1OIUB

Structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
b'DYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title N2-Substituted O6-Cyclohexylmethylguanine Derivatives: Potent Inhibitors of Cyclin-Dependent Kinases 1 and 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
total genus 97
structure length 256
sequence length 256
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1oiuB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1oiuB02
2WHBB 2JGZB 2WMAB 3MY5B 1P5EB 3TNIB 1JOWA 3H4CA 4OGRB 4BCNB 2WXVB 4EONB 4ELJA 1VYWB 4EOKB 3DDPB 3EOCB 3G33B 2WEVB 1GUXB 5HVYB 3QHWB 2WFYB 4F6SB 3MI9B 1GUXA 1VINA 3LQ5B 5CEIB 3POMA 4EOIB 4CFUB 3M03A 2UUEB 2UZBB 4EORB 1OKWB 4ROCA 5ACBA 2V22B 1UNGD 1UNHD 2BKZB 3MIAB 4II5B 4BCMD 3EIDB 1URCB 1H25B 1H4LD 4CFWB 4ELLA 1AISB 4BCFB 4EOJB 4UN0A 1H1RB 4CFXB 2IW6B 2WIHB 2WMBB 1C9BA 2CCIB 4Y72B 5HNBB 1F5QB 1GH6B 2PK2A 2X1NB 2C5NB 2G9XB 4EOMB 1D3UB 4BCQD 4CFNB 5LQFB 2PK9B 2R7GA 4KRDB 4IMYB 5HBEB 1H24B 5HQ0B 1G3NC 5HBJB 3TNWB 5IF1B 2IW9B 4F70B 1OI9B 2B9RA 2W96A 4F7JB 4NSTB 4BCJB 1OGUB 1OIYB 1OL1B 4BCMB 4BCPB 4CFMB 3BLHB 4CFVB 2C5OB 1UNLD 3K7AM 1TFBA 2WPAB 4BCKB 5ICPB 4ROEA 5IDNB 1W98B 3TN8B 1OKVB 1JKWA 1FINB 2W9FA 3MY1B 2IW8B 1H26B 5L2WB 5BNJB 1JSUB 2QDJA 4CRLB 4F6WB 5LMKB 2W99A 4RODA 1H1QB 2IVXA 4BCND 3BHTB 2CCHB 2W2HA 2BPMB 4F7SB 4EOLB 2EUFA 4YC3B 1OL2B 1KXUA 4YOSA 4EC8B 4EOQB 2W9ZA 1N4MA 4F7NB 4OR5B 1AD6A 1PKDB 2F2CA 2I53A 2C5VB 2PMIB 3BHVB 3RGFB 2UZDB 2PHGA 1O9KB 3O0GD 1ZP2A 4BCOB 1BU2A 1OIUB 1O9KA 2C6TB 3TNHB 5I5ZB 2UZLB 3BLRB 2C4GB 2UZEB 1XO2A 1H1SB 2C5XB 4BCQB 4EOSB 3F5XB 1QMZB 5HBHB 4F7LB 4YOOA 1VOLA 1FVVB 4G6LB 5EFQB 4EOOB 5CYIB 2CJMB 5IDPB 3DOGB 3BHUB 3BLQB 4FX3B 3EJ1B 4BCGB 4BCIB 1H1PB 4BCHB 1H27B 4YOZA 4CFUD 1H28B 4KRCB 4I3ZB 4F6UB 1JSTB 2I40B 4TTHA 1GY3B 2WIPB 4EC9B 1E9HB 4EOPB 3QHRB 3DDQB 5FGKB 4CXAB
chains in the Genus database with same CATH superfamily
