1OIEA

5'-nucleotidase (e. coli) with an engineered disulfide bridge (s228c, p513c)
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
525
structure length
519
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGCNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKCGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trapping a 96 Degree Domain Rotation in Two Distinct Conformations by Engineered Disulfide Bridges
pubmed doi rcsb
molecule keywords PROTEIN USHA
molecule tags Hydrolase
source organism Escherichia coli
total genus 171
structure length 519
sequence length 525
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1oieA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1oieA02
3AV0A 3N5UA 2QFPA 2KKNA 3ZU0A 3THNA 3JYFA 2P6BA 4Q7FA 1S8EA 3H60A 2O8AA 1Z2WA 2WDEA 4XPNA 2NYLC 3QFMA 3ZTVA 3HVQA 5J28A 1II7A 3RQZA 1M63A 3QFKA 4M0VA 1WARA 4ORAA 3P71C 2BCDA 3V4YA 3IVDA 3QG5C 3THOB 1S3LA 1USHA 1S3NA 4IL1A 2YVTA 2NYMC 2Z06A 3CK2A 3H68A 1T71A 4JA9A 3PSOA 2CV9A 3E7AA 2ZBMA 3IB8A 4FBQA 2HYOA 3H67A 3E7BA 3C5WC 4FCXA 4O4KA 3GVEA 3IB7A 1WAO1 4H1SA 1SU1A 4ZX2A 5GTUA 5INBA 3RL3A 4H2IA 2IE4C 5B8IA 1QFCA 4H1YP 3RL5A 1FJMA 2Z72A 1TCOA 2AHDA 3H64A 4UT2A 5C1VA 4H2BA 5F3WA 1QHWA 4LU9A 5DNYA 4G9JA 2WDCA 3C9FA 2Z1AA 1XZWA 2USHA 2A22A 2WDFA 2NPPC 3IVEA 4ORBA 4B2OA 4MP0A 4TUIA 2QFRA 1HO5A 4I5LC 3KBPA 1S95A 2HY1A 3ICFA 3TGHA 5IOHA 1UF3A 1IT6A 2GJUA 3DW8C 4FBWA 2Q8UA 2NXFA 3FGAC 4H2FA 4IYPC 2IAEC 1NNWA 3QFOA 4V0VA 4WWLA 4UT3B 2XMOA 4MOVA 4UWQA 2R17A 4J6OA 4DSYA 4OR9A 4MOYA 3DSCA 1HPUA 1XM7A 1V73A 4V0XA 3H62B 1MF8A 4FBKA 5JPEA 4TUGA 4YKEA 1Z2XA 1S3MA 4O43A 3EGHA 4LTYA 3RL4A 2IE3C 5EQVA 1UTEA 3PSNA 1HP1A 2BDXA 2O8GA 3K7VC 4JA7A 1OIDA 4I5NC 3K7WC 1OI8A 4ZVZA 4F0ZA 1JK7A 3AUZA 3H69A 4O5GA 4V0WA 2JOGA 3T1IA 1G5BA 3LL8A 1KBPA 2HYPA 1OIEA 5JJTA 4ORCA 5JPFA 2DFJA 4H2GA 4KBPA 2WDDA 2BQ8X 4DT2A 4O24A 4KKZA 1U32A 1T70A 3H66A 4HD0A 4UT3A 5HPEA 2QJCA 1AUIA 1S70A 1W24A 4LACC 4DHLA 3H61A 3EGGA 3DSDA 3QFNA 4NZVA 3H63A
chains in the Genus database with same CATH superfamily
