1OIYB

Structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title N2-Substituted O6-Cyclohexylmethylguanine Derivatives: Potent Inhibitors of Cyclin-Dependent Kinases 1 and 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
total genus 98
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1oiyB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1oiyB02
5FGKB 5CYIB 4KRDB 4BCKB 4EC9B 3TNWB 2F2CA 4ROCA 4BCNB 2UZEB 2I40B 4YOSA 3DDPB 1XO2A 2WHBB 2C6TB 3MI9B 1UNGD 1H24B 4Y72B 4BCND 1H1RB 4BCIB 3TNIB 1P5EB 4G6LB 1PKDB 1H1QB 4CFMB 1JSUB 5HNBB 4EOJB 4ELJA 2PMIB 1OGUB 1UNLD 3G33B 4EC8B 4F70B 1OL2B 1OI9B 1ZP2A 5HBHB 4EOPB 3O0GD 3M03A 5EFQB 5ICPB 1H27B 1VYWB 4ELLA 4ROEA 2QDJA 4F6WB 3MY1B 2C5VB 3DDQB 5HBEB 4F7NB 4KRCB 5LMKB 4FX3B 1GUXA 2W9FA 1C9BA 2W99A 5HVYB 4EOIB 4F7SB 5ACBA 5IDPB 4NSTB 4CFNB 1H1SB 4BCFB 4EOSB 3LQ5B 2WMAB 2PK2A 4YOOA 1G3NC 3TNHB 4CFVB 1N4MA 3BHVB 3H4CA 1H26B 4BCMB 5IF1B 1GH6B 4F6UB 4EOQB 4UN0A 4BCMD 3MIAB 1GY3B 4CFWB 1OIUB 5LQFB 2PK9B 2C4GB 2EUFA 4BCHB 3BHTB 2WFYB 3BHUB 4YC3B 4EOKB 2WEVB 3F5XB 4F6SB 5BNJB 2X1NB 3BLHB 1GUXB 1OIYB 2UZDB 3POMA 4EORB 2C5NB 1H4LD 2V22B 1F5QB 1AISB 1FINB 3QHWB 2CCIB 5HBJB 4BCGB 5CEIB 1E9HB 1QMZB 1H25B 2WXVB 4CFUD 2C5OB 2WPAB 2UZLB 1VOLA 1JKWA 1BU2A 2PHGA 3K7AM 2WMBB 4OGRB 2R7GA 2C5XB 4OR5B 1URCB 2UZBB 4RODA 5HQ0B 2W96A 2W9ZA 4I3ZB 4BCPB 1OKWB 2IW8B 4TTHA 4F7JB 1TFBA 3QHRB 1W98B 1OKVB 1D3UB 5IDNB 1O9KA 1UNHD 3EIDB 3EOCB 2CJMB 1OL1B 3BLQB 4BCQB 1VINA 1JSTB 2I53A 3RGFB 2WIHB 4BCQD 1FVVB 2BPMB 4F7LB 3DOGB 2WIPB 4CFUB 4BCJB 2BKZB 4IMYB 1H1PB 1JOWA 3EJ1B 4EOLB 1KXUA 2G9XB 2B9RA 4BCOB 4EOMB 4YOZA 3TN8B 2CCHB 4EOOB 2IW6B 4II5B 2UUEB 1O9KB 3BLRB 1AD6A 2IW9B 4EONB 5I5ZB 2JGZB 3MY5B 4CXAB 5L2WB 2IVXA 4CRLB 2W2HA 4CFXB 1H28B
chains in the Genus database with same CATH superfamily
4MIMA 5FGKB 4BCKB 3TNWB 3HZJA 4HNTA 5IHYA 4Y72B 4CFMB 4ELJA 1JSUB 1OGUB 3G33B 1OL2B 1OI9B 4EOPB 5EFQB 5ICPB 4ROEA 4F6WB 3MY1B 2C5VB 3QYGB 4KRCB 2WMAB 1G3NC 1H26B 4F6UB 4UN0A 1GY3B 3VKGA 1OIUB 2KMGA 1E7PA 2QF7A 2EUFA 3HO8A 3BHTB 4YC3B 3A8OB 2WEVB 3BG5A 2X1NB 2UZDB 2C5NB 1UGRB 4OB3B 1E9HB 2WPAB 2UZLB 1VOLA 2ZCFB 2D0QB 2ZPIB 4HNUA 2W9ZA 4I3ZB 