1OIDA

5'-nucleotidase (e. coli) with an engineered disulfide bridge (s228c, p513c)
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
525
structure length
525
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGCNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKCGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trapping a 96 Degree Domain Rotation in Two Distinct Conformations by Engineered Disulfide Bridges
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN USHA
total genus 172
structure length 525
sequence length 525
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1oidA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1oidA02
4B2OA 3DSDA 1IT6A 2HYPA 4H2BA 4YKEA 1U32A 2JOGA 4IL1A 2NXFA 3DSCA 4FCXA 1TCOA 3PSNA 1W24A 4H2IA 2WDFA 2YVTA 3AV0A 3H67A 5JPEA 3RL4A 1XM7A 1S8EA 3CK2A 2BCDA 1HO5A 2ZBMA 3TGHA 3H63A 4TUGA 2QFRA 1JK7A 4O4KA 3PSOA 3H69A 3QFNA 2BQ8X 1Z2WA 4ZVZA 4DT2A 3H60A 1UTEA 4I5NC 3T1IA 1FJMA 2HYOA 3E7AA 5EQVA 4OR9A 3H62B 2Z06A 3IB8A 1S3MA 3H64A 1S70A 1S3NA 5F3WA 4ORBA 3EGGA 2IAEC 3HVQA 3IVDA 4UT3A 5JPFA 5JJTA 3H66A 4J6OA 3QG5C 1MF8A 1UF3A 4H2GA 4MOYA 1QFCA 3P71C 3RL5A 4O43A 3C5WC 4MP0A 1OIEA 4ORCA 2A22A 5GTUA 1Z2XA 2WDDA 3RQZA 1S95A 3IVEA 5INBA 2XMOA 4H1YP 4H1SA 4UT2A 1II7A 1T70A 3N5UA 1HP1A 2QFPA 5B8IA 3QFKA 2HY1A 4FBQA 1SU1A 5IOHA 3H68A 4UWQA 1T71A 4H2FA 4TUIA 1KBPA 2AHDA 4LACC 1QHWA 4JA9A 2P6BA 4FBKA 2KKNA 4MOVA 3JYFA 1HPUA 4IYPC 1NNWA 3QFMA 5DNYA 4DHLA 3GVEA 3ZU0A 3C9FA 4KKZA 1WARA 3ICFA 2O8AA 3K7VC 2BDXA 4V0XA 4O5GA 5HPEA 2IE3C 2Z1AA 4LU9A 3K7WC 4V0WA 1USHA 1V73A 4G9JA 3E7BA 1G5BA 2Z72A 3THOB 2O8GA 2R17A 1WAO1 2IE4C 4M0VA 2DFJA 4O24A 1OIDA 4JA7A 3KBPA 2WDEA 4HD0A 3LL8A 4DSYA 2WDCA 4ORAA 2USHA 4KBPA 3H61A 4F0ZA 2QJCA 4NZVA 4I5LC 2CV9A 5J28A 5C1VA 3QFOA 1OI8A 2GJUA 4V0VA 3THNA 3DW8C 3FGAC 1AUIA 4WWLA 3V4YA 3RL3A 3AUZA 4ZX2A 2NYMC 3ZTVA 2NPPC 2NYLC 3EGHA 4LTYA 4UT3B 4XPNA 2Q8UA 4Q7FA 1M63A 3IB7A 4FBWA 1S3LA 1XZWA
chains in the Genus database with same CATH superfamily