3AV0A 3N5UA 2QFPA 3D03A 2KKNA 3ZU0A 3THNA 3JYFA 2P6BA 4Q7FA 1S8EA 3H60A 2O8AA 1Z2WA 2WDEA 4XPNA 2NYLC 3QFMA 3ZTVA 3HVQA 5J28A 1II7A 3RQZA 1M63A 3QFKA 4M0VA 1WARA 4ORAA 3P71C 2BCDA 3V4YA 3IVDA 3QG5C 3THOB 1S3LA 1USHA 1S3NA 4IL1A 2YVTA 2NYMC 2DXNA 2Z06A 3CK2A 3H68A 1T71A 4JA9A 3E0JA 3PSOA 2CV9A 3E7AA 2ZBMA 3IB8A 4FBQA 2HYOA 3H67A 3E7BA 2ZOAA 3C5WC 4FCXA 4O4KA 3GVEA 3IB7A 1WAO1 4H1SA 1SU1A 4ZX2A 5GTUA 5INBA 3RL3A 4H2IA 2IE4C 5B8IA 2DXLA 1QFCA 4H1YP 3RL5A 1FJMA 2Z72A 1TCOA 2AHDA 3H64A 4UT2A 5C1VA 4H2BA 5F3WA 1QHWA 4LU9A 5DNYA 4G9JA 2WDCA 3C9FA 2Z1AA 1XZWA 2USHA 2A22A 2WDFA 2NPPC 3IVEA 4ORBA 4B2OA 4MP0A 4TUIA 2QFRA 1HO5A 4I5LC 3KBPA 1S95A 2HY1A 3ICFA 3TGHA 5IOHA 1UF3A 1IT6A 2GJUA 3DW8C 4FBWA 2Q8UA 2NXFA 3FGAC 4H2FA 4IYPC 2IAEC 1NNWA 3QFOA 4V0VA 4WWLA 4UT3B 2XMOA 4MOVA 4UWQA 2R17A 4J6OA 4DSYA 4OR9A 4MOYA 3DSCA 1HPUA 1XM7A 1V73A 4V0XA 3H62B 1MF8A 4FBKA 5JPEA 4TUGA 4YKEA 1Z2XA 1S3MA 4O43A 3EGHA 4LTYA 3RL4A 2IE3C 5EQVA 1UTEA 3PSNA 1HP1A 2BDXA 2O8GA 3K7VC 4JA7A 1OIDA 4I5NC 3K7WC 1OI8A 4ZVZA 4F0ZA 1JK7A 3AUZA 3H69A 4O5GA 4V0WA 2JOGA 3T1IA 1G5BA 3LL8A 1KBPA 2HYPA 1OIEA 5JJTA 4ORCA 5JPFA 2DFJA 4H2GA 3FLOA 4KBPA 2WDDA 2BQ8X 4DT2A 4O24A 4KKZA 1U32A 1T70A 3H66A 4HD0A 4UT3A 5HPEA 2ZO9B 2QJCA 1AUIA 1S70A 1W24A 4LACC 4DHLA 3H61A 3EGGA 3DSDA 3QFNA 4NZVA 2YEQA 3H63A
chains in the Genus database with same CATH topology
3AV0A 3N5UA 2QFPA 3D03A 2KKNA 3ZU0A 3THNA 3JYFA 2P6BA 4Q7FA 1S8EA 3H60A 2O8AA 1Z2WA 2WDEA 4XPNA 2NYLC 3QFMA 3ZTVA 3HVQA 5J28A 1II7A 3RQZA 1M63A 3QFKA 4M0VA 1WARA 4ORAA 3P71C 2BCDA 3V4YA 3IVDA 3QG5C 3THOB 1S3LA 1USHA 1S3NA 4IL1A 2YVTA 2NYMC 2DXNA 2Z06A 3CK2A 3H68A 1T71A 4JA9A 3E0JA 3PSOA 2CV9A 3E7AA 2ZBMA 3IB8A 4FBQA 2HYOA 3H67A 3E7BA 2ZOAA 3C5WC 4FCXA 4O4KA 3GVEA 3IB7A 1WAO1 4H1SA 1SU1A 4ZX2A 5GTUA 5INBA 3RL3A 4H2IA 2IE4C 5B8IA 2DXLA 1QFCA 4H1YP 3RL5A 1FJMA 2Z72A 1TCOA 2AHDA 3H64A 4UT2A 5C1VA 4H2BA 5F3WA 1QHWA 4LU9A 5DNYA 4G9JA 2WDCA 3C9FA 2Z1AA 1XZWA 2USHA 2A22A 2WDFA 2NPPC 3IVEA 4ORBA 4B2OA 4MP0A 4TUIA 2QFRA 1HO5A 4I5LC 3KBPA 1S95A 2HY1A 3ICFA 3TGHA 5IOHA 1UF3A 1IT6A 2GJUA 3DW8C 4FBWA 2Q8UA 2NXFA 3FGAC 4H2FA 4IYPC 2IAEC 1NNWA 3QFOA 4V0VA 4WWLA 4UT3B 2XMOA 4MOVA 4UWQA 2R17A 4J6OA 4DSYA 4OR9A 4MOYA 3DSCA 1HPUA 1XM7A 1V73A 4V0XA 3H62B 1MF8A 4FBKA 