1OJ5A

Crystal structure of the nco-a1 pas-b domain bound to the stat6 transactivation domain lxxll motif
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
105
Chain Sequence
VESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPMQPFIMGIHIIDRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Ncoa-1/Src-1 Pas-B Domain Bound to the Lxxll Motif of the Stat6 Transactivation Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcriptional coactivator
molecule keywords STEROID RECEPTOR COACTIVATOR 1A
total genus 28
structure length 105
sequence length 109
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1oj5A00
1UWPX 3MFXA 2WKRA 3F1OA 3MQOA 3E4QA 1LT0A 3UB8A 5DKLA 2H28A 4KUKA 3UMEA 4WN5A 3GECA 2QKPA 2V9AA 3A0VA 2V1AA 3HJKA 4GHIA 4HH2A 2A24B 1N9OA 3LIDA 4JGQA 5HZHA 3NOTC 1GSVA 2CMNA 4H6JB 1XFQA 4M4XA 1LSVA 3F1PA 3F1NB 4WLAA 5HD5A 3T50A 2V0UA 2A24A 4R38A 5EFWA 2R78A 2VV7A 3LIEA 1TS7A 2PR5A 5A8BA 3ZQ5A 2YKFA 5IS1A 4BBUA 1T1BA 4I3JA 1S1ZA 4GW9A 4K08A 4KQDA 4B9OA 1LSXA 3HJIA 2JHEA 3MR0A 4HP9A 4LLOB 1N9NA 5G4ZA 5F5YA 1DP9A 3LICA 2BASA 5HWVA 3GDIA 1DP8A 3H9WA 1OTAA 4I3IA 4R3AA 1G28A 4WUJA 4XT2B 3SW1A 2QWSA 3LI9A 4E04A 2QJ5A 1XJ3A 2KDKA 3MXQA 3VE4A 4DJ2A 2ZBBA 4EEUA 1BYWA 4LPZA 2K7SA 4DJ3A 1OTBA 3H82B 2ZOHA 3E4PA 3MJQA 4L9GA 4HJ4A 1XJ2A 4NXEA 1WA9A 1ODVA 3FC7A 1P97A 1T1CA 3ULFA 1S4SA 1T19A 1V9YA 1LL8A 2PD8A 4JGOA 4YWZA 4HIAA 2PYRA 2GJ3A 3IBRA 5AVEA 5HDDA 4BBVA 5TBMB 5DKKA 4F3LB 1Y28A 2WKQA 1D7EA 2OWJA 3A0SA 3D72A 3K3CA 1OTDA 2QHKA 1OTIA 3C2WA 3LIBA 4HJ3A 4LRYC 4XT2A 4WL9A 3UMDA 1UGUA 4MN5A 3BY8A 4HQAA 2PYPA 3PHYA 5I5LA 3VE3A 3RH8B 2VV6A 3MQQA 1XJ6A 3EWKA 4LRZE 1TS0A 5F6AA 5J4EA 1S67L 3NHQA 1MZUA 3PYPA 5HD3A 1OT6A 3CLOA 3IS2B 3UB7A 4I5SA 3IS2A 2D02A 1KOUA 3BWLA 2YKHA 2JN7A 2PDRA 3CAXA 4I39A 3LUQA 4NXFA 5G4YA 3UB9A 1OJGA 3F1PB 3F1NA 4H6JA 1S66L 3NOUC 4HH3A 1LSWA 3KX0X 3BY9A 5IU1A 3UE6A 2INWA 3B33A 3CWFA 2PHYA 3F1OB 4GS9A 5DJTA 1XFNA 4HOIA 2V1BA 4LRXC 1P0ZA 1VB6A 2D01A 3G6OA 4HNBA 5HDSA 4L9FA 4HI4A 2M1CA 3ICYA 3LIAA 3LI8A 2HV1A 3H7WA 5DJUA 2L4RA 2VEAA 3NJAA 4HHDA 5J3WA 4HP4A 4F3LA 4BBTA 1X0OA 3K3DA 5F69A 2PD7A 2Z6CA 4NXGA 2KX6A 4GS9B 1V9ZA 2J80A 3UB6A 1DRMA 1NWZA 4R70A 4EXOA 3P7NA 1EW0A 3E4OA 2PR6A 1JNUA 4HY8A 4I38A 4EETB 5J7EA 1TS6A 4EESA 1F98A 1T1AA 2WKPA 3H7WB 1DP6A 4EQ1A 3VOLA 1GSWA 1F9IA 5AVFA 3OLOA 2OOLA 3FG8A 2ZOIA 5HWWA 4MN6A 4NXBA 4EW7A 4WF0A 4GHIB 2EA9A 2QJ7A 1GSXA 3LIFA 1OJ5A 4I3AA 5HWTA 5F68A 4EEPA 2V0WA 1OT9A 3RTYA 2L1MA 2P7JA 5TBMA 3A0RA 4RQ9A 4PKYA 3C8CA 3NOPC 2OWHA 1D06A 2Z6DA 3LYXA 4GCZA 1XJ4A 1N9LA 2VV8A 1S4RA 2W0NA 4HJ6A 1OTEA 4L9EA 4PKYG 4EERA 5KIZA 2B02A 2L0WA 2I9VA 5HSQA 1UWNX 1T18A 4KUOA 3EEHA 2W27A 3H82A 5HDCA 4JGPA 4JGRA 4R6LA 2VLGA 1TS8A 1S1YA
chains in the Genus database with same CATH superfamily
3MFXA 5FAPA 3E4QA 4KUKA 3EEAA 5IHVA 3HBRA 4XUZA 3UPOA 2VV7A 3Q07A 3ZQ5A 3SS3A 1CEFA 3Q81A 2ZD8A 1ZHHB 4Y3IA 2PU2A 5DF9A 5GLAA 3W2ZA 2P9VA 2ZM8A 1ONGA 4KQQA 4XXRA 2BASA 4UHUA 3IX4A 1K4EA 4GN2A 1BUEA 3DTEA 4R1GA 2WAEA 4FH4A 3VE4A 5EVIA 1BYWA 2Q9MA 2V8FA 1Z6FA 2JKRI 2R9XA 3P98A 2HPBA 5AVEA 3O87A 1Q2QA 4P87A 3C2WA 2QMIA 4KZBA 1XA1A 4FOFA 3ZG0A 1JWPA 3NDEA 3IWIA 2W1TB 1K57A 3CAXA 3LUQA 1YAXA 1L3LA 3GMWA 3OPRA 1LHYA 3IF6B 2EWVA 1Y4OA 3BY9A 3BQAA 3V3RA 3VSKA 1H8MA 2W3EA 3UO9A 3IWOA 2EFUA 1DJAA 1VB6A 3CG5A 1KE0A 3H7WA 2OV5A 4UQIS 5F69A 3SOIA 2UWXA 4I38A 4PHTA 3LR4A 2WKPA 4DN0A 1STZA 1OJ5A 4OONA 3N7WA 4RQ9A 4ETZA 2WGVA 1XJ4A 3VP0A 5KIZA 1JWVA 1VM1A 2L0WA 5FEFA 3CHWP 1L0DA 4C3QA 2JKTM 3IF5A 2VLGA 5F6AA 4RX2A 1HVBA 2WGIA 4S2JA 3T50A 1YLZA 2PR5A 3QP5A 3MSHA 4CLCA 3UE3A 2V2FF 4EBNA 3UPPA 2JCHA 3G34A 4CJNA 3MXSA 1ES5A 2ZQ8A 1Q2PA 1SCWA 3OPPA 5J8XA 3UE0A 1W63M 1K57C 1MWSA 3VOZA 3ZNTA 4BBVA 3BQ8A 3K3CA 4QY6A 4LRYC 3TRCA 3W4OA 4MN5A 3JYIA 1TS0A 1ZTUA 4F94A 5BOHA 5HX9A 3TSGA 5EE8A 3U2AA 5TGFA 3G4PA 4RX3A 4WZ5A 4LGWA 3RJUA 4LRXC 3WS4A 5C5KA 4G3WA 3KSFA 4GS9B 5HW3A 1JNUA 4EETB 3IF6A 1YLTA 3C7UA 3BLSA 4KENB 2W3FA 5FAOA 3SH8A 1G5UA 1IYSA 3TJZC 1XPBA 5FI7A 1PI5A 4OOMA 4O01A 4OQIA 3ZCZA 4PKYG 4DMZA 2HP6A 2PT7A 1PWGA 1N9BA 3HCYA 3M2JA 3M6HA 