4HNVA 3TNIB 2QDYB 5HVYB 3QYGB 5CEIB 4BCMD 3MIAB 1URCB 1H4LD 3X25B 1F5QB 1GH6B 4EOMB 4BCQD 4CFNB 2R7GA 4IMYB 2CZ0B 2IW9B 3VKGA 2W96A 3A8GB 1OIYB 1OL1B 4BCPB 2DXBB 2C5OB 4ROEA 5IDNB 1W98B 2ZPGB 3TN8B 1JKWA 2W9FA 4CRLB 4EOQB 2W9ZA 4NC6A 1PKDB 3X26B 2C5VB 2PHGA 2LW4A 2QFZA 1BU2A 1UGSB 1OIUB 1O9KA 2C6TB 3TNHB 5I5ZB 1H1SB 4EOSB 1VOLA 3F5XB 5HBHB 4G6LB 5IDPB 3DOGB 4BXXX 3BLQB 4OB2B 3EJ1B 1H28B 3QYHB 1JSTB 2I40B 3QZ5B 4MFDA 3DDQB 3X24B 2ZPFB 3QYEA 2JGZB 3MY5B 4BCNB 2QGSA 3DDPB 2ZPBB 4ZGJB 3MI9B 3M03A 2UUEB 2V22B 1UNHD 2BS4A 4FM4B 1H25B 2ZCFB 4ELLA 4EOJB 4UN0A 3HHTB 3B57A 1H1RB 4OB3B 2IW6B 2WIHB 2CCIB 4Y72B 5HNBB 2PK2A 2C5NB 2PK9B 5HBEB 1G3NC 4BY1X 4F70B 3A8HB 1OGUB 3BLHB 5IHYA 1UNLD 5ICPB 4BCKB 1FINB 3BG3A 5L2WB 1JSUB 2W99A 4BCND 4F7SB 5DQVA 4EOLB 1OL2B 4EC8B 4YOSA 1N4MA 4AKHA 2DMEA 4OR5B 1AD6A 3TW6A 3VKHA 2UZDB 1O9KB 1UGPB 4ZGDB 3QWLA 4HNTA 2UZLB 3BLRB 2CZ7B 1XO2A 2C5XB 4F7LB 1QMZB 1FVVB 3QXEB 3VYHB 2CJMB 3BHUB 4FX3B 4JX4A 4BCHB 4YOZA 4KRCB 4F6UB 4OB1B 1GY3B 2WIPB 4JX6A 2WMAB 1P5EB 1JOWA 4OGRB 2WXVB 4ELJA 3EOCB 3G33B 3X20B 2WEVB 4F6SB 1GUXA 2G77A 2ZZDB 3LQ5B 3POMA 4EOIB 4MFEA 4CFUB 2QF7A 2KMGA 4II5B 1UNGD 4AKIA 1AISB 3PO3S 2DD5B 4CFXB 1C9BA 2PJQA 2ZPHB 2X1NB 1D3UB 5LQFB 5IF1B 2DPPB 4BCMB 4JX5A 4CFMB 4AI6A 2DD4B 4AKGA 3K7AM 1TFBA 2WPAB 5EJCA 1OKVB 2QDJA 4F6WB 5LMKB 2IVXA 2CCHB 2BPMB 3X28B 2EUFA 4YC3B 1KXUA 2QQ8A 4OB0B 1E7PA 4ZGEB 2AHJB 2F2CA 3DTOA 3BHVB 4QSHA 3RGFB 3A8MB 3QYBA 3O0GD 2IN3A 2ZPEB 4BCOB 1IREB 3KHIA 2C4GB 2UZEB 4YOOA 4BY7X 5EFQB 5CYIB 3QZ9B 4BCIB 1H27B 4I3ZB 1QLBA 2BS2A 4EC9B 1ENWA 3QHRB 5FGKB 4F7JB 4CXAB 2D0QB 2WHBB 3WVEB 3H4CA 4EONB 1VYWB 4EOKB 1GUXB 2CYZB 4BBSM 3QHWB 2WFYB 3GTMS 4M6VA 1VINA 2WJ9A 2UZBB 2BS3A 4EORB 1OKWB 1AHJB 4ROCA 5ACBA 2BKZB 3EIDB 3VYGB 4CFWB 4HLQA 3BG5A 4BCFB 3HO8A 2WMBB 2G9XB 4MIMA 3BG9A 1FKMA 4KRDB 1H24B 5HQ0B 5HBJB 3TNWB 3TW7A 1OI9B 3HB9A 2B9RA 1UGQB 4NSTB 4BCJB 4CFVB 1TD6A 3A8LB 4LOCA 2KR6A 3DJBA 3MY1B 2IW8B 1H26B 5BNJB 4RODA 1H1QB 3BHTB 3NDQA 2W2HA 1V29B 2CZ1B 3HBLA 4F7NB 1UGRB 3WVDB 4BBRM 2I53A 3A8OB 3HZJA 4Z6YA 2PMIB 1ZP2A 3DL1A 4BCQB 2ZPIB 4EOOB 4HNUA 2DXCB 4HL4A 4BCGB 5DQWA 1H1PB 4CFUD 2CZ6B 4TTHA 1E9HB 4EOPB
chains in the Genus database with same CATH topology