5JPEA 4TUGA 4YKEA 1Z2XA 1S3MA 4O43A 3EGHA 4LTYA 3RL4A 2IE3C 5EQVA 1UTEA 3PSNA 1HP1A 2BDXA 2O8GA 3K7VC 4JA7A 1OIDA 4I5NC 3K7WC 1OI8A 4ZVZA 4F0ZA 1JK7A 3AUZA 3H69A 4O5GA 4V0WA 2JOGA 3T1IA 1G5BA 3LL8A 1KBPA 2HYPA 1OIEA 5JJTA 4ORCA 5JPFA 2DFJA 4H2GA 3FLOA 4KBPA 2WDDA 2BQ8X 4DT2A 4O24A 4KKZA 1U32A 1T70A 3H66A 4HD0A 4UT3A 5HPEA 2ZO9B 2QJCA 1AUIA 1S70A 1W24A 4LACC 4DHLA 3H61A 3EGGA 3DSDA 3QFNA 4NZVA 2YEQA 3H63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV0 A;  3N5U A;  2QFP A;  2KKN A;  3ZU0 A;  3THN A;  3JYF A;  2P6B A;  4Q7F A;  1S8E A;  3H60 A;  2O8A A;  1Z2W A;  2WDE A;  4XPN A;  2NYL C;  3QFM A;  3ZTV A;  3HVQ A;  5J28 A;  1II7 A;  3RQZ A;  1M63 A;  3QFK A;  4M0V A;  1WAR A;  4ORA A;  3P71 C;  2BCD A;  3V4Y A;  3IVD A;  3QG5 C;  3THO B;  1S3L A;  1USH A;  1S3N A;  4IL1 A;  2YVT A;  2NYM C;  2Z06 A;  3CK2 A;  3H68 A;  1T71 A;  4JA9 A;  3PSO A;  2CV9 A;  3E7A A;  2ZBM A;  3IB8 A;  4FBQ A;  2HYO A;  3H67 A;  3E7B A;  3C5W C;  4FCX A;  4O4K A;  3GVE A;  3IB7 A;  1WAO 1;  4H1S A;  1SU1 A;  4ZX2 A;  5GTU A;  5INB A;  3RL3 A;  4H2I A;  2IE4 C;  5B8I A;  1QFC A;  4H1Y P;  3RL5 A;  1FJM A;  2Z72 A;  1TCO A;  2AHD A;  3H64 A;  4UT2 A;  5C1V A;  4H2B A;  5F3W A;  1QHW A;  4LU9 A;  5DNY A;  4G9J A;  2WDC A;  3C9F A;  2Z1A A;  1XZW A;  2USH A;  2A22 A;  2WDF A;  2NPP C;  3IVE A;  4ORB A;  4B2O A;  4MP0 A;  4TUI A;  2QFR A;  1HO5 A;  4I5L C;  3KBP A;  1S95 A;  2HY1 A;  3ICF A;  3TGH A;  5IOH A;  1UF3 A;  1IT6 A;  2GJU A;  3DW8 C;  4FBW A;  2Q8U A;  2NXF A;  3FGA C;  4H2F A;  4IYP C;  2IAE C;  1NNW A;  3QFO A;  4V0V A;  4WWL A;  4UT3 B;  2XMO A;  4MOV A;  4UWQ A;  2R17 A;  4J6O A;  4DSY A;  4OR9 A;  4MOY A;  3DSC A;  1HPU A;  1XM7 A;  1V73 A;  4V0X A;  3H62 B;  1MF8 A;  4FBK A;  5JPE A;  4TUG A;  4YKE A;  1Z2X A;  1S3M A;  4O43 A;  3EGH A;  4LTY A;  3RL4 A;  2IE3 C;  5EQV A;  1UTE A;  3PSN A;  1HP1 A;  2BDX A;  2O8G A;  3K7V C;  4JA7 A;  1OID A;  4I5N C;  3K7W C;  1OI8 A;  4ZVZ A;  4F0Z A;  1JK7 A;  3AUZ A;  3H69 A;  4O5G A;  4V0W A;  2JOG A;  3T1I A;  1G5B A;  3LL8 A;  1KBP A;  2HYP A;  1OIE A;  5JJT A;  4ORC A;  5JPF A;  2DFJ A;  4H2G A;  4KBP A;  2WDD A;  2BQ8 X;  4DT2 A;  4O24 A;  4KKZ A;  1U32 A;  1T70 A;  3H66 A;  4HD0 A;  4UT3 A;  5HPE A;  2QJC A;  1AUI A;  1S70 A;  1W24 A;  4LAC C;  4DHL A;  3H61 A;  3EGG A;  3DSD A;  3QFN A;  4NZV A;  3H63 A; 