4ZGEB 3TW6A 2DXCB 2CZ7B 5IDNB 2ZPHB 4MFDA 2CJMB 3A8GB 3B57A 2BKZB 3QWLA 1KXUA 2B9RA 4YOZA 4II5B 3BLRB 4CXAB 2W2HA 3DTOA 4CFXB 4BCNB 4YOSA 1XO2A 3MI9B 1UNGD 1H24B 3QYEA 4EOJB 5HNBB 1V29B 2QGSA 1H27B 4ELLA 2QDJA 4JX5A 5HBEB 2ZPFB 5LMKB 3VYHB 4FX3B 1C9BA 2W99A 4CFNB 3LQ5B 1UGQB 4FM4B 1N4MA 3H4CA 4BCMB 4AI6A 3WVDB 2PK9B 2C4GB 4BCHB 3BHUB 4EOKB 3F5XB 5BNJB 3QXEB 3QZ5B 1OIYB 3POMA 1H4LD 1F5QB 4ZGJB 1FINB 2QQ8A 4M6VA 2DMEA 3BG9A 1QMZB 4QSHA 4HNVA 1JKWA 2PHGA 3A8HB 1QLBA 2R7GA 4RODA 3PO3S 2IN3A 4BCPB 4TTHA 2CZ6B 4F7JB 3KHIA 3QHRB 1W98B 1OKVB 1D3UB 4MFEA 3X26B 3BLQB 1OL1B 4BCQB 2CYZB 4JX6A 3TW7A 1JSTB 3RGFB 2WIHB 1IREB 4BCJB 4HLQA 1JOWA 3EJ1B 2AHJB 4BCOB 4EOOB 5I5ZB 2JGZB 3MY5B 2BS2A 2IVXA 4BBRM 5CYIB 4EC9B 1TD6A 4BY1X 4ROCA 2UZEB 2I40B 4BCND 1H1QB 2ZPBB 2PMIB 1UNLD 4F70B 2BS4A 1ZP2A 5HBHB 4AKHA 3O0GD 2ZZDB 4F7NB 3QYHB 3X24B 5ACBA 4NSTB 3A8LB 1H1SB 4BCFB 4EOSB 3TNHB 5DQVA 4CFVB 3BHVB 5IF1B 4EOQB 3GTMS 3VKHA 4BCMD 5EJCA 2WFYB 1ENWA 1AISB 3QHWB 1H25B 1AHJB 2WXVB 3NDQA 2WJ9A 4BXXX 3HB9A 4CFUD 2BS3A 4BY7X 1BU2A 2WMBB 2DPPB 4OGRB 2C5XB 1URCB 2UZBB 2W96A 1TFBA 1O9KA 3EIDB 1UGPB 2DXBB 4BCQD 4JX4A 2WIPB 4CFUB 4IMYB 3DJBA 2CCHB 3QZ9B 1O9KB 1AD6A 4EONB 3QYBA 5L2WB 4CRLB 4KRDB 2F2CA 4ZGDB 3DDPB 2WHBB 2C6TB 2DD5B 4EORB 1H1RB 3A8MB 3TNIB 1P5EB 4G6LB 1PKDB 4BCIB 4EC8B 3X20B 3M03A 1VYWB 3HHTB 3DDQB 2DD4B 1GUXA 3X28B 2W9FA 3BG3A 5HVYB 4EOIB 4F7SB 5IDPB 2PK2A 4YOOA 3X25B 2QFZA 1GH6B 4OB2B 2CZ1B 3MIAB 4OB1B 4CFWB 5LQFB 2ZPEB 2LW4A 4F6SB 3BLHB 1GUXB 1UGSB 2V22B 3VYGB 2ZPGB 2CZ0B 2CCIB 5HBJB 4BCGB 5CEIB 2C5OB 4AKIA 3K7AM 4OR5B 5HQ0B 2QDYB 1OKWB 2IW8B 3DL1A 2PJQA 4BBSM 1FKMA 4LOCA 4NC6A 1UNHD 3EOCB 3WVEB 1VINA 2I53A 1FVVB 4HL4A 2BPMB 4F7LB 3DOGB 5DQWA 4Z6YA 2KR6A 1H1PB 4EOLB 2G77A 2G9XB 4AKGA 4EOMB 3HBLA 3TN8B 2IW6B 2UUEB 2IW9B 4OB0B 1H28B
chains in the Genus database with same CATH topology