4B2OA 3DSDA 1IT6A 2HYPA 4H2BA 4YKEA 1U32A 2JOGA 4IL1A 2NXFA 3DSCA 4FCXA 1TCOA 3PSNA 1W24A 4H2IA 2WDFA 2YVTA 3AV0A 3H67A 5JPEA 3RL4A 1XM7A 1S8EA 3CK2A 2BCDA 1HO5A 2ZBMA 3TGHA 3H63A 4TUGA 2QFRA 1JK7A 4O4KA 3PSOA 3H69A 3QFNA 2BQ8X 1Z2WA 4ZVZA 4DT2A 3H60A 1UTEA 4I5NC 3T1IA 1FJMA 2HYOA 3E7AA 5EQVA 4OR9A 3H62B 2Z06A 3IB8A 3FLOA 1S3MA 3H64A 1S70A 1S3NA 5F3WA 4ORBA 3EGGA 2IAEC 3HVQA 3IVDA 4UT3A 5JPFA 5JJTA 3H66A 4J6OA 3QG5C 1MF8A 1UF3A 4H2GA 2ZO9B 4MOYA 1QFCA 3P71C 3RL5A 4O43A 3C5WC 4MP0A 1OIEA 2DXLA 4ORCA 2A22A 5GTUA 1Z2XA 2WDDA 3RQZA 1S95A 3IVEA 5INBA 2DXNA 2XMOA 4H1YP 4H1SA 4UT2A 1II7A 1T70A 3N5UA 1HP1A 2QFPA 5B8IA 3QFKA 2HY1A 4FBQA 1SU1A 5IOHA 3H68A 4UWQA 1T71A 3D03A 4H2FA 4TUIA 1KBPA 2AHDA 4LACC 1QHWA 4JA9A 2P6BA 4FBKA 2KKNA 4MOVA 3JYFA 1HPUA 4IYPC 1NNWA 3QFMA 5DNYA 4DHLA 2YEQA 3GVEA 3ZU0A 3C9FA 4KKZA 1WARA 3ICFA 2O8AA 3K7VC 2BDXA 4V0XA 4O5GA 5HPEA 2IE3C 2Z1AA 4LU9A 3K7WC 4V0WA 1USHA 1V73A 4G9JA 3E7BA 1G5BA 2Z72A 3THOB 2O8GA 2R17A 1WAO1 2IE4C 4M0VA 2DFJA 4O24A 1OIDA 4JA7A 3KBPA 2WDEA 4HD0A 3LL8A 4DSYA 2WDCA 4ORAA 2USHA 4KBPA 3H61A 4F0ZA 2QJCA 4NZVA 4I5LC 2CV9A 5J28A 5C1VA 3QFOA 1OI8A 2GJUA 4V0VA 3THNA 3DW8C 3FGAC 1AUIA 3E0JA 4WWLA 3RL3A 3V4YA 3AUZA 4ZX2A 2NYMC 3ZTVA 2NPPC 2NYLC 2ZOAA 3EGHA 4LTYA 4UT3B 4XPNA 2Q8UA 4Q7FA 1M63A 3IB7A 4FBWA 1S3LA 1XZWA
chains in the Genus database with same CATH topology
4B2OA 3DSDA 1IT6A 2HYPA 4H2BA 4YKEA 1U32A 2JOGA 4IL1A 2NXFA 3DSCA 4FCXA 1TCOA 3PSNA 1W24A 4H2IA 2WDFA 2YVTA 3AV0A 3H67A 5JPEA 3RL4A 1XM7A 1S8EA 3CK2A 2BCDA 1HO5A 2ZBMA 3TGHA 3H63A 4TUGA 2QFRA 1JK7A 4O4KA 3PSOA 3H69A 3QFNA 2BQ8X 1Z2WA 4ZVZA 4DT2A 3H60A 1UTEA 4I5NC 3T1IA 1FJMA 2HYOA 3E7AA 5EQVA 4OR9A 3H62B 2Z06A 3IB8A 3FLOA 1S3MA 3H64A 1S70A 1S3NA 5F3WA 4ORBA 3EGGA 2IAEC 3HVQA 3IVDA 4UT3A 5JPFA 5JJTA 3H66A 4J6OA 3QG5C 1MF8A 1UF3A 4H2GA 2ZO9B 4MOYA 1QFCA 3P71C 3RL5A 4O43A 3C5WC 4MP0A 1OIEA 2DXLA 4ORCA 2A22A 5GTUA 1Z2XA 2WDDA 3RQZA 1S95A 3IVEA 5INBA 2DXNA 2XMOA 4H1YP 4H1SA 4UT2A 1II7A 1T70A 3N5UA 1HP1A 2QFPA 5B8IA 3QFKA 2HY1A 4FBQA 1SU1A 5IOHA 3H68A 4UWQA 1T71A 3D03A 4H2FA 4TUIA 1KBPA 2AHDA 4LACC 1QHWA 4JA9A 2P6BA 4FBKA 2KKNA 4MOVA 3JYFA 1HPUA 4IYPC 1NNWA 3QFMA 5DNYA 4DHLA 2YEQA 3GVEA 3ZU0A 3C9FA 4KKZA 1WARA 3ICFA 2O8AA 3K7VC 2BDXA 4V0XA 4O5GA 5HPEA 2IE3C 2Z1AA 4LU9A 3K7WC 4V0WA 