5A90A 4ESPA 1RGZA 3MZFA 2V1ZA 3GECA 2EX2A 1LSVA 3R7WB 5HAQA 2W1TA 2ZMVA 1TS7A 2A3UA 2E8JA 1FR6A 4MLLA 4KQDA 3FWLA 5L09A 4MEZA 3WS5A 2B5RA 4S2KA 1PRQA 1YMSA 1RCJA 1ES4A 2OAQ1 1SHVA 3FKVA 3MS6A 4S2NC 1BLPA 1I2WA 2JKRM 1MBLA 2XRNA 1W7FA 1M6KA 3DW0A 4GD8A 1D7EA 3OPLA 4K91A 3VE3A 3KO6A 2WKEA 5EECA 2XF3A 4Y0UA 4FCFA 4JLFA 1K54A 2H0YA 3UE6A 1JTDA 1XFNA 4U0XA 1K56A 1VETA 3DWKA 4E3JA 1JTGA 4GNUA 1KE3A 4EU0A 3K3DA 4BBUA 1NWZA 3SS4A 3BRMA 3BECA 5FQIA 1T1AA 2ACGA 2Z2MB 1DP6A 2EWWA 3VOLA 3IH8A 1LL5A 4KZAA 3DTKA 3RTYA 3ZG8B 2ZQ9A 4R38A 1BULA 1GA9A 2Z6DA 1N9LA 1F5MA 1MKIA 1UWNX 1FSYA 2WADA 4MMNA 2A24B 4BD1A 4P6ZS 4NETA 3LCEA 1GSVA 2CMNA 1CI8A 1YLPA 2JKFA 2VX8A 5EUAA 4CQHA 3PAEA 5CECA 4IBRA 4R3JA 2JHEA 1MWTA 5F5YA 4X1LA 4ID4A 1PIOA 2Y4AA 3L9KA 2XSSA 3ZHHA 3MQ0A 2ZBBA 3ISGA 2ZOHA 2IWBA 4HJ4A 2XGNA 3MZEA 5HL6A 4IUHA 1T19A 2P08A 1LI9A 4S2NA 5TBMB 4RYEA 3G32A 4ZTKA 4XT2A 1NZOA 1W79A 4MBKA 3O5YA 3MKEA 4LRZE 4OOLA 3NHQA 2DMWA 2ZC4B 3S7PA 2VZWA 1FCMA 4I39A 3UB9A 1YKDA 4UQIM 2ZC3B 3F1NA 1CQAA 2ZQAA 4HOIA 3G6OA 3RXXA 2ZL1A 1IYOA 3HL9A 3ZG7B 1S0WA 4BL2A 3KSHA 4EQ1A 3VP1A 3WRTA 1F9IA 2FFYA 5KSHA 5CX7A 3ZYTA 4G3KA 3IHAA 4PKYA 2PBDP 4GCZA 2VV8A 2W1RA 3S4XA 1O07A 3A3JA 3EEHA 2W27A 5HDCA 1UWPX 2DCFA 4O0PA 2Y2KA 1YSPA 2EXAA 4ZAMA 4WEJA 5CRFA 3UPNA 2PAVP 3R4KA 3S1YA 2ZC5B 1MWRA 3NBLA 5FASA 3UY6A 2JC7A 5EOOA 2O9AA 2WGWA 1N9NA 2Y55A 4S2MA 1MXOA 1K55A 3SW1A 1YLWA 5CHMA 3G30A 2MJ6A 4PM6A 1HLUP 3IH9A 1ZG4A 2UV0E 2G2WA 1NZUA 4HIAA 4NEED 4X53A 5CXWA 4X56A 2WKQA 1OTDA 3OCNA 5A91A 1YT4A 4HQAA 3VFFA 2VV6A 4GKUA 1IEMA 3NULA 3OBFA 4X6TA 2XH9A 4B4XA 1Y54A 4E6WA 1I5QA 4FUWA 4O7DA 2PU4A 3HLGA 4DRTA 3E2KA 3HLWA 4ETXA 3JPUA 1NYYA 3ICYA 4E3LA 5KZHA 4NXGA 2PR6A 4QY5A 2XQZA 2J8YA 5EV0A 3AGEA 5HWWA 5HPFA 4GHIB 4OQHA 1MPLA 2XK1A 4JXSA 4I3AA 1L0EA 2O9CA 3OZHA 1CJFA 2BLSA 1OT9A 3AGFA 3ITAA 2AVXA 4JBFA 1WYCA 4EERA 2XR0A 2VGKA 1T18A 1W8YA 4PM7A 3HLFA 1CF0A 1KGFA 1NXYA 5FSRA 1FCNA 1S1YA 3JVVA 4KZ7A 5DKLA 3UMEA 4HH2A 3EGXC 1PWCA 3F1NB 4JF4A 3Q82A 4DXBA 1BZAA 1GCEA 4U0TA 2M7VA 3FKWA 4LCLA 5F1FA 2QWSA 4BWIA 3QP1A 3C4PA 2QZ6A 1W8QA 4D2OA 2A49A 3E4PA 3MJQA 2WKIA 2W3DA 3LGOA 2O9BA 1WA9A 3IX3A 1FR1A 3A0SA 3LIBA 4X55A 4GB7A 4O8GA 3BYDA 2Y2LA 3IHBA 3M2KA 2QPNA 1L2SA 3AGDA 1SDEA 5GHXA 4Y0OA 1S66L 2J3TC 4U3TA 2BTFP 4KG2A 1VEUB 5LBRA 2M1CA 5E43A 2RL3A 1X0OA 5M1AA 1IYPA 3PBQA 5HPIA 5FEGA 4PM5A 5IT5A 2O99A 1IOUA 4ME4A 4UA9A 5AQ7A 3SS5A 2H10A 3ITBA 4B88A 4IBXA 3LIFA 4DDYA 2W3GA 2OWHA 4R3AA 4FD8A 3T4QA 3HVFA 4JGRA 3MQOA 3UB8A 5EM0A 1K54C 2ZC6B 1YLJA 3NOTC 3KYZA 3F1PA 5A92A 2A24A 1XXMA 3EGDC 4Z9QA 2ZMFA 5CTNA 2QYBA 2V20A 3V39A 1BLHA 3LR0A 4EUZA 1G28A 3S7NA 4MNRA 3MKFA 1TD5A 2IWCA 3ZVTA 1FSWA 4QWOA 4OOYA 1XJ2A 5EVEA 2VGLS 4WM9A 1VETB 3QNCA 2Y2HA 5EVIB 5EVLA 3S7OA 1CI9A 4Q0JA 1SZVA 3PHYA 5K5BA 1MZUA 3G35A 3GTCA 5G4YA 1ESIA 3MF0A 4YOFA 1IKGA 1EROA 2Y79A 3NC8A 4E3NA 3VFHA 5GLBA 3CWFA 1NJ4A 2V1BA 5L8MA 4DE2A 1H8ZA 3LY4A 1K38A 4IVKA 2GDNA 1BTLA 5DJUA 2O0YA 3NJAA 4HP4A 4F3LA 2G2UA 4X68A 2ZM2A 4E3IA 5D3OA 4E3MA 5CEBA 4B93A 3H7WB 4ZJ1A 2OOLA 1PFLA 1XKZA 4NXBA 4OLGA 1GSXA 2FH5A 3ZG5A 5TR7A 1NY0A 4Q8IA 2W0NA 5E2GA 2R9WA 4DE3A 4Y15A 3WS0A 3R7WA 4KG6A 4WZ5C 1F2KA 4JXVA 3O86A 2V9AA 4YINA 4BLMA 4YNRA 4LV3A 5TJJA 1M40A 1RP5A 5HAPA 3HLEA 2YKFA 2J9PA 1NYMA 4OPYA 3QP6A 4Q0HA 2HP5A 3IF6C 3GDIA 1O7EA 4HBTA 1MKMA 5HL1A 5EVIC 4PM9A 4OQGA 4LPZA 3WS2A 3DTMA 1MWUA 1GHIA 1ZG6A 1YM1A 4IJGA 3HLBA 3EWKA 4WZ4A 3KYEA 5J4EA 4CPKA 3UDIA 3IS2B 3CUEC 4I5SA 3IS2A 4QU3A 3IXHA 4ZBEA 3ZG9B 3PBRA 4CLCB 2H5SA 3DWZA 1C3BA 4MBFA 3MXRA 3T4OA 5M19A 5FQ9A 3T1SA 3PBNA 2XLNA 4OPZA 4LV1A 1LL9A 1XP4A 1W5DA 5M18A 5E2HA 1ERMA 2Y2NA 3OLOA 5E2FA 2PRFA 1H8YA 4WF0A 2EA9A 2DNSA 3HUOA 2P7JA 3A0RA 3SH7A 3CI6A 3OPHA 1OTEA 4ARZA 1AXBA 2I9VA 1JWZA 2K31A 4JGPA 4R6LA 3B42A 3KYQA 1VQQA 4CLCD 1DJBA 2V1AA 2ZQ7A 4JGQA 4M4XA 4P85A 4EUVA 2J3TD 2R78A 4MDZA 1KDSA 4WMCA 3FZCA 1FIKA 3HJIA 3MMHA 2OAP1 2EX9A 2NUPC 4OKPA 3H9WA 4WUJA 4XUXA 2KDKA 3K2NA 3BJNA 4BQMA 1K4FA 2WUQA 3O3VA 1WE4A 4NXEA 3TW8A 1LL8A 1TDLA 2XD1A 5GHZA 2QHKA 2OLUA 3MZDA 3BY8A 2HJ9C 1FILA 1YMXA 3RH8B 5EPHA 2P9VB 2HDRA 