5FGKB 5CYIB 4KRDB 4BCKB 4EC9B 3TNWB 2F2CA 4ROCA 4BCNB 2UZEB 2I40B 4YOSA 3DDPB 1XO2A 2WHBB 2C6TB 3MI9B 1UNGD 1H24B 4Y72B 4BCND 1H1RB 4BCIB 3TNIB 1P5EB 4G6LB 1PKDB 1H1QB 4CFMB 1JSUB 5HNBB 4EOJB 4ELJA 2PMIB 1OGUB 1UNLD 3G33B 4EC8B 4F70B 1OL2B 1OI9B 1ZP2A 5HBHB 4EOPB 3O0GD 3M03A 5EFQB 5ICPB 1H27B 1VYWB 4ELLA 4ROEA 2QDJA 4F6WB 3MY1B 2C5VB 3DDQB 5HBEB 4F7NB 4KRCB 5LMKB 4FX3B 1GUXA 2W9FA 1C9BA 2W99A 5HVYB 4EOIB 4F7SB 5ACBA 5IDPB 4NSTB 4CFNB 1H1SB 4BCFB 4EOSB 3LQ5B 2WMAB 2PK2A 4YOOA 1G3NC 3TNHB 4CFVB 1N4MA 3BHVB 3H4CA 1H26B 4BCMB 5IF1B 1GH6B 4F6UB 4EOQB 4UN0A 4BCMD 3MIAB 1GY3B 4CFWB 1OIUB 5LQFB 2PK9B 2C4GB 2EUFA 4BCHB 3BHTB 2WFYB 3BHUB 4YC3B 4EOKB 2WEVB 3F5XB 4F6SB 5BNJB 2X1NB 3BLHB 1GUXB 1OIYB 2UZDB 3POMA 4EORB 2C5NB 1H4LD 2V22B 1F5QB 1AISB 1FINB 3QHWB 2CCIB 5HBJB 4BCGB 5CEIB 1E9HB 1QMZB 1H25B 2WXVB 4CFUD 2C5OB 2WPAB 2UZLB 1VOLA 1JKWA 1BU2A 2PHGA 3K7AM 2WMBB 4OGRB 2R7GA 2C5XB 4OR5B 1URCB 2UZBB 4RODA 5HQ0B 2W96A 2W9ZA 4I3ZB 4BCPB 1OKWB 2IW8B 4TTHA 4F7JB 1TFBA 3QHRB 1W98B 1OKVB 1D3UB 5IDNB 1O9KA 1UNHD 3EIDB 3EOCB 2CJMB 1OL1B 3BLQB 4BCQB 1VINA 1JSTB 2I53A 3RGFB 2WIHB 4BCQD 1FVVB 2BPMB 4F7LB 3DOGB 2WIPB 4CFUB 4BCJB 2BKZB 4IMYB 1H1PB 1JOWA 3EJ1B 4EOLB 1KXUA 2G9XB 2B9RA 4BCOB 4EOMB 4YOZA 3TN8B 2CCHB 4EOOB 2IW6B 4II5B 2UUEB 1O9KB 3BLRB 1AD6A 2IW9B 4EONB 5I5ZB 2JGZB 3MY5B 4CXAB 5L2WB 2IVXA 4CRLB 2W2HA 4CFXB 1H28B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FGK B;  5CYI B;  4KRD B;  4BCK B;  4EC9 B;  3TNW B;  2F2C A;  4ROC A;  4BCN B;  2UZE B;  2I40 B;  4YOS A;  3DDP B;  1XO2 A;  2WHB B;  2C6T B;  3MI9 B;  1UNG D;  1H24 B;  4Y72 B;  4BCN D;  1H1R B;  4BCI B;  3TNI B;  1P5E B;  4G6L B;  1PKD B;  1H1Q B;  4CFM B;  1JSU B;  5HNB B;  4EOJ B;  4ELJ A;  2PMI B;  1OGU B;  1UNL D;  3G33 B;  4EC8 B;  4F70 B;  1OL2 B;  1OI9 B;  1ZP2 A;  5HBH B;  4EOP B;  3O0G D;  3M03 A;  5EFQ B;  5ICP B;  1H27 B;  1VYW B;  4ELL A;  4ROE A;  2QDJ A;  4F6W B;  3MY1 B;  2C5V B;  3DDQ B;  5HBE B;  4F7N B;  4KRC B;  5LMK B;  4FX3 B;  1GUX A;  2W9F A;  1C9B A;  2W99 A;  5HVY B;  4EOI B;  4F7S B;  5ACB A;  5IDP B;  4NST B;  4CFN B;  1H1S B;  4BCF B;  4EOS B;  3LQ5 B;  2WMA B;  2PK2 A;  4YOO A;  1G3N C;  3TNH B;  4CFV B;  1N4M A;  3BHV B;  3H4C A;  1H26 B;  4BCM B;  5IF1 B;  1GH6 B;  4F6U B;  4EOQ B;  4UN0 A;  4BCM D;  3MIA B;  1GY3 B;  4CFW B;  1OIU B;  5LQF B;  2PK9 B;  2C4G B;  2EUF A;  4BCH B;  3BHT B;  2WFY B;  3BHU B;  4YC3 B;  4EOK B;  2WEV B;  3F5X B;  4F6S B;  