1OIEA

5'-nucleotidase (e. coli) with an engineered disulfide bridge (s228c, p513c)
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
525
structure length
519
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGCNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKCGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Trapping a 96 Degree Domain Rotation in Two Distinct Conformations by Engineered Disulfide Bridges
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN USHA
total genus 171
structure length 519
sequence length 525
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1oieA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1oieA02
3ZU0A 1XM7A 1UTEA 1KBPA 3DSDA 2A22A 2XMOA 4F0ZA 3IB8A 2QFRA 4LTYA 4Q7FA 5B8IA 3HVQA 3IVDA 1T71A 3H67A 1TCOA 3T1IA 1HPUA 1S8EA 3AV0A 4KBPA 4TUGA 3QG5C 3QFNA 4IYPC 2O8GA 1OI8A 4YKEA 5JJTA 2WDCA 4TUIA 1S3NA 1OIDA 1T70A 4H2BA 1WAO1 2Z72A 4V0WA 1V73A 4JA9A 4ORBA 4UWQA 1FJMA 4O24A 2YVTA 3QFKA 3TGHA 2AHDA 5DNYA 4HD0A 3RL3A 2O8AA 4H1SA 3RL5A 1Z2WA 3DW8C 2IAEC 2NYMC 2Z1AA 4FBWA 1JK7A 4FCXA 2WDEA 4NZVA 4UT3B 4DSYA 1USHA 3H69A 3RL4A 2WDDA 1Z2XA 3LL8A 4H2GA 2NXFA 1U32A 5F3WA 3E7BA 5J28A 2NYLC 3THOB 2CV9A 2HY1A 1AUIA 3H66A 1S70A 4FBKA 4FBQA 4ORAA 5INBA 2Z06A 1IT6A 4UT3A 4O43A 3FGAC 4JA7A 2HYOA 3H62B 3K7VC 2BQ8X 3CK2A 4H2IA 3C9FA 2JOGA 4MOVA 4O5GA 4IL1A 2NPPC 1S3MA 1HO5A 1SU1A 1W24A 1HP1A 3QFMA 4M0VA 3C5WC 5JPEA 4I5LC 2IE3C 1MF8A 3AUZA 4I5NC 3GVEA 4UT2A 3RQZA 2KKNA 4ORCA 3EGGA 3N5UA 4H1YP 1QHWA 5C1VA 3PSOA 3H68A 4KKZA 2HYPA 1OIEA 2WDFA 5GTUA 3H61A 3EGHA 1NNWA 3THNA 4G9JA 1S3LA 2IE4C 3JYFA 4MP0A 1G5BA 4J6OA 1UF3A 4MOYA 4OR9A 3ICFA 3PSNA 3V4YA 3H63A 3IVEA 3QFOA 5HPEA 2BDXA 1WARA 3H64A 3KBPA 3P71C 4LU9A 5EQVA 4DHLA 3IB7A 4LACC 4O4KA 5JPFA 1XZWA 2QJCA 3K7WC 2BCDA 2GJUA 3ZTVA 1M63A 1QFCA 2DFJA 2P6BA 4ZVZA 2ZBMA 4B2OA 4DT2A 1II7A 4WWLA 3H60A 3DSCA 3E7AA 4V0VA 2R17A 4XPNA 1S95A 2USHA 4ZX2A 2Q8UA 5IOHA 2QFPA 4V0XA 4H2FA
chains in the Genus database with same CATH superfamily