#chains in the Genus database with same CATH topology
 3AV0 A;  3N5U A;  2QFP A;  3D03 A;  2KKN A;  3ZU0 A;  3THN A;  3JYF A;  2P6B A;  4Q7F A;  1S8E A;  3H60 A;  2O8A A;  1Z2W A;  2WDE A;  4XPN A;  2NYL C;  3QFM A;  3ZTV A;  3HVQ A;  5J28 A;  1II7 A;  3RQZ A;  1M63 A;  3QFK A;  4M0V A;  1WAR A;  4ORA A;  3P71 C;  2BCD A;  3V4Y A;  3IVD A;  3QG5 C;  3THO B;  1S3L A;  1USH A;  1S3N A;  4IL1 A;  2YVT A;  2NYM C;  2DXN A;  2Z06 A;  3CK2 A;  3H68 A;  1T71 A;  4JA9 A;  3E0J A;  3PSO A;  2CV9 A;  3E7A A;  2ZBM A;  3IB8 A;  4FBQ A;  2HYO A;  3H67 A;  3E7B A;  2ZOA A;  3C5W C;  4FCX A;  4O4K A;  3GVE A;  3IB7 A;  1WAO 1;  4H1S A;  1SU1 A;  4ZX2 A;  5GTU A;  5INB A;  3RL3 A;  4H2I A;  2IE4 C;  5B8I A;  2DXL A;  1QFC A;  4H1Y P;  3RL5 A;  1FJM A;  2Z72 A;  1TCO A;  2AHD A;  3H64 A;  4UT2 A;  5C1V A;  4H2B A;  5F3W A;  1QHW A;  4LU9 A;  5DNY A;  4G9J A;  2WDC A;  3C9F A;  2Z1A A;  1XZW A;  2USH A;  2A22 A;  2WDF A;  2NPP C;  3IVE A;  4ORB A;  4B2O A;  4MP0 A;  4TUI A;  2QFR A;  1HO5 A;  4I5L C;  3KBP A;  1S95 A;  2HY1 A;  3ICF A;  3TGH A;  5IOH A;  1UF3 A;  1IT6 A;  2GJU A;  3DW8 C;  4FBW A;  2Q8U A;  2NXF A;  3FGA C;  4H2F A;  4IYP C;  2IAE C;  1NNW A;  3QFO A;  4V0V A;  4WWL A;  4UT3 B;  2XMO A;  4MOV A;  4UWQ A;  2R17 A;  4J6O A;  4DSY A;  4OR9 A;  4MOY A;  3DSC A;  1HPU A;  1XM7 A;  1V73 A;  4V0X A;  3H62 B;  1MF8 A;  4FBK A;  5JPE A;  4TUG A;  4YKE A;  1Z2X A;  1S3M A;  4O43 A;  3EGH A;  4LTY A;  3RL4 A;  2IE3 C;  5EQV A;  1UTE A;  3PSN A;  1HP1 A;  2BDX A;  2O8G A;  3K7V C;  4JA7 A;  1OID A;  4I5N C;  3K7W C;  1OI8 A;  4ZVZ A;  4F0Z A;  1JK7 A;  3AUZ A;  3H69 A;  4O5G A;  4V0W A;  2JOG A;  3T1I A;  1G5B A;  3LL8 A;  1KBP A;  2HYP A;  1OIE A;  5JJT A;  4ORC A;  5JPF A;  2DFJ A;  4H2G A;  3FLO A;  4KBP A;  2WDD A;  2BQ8 X;  4DT2 A;  4O24 A;  4KKZ A;  1U32 A;  1T70 A;  3H66 A;  4HD0 A;  4UT3 A;  5HPE A;  2ZO9 B;  2QJC A;  1AUI A;  1S70 A;  1W24 A;  4LAC C;  4DHL A;  3H61 A;  3EGG A;  3DSD A;  3QFN A;  4NZV A;  2YEQ A;  3H63 A; 