5BNJ B;  2X1N B;  3BLH B;  1GUX B;  1OIY B;  2UZD B;  3POM A;  4EOR B;  2C5N B;  1H4L D;  2V22 B;  1F5Q B;  1AIS B;  1FIN B;  3QHW B;  2CCI B;  5HBJ B;  4BCG B;  5CEI B;  1E9H B;  1QMZ B;  1H25 B;  2WXV B;  4CFU D;  2C5O B;  2WPA B;  2UZL B;  1VOL A;  1JKW A;  1BU2 A;  2PHG A;  3K7A M;  2WMB B;  4OGR B;  2R7G A;  2C5X B;  4OR5 B;  1URC B;  2UZB B;  4ROD A;  5HQ0 B;  2W96 A;  2W9Z A;  4I3Z B;  4BCP B;  1OKW B;  2IW8 B;  4TTH A;  4F7J B;  1TFB A;  3QHR B;  1W98 B;  1OKV B;  1D3U B;  5IDN B;  1O9K A;  1UNH D;  3EID B;  3EOC B;  2CJM B;  1OL1 B;  3BLQ B;  4BCQ B;  1VIN A;  1JST B;  2I53 A;  3RGF B;  2WIH B;  4BCQ D;  1FVV B;  2BPM B;  4F7L B;  3DOG B;  2WIP B;  4CFU B;  4BCJ B;  2BKZ B;  4IMY B;  1H1P B;  1JOW A;  3EJ1 B;  4EOL B;  1KXU A;  2G9X B;  2B9R A;  4BCO B;  4EOM B;  4YOZ A;  3TN8 B;  2CCH B;  4EOO B;  2IW6 B;  4II5 B;  2UUE B;  1O9K B;  3BLR B;  1AD6 A;  2IW9 B;  4EON B;  5I5Z B;  2JGZ B;  3MY5 B;  4CXA B;  5L2W B;  2IVX A;  4CRL B;  2W2H A;  4CFX B;  1H28 B; 
#chains in the Genus database with same CATH topology
 4MIM A;  5FGK B;  4BCK B;  3TNW B;  3HZJ A;  4HNT A;  5IHY A;  4Y72 B;  4CFM B;  4ELJ A;  1JSU B;  1OGU B;  3G33 B;  1OL2 B;  1OI9 B;  4EOP B;  5EFQ B;  5ICP B;  4ROE A;  4F6W B;  3MY1 B;  2C5V B;  3QYG B;  4KRC B;  2WMA B;  1G3N C;  1H26 B;  4F6U B;  4UN0 A;  1GY3 B;  3VKG A;  1OIU B;  2KMG A;  1E7P A;  2QF7 A;  2EUF A;  3HO8 A;  3BHT B;  4YC3 B;  3A8O B;  2WEV B;  3BG5 A;  2X1N B;  2UZD B;  2C5N B;  1UGR B;  4OB3 B;  1E9H B;  2WPA B;  2UZL B;  1VOL A;  2ZCF B;  2D0Q B;  2ZPI B;  4HNU A;  2W9Z A;  4I3Z B;  4ZGE B;  3TW6 A;  2DXC B;  2CZ7 B;  5IDN B;  2ZPH B;  4MFD A;  2CJM B;  3A8G B;  3B57 A;  2BKZ B;  3QWL A;  1KXU A;  2B9R A;  4YOZ A;  4II5 B;  3BLR B;  4CXA B;  2W2H A;  3DTO A;  4CFX B;  4BCN B;  4YOS A;  1XO2 A;  3MI9 B;  1UNG D;  1H24 B;  3QYE A;  4EOJ B;  5HNB B;  1V29 B;  2QGS A;  1H27 B;  4ELL A;  2QDJ A;  4JX5 A;  5HBE B;  2ZPF B;  5LMK B;  3VYH B;  4FX3 B;  1C9B A;  2W99 A;  4CFN B;  3LQ5 B;  1UGQ B;  4FM4 B;  1N4M A;  3H4C A;  4BCM B;  4AI6 A;  3WVD B;  2PK9 B;  2C4G B;  4BCH B;  3BHU B;  4EOK B;  3F5X B;  5BNJ B;  