1USHA 1V73A 4G9JA 3E7BA 1G5BA 2Z72A 3THOB 2O8GA 2R17A 1WAO1 2IE4C 4M0VA 2DFJA 4O24A 1OIDA 4JA7A 3KBPA 2WDEA 4HD0A 3LL8A 4DSYA 2WDCA 4ORAA 2USHA 4KBPA 3H61A 4F0ZA 2QJCA 4NZVA 4I5LC 2CV9A 5J28A 5C1VA 3QFOA 1OI8A 2GJUA 4V0VA 3THNA 3DW8C 3FGAC 1AUIA 3E0JA 4WWLA 3RL3A 3V4YA 3AUZA 4ZX2A 2NYMC 3ZTVA 2NPPC 2NYLC 2ZOAA 3EGHA 4LTYA 4UT3B 4XPNA 2Q8UA 4Q7FA 1M63A 3IB7A 4FBWA 1S3LA 1XZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B2O A;  3DSD A;  1IT6 A;  2HYP A;  4H2B A;  4YKE A;  1U32 A;  2JOG A;  4IL1 A;  2NXF A;  3DSC A;  4FCX A;  1TCO A;  3PSN A;  1W24 A;  4H2I A;  2WDF A;  2YVT A;  3AV0 A;  3H67 A;  5JPE A;  3RL4 A;  1XM7 A;  1S8E A;  3CK2 A;  2BCD A;  1HO5 A;  2ZBM A;  3TGH A;  3H63 A;  4TUG A;  2QFR A;  1JK7 A;  4O4K A;  3PSO A;  3H69 A;  3QFN A;  2BQ8 X;  1Z2W A;  4ZVZ A;  4DT2 A;  3H60 A;  1UTE A;  4I5N C;  3T1I A;  1FJM A;  2HYO A;  3E7A A;  5EQV A;  4OR9 A;  3H62 B;  2Z06 A;  3IB8 A;  1S3M A;  3H64 A;  1S70 A;  1S3N A;  5F3W A;  4ORB A;  3EGG A;  2IAE C;  3HVQ A;  3IVD A;  4UT3 A;  5JPF A;  5JJT A;  3H66 A;  4J6O A;  3QG5 C;  1MF8 A;  1UF3 A;  4H2G A;  4MOY A;  1QFC A;  3P71 C;  3RL5 A;  4O43 A;  3C5W C;  4MP0 A;  1OIE A;  4ORC A;  2A22 A;  5GTU A;  1Z2X A;  2WDD A;  3RQZ A;  1S95 A;  3IVE A;  5INB A;  2XMO A;  4H1Y P;  4H1S A;  4UT2 A;  1II7 A;  1T70 A;  3N5U A;  1HP1 A;  2QFP A;  5B8I A;  3QFK A;  2HY1 A;  4FBQ A;  1SU1 A;  5IOH A;  3H68 A;  4UWQ A;  1T71 A;  4H2F A;  4TUI A;  1KBP A;  2AHD A;  4LAC C;  1QHW A;  4JA9 A;  2P6B A;  4FBK A;  2KKN A;  4MOV A;  3JYF A;  1HPU A;  4IYP C;  1NNW A;  3QFM A;  5DNY A;  4DHL A;  3GVE A;  3ZU0 A;  3C9F A;  4KKZ A;  1WAR A;  3ICF A;  2O8A A;  3K7V C;  2BDX A;  4V0X A;  4O5G A;  5HPE A;  2IE3 C;  2Z1A A;  4LU9 A;  3K7W C;  4V0W A;  1USH A;  1V73 A;  4G9J A;  3E7B A;  1G5B A;  2Z72 A;  3THO B;  2O8G A;  2R17 A;  1WAO 1;  2IE4 C;  4M0V A;  2DFJ A;  4O24 A;  1OID A;  4JA7 A;  3KBP A;  2WDE A;  4HD0 A;  3LL8 A;  4DSY A;  2WDC A;  4ORA A;  2USH A;  4KBP A;  3H61 A;  4F0Z A;  2QJC A;  4NZV A;  4I5L C;  2CV9 A;  5J28 A;  5C1V A;  3QFO A;  1OI8 A;  2GJU A;  4V0V A;  3THN A;  3DW8 C;  3FGA C;  1AUI A;  4WWL A;  3V4Y A;  3RL3 A;  3AUZ A;  4ZX2 A;  2NYM C;  3ZTV A;  2NPP C;  2NYL C;  3EGH A;  4LTY A;  4UT3 B;  4XPN A;  2Q8U A;  4Q7F A;  1M63 A;  3IB7 A;  4FBW A;  1S3L A;  1XZW A; 