2WHBB 2JGZB 2WMAB 3MY5B 1P5EB 3TNIB 1JOWA 3H4CA 4OGRB 4BCNB 2WXVB 4EONB 4ELJA 1VYWB 4EOKB 3DDPB 3EOCB 3G33B 2WEVB 1GUXB 5HVYB 3QHWB 2WFYB 4F6SB 3MI9B 1GUXA 1VINA 3LQ5B 5CEIB 3POMA 4EOIB 4CFUB 3M03A 2UUEB 2UZBB 4EORB 1OKWB 4ROCA 5ACBA 2V22B 1UNGD 1UNHD 2BKZB 3MIAB 4II5B 4BCMD 3EIDB 1URCB 1H25B 1H4LD 4CFWB 4ELLA 1AISB 4BCFB 4EOJB 4UN0A 1H1RB 4CFXB 2IW6B 2WIHB 2WMBB 1C9BA 2CCIB 4Y72B 5HNBB 1F5QB 1GH6B 2PK2A 2X1NB 2C5NB 2G9XB 4EOMB 1D3UB 4BCQD 4CFNB 5LQFB 2PK9B 2R7GA 4KRDB 4IMYB 5HBEB 1H24B 5HQ0B 1G3NC 5HBJB 3TNWB 5IF1B 2IW9B 4F70B 1OI9B 2B9RA 2W96A 4F7JB 4NSTB 4BCJB 1OGUB 1OIYB 1OL1B 4BCMB 4BCPB 4CFMB 3BLHB 4CFVB 2C5OB 1UNLD 3K7AM 1TFBA 2WPAB 4BCKB 5ICPB 4ROEA 5IDNB 1W98B 3TN8B 1OKVB 1JKWA 1FINB 2W9FA 3MY1B 2IW8B 1H26B 5L2WB 5BNJB 1JSUB 2QDJA 4CRLB 4F6WB 5LMKB 2W99A 4RODA 1H1QB 2IVXA 4BCND 3BHTB 2CCHB 2W2HA 2BPMB 4F7SB 4EOLB 2EUFA 4YC3B 1OL2B 1KXUA 4YOSA 4EC8B 4EOQB 2W9ZA 1N4MA 4F7NB 4OR5B 1AD6A 1PKDB 2F2CA 2I53A 2C5VB 2PMIB 3BHVB 3RGFB 2UZDB 2PHGA 1O9KB 3O0GD 1ZP2A 4BCOB 1BU2A 1OIUB 1O9KA 2C6TB 3TNHB 5I5ZB 2UZLB 3BLRB 2C4GB 2UZEB 1XO2A 1H1SB 2C5XB 4BCQB 4EOSB 3F5XB 1QMZB 5HBHB 4F7LB 4YOOA 1VOLA 1FVVB 4G6LB 5EFQB 4EOOB 5CYIB 2CJMB 5IDPB 3DOGB 3BHUB 3BLQB 4FX3B 3EJ1B 4BCGB 4BCIB 1H1PB 4BCHB 1H27B 4YOZA 4CFUD 1H28B 4KRCB 4I3ZB 4F6UB 1JSTB 2I40B 4TTHA 1GY3B 2WIPB 4EC9B 1E9HB 4EOPB 3QHRB 3DDQB 5FGKB 4CXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WHB B;  2JGZ B;  2WMA B;  3MY5 B;  1P5E B;  3TNI B;  1JOW A;  3H4C A;  4OGR B;  4BCN B;  2WXV B;  4EON B;  4ELJ A;  1VYW B;  4EOK B;  3DDP B;  3EOC B;  3G33 B;  2WEV B;  1GUX B;  5HVY B;  3QHW B;  2WFY B;  4F6S B;  3MI9 B;  1GUX A;  1VIN A;  3LQ5 B;  5CEI B;  3POM A;  4EOI B;  4CFU B;  3M03 A;  2UUE B;  2UZB B;  4EOR B;  1OKW B;  4ROC A;  5ACB A;  2V22 B;  1UNG D;  1UNH D;  2BKZ B;  3MIA B;  4II5 B;  4BCM D;  3EID B;  1URC B;  1H25 B;  1H4L D;  4CFW B;  4ELL A;  1AIS B;  4BCF B;  4EOJ B;  4UN0 A;  1H1R B;  4CFX B;  2IW6 B;  2WIH B;  2WMB B;  1C9B A;  2CCI B;  4Y72 B;  5HNB B;  1F5Q B;  1GH6 B;  2PK2 A;  2X1N B;  2C5N B;  2G9X B;  4EOM B;  1D3U B;  4BCQ D;  4CFN B;  5LQF B;  2PK9 B;  2R7G A;  4KRD B;  4IMY B;  5HBE B;  1H24 B;  5HQ0 B;  1G3N C;  5HBJ B;  3TNW B;  5IF1 B;  2IW9 B;  4F70 B;  1OI9 B;  2B9R A;  2W96 A;  4F7J B;  4NST B;  4BCJ B;  1OGU B;  1OIY B;  1OL1 B;  4BCM B;  4BCP B;  4CFM B;  3BLH B;  4CFV B;  2C5O B;  1UNL D;  3K7A