3GV9A 1YSQA 3BWLA 2Y2PA 4CLCC 5MC7A 1TDGA 4D60A 5F83A 2ZL1B 4NG2A 2Y2MA 3B3XA 3WRZA 3PTEA 2PHYA 1G6OA 2FFFB 2WZXA 2GZAA 2WZZA 4L9FA 1HZOA 3VP2A 2HDQA 2PD7A 4R70A 3SH9A 4KG5A 3PBOA 4OH0A 2ZOIA 3IX8A 4MN6A 3EQUA 4IHQA 5HWTA 2ZQCA 4EEPA 1LI0A 5KMWA 3Q7VA 3WWXA 4Z1WA 5DF8A 1IKIA 5FATA 3HREA 2XEPA 3FYZA 2B02A 3I7JA 1J3WA 4AFIA 3F1OA 1LT0A 1I2SA 1W63Q 3V67A 1A0KA 5HWVA 1E25A 1IYQA 3NIAA 5FI2A 1LSXA 1NLZA 5F82A 1OTAA 3C30A 4XT2B 4DJ2A 2ZLYA 3O88A 4LCMA 4OPQA 1OTBA 1L0GA 3FC7A 4QPRA 1T1CA 3T12B 2PD8A 2Y2QA 3D3OA 5A93A 4EBPA 4L9GA 1ESUA 5CTMA 1K6RA 1UGUA 4N9LA 1JVJA 1ONHA 4PMAA 5JYPA 1K55C 2BG1A 4CLCE 3S7QA 3HLDA 3CITA 3PR6A 4HH3A 5FQJA 4H8RA 5AJGA 4OPRA 3CPTB 5DFYA 1BT5A 2Y2JA 5HDSA 5KSCA 4KZ6A 4BENA 1KVMA 3LEQA 4FTXA 3G2YA 3SZTA 5DFXA 2VGJA 3E4OA 1KE4A 2C5WB 5HAIA 1GA0A 4MCWA 3C4OA 1SKFA 2DRWA 3LO7A 4YFMA 1K25A 1DJCA 4Y13A 3BFEA 2Y2GA 4ZJ2A 4EV4A 4E6XA 4OQ0A 5GL9A 4UA6A 4KZ3A 1H0MA 2XFTA 3LYXA 2EXBA 2JE5A 4DKIA 3EOIA 1TS8A 1PW1A 1KDWA 2CC1A 2HDSA 3HJKA 1N9OA 1MY8A 2OLVA 2K2NA 1D1JA 1XFQA 4WLAA 2V0UA 4QB8A 5E2EA 5A8BA 2VA0A 3BFFA 3N8LA 4S2OA 3NY4A 3IQAA 4HP9A 4A5RA 1DP9A 3LICA 4X25A 5DF7A 2QJ5A 3IXDA 3UDFA 3TE8A 4P0MA 1YPRA 5CGXA 4RA7A 1E3UD 2ZC7A 3NI9A 4M3KA 5GLDA 2J9OA 4BJPA 2A2LA 1P97A 3IXBA 1V9YA 4YWZA 4JGOA 5FQKA 1QMEA 4GJ4A 2G7UA 1CEGA 1E3UA 2HF6A 2WK0A 2XA7M 3MQQA 3GQZA 3MBZA 4Y5FA 2YKHA 4IUKA 4KQOA 1HD8A 3VV4A 1ES2A 3FPVA 2EX6A 3UB5P 2WAFA 1SDNA 2P04A 1VEUA 2LB5A 3BLMA 2D01A 2XA7S 2VK3A 3BFCA 2IA2A 3LEZA 4E3KA 5L2FA 5DTTA 4EXOA 1EW0A 1K56D 3V5MA 5FAQA 5AQ9A 3MFDA 5CGWA 3N8SA 2X71A 4GLQA 3NDGA 4KZ9A 1TF1A 3KSIA 4E3OA 2FZ0A 3CJMA 1YLYA 1LLBA 5FQQA 2Y59A 4QD4A 4R3BA 5F1GA 1HTZA 1FQGA 1KGGA 2QKPA 4GHIA 4WBGA 4OLDA 3CUEA 4Y7PA 3GRJA 3G2ZA 2GNXA 5GHYA 3VSLA 3S22A 3QP8A 1DP8A 3T4KA 3MXQA 1KGEA 2HJEA 2Q0OA 3H82B 1ALQA 4FSFA 1Y28A 5HFOA 1VHMA 1OTIA 4N92A 4Y2FA 4PM8A 3P09A 4DF6A 2JKTI 4L0LA 1OT6A 3QHYA 2PDRA 5G18A 4H6JA 1U60A 3Q1FA 3BW6A 3KX0X 4IEDA 4X1MA 2INWA 3GR2A 1XGJA 1SKOA 3BM6A 4HI4A 1ZKJA 4S2PA 3UB6A 1V9ZA 4PAUA 1DRMA 1K6SA 4HY8A 5J7EA 1EWZA 2P74A 1DY6A 5TFQA 3V50A 3PBSA 4P6BA 1GHMA 5F68A 2Y91A 2GX5A 5CHJA 4ZDXA 1D06A 1H3QA 4HJ6A 4MN7A 3BEBA 1TVFA 3LR3A 4DE0A 2J3WA 4ZJ3A 2VKSA 4B4ZA 2WGWB 4N9KA 1H5XA 4FH2A 3GSGA 1RGYA 4GD6A 4LLOB 3IWQA 2XDMA 4E04A 1XJ3A 1ACFA 1IFQA 1K0KA 4DJ3A 3DBAA 3ZVWA 1S4SA 3U4LP 5AQBA 2JBFA 1MC0A 5CHUA 3C38A 3FPWA 4WL9A 1E4DA 1NLYA 4GZBA 3CZDA 4R4RA 5I5LA 1XJ6A 1KVLA 1S67L 4R4SA 4ZRRA 5HD3A 5FDHA 1G68A 4NXFA 3TOIA 2ZJ9A 3F1PB 3Q7VB 1LSWA 4Q0IA 4WMCD 3PXPA 5HARA 3T1RA 3UE1A 4DDSA 5J3WA 2Z6CA 3CPTA 2VJWA 3P7NA 2HGVA 4WELA 2W3HA 1G6AA 3V3SA 3ZGAB 1GSWA 4JXGA 3FG8A 4UEYA 3IT9A 2QJ7A 2V0WA 2L1MA 5TBMA 4EQIA 3P01A 3CMZA 1S4RA 3GVBA 4KZ5A 3G31A 3EQVA 1SKOB 1OPXA 3ULFA 3ZDJA 3C8CA 2EFXA 2WKRA 4GDBA 4BL3A 2Q9NA 3LIDA 4DXCA 3C5AA 4H6JB 1PWDA 4JPMA 3E0YA 4K0XA 4X69A 1T1BA 4I3JA 1S1ZA 4B9OA 3DAVA 3TG9A 3BFGA 3OCLA 4UA7A 1ERQA 1N4OA 5CEDA 1L0FA 2B18A 4EEUA 1BLSA 3C7VA 3E2LA 1BSGA 3IBJA 4K0WA 3VMAA 5DKKA 3D72A 2Z2LB 5L10A 2Y2OA 1QMFA 3PYPA 3UB7A 4LV2A 1PI4A 3VP3A 4QJGA 2JN7A 3M6BA 3RXWA 3VOYA 3LFVA 4WYYA 3NOUC 5JYOA 5IU1A 3B33A 4RVAA 3F1OB 4HESA 4R0QA 2HV1A 2L4RA 4HHDA 3PBTA 2KX6A 3LY3A 1IELA 5DVAA 5AVFA 3UNWA 2WYXA 2PBYA 5FQMA 2Y2IA 1XGIA 3A3EA 4HBUA 4N1HA 4KUOA 4OVDA 3N4IA 3E98A 5EVID 4Y17A 5FI6A 5U47A 2H28A 4Y0TA 3A0VA 3T1QB 5HZHA 3WS1A 2HZ5A 2XROA 3BFDA 4NKPA 5HD5A 5CGSA 1P9WA 1PYYA 4EWFA 4GDNA 4GW9A 3HLCA 3JVUA 5CERA 5G4ZA 1AWIA 4I3IA 2IWDA 3NECA 4IVIA 1EI5A 4MBHA 5L07A 4C75A 3QP2A 1GHPA 4OP5A 3B47A 4ARZB 2XFSA 1XX2A 1CK3A 3T4JA 2VGLM 2PYRA 3IBRA 4S2LA 4F3LB 2OSUA 1FCOA 4JF6A 4LV0A 3ZFZA 2KOIA 4JXWA 3CLOA 4BMWA 3L7HA 2D02A 1KOUA 3QP4A 1NRJA 4EBLA 1PNEA 1ZC2A 5DTKA 1TEMA 4GS9A 5FDSA 3FV7A 1P0ZA 3NCKA 3A3FA 4EW7A 3LIAA 5AQAA 3LI8A 4KZ4A 2VEAA 4DE1A 3W4QA 4BBTA 3T4LA 3KSGA 4N1XA 2J80A 3T1XA 3OOVA 3N8RA 1TS6A 4KQRA 2ZQDA 2X02A 4C6YA 2ZMAA 1PZOA 2EX8A 2WKHA 5FA7A 3HUNA 2LB9A 2X01A 4NK3A 3H82A 3W8KA 4WN5A 3UN7A 4HEFA 5EFWA 3A3IA 3LIEA 5FL3A 3IXGA 2KLIA 4JF5A 3QNBA 5EM1A 5IS1A 2HP9A 4R23A 1NRFA 4K08A 3MR0A 2C6WB 3OC2A 3A3DA 2HDUA 2J7VA 4II7A 3LI9A 4G3VA 1BLCA 4BD0A 3T4SA 3T4TA 1PW8A 1ES3A 2K7SA 2JKGA 5GLCA 4WEKA 4UAAA 1YQSA 1ODVA 1S6RA 3UDXA 2RCXA 2M7UA 2B95A 3D4FA 2GJ3A 5HDDA 3ZNYA 2H0TA 2OWJA 4HJ3A 3UMDA 3N6IA 2PYPA 3VP4A 4OP8A 3D9YA 5EOEA 1FOFA 1PZPA 2NUTC 4KZ8A 2Y8HA 2E8IA 1WYBA 1OJGA 1XA7A 3LR5A 4PPRA 2ZM0A 4LENA 3RFBA 1P9RA 4P6ZM 1OMEA 5DJTA 4HNBA 2I72A 4QHCA 3PAGA 2XD5A 1J9MA 4EESA 1F98A 3HUMA 3DTIA 1Z09A 4S2IA 3NOPC 3W4PA 3Q7ZA 4L9EA 5I94A 4LFUA 5HSQA 4JKTA 4GOGA 5DTSA 2V8CA