3ZU0A 1XM7A 2DXNA 1UTEA 1KBPA 3DSDA 2A22A 2XMOA 4F0ZA 3IB8A 2QFRA 4LTYA 4Q7FA 3D03A 5B8IA 3HVQA 3IVDA 1T71A 3H67A 1TCOA 3T1IA 1HPUA 1S8EA 3AV0A 4KBPA 4TUGA 3QG5C 3QFNA 4IYPC 2O8GA 1OI8A 4YKEA 5JJTA 2WDCA 4TUIA 1S3NA 1OIDA 1T70A 4H2BA 1WAO1 2Z72A 4V0WA 1V73A 4JA9A 4ORBA 4UWQA 1FJMA 4O24A 2YVTA 3QFKA 3TGHA 2AHDA 5DNYA 4HD0A 3RL3A 2O8AA 4H1SA 3RL5A 1Z2WA 3DW8C 2IAEC 2NYMC 2Z1AA 4FBWA 1JK7A 4FCXA 2WDEA 4NZVA 4UT3B 4DSYA 1USHA 3H69A 3E0JA 3RL4A 2WDDA 1Z2XA 3LL8A 4H2GA 2NXFA 1U32A 5F3WA 3E7BA 5J28A 2NYLC 3THOB 2CV9A 2HY1A 1AUIA 3H66A 1S70A 4FBKA 4FBQA 4ORAA 5INBA 2Z06A 1IT6A 4UT3A 4O43A 3FGAC 4JA7A 2HYOA 3H62B 3K7VC 2BQ8X 3CK2A 4H2IA 2DXLA 3C9FA 2JOGA 2ZO9B 4MOVA 4O5GA 4IL1A 2NPPC 1S3MA 1HO5A 1SU1A 1W24A 1HP1A 3QFMA 4M0VA 3C5WC 5JPEA 4I5LC 2IE3C 1MF8A 3AUZA 4I5NC 3GVEA 4UT2A 3RQZA 2KKNA 4ORCA 3EGGA 3N5UA 4H1YP 1QHWA 5C1VA 3PSOA 3H68A 4KKZA 2HYPA 1OIEA 2WDFA 5GTUA 3H61A 3EGHA 1NNWA 3THNA 4G9JA 1S3LA 2IE4C 3JYFA 4MP0A 1G5BA 4J6OA 1UF3A 4MOYA 4OR9A 3ICFA 3PSNA 3V4YA 3H63A 3IVEA 3QFOA 5HPEA 2BDXA 1WARA 3H64A 3KBPA 3P71C 4LU9A 5EQVA 4DHLA 3IB7A 4LACC 4O4KA 5JPFA 1XZWA 2QJCA 3K7WC 2BCDA 2GJUA 3ZTVA 1M63A 3FLOA 1QFCA 2DFJA 2P6BA 4ZVZA 2ZBMA 4B2OA 4DT2A 1II7A 4WWLA 3H60A 3DSCA 3E7AA 4V0VA 2R17A 4XPNA 1S95A 2USHA 2ZOAA 4ZX2A 2YEQA 2Q8UA 5IOHA 2QFPA 4V0XA 4H2FA
chains in the Genus database with same CATH topology
3ZU0A 1XM7A 2DXNA 1UTEA 1KBPA 3DSDA 2A22A 2XMOA 4F0ZA 3IB8A 2QFRA 4LTYA 4Q7FA 3D03A 5B8IA 3HVQA 3IVDA 1T71A 3H67A 1TCOA 3T1IA 1HPUA 1S8EA 3AV0A 4KBPA 4TUGA 3QG5C 3QFNA 4IYPC 2O8GA 1OI8A 4YKEA 5JJTA 2WDCA 4TUIA 1S3NA 1OIDA 1T70A 4H2BA 1WAO1 2Z72A 4V0WA 1V73A 4JA9A 4ORBA 4UWQA 1FJMA 4O24A 2YVTA 3QFKA 3TGHA 2AHDA 5DNYA 4HD0A 3RL3A 2O8AA 4H1SA 3RL5A 1Z2WA 3DW8C 2IAEC 2NYMC 2Z1AA 4FBWA 1JK7A 4FCXA 2WDEA 4NZVA 4UT3B 4DSYA 1USHA 3H69A 3E0JA 3RL4A 2WDDA 1Z2XA 3LL8A 4H2GA 2NXFA 1U32A 5F3WA 3E7BA 5J28A 2NYLC 3THOB 2CV9A 2HY1A 1AUIA 3H66A 1S70A 4FBKA 4FBQA 4ORAA 5INBA 2Z06A 1IT6A 4UT3A 4O43A 3FGAC 4JA7A 2HYOA 3H62B 3K7VC 2BQ8X 3CK2A 4H2IA 2DXLA 3C9FA 2JOGA 2ZO9B 4MOVA 4O5GA 4IL1A 2NPPC 1S3MA 1HO5A 1SU1A 1W24A 1HP1A 3QFMA 4M0VA 3C5WC 5JPEA 4I5LC 2IE3C 1MF8A 3AUZA 4I5NC 3GVEA 4UT2A 3RQZA 2KKNA 4ORCA 3EGGA 3N5UA 4H1YP 1QHWA 5C1VA 3PSOA 3H68A 4KKZA 2HYPA 1OIEA 2WDFA 5GTUA 3H61A 3EGHA 1NNWA 