3QXE B;  3QZ5 B;  1OIY B;  3POM A;  1H4L D;  1F5Q B;  4ZGJ B;  1FIN B;  2QQ8 A;  4M6V A;  2DME A;  3BG9 A;  1QMZ B;  4QSH A;  4HNV A;  1JKW A;  2PHG A;  3A8H B;  1QLB A;  2R7G A;  4ROD A;  3PO3 S;  2IN3 A;  4BCP B;  4TTH A;  2CZ6 B;  4F7J B;  3KHI A;  3QHR B;  1W98 B;  1OKV B;  1D3U B;  4MFE A;  3X26 B;  3BLQ B;  1OL1 B;  4BCQ B;  2CYZ B;  4JX6 A;  3TW7 A;  1JST B;  3RGF B;  2WIH B;  1IRE B;  4BCJ B;  4HLQ A;  1JOW A;  3EJ1 B;  2AHJ B;  4BCO B;  4EOO B;  5I5Z B;  2JGZ B;  3MY5 B;  2BS2 A;  2IVX A;  4BBR M;  5CYI B;  4EC9 B;  1TD6 A;  4BY1 X;  4ROC A;  2UZE B;  2I40 B;  4BCN D;  1H1Q B;  2ZPB B;  2PMI B;  1UNL D;  4F70 B;  2BS4 A;  1ZP2 A;  5HBH B;  4AKH A;  3O0G D;  2ZZD B;  4F7N B;  3QYH B;  3X24 B;  5ACB A;  4NST B;  3A8L B;  1H1S B;  4BCF B;  4EOS B;  3TNH B;  5DQV A;  4CFV B;  3BHV B;  5IF1 B;  4EOQ B;  3GTM S;  3VKH A;  4BCM D;  5EJC A;  2WFY B;  1ENW A;  1AIS B;  3QHW B;  1H25 B;  1AHJ B;  2WXV B;  3NDQ A;  2WJ9 A;  4BXX X;  3HB9 A;  4CFU D;  2BS3 A;  4BY7 X;  1BU2 A;  2WMB B;  2DPP B;  4OGR B;  2C5X B;  1URC B;  2UZB B;  2W96 A;  1TFB A;  1O9K A;  3EID B;  1UGP B;  2DXB B;  4BCQ D;  4JX4 A;  2WIP B;  4CFU B;  4IMY B;  3DJB A;  2CCH B;  3QZ9 B;  1O9K B;  1AD6 A;  4EON B;  3QYB A;  5L2W B;  4CRL B;  4KRD B;  2F2C A;  4ZGD B;  3DDP B;  2WHB B;  2C6T B;  2DD5 B;  4EOR B;  1H1R B;  3A8M B;  3TNI B;  1P5E B;  4G6L B;  1PKD B;  4BCI B;  4EC8 B;  3X20 B;  3M03 A;  1VYW B;  3HHT B;  3DDQ B;  2DD4 B;  1GUX A;  3X28 B;  2W9F A;  3BG3 A;  5HVY B;  4EOI B;  4F7S B;  5IDP B;  2PK2 A;  4YOO A;  3X25 B;  2QFZ A;  1GH6 B;  4OB2 B;  2CZ1 B;  3MIA B;  4OB1 B;  4CFW B;  5LQF B;  2ZPE B;  2LW4 A;  4F6S B;  3BLH B;  1GUX B;  1UGS B;  2V22 B;  3VYG B;  2ZPG B;  2CZ0 B;  2CCI B;  5HBJ B;  4BCG B;  5CEI B;  2C5O B;  4AKI A;  3K7A M;  4OR5 B;  5HQ0 B;  2QDY B;  1OKW B;  2IW8 B;  3DL1 A;  2PJQ A;  4BBS M;  1FKM A;  4LOC A;  4NC6 A;  1UNH D;  3EOC B;  3WVE B;  1VIN A;  2I53 A;  1FVV B;  4HL4 A;  2BPM B;  4F7L B;  3DOG B;  5DQW A;  4Z6Y A;  2KR6 A;  1H1P B;  4EOL B;  2G77 A;  2G9X B;  4AKG A;  4EOM B;  3HBL A;  3TN8 B;  2IW6 B;  2UUE B;  2IW9 B;  4OB0 B;  1H28 B; 