chains in the Genus database with same CATH topology
3B42A 1UWPX 3KYQA 4O0PA 3MFXA 3E4QA 2J3WA 4KUKA 3EEAA 1YSPA 4CLCD 2V1AA 2VKSA 4WEJA 4JGQA 3R4KA 4M4XA 4EUVA 2J3TD 2R78A 2VV7A 4MDZA 3ZQ5A 1ZHHB 4Y3IA 5DF9A 2O9AA 3W2ZA 3HJIA 4LLOB 3MMHA 2OAP1 1N9NA 2BASA 2NUPC 3H9WA 3SW1A 4WUJA 4E04A 1XJ3A 2KDKA 1IFQA 3VE4A 2MJ6A 3K2NA 1BYWA 4DJ3A 3BJNA 3DBAA 2JKRI 4NXEA 3TW8A 1S4SA 1LL8A 4HIAA 4NEED 5AVEA 1MC0A 2WKQA 1OTDA 2QHKA 3C2WA 3C38A 3FPWA 3OCNA 4WL9A 1NLYA 3BY8A 4HQAA 2HJ9C 5I5LA 3RH8B 2VV6A 1XJ6A 4FOFA 1S67L 4ZRRA 5HD3A 1YSQA 3OBFA 3BWLA 2W1TB 3CAXA 4NXFA 3LUQA 1YAXA 3F1PB 4CLCC 5MC7A 2EWVA 1LSWA 4Q0IA 3BY9A 3BQAA 1H8MA 2W3EA 2PHYA 1G6OA 3PXPA 1VB6A 4ETXA 2GZAA 4L9FA 3ICYA 3H7WA 5J3WA 4UQIS 5F69A 2PD7A 2Z6CA 4NXGA 2VJWA 4R70A 3P7NA 2HGVA 2PR6A 4I38A 3PBOA 4PHTA 3LR4A 2W3HA 4WELA 2WKPA 1GSWA 3FG8A 4DN0A 1STZA 2ZOIA 5HWWA 5HPFA 4MN6A 4UEYA 3EQUA 4GHIB 2QJ7A 1OJ5A 4I3AA 4IHQA 2O9CA 5HWTA 4EEPA 2V0WA 1OT9A 2L1MA 5TBMA 4RQ9A 4ETZA 3P01A 4Z1WA 1XJ4A 4EERA 1S4RA 5KIZA 2B02A 2L0WA 1T18A 3EQVA 2JKTM 1OPXA 2VLGA 5F6AA 3ULFA 4AFIA 3C8CA 1S1YA 2WKRA 3F1OA 3JVVA 1LT0A 5DKLA 3UMEA 4HH2A 3EGXC 3LIDA 1W63Q 4H6JB 3V67A 3F1NB 3E0YA 3T50A 5HWVA 2PR5A 1T1BA 4CLCA 4I3JA 1S1ZA 4B9OA 2M7VA 1LSXA 3OCLA 3UE3A 1NLZA 1OTAA 3C30A 4XT2B 2QWSA 4DJ2A 2B18A 4BWIA 4EEUA 1OTBA 1W63M 3E4PA 3MJQA 2W3DA 2O9BA 1WA9A 3FC7A 4QPRA 3IBJA 1T1CA 2PD8A 4BBVA 3D3OA 3BQ8A 5DKKA 3D72A 4L9GA 3A0SA 3K3CA 3LIBA 4LRYC 3TRCA 1UGUA 4MN5A 4O8GA 1TS0A 1ZTUA 3PYPA 3UB7A 2JN7A 3U2AA 4CLCE 3S7QA 3LFVA 3CITA 3PR6A 1S66L 3NOUC 4HH3A 5IU1A 2J3TC 5AJGA 3B33A 3F1OB 5DFYA 4LRXC 5LBRA 5HDSA 5C5KA 2M1CA 2HV1A 4G3WA 2L4RA 4HHDA 1X0OA 3KSFA 3PBTA 3PBQA 2KX6A 4GS9B 5HPIA 3E4OA 5DFXA 1JNUA 4EETB 5IT5A 2O99A 4MCWA 1IOUA 4ME4A 5AVFA 3LIFA 2W3FA 2W3GA 3TJZC 4OOMA 4O01A 2OWHA 3LYXA 4R3AA 4PKYG 4DMZA 2PT7A 3HCYA 4KUOA 3EOIA 3T4QA 4JGRA 3E98A 1TS8A 3MQOA 3UB8A 2H28A 3GECA 3A0VA 3HJKA 1N9OA 5HZHA 3NOTC 2K2NA 3KYZA 2XROA 1XFQA 4WLAA 1LSVA 3F1PA 4NKPA 5HD5A 2V0UA 2A24A 3R7WB 2W1TA 2ZMVA 1TS7A 5A8BA 2VA0A 1P9WA 3EGDC 4GW9A 4KQDA 3JVUA 2ZMFA 4HP9A 2QYBA 5G4ZA 1DP9A 3LICA 3LR0A 4I3IA 1G28A 2OAQ1 3S7NA 2QJ5A 3TE8A 1TD5A 2JKRM 2XRNA 4BJPA 1XJ2A 3B47A 2A2LA 4ARZB 2VGLS 1P97A 3T4JA 1V9YA 4YWZA 4JGOA 2VGLM 2PYRA 4GJ4A 2G7UA 3IBRA 4F3LB 1D7EA 3S7OA 4Q0JA 2HF6A 3VE3A 3PHYA 2XA7M 3MQQA 2KOIA 5K5BA 3KO6A 1MZUA 3CLOA 4Y5FA 4BMWA 2D02A 1KOUA 2YKHA 5G4YA 4IUKA 4KQOA 3VV4A 3MF0A 4YOFA 3FPVA 1NRJA 2Y79A 2P04A 3UE6A 3CWFA 4GS9A 1XFNA 2LB5A 2V1BA 5L8MA 1P0ZA 2D01A 2XA7S 2IA2A 4EW7A 5DJUA 2O0YA 3LIAA 3LI8A 2VEAA 3NJAA 4EU0A 4HP4A 4F3LA 4BBTA 3T4LA 3K3DA 3KSGA 4BBUA 2J80A 4EXOA 1NWZA 3OOVA 1EW0A 1TS6A 1T1AA 4B93A 3H7WB 1DP6A 2EWWA 3VOLA 2OOLA 4NXBA 1GSXA 2FH5A 3RTYA 4GLQA 1TF1A 4R38A 2LB9A 2Z6DA 3KSIA 2W0NA 1N9LA 1F5MA 1UWNX 2FZ0A 3H82A 4MMNA 2A24B 3R7WA 4P6ZS 4WN5A 2QKPA 2V9AA 4GHIA 4YNRA 1GSVA 2CMNA 5TJJA 5EFWA 3CUEA 3LIEA 5FL3A 2VX8A 2KLIA 2YKFA 4CQHA 2GNXA 5IS1A 4Q0HA 4K08A 3MR0A 2JHEA 3OC2A 5F5YA 3GDIA 1DP8A 3T4KA 4II7A 1MKMA 3LI9A 4G3VA 2XSSA 3MXQA 3MQ0A 2ZBBA 3T4SA 3T4TA 4LPZA 2K7SA 2HJEA 3H82B 2ZOHA 4WEKA 4HJ4A 1ODVA 5HL6A 4IUHA 1T19A 2P08A 4FSFA 2M7UA 2GJ3A 5HDDA 4IJGA 5TBMB 1Y28A 2OWJA 1VHMA 4XT2A 1OTIA 4HJ3A 3UMDA 2PYPA 4Y2FA 3O5YA 3EWKA 4LRZE 5J4EA 4OOLA 3NHQA 2JKTI 4L0LA 1OT6A 3IS2B 2DMWA 2NUTC 3CUEC 4I5SA 3IS2A 3S7PA 2VZWA 4I39A 2PDRA 2Y8HA 3UB9A 1YKDA 4UQIM 1OJGA 3F1NA 4H6JA 3LR5A 3PBRA 4CLCB 3RFBA 3BW6A 1P9RA 3KX0X 4P6ZM 3T4OA 2INWA 5DJTA 4HOIA 3G6OA 4HNBA 4HI4A 3PBNA 3UB6A 1V9ZA 4PAUA 1DRMA 4HY8A 5J7EA 4EESA 1F98A 3KSHA 4EQ1A 1F9IA 3OLOA 3PBSA 4WF0A 5KSHA 2EA9A 5CX7A 