43 A;  3THO B;  3H67 A;  1M63 A;  4H2G A;  2Z1A A;  2P6B A;  4LAC C;  5JJT A;  2IE3 C;  4FBW A;  5F3W A;  3IVD A;  1KBP A;  4NZV A;  1AUI A;  5J28 A;  1UF3 A;  1XM7 A;  4ZX2 A;  4LU9 A;  4MOY A;  1S95 A;  1WAO 1;  1II7 A;  5JPE A;  3PSN A;  4LTY A;  4Q7F A;  3N5U A;  4V0V A;  4XPN A;  4O4K A;  2DFJ A;  2IE4 C;  1UTE A;  3KBP A;  1Z2W A;  2HY1 A;  1QHW A;  1WAR A;  1S3N A;  1JK7 A;  5INB A;  2QFP A;  2NYL C;  3EGG A;  4H2B A;  3ZU0 A;  3RL5 A;  2A22 A;  2WDF A;  3E7A A;  2Z06 A;  4G9J A;  4TUI A;  2HYP A;  3H60 A;  2AHD A;  4FCX A;  1QFC A;  1S70 A;  2GJU A;  2KKN A;  2Q8U A;  4F0Z A;  4DSY A;  4O24 A;  2HYO A;  4TUG A;  4V0X A;  4FBK A;  3K7V C;  1XZW A;  2IAE C;  2QFR A;  2XMO A;  1MF8 A;  3QFK A;  3IVE A;  1W24 A;  1HO5 A;  5JPF A;  4MOV A;  1OID A;  3H68 A;  2WDC A;  3IB7 A;  2USH A;  2YVT A;  2WDD A;  3CK2 A;  4UWQ A;  3THN A;  3ICF A;  4JA9 A;  3FGA C;  4DT2 A;  1OI8 A;  5EQV A;  4H1S A;  3H62 B;  1G5B A;  1HPU A;  2O8A A;  3HVQ A;  2R17 A;  3AUZ A;  3EGH A;  5C1V A;  3C9F A;  2NYM C;  2BCD A;  4ZVZ A; 
#chains in the Genus database with same CATH topology
 4UT2 A;  2Z72 A;  3GVE A;  3H69 A;  4J6O A;  4JA7 A;  4FBQ A;  4UT3 B;  1TCO A;  1FJM A;  1S8E A;  4HD0 A;  5B8I A;  4ORB A;  2DXN A;  3RQZ A;  3QFN A;  1S3M A;  3JYF A;  3RL4 A;  2ZBM A;  4WWL A;  4UT3 A;  2WDE A;  3PSO A;  4MP0 A;  3K7W C;  4M0V A;  5IOH A;  4V0W A;  3DW8 C;  4KKZ A;  2BDX A;  4OR9 A;  2JOG A;  1OIE A;  3DSC A;  3QFM A;  5DNY A;  1T71 A;  4H1Y P;  3P71 C;  2BQ8 X;  3E7B A;  3T1I A;  3AV0 A;  4YKE A;  3TGH A;  4H2F A;  4B2O A;  4KBP A;  3QG5 C;  1HP1 A;  1V73 A;  3H63 A;  3H66 A;  1S3L A;  4O5G A;  3DSD A;  3C5W C;  1T70 A;  1IT6 A;  4I5L C;  4DHL A;  3IB8 A;  4H2I A;  4ORA A;  3RL3 A;  3LL8 A;  4IL1 A;  3ZTV A;  4IYP C;  5GTU A;  2NPP C;  1USH A;  3QFO A;  5HPE A;  1NNW A;  2NXF A;  2QJC A;  1U32 A;  3H64 A;  4ORC A;  1SU1 A;  1Z2X A;  2CV9 A;  4I5N C;  2O8G A;  3H61 A;  3V4Y A;  4O43 A;  3THO B;  3H67 A;  1M63 A;  4H2G A;  2Z1A A;  2P6B A;  4LAC C;  5JJT A;  2ZO9 B;  2IE3 C;  4FBW A;  5F3W A;  3IVD A;  1KBP A;  4NZV A;  1AUI A;  5J28 A;  1UF3 A;  1XM7 A;  4ZX2 A;  4LU9 A;  4MOY A;  1S95 A;  1WAO 1;  1II7 A;  5JPE A;  3PSN A;  4LTY A;  4Q7F A;  3N5U A;  4V0V A;  4XPN A;  4O4K A;  2DFJ A;  2YEQ A;  2IE4 C;  2DXL A;  1UTE A;  3KBP A;  1Z2W A;  2HY1 A;  1QHW A;  1WAR A;  1S3N A;  3FLO A;  1JK7 A;  5INB A;  2QFP A;  2NYL C;  3EGG A;  4H2B A;  3ZU0 A;  3RL5 A;  2A22 A;  2WDF A;  3E7A A;  2Z06 A;  4G9J A;  4TUI A;  3E0J A;  2HYP A;  3H60 A;  2AHD A;  4FCX A;  1QFC A;  1S70 A;  