M;  1TFB A;  2WPA B;  4BCK B;  5ICP B;  4ROE A;  5IDN B;  1W98 B;  3TN8 B;  1OKV B;  1JKW A;  1FIN B;  2W9F A;  3MY1 B;  2IW8 B;  1H26 B;  5L2W B;  5BNJ B;  1JSU B;  2QDJ A;  4CRL B;  4F6W B;  5LMK B;  2W99 A;  4ROD A;  1H1Q B;  2IVX A;  4BCN D;  3BHT B;  2CCH B;  2W2H A;  2BPM B;  4F7S B;  4EOL B;  2EUF A;  4YC3 B;  1OL2 B;  1KXU A;  4YOS A;  4EC8 B;  4EOQ B;  2W9Z A;  1N4M A;  4F7N B;  4OR5 B;  1AD6 A;  1PKD B;  2F2C A;  2I53 A;  2C5V B;  2PMI B;  3BHV B;  3RGF B;  2UZD B;  2PHG A;  1O9K B;  3O0G D;  1ZP2 A;  4BCO B;  1BU2 A;  1OIU B;  1O9K A;  2C6T B;  3TNH B;  5I5Z B;  2UZL B;  3BLR B;  2C4G B;  2UZE B;  1XO2 A;  1H1S B;  2C5X B;  4BCQ B;  4EOS B;  3F5X B;  1QMZ B;  5HBH B;  4F7L B;  4YOO A;  1VOL A;  1FVV B;  4G6L B;  5EFQ B;  4EOO B;  5CYI B;  2CJM B;  5IDP B;  3DOG B;  3BHU B;  3BLQ B;  4FX3 B;  3EJ1 B;  4BCG B;  4BCI B;  1H1P B;  4BCH B;  1H27 B;  4YOZ A;  4CFU D;  1H28 B;  4KRC B;  4I3Z B;  4F6U B;  1JST B;  2I40 B;  4TTH A;  1GY3 B;  2WIP B;  4EC9 B;  1E9H B;  4EOP B;  3QHR B;  3DDQ B;  5FGK B;  4CXA B; 
#chains in the Genus database with same CATH topology
 4HNV A;  3TNI B;  2QDY B;  5HVY B;  3QYG B;  5CEI B;  4BCM D;  3MIA B;  1URC B;  1H4L D;  3X25 B;  1F5Q B;  1GH6 B;  4EOM B;  4BCQ D;  4CFN B;  2R7G A;  4IMY B;  2CZ0 B;  2IW9 B;  3VKG A;  2W96 A;  3A8G B;  1OIY B;  1OL1 B;  4BCP B;  2DXB B;  2C5O B;  4ROE A;  5IDN B;  1W98 B;  2ZPG B;  3TN8 B;  1JKW A;  2W9F A;  4CRL B;  4EOQ B;  2W9Z A;  4NC6 A;  1PKD B;  3X26 B;  2C5V B;  2PHG A;  2LW4 A;  2QFZ A;  1BU2 A;  1UGS B;  1OIU B;  1O9K A;  2C6T B;  3TNH B;  5I5Z B;  1H1S B;  4EOS B;  1VOL A;  3F5X B;  5HBH B;  4G6L B;  5IDP B;  3DOG B;  4BXX X;  3BLQ B;  4OB2 B;  3EJ1 B;  1H28 B;  3QYH B;  1JST B;  2I40 B;  3QZ5 B;  4MFD A;  3DDQ B;  3X24 B;  2ZPF B;  3QYE A;  2JGZ B;  3MY5 B;  4BCN B;  2QGS A;  3DDP B;  2ZPB B;  4ZGJ B;  3MI9 B;  3M03 A;  2UUE B;  2V22 B;  1UNH D;  2BS4 A;  4FM4 B;  1H25 B;  2ZCF B;  4ELL A;  4EOJ B;  4UN0 A;  3HHT B;  3B57 A;  1H1R B;  4OB3 B;  2IW6 B;  2WIH B;  2CCI B;  4Y72 B;  5HNB B;  2PK2 A;  2C5N B;  2PK9 B;  5HBE B;  1G3N C;  4BY1 X;  4F70 B;  3A8H B;  1OGU B;  3BLH B;  5IHY