5F68A 3ZYTA 4G3KA 2P7JA 3A0RA 2GX5A 4PKYA 3NOPC 1D06A 3CI6A 4GCZA 1H3QA 2VV8A 4HJ6A 1OTEA 4L9EA 4MN7A 4ARZA 2W1RA 2I9VA 2K31A 5HSQA 3LR3A 3EEHA 2W27A 5HDCA 4JGPA 4R6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWP X;  3MFX A;  2WKR A;  3F1O A;  3MQO A;  3E4Q A;  1LT0 A;  3UB8 A;  5DKL A;  2H28 A;  4KUK A;  3UME A;  4WN5 A;  3GEC A;  2QKP A;  2V9A A;  3A0V A;  2V1A A;  3HJK A;  4GHI A;  4HH2 A;  2A24 B;  1N9O A;  3LID A;  4JGQ A;  5HZH A;  3NOT C;  1GSV A;  2CMN A;  4H6J B;  1XFQ A;  4M4X A;  1LSV A;  3F1P A;  3F1N B;  4WLA A;  5HD5 A;  3T50 A;  2V0U A;  2A24 A;  4R38 A;  5EFW A;  2R78 A;  2VV7 A;  3LIE A;  1TS7 A;  2PR5 A;  5A8B A;  3ZQ5 A;  2YKF A;  5IS1 A;  4BBU A;  1T1B A;  4I3J A;  1S1Z A;  4GW9 A;  4K08 A;  4KQD A;  4B9O A;  1LSX A;  3HJI A;  2JHE A;  3MR0 A;  4HP9 A;  4LLO B;  1N9N A;  5G4Z A;  5F5Y A;  1DP9 A;  3LIC A;  2BAS A;  5HWV A;  3GDI A;  1DP8 A;  3H9W A;  1OTA A;  4I3I A;  4R3A A;  1G28 A;  4WUJ A;  4XT2 B;  3SW1 A;  2QWS A;  3LI9 A;  4E04 A;  2QJ5 A;  1XJ3 A;  2KDK A;  3MXQ A;  3VE4 A;  4DJ2 A;  2ZBB A;  4EEU A;  1BYW A;  4LPZ A;  2K7S A;  4DJ3 A;  1OTB A;  3H82 B;  2ZOH A;  3E4P A;  3MJQ A;  4L9G A;  4HJ4 A;  1XJ2 A;  4NXE A;  1WA9 A;  1ODV A;  3FC7 A;  1P97 A;  1T1C A;  3ULF A;  1S4S A;  1T19 A;  1V9Y A;  1LL8 A;  2PD8 A;  4JGO A;  4YWZ A;  4HIA A;  2PYR A;  2GJ3 A;  3IBR A;  5AVE A;  5HDD A;  4BBV A;  5TBM B;  5DKK A;  4F3L B;  1Y28 A;  2WKQ A;  1D7E A;  2OWJ A;  3A0S A;  3D72 A;  3K3C A;  1OTD A;  2QHK A;  1OTI A;  3C2W A;  3LIB A;  4HJ3 A;  4LRY C;  4XT2 A;  4WL9 A;  3UMD A;  1UGU A;  4MN5 A;  3BY8 A;  4HQA A;  2PYP A;  3PHY A;  5I5L A;  3VE3 A;  3RH8 B;  2VV6 A;  3MQQ A;  1XJ6 A;  3EWK A;  4LRZ E;  1TS0 A;  5F6A A;  5J4E A;  1S67 L;  3NHQ A;  1MZU A;  3PYP A;  5HD3 A;  1OT6 A;  3CLO A;  3IS2 B;  3UB7 A;  4I5S A;  3IS2 A;  2D02 A;  1KOU A;  3BWL A;  2YKH A;  2JN7 A;  2PDR A;  3CAX A;  4I39 A;  3LUQ A;  4NXF A;  5G4Y A;  3UB9 A;  1OJG A;  3F1P B;  3F1N A;  4H6J A;  1S66 L;  3NOU C;  4HH3 A;  1LSW A;  3KX0 X;  3BY9 A;  5IU1 A;  3UE6 A;  2INW A;  3B33 A;  3CWF A;  2PHY A;  3F1O B;  4GS9 A;  5DJT A;  1XFN A;  4HOI A;  2V1B A;  4LRX C;  1P0Z A;  1VB6 A;  2D01 A;  3G6O A;  4HNB A;  5HDS A;  4L9F A;  4HI4 A;  2M1C A;  3ICY A;  3LIA A;  3LI8 A;  2HV1 A;  3H7W A;  5DJU A;  2L4R A;  2VEA A;  3NJA A;  4HHD A;  5J3W A;  4HP4 A;  4F3L A;  4BBT A;  1X0O A;  3K3D A;  5F69 A;  2PD7 A;  2Z6C A;  4NXG A;  2KX6 A;  4GS9 B;  1V9Z A;  2J80 A;  3UB6 A;  1DRM A;  1NWZ A;  4R70 A;  4EXO A;  3P7N A;  1EW0 A;  3E4O A;  2PR6 A;  1JNU A;  4HY8 A;  4I38 A;  4EET B;  5J7E A;  1TS6 A;  4EES A;  1F98 A;  1T1A A;  2WKP A;  3H7W B;  1DP6 A;  4EQ1 A;  3VOL A;  1GSW A;  1F9I A;  5AVF A;  3OLO A;  2OOL A;  3FG8 A;  2ZOI A;  5HWW A;  4MN6 A;  4NXB A;  4EW7 A;  4WF0 A;  4GHI B;  2EA9 A;  2QJ7 A;  1GSX A;  3LIF A;  1OJ5 A;  4I3A A;  5HWT A;  5F68 A;  4EEP A;  2V0W A;  1OT9 A;  3RTY A;  2L1M A;  2P7J A;  5TBM A;  3A0R A;  4RQ9 A;  4PKY A;  3C8C A;  3NOP C;  2OWH A;  1D06 A;  2Z6D A;  3LYX A;  4GCZ A;  1XJ4 A;  1N9L A;  2VV8 A;  1S4R A;  2W0N A;  4HJ6 A;  1OTE A;  4L9E A;  4PKY G;  4EER A;  5KIZ A;  2B02 A;  2L0W A;  2I9V A;  5HSQ A;  1UWN X;  1T18 A;  4KUO A;  3EEH A;  2W27 A;  3H82 A;  5HDC A;  4JGP A;  4JGR A;  4R6L A;  2VLG A;  1TS8 A;  1S1Y A; 
#chains in the Genus database with same CATH topology
 3MFX A;  5FAP A;  3E4Q A;  4KUK A;  3EEA A;  5IHV A;  3HBR A;  4XUZ A;  3UPO A;  2VV7 A;  3Q07 A;  3ZQ5 A;  3SS3 A;  1CEF A;  3Q81 A;  2ZD8 A;  1ZHH B;  4Y3I A;  2PU2 A;  5DF9 A;  5GLA A;  3W2Z A;  2P9V A;  2ZM8 A;  1ONG A;  4KQQ A;  4XXR A;  2BAS A;  4UHU A;  3IX4 A;  1K4E A;  4GN2 A;  1BUE A;  3DTE A;  4R1G A;  2WAE A;  4FH4 A;  3VE4 A;  5EVI A;  1BYW A;  2Q9M A;  2V8F A;  1Z6F A;  2JKR I;  2R9X A;  3P98 A;  2HPB A;  5AVE A;  3O87 A;  1Q2Q A;  4P87 A;  3C2W A;  2QMI A;  4KZB A;  1XA1 A;  4FOF A;  3ZG0 A;  1JWP A;  3NDE A;  3IWI A;  2W1T B;  1K57 A;  3CAX A;  3LUQ A;  1YAX A;  1L3L A;  3GMW A;  3OPR A;  1LHY A;  3IF6 B;  2EWV A;  1Y4O A;  3BY9 