2GJU A;  2KKN A;  2Q8U A;  4F0Z A;  4DSY A;  4O24 A;  2HYO A;  4TUG A;  4V0X A;  4FBK A;  3K7V C;  1XZW A;  2ZOA A;  2IAE C;  2QFR A;  2XMO A;  1MF8 A;  3QFK A;  3IVE A;  1W24 A;  1HO5 A;  5JPF A;  4MOV A;  1OID A;  3H68 A;  2WDC A;  3IB7 A;  2USH A;  2YVT A;  2WDD A;  3CK2 A;  4UWQ A;  3THN A;  3ICF A;  4JA9 A;  3FGA C;  4DT2 A;  1OI8 A;  5EQV A;  4H1S A;  3H62 B;  1G5B A;  1HPU A;  2O8A A;  3HVQ A;  2R17 A;  3AUZ A;  3EGH A;  3D03 A;  5C1V A;  3C9F A;  2NYM C;  2BCD A;  4ZVZ A; 
#chains in the Genus database with same CATH homology
 4UT2 A;  2Z72 A;  3GVE A;  3H69 A;  4J6O A;  4JA7 A;  4FBQ A;  4UT3 B;  1TCO A;  1FJM A;  1S8E A;  4HD0 A;  5B8I A;  4ORB A;  2DXN A;  3RQZ A;  3QFN A;  1S3M A;  3JYF A;  3RL4 A;  2ZBM A;  4WWL A;  4UT3 A;  2WDE A;  3PSO A;  4MP0 A;  3K7W C;  4M0V A;  5IOH A;  4V0W A;  3DW8 C;  4KKZ A;  2BDX A;  4OR9 A;  2JOG A;  1OIE A;  3DSC A;  3QFM A;  5DNY A;  1T71 A;  4H1Y P;  3P71 C;  2BQ8 X;  3E7B A;  3T1I A;  3AV0 A;  4YKE A;  3TGH A;  4H2F A;  4B2O A;  4KBP A;  3QG5 C;  1HP1 A;  1V73 A;  3H63 A;  3H66 A;  1S3L A;  4O5G A;  3DSD A;  3C5W C;  1T70 A;  1IT6 A;  4I5L C;  4DHL A;  3IB8 A;  4H2I A;  4ORA A;  3RL3 A;  3LL8 A;  4IL1 A;  3ZTV A;  4IYP C;  5GTU A;  2NPP C;  1USH A;  3QFO A;  5HPE A;  1NNW A;  2NXF A;  2QJC A;  1U32 A;  3H64 A;  4ORC A;  1SU1 A;  1Z2X A;  2CV9 A;  4I5N C;  2O8G A;  3H61 A;  3V4Y A;  4O43 A;  3THO B;  3H67 A;  1M63 A;  4H2G A;  2Z1A A;  2P6B A;  4LAC C;  5JJT A;  2ZO9 B;  2IE3 C;  4FBW A;  5F3W A;  3IVD A;  1KBP A;  4NZV A;  1AUI A;  5J28 A;  1UF3 A;  1XM7 A;  4ZX2 A;  4LU9 A;  4MOY A;  1S95 A;  1WAO 1;  1II7 A;  5JPE A;  3PSN A;  4LTY A;  4Q7F A;  3N5U A;  4V0V A;  4XPN A;  4O4K A;  2DFJ A;  2YEQ A;  2IE4 C;  2DXL A;  1UTE A;  3KBP A;  1Z2W A;  2HY1 A;  1QHW A;  1WAR A;  1S3N A;  3FLO A;  1JK7 A;  5INB A;  2QFP A;  2NYL C;  3EGG A;  4H2B A;  3ZU0 A;  3RL5 A;  2A22 A;  2WDF A;  3E7A A;  2Z06 A;  4G9J A;  4TUI A;  3E0J A;  2HYP A;  3H60 A;  2AHD A;  4FCX A;  1QFC A;  1S70 A;  2GJU A;  2KKN A;  2Q8U A;  4F0Z A;  4DSY A;  4O24 A;  2HYO A;  4TUG A;  4V0X A;  4FBK A;  3K7V C;  1XZW A;  2ZOA A;  2IAE C;  2QFR A;  2XMO A;  1MF8 A;  3QFK A;  3IVE A;  1W24 A;  1HO5 A;  5JPF A;  4MOV A;  1OID A;  3H68 A;  2WDC A;  3IB7 A;  2USH A;  2YVT A;  2WDD A;  3CK2 A;  4UWQ A;  3THN A;  3ICF A;  4JA9 A;  3FGA C;  4DT2 A;  1OI8 A;  5EQV A;  4H1S A;  3H62 B;  1G5B A;  1HPU A;  2O8A A;  3HVQ A;  2R17 A;  3AUZ A;  3EGH A;  3D03 A;  5C1V A;  3C9F A;  2NYM C;  2BCD A;  4ZVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...