#chains in the Genus database with same CATH topology
 4B2O A;  3DSD A;  1IT6 A;  2HYP A;  4H2B A;  4YKE A;  1U32 A;  2JOG A;  4IL1 A;  2NXF A;  3DSC A;  4FCX A;  1TCO A;  3PSN A;  1W24 A;  4H2I A;  2WDF A;  2YVT A;  3AV0 A;  3H67 A;  5JPE A;  3RL4 A;  1XM7 A;  1S8E A;  3CK2 A;  2BCD A;  1HO5 A;  2ZBM A;  3TGH A;  3H63 A;  4TUG A;  2QFR A;  1JK7 A;  4O4K A;  3PSO A;  3H69 A;  3QFN A;  2BQ8 X;  1Z2W A;  4ZVZ A;  4DT2 A;  3H60 A;  1UTE A;  4I5N C;  3T1I A;  1FJM A;  2HYO A;  3E7A A;  5EQV A;  4OR9 A;  3H62 B;  2Z06 A;  3IB8 A;  3FLO A;  1S3M A;  3H64 A;  1S70 A;  1S3N A;  5F3W A;  4ORB A;  3EGG A;  2IAE C;  3HVQ A;  3IVD A;  4UT3 A;  5JPF A;  5JJT A;  3H66 A;  4J6O A;  3QG5 C;  1MF8 A;  1UF3 A;  4H2G A;  2ZO9 B;  4MOY A;  1QFC A;  3P71 C;  3RL5 A;  4O43 A;  3C5W C;  4MP0 A;  1OIE A;  2DXL A;  4ORC A;  2A22 A;  5GTU A;  1Z2X A;  2WDD A;  3RQZ A;  1S95 A;  3IVE A;  5INB A;  2DXN A;  2XMO A;  4H1Y P;  4H1S A;  4UT2 A;  1II7 A;  1T70 A;  3N5U A;  1HP1 A;  2QFP A;  5B8I A;  3QFK A;  2HY1 A;  4FBQ A;  1SU1 A;  5IOH A;  3H68 A;  4UWQ A;  1T71 A;  3D03 A;  4H2F A;  4TUI A;  1KBP A;  2AHD A;  4LAC C;  1QHW A;  4JA9 A;  2P6B A;  4FBK A;  2KKN A;  4MOV A;  3JYF A;  1HPU A;  4IYP C;  1NNW A;  3QFM A;  5DNY A;  4DHL A;  2YEQ A;  3GVE A;  3ZU0 A;  3C9F A;  4KKZ A;  1WAR A;  3ICF A;  2O8A A;  3K7V C;  2BDX A;  4V0X A;  4O5G A;  5HPE A;  2IE3 C;  2Z1A A;  4LU9 A;  3K7W C;  4V0W A;  1USH A;  1V73 A;  4G9J A;  3E7B A;  1G5B A;  2Z72 A;  3THO B;  2O8G A;  2R17 A;  1WAO 1;  2IE4 C;  4M0V A;  2DFJ A;  4O24 A;  1OID A;  4JA7 A;  3KBP A;  2WDE A;  4HD0 A;  3LL8 A;  4DSY A;  2WDC A;  4ORA A;  2USH A;  4KBP A;  3H61 A;  4F0Z A;  2QJC A;  4NZV A;  4I5L C;  2CV9 A;  5J28 A;  5C1V A;  3QFO A;  1OI8 A;  2GJU A;  4V0V A;  3THN A;  3DW8 C;  3FGA C;  1AUI A;  3E0J A;  4WWL A;  3RL3 A;  3V4Y A;  3AUZ A;  4ZX2 A;  2NYM C;  3ZTV A;  2NPP C;  2NYL C;  2ZOA A;  3EGH A;  4LTY A;  4UT3 B;  4XPN A;  2Q8U A;  4Q7F A;  1M63 A;  3IB7 A;  4FBW A;  1S3L A;  1XZW A; 