A;  1UNL D;  5ICP B;  4BCK B;  1FIN B;  3BG3 A;  5L2W B;  1JSU B;  2W99 A;  4BCN D;  4F7S B;  5DQV A;  4EOL B;  1OL2 B;  4EC8 B;  4YOS A;  1N4M A;  4AKH A;  2DME A;  4OR5 B;  1AD6 A;  3TW6 A;  3VKH A;  2UZD B;  1O9K B;  1UGP B;  4ZGD B;  3QWL A;  4HNT A;  2UZL B;  3BLR B;  2CZ7 B;  1XO2 A;  2C5X B;  4F7L B;  1QMZ B;  1FVV B;  3QXE B;  3VYH B;  2CJM B;  3BHU B;  4FX3 B;  4JX4 A;  4BCH B;  4YOZ A;  4KRC B;  4F6U B;  4OB1 B;  1GY3 B;  2WIP B;  4JX6 A;  2WMA B;  1P5E B;  1JOW A;  4OGR B;  2WXV B;  4ELJ A;  3EOC B;  3G33 B;  3X20 B;  2WEV B;  4F6S B;  1GUX A;  2G77 A;  2ZZD B;  3LQ5 B;  3POM A;  4EOI B;  4MFE A;  4CFU B;  2QF7 A;  2KMG A;  4II5 B;  1UNG D;  4AKI A;  1AIS B;  3PO3 S;  2DD5 B;  4CFX B;  1C9B A;  2PJQ A;  2ZPH B;  2X1N B;  1D3U B;  5LQF B;  5IF1 B;  2DPP B;  4BCM B;  4JX5 A;  4CFM B;  4AI6 A;  2DD4 B;  4AKG A;  3K7A M;  1TFB A;  2WPA B;  5EJC A;  1OKV B;  2QDJ A;  4F6W B;  5LMK B;  2IVX A;  2CCH B;  2BPM B;  3X28 B;  2EUF A;  4YC3 B;  1KXU A;  2QQ8 A;  4OB0 B;  1E7P A;  4ZGE B;  2AHJ B;  2F2C A;  3DTO A;  3BHV B;  4QSH A;  3RGF B;  3A8M B;  3QYB A;  3O0G D;  2IN3 A;  2ZPE B;  4BCO B;  1IRE B;  3KHI A;  2C4G B;  2UZE B;  4YOO A;  4BY7 X;  5EFQ B;  5CYI B;  3QZ9 B;  4BCI B;  1H27 B;  4I3Z B;  1QLB A;  2BS2 A;  4EC9 B;  1ENW A;  3QHR B;  5FGK B;  4F7J B;  4CXA B;  2D0Q B;  2WHB B;  3WVE B;  3H4C A;  4EON B;  1VYW B;  4EOK B;  1GUX B;  2CYZ B;  4BBS M;  3QHW B;  2WFY B;  3GTM S;  4M6V A;  1VIN A;  2WJ9 A;  2UZB B;  2BS3 A;  4EOR B;  1OKW B;  1AHJ B;  4ROC A;  5ACB A;  2BKZ B;  3EID B;  3VYG B;  4CFW B;  4HLQ A;  3BG5 A;  4BCF B;  3HO8 A;  2WMB B;  2G9X B;  4MIM A;  3BG9 A;  1FKM A;  4KRD B;  1H24 B;  5HQ0 B;  5HBJ B;  3TNW B;  3TW7 A;  1OI9 B;  3HB9 A;  2B9R A;  1UGQ B;  4NST B;  4BCJ B;  4CFV B;  1TD6 A;  3A8L B;  4LOC A;  2KR6 A;  3DJB A;  3MY1 B;  2IW8 B;  1H26 B;  5BNJ B;  4ROD A;  1H1Q B;  3BHT B;  3NDQ A;  2W2H A;  1V29 B;  2CZ1 B;  3HBL A;  4F7N B;  1UGR B;  3WVD B;  4BBR M;  2I53 A;  3A8O B;  3HZJ A;  4Z6Y A;  2PMI B;  1ZP2 A;  3DL1 A;  4BCQ B;  2ZPI B;  4EOO B;  4HNU A;  2DXC B;  4HL4 A;  4BCG B;  5DQW A;  1H1P B;  4CFU D;  2CZ6 B;  4TTH A;  1E9H B;  4EOP B; 