3THNA 4G9JA 1S3LA 2IE4C 3JYFA 4MP0A 1G5BA 4J6OA 1UF3A 4MOYA 4OR9A 3ICFA 3PSNA 3V4YA 3H63A 3IVEA 3QFOA 5HPEA 2BDXA 1WARA 3H64A 3KBPA 3P71C 4LU9A 5EQVA 4DHLA 3IB7A 4LACC 4O4KA 5JPFA 1XZWA 2QJCA 3K7WC 2BCDA 2GJUA 3ZTVA 1M63A 3FLOA 1QFCA 2DFJA 2P6BA 4ZVZA 2ZBMA 4B2OA 4DT2A 1II7A 4WWLA 3H60A 3DSCA 3E7AA 4V0VA 2R17A 4XPNA 1S95A 2USHA 2ZOAA 4ZX2A 2YEQA 2Q8UA 5IOHA 2QFPA 4V0XA 4H2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZU0 A;  1XM7 A;  1UTE A;  1KBP A;  3DSD A;  2A22 A;  2XMO A;  4F0Z A;  3IB8 A;  2QFR A;  4LTY A;  4Q7F A;  5B8I A;  3HVQ A;  3IVD A;  1T71 A;  3H67 A;  1TCO A;  3T1I A;  1HPU A;  1S8E A;  3AV0 A;  4KBP A;  4TUG A;  3QG5 C;  3QFN A;  4IYP C;  2O8G A;  1OI8 A;  4YKE A;  5JJT A;  2WDC A;  4TUI A;  1S3N A;  1OID A;  1T70 A;  4H2B A;  1WAO 1;  2Z72 A;  4V0W A;  1V73 A;  4JA9 A;  4ORB A;  4UWQ A;  1FJM A;  4O24 A;  2YVT A;  3QFK A;  3TGH A;  2AHD A;  5DNY A;  4HD0 A;  3RL3 A;  2O8A A;  4H1S A;  3RL5 A;  1Z2W A;  3DW8 C;  2IAE C;  2NYM C;  2Z1A A;  4FBW A;  1JK7 A;  4FCX A;  2WDE A;  4NZV A;  4UT3 B;  4DSY A;  1USH A;  3H69 A;  3RL4 A;  2WDD A;  1Z2X A;  3LL8 A;  4H2G A;  2NXF A;  1U32 A;  5F3W A;  3E7B A;  5J28 A;  2NYL C;  3THO B;  2CV9 A;  2HY1 A;  1AUI A;  3H66 A;  1S70 A;  4FBK A;  4FBQ A;  4ORA A;  5INB A;  2Z06 A;  1IT6 A;  4UT3 A;  4O43 A;  3FGA C;  4JA7 A;  2HYO A;  3H62 B;  3K7V C;  2BQ8 X;  3CK2 A;  4H2I A;  3C9F A;  2JOG A;  4MOV A;  4O5G A;  4IL1 A;  2NPP C;  1S3M A;  1HO5 A;  1SU1 A;  1W24 A;  1HP1 A;  3QFM A;  4M0V A;  3C5W C;  5JPE A;  4I5L C;  2IE3 C;  1MF8 A;  3AUZ A;  4I5N C;  3GVE A;  4UT2 A;  3RQZ A;  2KKN A;  4ORC A;  3EGG A;  3N5U A;  4H1Y P;  1QHW A;  5C1V A;  3PSO A;  3H68 A;  4KKZ A;  2HYP A;  1OIE A;  2WDF A;  5GTU A;  3H61 A;  3EGH A;  1NNW A;  3THN A;  4G9J A;  1S3L A;  2IE4 C;  3JYF A;  4MP0 A;  1G5B A;  4J6O A;  1UF3 A;  4MOY A;  4OR9 A;  3ICF A;  3PSN A;  3V4Y A;  3H63 A;  3IVE A;  3QFO A;  5HPE A;  2BDX A;  1WAR A;  3H64 A;  3KBP A;  3P71 C;  4LU9 A;  5EQV A;  4DHL A;  3IB7 A;  4LAC C;  4O4K A;  5JPF A;  1XZW A;  2QJC A;  3K7W C;  2BCD A;  2GJU A;  3ZTV A;  1M63 A;  1QFC A;  2DFJ A;  2P6B A;  4ZVZ A;  2ZBM A;  4B2O A;  4DT2 A;  1II7 A;  4WWL A;  3H60 A;  3DSC A;  3E7A A;  4V0V A;  2R17 A;  4XPN A;  1S95 A;  2USH A;  4ZX2 A;  2Q8U A;  5IOH A;  2QFP A;  4V0X A;  4H2F A; 