A;  3BQA A;  3V3R A;  3VSK A;  1H8M A;  2W3E A;  3UO9 A;  3IWO A;  2EFU A;  1DJA A;  1VB6 A;  3CG5 A;  1KE0 A;  3H7W A;  2OV5 A;  4UQI S;  5F69 A;  3SOI A;  2UWX A;  4I38 A;  4PHT A;  3LR4 A;  2WKP A;  4DN0 A;  1STZ A;  1OJ5 A;  4OON A;  3N7W A;  4RQ9 A;  4ETZ A;  2WGV A;  1XJ4 A;  3VP0 A;  5KIZ A;  1JWV A;  1VM1 A;  2L0W A;  5FEF A;  3CHW P;  1L0D A;  4C3Q A;  2JKT M;  3IF5 A;  2VLG A;  5F6A A;  4RX2 A;  1HVB A;  2WGI A;  4S2J A;  3T50 A;  1YLZ A;  2PR5 A;  3QP5 A;  3MSH A;  4CLC A;  3UE3 A;  2V2F F;  4EBN A;  3UPP A;  2JCH A;  3G34 A;  4CJN A;  3MXS A;  1ES5 A;  2ZQ8 A;  1Q2P A;  1SCW A;  3OPP A;  5J8X A;  3UE0 A;  1W63 M;  1K57 C;  1MWS A;  3VOZ A;  3ZNT A;  4BBV A;  3BQ8 A;  3K3C A;  4QY6 A;  4LRY C;  3TRC A;  3W4O A;  4MN5 A;  3JYI A;  1TS0 A;  1ZTU A;  4F94 A;  5BOH A;  5HX9 A;  3TSG A;  5EE8 A;  3U2A A;  5TGF A;  3G4P A;  4RX3 A;  4WZ5 A;  4LGW A;  3RJU A;  4LRX C;  3WS4 A;  5C5K A;  4G3W A;  3KSF A;  4GS9 B;  5HW3 A;  1JNU A;  4EET B;  3IF6 A;  1YLT A;  3C7U A;  3BLS A;  4KEN B;  2W3F A;  5FAO A;  3SH8 A;  1G5U A;  1IYS A;  3TJZ C;  1XPB A;  5FI7 A;  1PI5 A;  4OOM A;  4O01 A;  4OQI A;  3ZCZ A;  4PKY G;  4DMZ A;  2HP6 A;  2PT7 A;  1PWG A;  1N9B A;  3HCY A;  3M2J A;  3M6H A;  5A90 A;  4ESP A;  1RGZ A;  3MZF A;  2V1Z A;  3GEC A;  2EX2 A;  1LSV A;  3R7W B;  5HAQ A;  2W1T A;  2ZMV A;  1TS7 A;  2A3U A;  2E8J A;  1FR6 A;  4MLL A;  4KQD A;  3FWL A;  5L09 A;  4MEZ A;  3WS5 A;  2B5R A;  4S2K A;  1PRQ A;  1YMS A;  1RCJ A;  1ES4 A;  2OAQ 1;  1SHV A;  3FKV A;  3MS6 A;  4S2N C;  1BLP A;  1I2W A;  2JKR M;  1MBL A;  2XRN A;  1W7F A;  1M6K A;  3DW0 A;  4GD8 A;  1D7E A;  3OPL A;  4K91 A;  3VE3 A;  3KO6 A;  2WKE A;  5EEC A;  2XF3 A;  4Y0U A;  4FCF A;  4JLF A;  1K54 A;  2H0Y A;  3UE6 A;  1JTD A;  1XFN A;  4U0X A;  1K56 A;  1VET A;  3DWK A;  4E3J A;  1JTG A;  4GNU A;  1KE3 A;  4EU0 A;  3K3D A;  4BBU A;  1NWZ A;  3SS4 A;  3BRM A;  3BEC A;  5FQI A;  1T1A A;  2ACG A;  2Z2M B;  1DP6 A;  2EWW A;  3VOL A;  3IH8 A;  1LL5 A;  4KZA A;  3DTK A;  3RTY A;  3ZG8 B;  2ZQ9 A;  4R38 A;  1BUL A;  1GA9 A;  2Z6D A;  1N9L A;  1F5M A;  1MKI A;  1UWN X;  1FSY A;  2WAD A;  4MMN A;  2A24 B;  4BD1 A;  4P6Z S;  4NET A;  3LCE A;  1GSV A;  2CMN A;  1CI8 A;  1YLP A;  2JKF A;  2VX8 A;  5EUA A;  4CQH A;  3PAE A;  5CEC A;  4IBR A;  4R3J A;  2JHE A;  1MWT A;  5F5Y A;  4X1L A;  4ID4 A;  1PIO A;  2Y4A A;  3L9K A;  2XSS A;  3ZHH A;  3MQ0 A;  2ZBB A;  3ISG A;  2ZOH A;  2IWB A;  4HJ4 A;  2XGN A;  3MZE A;  5HL6 A;  4IUH A;  1T19 A;  2P08 A;  1LI9 A;  4S2N A;  5TBM B;  4RYE A;  3G32 A;  4ZTK A;  4XT2 A;  1NZO A;  1W79 A;  4MBK A;  3O5Y A;  3MKE A;  4LRZ E;  4OOL A;  3NHQ A;  2DMW A;  2ZC4 B;  3S7P A;  2VZW A;  1FCM A;  4I39 A;  3UB9 A;  1YKD A;  4UQI M;  2ZC3 B;  3F1N A;  1CQA A;  2ZQA A;  4HOI A;  3G6O A;  3RXX A;  2ZL1 A;  1IYO A;  3HL9 A;  3ZG7 B;  1S0W A;  4BL2 A;  3KSH A;  4EQ1 A;  3VP1 A;  3WRT A;  1F9I A;  2FFY A;  5KSH A;  5CX7 A;  3ZYT A;  4G3K A;  3IHA A;  4PKY A;  2PBD P;  4GCZ A;  2VV8 A;  2W1R A;  3S4X A;  1O07 A;  3A3J A;  3EEH A;  2W27 A;  5HDC A;  1UWP X;  2DCF A;  4O0P A;  2Y2K A;  1YSP A;  2EXA A;  4ZAM A;  4WEJ A;  5CRF A;  3UPN A;  2PAV P;  3R4K A;  3S1Y A;  2ZC5 B;  1MWR A;  3NBL A;  5FAS A;  3UY6 A;  2JC7 A;  5EOO A;  2O9A A;  2WGW A;  1N9N A;  2Y55 A;  4S2M A;  1MXO A;  1K55 A;  3SW1 A;  1YLW A;  5CHM A;  3G30 A;  2MJ6 A;  4PM6 A;  1HLU P;  3IH9 A;  1ZG4 A;  2UV0 E;  2G2W A;  1NZU A;  4HIA A;  4NEE D;  4X53 A;  5CXW A;  4X56 A;  2WKQ A;  1OTD A;  3OCN A;  5A91 A;  1YT4 A;  4HQA A;  3VFF A;  2VV6 A;  4GKU A;  1IEM A;  3NUL A;  3OBF A;  4X6T A;  2XH9 A;  4B4X A;  1Y54 A;  4E6W A;  1I5Q A;  4FUW A;  4O7D A;  2PU4 A;  3HLG A;  4DRT A;  3E2K A;  3HLW A;  4ETX A;  3JPU A;  1NYY A;  3ICY A;  4E3L A;  5KZH A;  4NXG A;  2PR6 A;  4QY5 A;  2XQZ A;  2J8Y A;  5EV0 A;  3AGE A;  5HWW A;  5HPF A;  4GHI B;  4OQH A;  1MPL A;  2XK1 A;  4JXS A;  4I3A A;  1L0E A;  2O9C A;  3OZH A;  1CJF A;  2BLS A;  1OT9 A;  3AGF A;  3ITA A;  2AVX A;  4JBF A;  1WYC A;  4EER A;  2XR0 A;  2VGK A;  1T18 