#chains in the Genus database with same CATH homology
 2WHB B;  2JGZ B;  2WMA B;  3MY5 B;  1P5E B;  3TNI B;  1JOW A;  3H4C A;  4OGR B;  4BCN B;  2WXV B;  4EON B;  4ELJ A;  1VYW B;  4EOK B;  3DDP B;  3EOC B;  3G33 B;  2WEV B;  1GUX B;  5HVY B;  3QHW B;  2WFY B;  4F6S B;  3MI9 B;  1GUX A;  1VIN A;  3LQ5 B;  5CEI B;  3POM A;  4EOI B;  4CFU B;  3M03 A;  2UUE B;  2UZB B;  4EOR B;  1OKW B;  4ROC A;  5ACB A;  2V22 B;  1UNG D;  1UNH D;  2BKZ B;  3MIA B;  4II5 B;  4BCM D;  3EID B;  1URC B;  1H25 B;  1H4L D;  4CFW B;  4ELL A;  1AIS B;  4BCF B;  4EOJ B;  4UN0 A;  1H1R B;  4CFX B;  2IW6 B;  2WIH B;  2WMB B;  1C9B A;  2CCI B;  4Y72 B;  5HNB B;  1F5Q B;  1GH6 B;  2PK2 A;  2X1N B;  2C5N B;  2G9X B;  4EOM B;  1D3U B;  4BCQ D;  4CFN B;  5LQF B;  2PK9 B;  2R7G A;  4KRD B;  4IMY B;  5HBE B;  1H24 B;  5HQ0 B;  1G3N C;  5HBJ B;  3TNW B;  5IF1 B;  2IW9 B;  4F70 B;  1OI9 B;  2B9R A;  2W96 A;  4F7J B;  4NST B;  4BCJ B;  1OGU B;  1OIY B;  1OL1 B;  4BCM B;  4BCP B;  4CFM B;  3BLH B;  4CFV B;  2C5O B;  1UNL D;  3K7A M;  1TFB A;  2WPA B;  4BCK B;  5ICP B;  4ROE A;  5IDN B;  1W98 B;  3TN8 B;  1OKV B;  1JKW A;  1FIN B;  2W9F A;  3MY1 B;  2IW8 B;  1H26 B;  5L2W B;  5BNJ B;  1JSU B;  2QDJ A;  4CRL B;  4F6W B;  5LMK B;  2W99 A;  4ROD A;  1H1Q B;  2IVX A;  4BCN D;  3BHT B;  2CCH B;  2W2H A;  2BPM B;  4F7S B;  4EOL B;  2EUF A;  4YC3 B;  1OL2 B;  1KXU A;  4YOS A;  4EC8 B;  4EOQ B;  2W9Z A;  1N4M A;  4F7N B;  4OR5 B;  1AD6 A;  1PKD B;  2F2C A;  2I53 A;  2C5V B;  2PMI B;  3BHV B;  3RGF B;  2UZD B;  2PHG A;  1O9K B;  3O0G D;  1ZP2 A;  4BCO B;  1BU2 A;  1OIU B;  1O9K A;  2C6T B;  3TNH B;  5I5Z B;  2UZL B;  3BLR B;  2C4G B;  2UZE B;  1XO2 A;  1H1S B;  2C5X B;  4BCQ B;  4EOS B;  3F5X B;  1QMZ B;  5HBH B;  4F7L B;  4YOO A;  1VOL A;  1FVV B;  4G6L B;  5EFQ B;  4EOO B;  5CYI B;  2CJM B;  5IDP B;  3DOG B;  3BHU B;  3BLQ B;  4FX3 B;  3EJ1 B;  4BCG B;  4BCI B;  1H1P B;  4BCH B;  1H27 B;  4YOZ A;  4CFU D;  1H28 B;  4KRC B;  4I3Z B;  4F6U B;  1JST B;  2I40 B;  4TTH A;  1GY3 B;  2WIP B;  4EC9 B;  1E9H B;  4EOP B;  3QHR B;  3DDQ B;  5FGK B;  4CXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...