#chains in the Genus database with same CATH homology
 4B2O A;  3DSD A;  1IT6 A;  2HYP A;  4H2B A;  4YKE A;  1U32 A;  2JOG A;  4IL1 A;  2NXF A;  3DSC A;  4FCX A;  1TCO A;  3PSN A;  1W24 A;  4H2I A;  2WDF A;  2YVT A;  3AV0 A;  3H67 A;  5JPE A;  3RL4 A;  1XM7 A;  1S8E A;  3CK2 A;  2BCD A;  1HO5 A;  2ZBM A;  3TGH A;  3H63 A;  4TUG A;  2QFR A;  1JK7 A;  4O4K A;  3PSO A;  3H69 A;  3QFN A;  2BQ8 X;  1Z2W A;  4ZVZ A;  4DT2 A;  3H60 A;  1UTE A;  4I5N C;  3T1I A;  1FJM A;  2HYO A;  3E7A A;  5EQV A;  4OR9 A;  3H62 B;  2Z06 A;  3IB8 A;  3FLO A;  1S3M A;  3H64 A;  1S70 A;  1S3N A;  5F3W A;  4ORB A;  3EGG A;  2IAE C;  3HVQ A;  3IVD A;  4UT3 A;  5JPF A;  5JJT A;  3H66 A;  4J6O A;  3QG5 C;  1MF8 A;  1UF3 A;  4H2G A;  2ZO9 B;  4MOY A;  1QFC A;  3P71 C;  3RL5 A;  4O43 A;  3C5W C;  4MP0 A;  1OIE A;  2DXL A;  4ORC A;  2A22 A;  5GTU A;  1Z2X A;  2WDD A;  3RQZ A;  1S95 A;  3IVE A;  5INB A;  2DXN A;  2XMO A;  4H1Y P;  4H1S A;  4UT2 A;  1II7 A;  1T70 A;  3N5U A;  1HP1 A;  2QFP A;  5B8I A;  3QFK A;  2HY1 A;  4FBQ A;  1SU1 A;  5IOH A;  3H68 A;  4UWQ A;  1T71 A;  3D03 A;  4H2F A;  4TUI A;  1KBP A;  2AHD A;  4LAC C;  1QHW A;  4JA9 A;  2P6B A;  4FBK A;  2KKN A;  4MOV A;  3JYF A;  1HPU A;  4IYP C;  1NNW A;  3QFM A;  5DNY A;  4DHL A;  2YEQ A;  3GVE A;  3ZU0 A;  3C9F A;  4KKZ A;  1WAR A;  3ICF A;  2O8A A;  3K7V C;  2BDX A;  4V0X A;  4O5G A;  5HPE A;  2IE3 C;  2Z1A A;  4LU9 A;  3K7W C;  4V0W A;  1USH A;  1V73 A;  4G9J A;  3E7B A;  1G5B A;  2Z72 A;  3THO B;  2O8G A;  2R17 A;  1WAO 1;  2IE4 C;  4M0V A;  2DFJ A;  4O24 A;  1OID A;  4JA7 A;  3KBP A;  2WDE A;  4HD0 A;  3LL8 A;  4DSY A;  2WDC A;  4ORA A;  2USH A;  4KBP A;  3H61 A;  4F0Z A;  2QJC A;  4NZV A;  4I5L C;  2CV9 A;  5J28 A;  5C1V A;  3QFO A;  1OI8 A;  2GJU A;  4V0V A;  3THN A;  3DW8 C;  3FGA C;  1AUI A;  3E0J A;  4WWL A;  3RL3 A;  3V4Y A;  3AUZ A;  4ZX2 A;  2NYM C;  3ZTV A;  2NPP C;  2NYL C;  2ZOA A;  3EGH A;  4LTY A;  4UT3 B;  4XPN A;  2Q8U A;  4Q7F A;  1M63 A;  3IB7 A;  4FBW A;  1S3L A;  1XZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...