#chains in the Genus database with same CATH topology
 3ZU0 A;  1XM7 A;  2DXN A;  1UTE A;  1KBP A;  3DSD A;  2A22 A;  2XMO A;  4F0Z A;  3IB8 A;  2QFR A;  4LTY A;  4Q7F A;  3D03 A;  5B8I A;  3HVQ A;  3IVD A;  1T71 A;  3H67 A;  1TCO A;  3T1I A;  1HPU A;  1S8E A;  3AV0 A;  4KBP A;  4TUG A;  3QG5 C;  3QFN A;  4IYP C;  2O8G A;  1OI8 A;  4YKE A;  5JJT A;  2WDC A;  4TUI A;  1S3N A;  1OID A;  1T70 A;  4H2B A;  1WAO 1;  2Z72 A;  4V0W A;  1V73 A;  4JA9 A;  4ORB A;  4UWQ A;  1FJM A;  4O24 A;  2YVT A;  3QFK A;  3TGH A;  2AHD A;  5DNY A;  4HD0 A;  3RL3 A;  2O8A A;  4H1S A;  3RL5 A;  1Z2W A;  3DW8 C;  2IAE C;  2NYM C;  2Z1A A;  4FBW A;  1JK7 A;  4FCX A;  2WDE A;  4NZV A;  4UT3 B;  4DSY A;  1USH A;  3H69 A;  3E0J A;  3RL4 A;  2WDD A;  1Z2X A;  3LL8 A;  4H2G A;  2NXF A;  1U32 A;  5F3W A;  3E7B A;  5J28 A;  2NYL C;  3THO B;  2CV9 A;  2HY1 A;  1AUI A;  3H66 A;  1S70 A;  4FBK A;  4FBQ A;  4ORA A;  5INB A;  2Z06 A;  1IT6 A;  4UT3 A;  4O43 A;  3FGA C;  4JA7 A;  2HYO A;  3H62 B;  3K7V C;  2BQ8 X;  3CK2 A;  4H2I A;  2DXL A;  3C9F A;  2JOG A;  2ZO9 B;  4MOV A;  4O5G A;  4IL1 A;  2NPP C;  1S3M A;  1HO5 A;  1SU1 A;  1W24 A;  1HP1 A;  3QFM A;  4M0V A;  3C5W C;  5JPE A;  4I5L C;  2IE3 C;  1MF8 A;  3AUZ A;  4I5N C;  3GVE A;  4UT2 A;  3RQZ A;  2KKN A;  4ORC A;  3EGG A;  3N5U A;  4H1Y P;  1QHW A;  5C1V A;  3PSO A;  3H68 A;  4KKZ A;  2HYP A;  1OIE A;  2WDF A;  5GTU A;  3H61 A;  3EGH A;  1NNW A;  3THN A;  4G9J A;  1S3L A;  2IE4 C;  3JYF A;  4MP0 A;  1G5B A;  4J6O A;  1UF3 A;  4MOY A;  4OR9 A;  3ICF A;  3PSN A;  3V4Y A;  3H63 A;  3IVE A;  3QFO A;  5HPE A;  2BDX A;  1WAR A;  3H64 A;  3KBP A;  3P71 C;  4LU9 A;  5EQV A;  4DHL A;  3IB7 A;  4LAC C;  4O4K A;  5JPF A;  1XZW A;  2QJC A;  3K7W C;  2BCD A;  2GJU A;  3ZTV A;  1M63 A;  3FLO A;  1QFC A;  2DFJ A;  2P6B A;  4ZVZ A;  2ZBM A;  4B2O A;  4DT2 A;  1II7 A;  4WWL A;  3H60 A;  3DSC A;  3E7A A;  4V0V A;  2R17 A;  4XPN A;  1S95 A;  2USH A;  2ZOA A;  4ZX2 A;  2YEQ A;  2Q8U A;  5IOH A;  2QFP A;  4V0X A;  4H2F A; 