#chains in the Genus database with same CATH homology
 3AV0 A;  3N5U A;  2QFP A;  3D03 A;  2KKN A;  3ZU0 A;  3THN A;  3JYF A;  2P6B A;  4Q7F A;  1S8E A;  3H60 A;  2O8A A;  1Z2W A;  2WDE A;  4XPN A;  2NYL C;  3QFM A;  3ZTV A;  3HVQ A;  5J28 A;  1II7 A;  3RQZ A;  1M63 A;  3QFK A;  4M0V A;  1WAR A;  4ORA A;  3P71 C;  2BCD A;  3V4Y A;  3IVD A;  3QG5 C;  3THO B;  1S3L A;  1USH A;  1S3N A;  4IL1 A;  2YVT A;  2NYM C;  2DXN A;  2Z06 A;  3CK2 A;  3H68 A;  1T71 A;  4JA9 A;  3E0J A;  3PSO A;  2CV9 A;  3E7A A;  2ZBM A;  3IB8 A;  4FBQ A;  2HYO A;  3H67 A;  3E7B A;  2ZOA A;  3C5W C;  4FCX A;  4O4K A;  3GVE A;  3IB7 A;  1WAO 1;  4H1S A;  1SU1 A;  4ZX2 A;  5GTU A;  5INB A;  3RL3 A;  4H2I A;  2IE4 C;  5B8I A;  2DXL A;  1QFC A;  4H1Y P;  3RL5 A;  1FJM A;  2Z72 A;  1TCO A;  2AHD A;  3H64 A;  4UT2 A;  5C1V A;  4H2B A;  5F3W A;  1QHW A;  4LU9 A;  5DNY A;  4G9J A;  2WDC A;  3C9F A;  2Z1A A;  1XZW A;  2USH A;  2A22 A;  2WDF A;  2NPP C;  3IVE A;  4ORB A;  4B2O A;  4MP0 A;  4TUI A;  2QFR A;  1HO5 A;  4I5L C;  3KBP A;  1S95 A;  2HY1 A;  3ICF A;  3TGH A;  5IOH A;  1UF3 A;  1IT6 A;  2GJU A;  3DW8 C;  4FBW A;  2Q8U A;  2NXF A;  3FGA C;  4H2F A;  4IYP C;  2IAE C;  1NNW A;  3QFO A;  4V0V A;  4WWL A;  4UT3 B;  2XMO A;  4MOV A;  4UWQ A;  2R17 A;  4J6O A;  4DSY A;  4OR9 A;  4MOY A;  3DSC A;  1HPU A;  1XM7 A;  1V73 A;  4V0X A;  3H62 B;  1MF8 A;  4FBK A;  5JPE A;  4TUG A;  4YKE A;  1Z2X A;  1S3M A;  4O43 A;  3EGH A;  4LTY A;  3RL4 A;  2IE3 C;  5EQV A;  1UTE A;  3PSN A;  1HP1 A;  2BDX A;  2O8G A;  3K7V C;  4JA7 A;  1OID A;  4I5N C;  3K7W C;  1OI8 A;  4ZVZ A;  4F0Z A;  1JK7 A;  3AUZ A;  3H69 A;  4O5G A;  4V0W A;  2JOG A;  3T1I A;  1G5B A;  3LL8 A;  1KBP A;  2HYP A;  1OIE A;  5JJT A;  4ORC A;  5JPF A;  2DFJ A;  4H2G A;  3FLO A;  4KBP A;  2WDD A;  2BQ8 X;  4DT2 A;  4O24 A;  4KKZ A;  1U32 A;  1T70 A;  3H66 A;  4HD0 A;  4UT3 A;  5HPE A;  2ZO9 B;  2QJC A;  1AUI A;  1S70 A;  1W24 A;  4LAC C;  4DHL A;  3H61 A;  3EGG A;  3DSD A;  3QFN A;  4NZV A;  2YEQ A;  3H63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...