A;  1W8Y A;  4PM7 A;  3HLF A;  1CF0 A;  1KGF A;  1NXY A;  5FSR A;  1FCN A;  1S1Y A;  3JVV A;  4KZ7 A;  5DKL A;  3UME A;  4HH2 A;  3EGX C;  1PWC A;  3F1N B;  4JF4 A;  3Q82 A;  4DXB A;  1BZA A;  1GCE A;  4U0T A;  2M7V A;  3FKW A;  4LCL A;  5F1F A;  2QWS A;  4BWI A;  3QP1 A;  3C4P A;  2QZ6 A;  1W8Q A;  4D2O A;  2A49 A;  3E4P A;  3MJQ A;  2WKI A;  2W3D A;  3LGO A;  2O9B A;  1WA9 A;  3IX3 A;  1FR1 A;  3A0S A;  3LIB A;  4X55 A;  4GB7 A;  4O8G A;  3BYD A;  2Y2L A;  3IHB A;  3M2K A;  2QPN A;  1L2S A;  3AGD A;  1SDE A;  5GHX A;  4Y0O A;  1S66 L;  2J3T C;  4U3T A;  2BTF P;  4KG2 A;  1VEU B;  5LBR A;  2M1C A;  5E43 A;  2RL3 A;  1X0O A;  5M1A A;  1IYP A;  3PBQ A;  5HPI A;  5FEG A;  4PM5 A;  5IT5 A;  2O99 A;  1IOU A;  4ME4 A;  4UA9 A;  5AQ7 A;  3SS5 A;  2H10 A;  3ITB A;  4B88 A;  4IBX A;  3LIF A;  4DDY A;  2W3G A;  2OWH A;  4R3A A;  4FD8 A;  3T4Q A;  3HVF A;  4JGR A;  3MQO A;  3UB8 A;  5EM0 A;  1K54 C;  2ZC6 B;  1YLJ A;  3NOT C;  3KYZ A;  3F1P A;  5A92 A;  2A24 A;  1XXM A;  3EGD C;  4Z9Q A;  2ZMF A;  5CTN A;  2QYB A;  2V20 A;  3V39 A;  1BLH A;  3LR0 A;  4EUZ A;  1G28 A;  3S7N A;  4MNR A;  3MKF A;  1TD5 A;  2IWC A;  3ZVT A;  1FSW A;  4QWO A;  4OOY A;  1XJ2 A;  5EVE A;  2VGL S;  4WM9 A;  1VET B;  3QNC A;  2Y2H A;  5EVI B;  5EVL A;  3S7O A;  1CI9 A;  4Q0J A;  1SZV A;  3PHY A;  5K5B A;  1MZU A;  3G35 A;  3GTC A;  5G4Y A;  1ESI A;  3MF0 A;  4YOF A;  1IKG A;  1ERO A;  2Y79 A;  3NC8 A;  4E3N A;  3VFH A;  5GLB A;  3CWF A;  1NJ4 A;  2V1B A;  5L8M A;  4DE2 A;  1H8Z A;  3LY4 A;  1K38 A;  4IVK A;  2GDN A;  1BTL A;  5DJU A;  2O0Y A;  3NJA A;  4HP4 A;  4F3L A;  2G2U A;  4X68 A;  2ZM2 A;  4E3I A;  5D3O A;  4E3M A;  5CEB A;  4B93 A;  3H7W B;  4ZJ1 A;  2OOL A;  1PFL A;  1XKZ A;  4NXB A;  4OLG A;  1GSX A;  2FH5 A;  3ZG5 A;  5TR7 A;  1NY0 A;  4Q8I A;  2W0N A;  5E2G A;  2R9W A;  4DE3 A;  4Y15 A;  3WS0 A;  3R7W A;  4KG6 A;  4WZ5 C;  1F2K A;  4JXV A;  3O86 A;  2V9A A;  4YIN A;  4BLM A;  4YNR A;  4LV3 A;  5TJJ A;  1M40 A;  1RP5 A;  5HAP A;  3HLE A;  2YKF A;  2J9P A;  1NYM A;  4OPY A;  3QP6 A;  4Q0H A;  2HP5 A;  3IF6 C;  3GDI A;  1O7E A;  4HBT A;  1MKM A;  5HL1 A;  5EVI C;  4PM9 A;  4OQG A;  4LPZ A;  3WS2 A;  3DTM A;  1MWU A;  1GHI A;  1ZG6 A;  1YM1 A;  4IJG A;  3HLB A;  3EWK A;  4WZ4 A;  3KYE A;  5J4E A;  4CPK A;  3UDI A;  3IS2 B;  3CUE C;  4I5S A;  3IS2 A;  4QU3 A;  3IXH A;  4ZBE A;  3ZG9 B;  3PBR A;  4CLC B;  2H5S A;  3DWZ A;  1C3B A;  4MBF A;  3MXR A;  3T4O A;  5M19 A;  5FQ9 A;  3T1S A;  3PBN A;  2XLN A;  4OPZ A;  4LV1 A;  1LL9 A;  1XP4 A;  1W5D A;  5M18 A;  5E2H A;  1ERM A;  2Y2N A;  3OLO A;  5E2F A;  2PRF A;  1H8Y A;  4WF0 A;  2EA9 A;  2DNS A;  3HUO A;  2P7J A;  3A0R A;  3SH7 A;  3CI6 A;  3OPH A;  1OTE A;  4ARZ A;  1AXB A;  2I9V A;  1JWZ A;  2K31 A;  4JGP A;  4R6L A;  3B42 A;  3KYQ A;  1VQQ A;  4CLC D;  1DJB A;  2V1A A;  2ZQ7 A;  4JGQ A;  4M4X A;  4P85 A;  4EUV A;  2J3T D;  2R78 A;  4MDZ A;  1KDS A;  4WMC A;  3FZC A;  1FIK A;  3HJI A;  3MMH A;  2OAP 1;  2EX9 A;  2NUP C;  4OKP A;  3H9W A;  4WUJ A;  4XUX A;  2KDK A;  3K2N A;  3BJN A;  4BQM A;  1K4F A;  2WUQ A;  3O3V A;  1WE4 A;  4NXE A;  3TW8 A;  1LL8 A;  1TDL A;  2XD1 A;  5GHZ A;  2QHK A;  2OLU A;  3MZD A;  3BY8 A;  2HJ9 C;  1FIL A;  1YMX A;  3RH8 B;  5EPH A;  2P9V B;  2HDR A;  3GV9 A;  1YSQ A;  3BWL A;  2Y2P A;  4CLC C;  5MC7 A;  1TDG A;  4D60 A;  5F83 A;  2ZL1 B;  4NG2 A;  2Y2M A;  3B3X A;  3WRZ A;  3PTE A;  2PHY A;  1G6O A;  2FFF B;  2WZX A;  2GZA A;  2WZZ A;  4L9F A;  1HZO A;  3VP2 A;  2HDQ A;  2PD7 A;  4R70 A;  3SH9 A;  4KG5 A;  3PBO A;  4OH0 A;  2ZOI A;  3IX8 A;  4MN6 A;  3EQU A;  4IHQ A;  5HWT A;  2ZQC A;  4EEP A;  1LI0 A;  5KMW A;  3Q7V A;  3WWX A;  4Z1W A;  5DF8 A;  1IKI A;  5FAT A;  3HRE A;  2XEP A;  3FYZ A;  2B02 A;  3I7J A;  1J3W A;  4AFI A;  3F1O A;  1LT0 A;  1I2S A;  1W63 Q;  3V67 A;  1A0K A;  5HWV A;  1E25 A;  1IYQ A;  3NIA A;  5FI2 A;  1LSX A;  1NLZ A;  5F82 A;  1OTA A;  3C30 A;  4XT2 B;  4DJ2 A;  2ZLY A;  3O88 A;  4LCM A;  4OPQ A;  1OTB A;  1L0G A;  3FC7 A;  4QPR A;  1T1C A;  3T12 B;  2PD8 A;  