#chains in the Genus database with same CATH homology
 5FGK B;  5CYI B;  4KRD B;  4BCK B;  4EC9 B;  3TNW B;  2F2C A;  4ROC A;  4BCN B;  2UZE B;  2I40 B;  4YOS A;  3DDP B;  1XO2 A;  2WHB B;  2C6T B;  3MI9 B;  1UNG D;  1H24 B;  4Y72 B;  4BCN D;  1H1R B;  4BCI B;  3TNI B;  1P5E B;  4G6L B;  1PKD B;  1H1Q B;  4CFM B;  1JSU B;  5HNB B;  4EOJ B;  4ELJ A;  2PMI B;  1OGU B;  1UNL D;  3G33 B;  4EC8 B;  4F70 B;  1OL2 B;  1OI9 B;  1ZP2 A;  5HBH B;  4EOP B;  3O0G D;  3M03 A;  5EFQ B;  5ICP B;  1H27 B;  1VYW B;  4ELL A;  4ROE A;  2QDJ A;  4F6W B;  3MY1 B;  2C5V B;  3DDQ B;  5HBE B;  4F7N B;  4KRC B;  5LMK B;  4FX3 B;  1GUX A;  2W9F A;  1C9B A;  2W99 A;  5HVY B;  4EOI B;  4F7S B;  5ACB A;  5IDP B;  4NST B;  4CFN B;  1H1S B;  4BCF B;  4EOS B;  3LQ5 B;  2WMA B;  2PK2 A;  4YOO A;  1G3N C;  3TNH B;  4CFV B;  1N4M A;  3BHV B;  3H4C A;  1H26 B;  4BCM B;  5IF1 B;  1GH6 B;  4F6U B;  4EOQ B;  4UN0 A;  4BCM D;  3MIA B;  1GY3 B;  4CFW B;  1OIU B;  5LQF B;  2PK9 B;  2C4G B;  2EUF A;  4BCH B;  3BHT B;  2WFY B;  3BHU B;  4YC3 B;  4EOK B;  2WEV B;  3F5X B;  4F6S B;  5BNJ B;  2X1N B;  3BLH B;  1GUX B;  1OIY B;  2UZD B;  3POM A;  4EOR B;  2C5N B;  1H4L D;  2V22 B;  1F5Q B;  1AIS B;  1FIN B;  3QHW B;  2CCI B;  5HBJ B;  4BCG B;  5CEI B;  1E9H B;  1QMZ B;  1H25 B;  2WXV B;  4CFU D;  2C5O B;  2WPA B;  2UZL B;  1VOL A;  1JKW A;  1BU2 A;  2PHG A;  3K7A M;  2WMB B;  4OGR B;  2R7G A;  2C5X B;  4OR5 B;  1URC B;  2UZB B;  4ROD A;  5HQ0 B;  2W96 A;  2W9Z A;  4I3Z B;  4BCP B;  1OKW B;  2IW8 B;  4TTH A;  4F7J B;  1TFB A;  3QHR B;  1W98 B;  1OKV B;  1D3U B;  5IDN B;  1O9K A;  1UNH D;  3EID B;  3EOC B;  2CJM B;  1OL1 B;  3BLQ B;  4BCQ B;  1VIN A;  1JST B;  2I53 A;  3RGF B;  2WIH B;  4BCQ D;  1FVV B;  2BPM B;  4F7L B;  3DOG B;  2WIP B;  4CFU B;  4BCJ B;  2BKZ B;  4IMY B;  1H1P B;  1JOW A;  3EJ1 B;  4EOL B;  1KXU A;  2G9X B;  2B9R A;  4BCO B;  4EOM B;  4YOZ A;  3TN8 B;  2CCH B;  4EOO B;  2IW6 B;  4II5 B;  2UUE B;  1O9K B;  3BLR B;  1AD6 A;  2IW9 B;  4EON B;  5I5Z B;  2JGZ B;  3MY5 B;  4CXA B;  5L2W B;  2IVX A;  4CRL B;  2W2H A;  4CFX B;  1H28 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...