#chains in the Genus database with same CATH homology
 3ZU0 A;  1XM7 A;  2DXN A;  1UTE A;  1KBP A;  3DSD A;  2A22 A;  2XMO A;  4F0Z A;  3IB8 A;  2QFR A;  4LTY A;  4Q7F A;  3D03 A;  5B8I A;  3HVQ A;  3IVD A;  1T71 A;  3H67 A;  1TCO A;  3T1I A;  1HPU A;  1S8E A;  3AV0 A;  4KBP A;  4TUG A;  3QG5 C;  3QFN A;  4IYP C;  2O8G A;  1OI8 A;  4YKE A;  5JJT A;  2WDC A;  4TUI A;  1S3N A;  1OID A;  1T70 A;  4H2B A;  1WAO 1;  2Z72 A;  4V0W A;  1V73 A;  4JA9 A;  4ORB A;  4UWQ A;  1FJM A;  4O24 A;  2YVT A;  3QFK A;  3TGH A;  2AHD A;  5DNY A;  4HD0 A;  3RL3 A;  2O8A A;  4H1S A;  3RL5 A;  1Z2W A;  3DW8 C;  2IAE C;  2NYM C;  2Z1A A;  4FBW A;  1JK7 A;  4FCX A;  2WDE A;  4NZV A;  4UT3 B;  4DSY A;  1USH A;  3H69 A;  3E0J A;  3RL4 A;  2WDD A;  1Z2X A;  3LL8 A;  4H2G A;  2NXF A;  1U32 A;  5F3W A;  3E7B A;  5J28 A;  2NYL C;  3THO B;  2CV9 A;  2HY1 A;  1AUI A;  3H66 A;  1S70 A;  4FBK A;  4FBQ A;  4ORA A;  5INB A;  2Z06 A;  1IT6 A;  4UT3 A;  4O43 A;  3FGA C;  4JA7 A;  2HYO A;  3H62 B;  3K7V C;  2BQ8 X;  3CK2 A;  4H2I A;  2DXL A;  3C9F A;  2JOG A;  2ZO9 B;  4MOV A;  4O5G A;  4IL1 A;  2NPP C;  1S3M A;  1HO5 A;  1SU1 A;  1W24 A;  1HP1 A;  3QFM A;  4M0V A;  3C5W C;  5JPE A;  4I5L C;  2IE3 C;  1MF8 A;  3AUZ A;  4I5N C;  3GVE A;  4UT2 A;  3RQZ A;  2KKN A;  4ORC A;  3EGG A;  3N5U A;  4H1Y P;  1QHW A;  5C1V A;  3PSO A;  3H68 A;  4KKZ A;  2HYP A;  1OIE A;  2WDF A;  5GTU A;  3H61 A;  3EGH A;  1NNW A;  3THN A;  4G9J A;  1S3L A;  2IE4 C;  3JYF A;  4MP0 A;  1G5B A;  4J6O A;  1UF3 A;  4MOY A;  4OR9 A;  3ICF A;  3PSN A;  3V4Y A;  3H63 A;  3IVE A;  3QFO A;  5HPE A;  2BDX A;  1WAR A;  3H64 A;  3KBP A;  3P71 C;  4LU9 A;  5EQV A;  4DHL A;  3IB7 A;  4LAC C;  4O4K A;  5JPF A;  1XZW A;  2QJC A;  3K7W C;  2BCD A;  2GJU A;  3ZTV A;  1M63 A;  3FLO A;  1QFC A;  2DFJ A;  2P6B A;  4ZVZ A;  2ZBM A;  4B2O A;  4DT2 A;  1II7 A;  4WWL A;  3H60 A;  3DSC A;  3E7A A;  4V0V A;  2R17 A;  4XPN A;  1S95 A;  2USH A;  2ZOA A;  4ZX2 A;  2YEQ A;  2Q8U A;  5IOH A;  2QFP A;  4V0X A;  4H2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...