2Y2Q A;  3D3O A;  5A93 A;  4EBP A;  4L9G A;  1ESU A;  5CTM A;  1K6R A;  1UGU A;  4N9L A;  1JVJ A;  1ONH A;  4PMA A;  5JYP A;  1K55 C;  2BG1 A;  4CLC E;  3S7Q A;  3HLD A;  3CIT A;  3PR6 A;  4HH3 A;  5FQJ A;  4H8R A;  5AJG A;  4OPR A;  3CPT B;  5DFY A;  1BT5 A;  2Y2J A;  5HDS A;  5KSC A;  4KZ6 A;  4BEN A;  1KVM A;  3LEQ A;  4FTX A;  3G2Y A;  3SZT A;  5DFX A;  2VGJ A;  3E4O A;  1KE4 A;  2C5W B;  5HAI A;  1GA0 A;  4MCW A;  3C4O A;  1SKF A;  2DRW A;  3LO7 A;  4YFM A;  1K25 A;  1DJC A;  4Y13 A;  3BFE A;  2Y2G A;  4ZJ2 A;  4EV4 A;  4E6X A;  4OQ0 A;  5GL9 A;  4UA6 A;  4KZ3 A;  1H0M A;  2XFT A;  3LYX A;  2EXB A;  2JE5 A;  4DKI A;  3EOI A;  1TS8 A;  1PW1 A;  1KDW A;  2CC1 A;  2HDS A;  3HJK A;  1N9O A;  1MY8 A;  2OLV A;  2K2N A;  1D1J A;  1XFQ A;  4WLA A;  2V0U A;  4QB8 A;  5E2E A;  5A8B A;  2VA0 A;  3BFF A;  3N8L A;  4S2O A;  3NY4 A;  3IQA A;  4HP9 A;  4A5R A;  1DP9 A;  3LIC A;  4X25 A;  5DF7 A;  2QJ5 A;  3IXD A;  3UDF A;  3TE8 A;  4P0M A;  1YPR A;  5CGX A;  4RA7 A;  1E3U D;  2ZC7 A;  3NI9 A;  4M3K A;  5GLD A;  2J9O A;  4BJP A;  2A2L A;  1P97 A;  3IXB A;  1V9Y A;  4YWZ A;  4JGO A;  5FQK A;  1QME A;  4GJ4 A;  2G7U A;  1CEG A;  1E3U A;  2HF6 A;  2WK0 A;  2XA7 M;  3MQQ A;  3GQZ A;  3MBZ A;  4Y5F A;  2YKH A;  4IUK A;  4KQO A;  1HD8 A;  3VV4 A;  1ES2 A;  3FPV A;  2EX6 A;  3UB5 P;  2WAF A;  1SDN A;  2P04 A;  1VEU A;  2LB5 A;  3BLM A;  2D01 A;  2XA7 S;  2VK3 A;  3BFC A;  2IA2 A;  3LEZ A;  4E3K A;  5L2F A;  5DTT A;  4EXO A;  1EW0 A;  1K56 D;  3V5M A;  5FAQ A;  5AQ9 A;  3MFD A;  5CGW A;  3N8S A;  2X71 A;  4GLQ A;  3NDG A;  4KZ9 A;  1TF1 A;  3KSI A;  4E3O A;  2FZ0 A;  3CJM A;  1YLY A;  1LLB A;  5FQQ A;  2Y59 A;  4QD4 A;  4R3B A;  5F1G A;  1HTZ A;  1FQG A;  1KGG A;  2QKP A;  4GHI A;  4WBG A;  4OLD A;  3CUE A;  4Y7P A;  3GRJ A;  3G2Z A;  2GNX A;  5GHY A;  3VSL A;  3S22 A;  3QP8 A;  1DP8 A;  3T4K A;  3MXQ A;  1KGE A;  2HJE A;  2Q0O A;  3H82 B;  1ALQ A;  4FSF A;  1Y28 A;  5HFO A;  1VHM A;  1OTI A;  4N92 A;  4Y2F A;  4PM8 A;  3P09 A;  4DF6 A;  2JKT I;  4L0L A;  1OT6 A;  3QHY A;  2PDR A;  5G18 A;  4H6J A;  1U60 A;  3Q1F A;  3BW6 A;  3KX0 X;  4IED A;  4X1M A;  2INW A;  3GR2 A;  1XGJ A;  1SKO A;  3BM6 A;  4HI4 A;  1ZKJ A;  4S2P A;  3UB6 A;  1V9Z A;  4PAU A;  1DRM A;  1K6S A;  4HY8 A;  5J7E A;  1EWZ A;  2P74 A;  1DY6 A;  5TFQ A;  3V50 A;  3PBS A;  4P6B A;  1GHM A;  5F68 A;  2Y91 A;  2GX5 A;  5CHJ A;  4ZDX A;  1D06 A;  1H3Q A;  4HJ6 A;  4MN7 A;  3BEB A;  1TVF A;  3LR3 A;  4DE0 A;  2J3W A;  4ZJ3 A;  2VKS A;  4B4Z A;  2WGW B;  4N9K A;  1H5X A;  4FH2 A;  3GSG A;  1RGY A;  4GD6 A;  4LLO B;  3IWQ A;  2XDM A;  4E04 A;  1XJ3 A;  1ACF A;  1IFQ A;  1K0K A;  4DJ3 A;  3DBA A;  3ZVW A;  1S4S A;  3U4L P;  5AQB A;  2JBF A;  1MC0 A;  5CHU A;  3C38 A;  3FPW A;  4WL9 A;  1E4D A;  1NLY A;  4GZB A;  3CZD A;  4R4R A;  5I5L A;  1XJ6 A;  1KVL A;  1S67 L;  4R4S A;  4ZRR A;  5HD3 A;  5FDH A;  1G68 A;  4NXF A;  3TOI A;  2ZJ9 A;  3F1P B;  3Q7V B;  1LSW A;  4Q0I A;  4WMC D;  3PXP A;  5HAR A;  3T1R A;  3UE1 A;  4DDS A;  5J3W A;  2Z6C A;  3CPT A;  2VJW A;  3P7N A;  2HGV A;  4WEL A;  2W3H A;  1G6A A;  3V3S A;  3ZGA B;  1GSW A;  4JXG A;  3FG8 A;  4UEY A;  3IT9 A;  2QJ7 A;  2V0W A;  2L1M A;  5TBM A;  4EQI A;  3P01 A;  3CMZ A;  1S4R A;  3GVB A;  4KZ5 A;  3G31 A;  3EQV A;  1SKO B;  1OPX A;  3ULF A;  3ZDJ A;  3C8C A;  2EFX A;  2WKR A;  4GDB A;  4BL3 A;  2Q9N A;  3LID A;  4DXC A;  3C5A A;  4H6J B;  1PWD A;  4JPM A;  3E0Y A;  4K0X A;  4X69 A;  1T1B A;  4I3J A;  1S1Z A;  4B9O A;  3DAV A;  3TG9 A;  3BFG A;  3OCL A;  4UA7 A;  1ERQ A;  1N4O A;  5CED A;  1L0F A;  2B18 A;  4EEU A;  1BLS A;  3C7V A;  3E2L A;  1BSG A;  3IBJ A;  4K0W A;  3VMA A;  5DKK A;  3D72 A;  2Z2L B;  5L10 A;  2Y2O A;  1QMF A;  3PYP A;  3UB7 A;  4LV2 A;  1PI4 A;  3VP3 A;  4QJG A;  2JN7 A;  3M6B A;  3RXW A;  3VOY A;  3LFV A;  4WYY A;  3NOU C;  5JYO A;  5IU1 A;  3B33 A;  4RVA A;  3F1O B;  4HES A;  4R0Q A;  2HV1 A;  2L4R A;  4HHD A;  3PBT A;  2KX6 A;  3LY3 A;  1IEL A;  5DVA A;  5AVF A;  3UNW A;  2WYX A;  2PBY A;  5FQM A;  2Y2I A;  1XGI A;  3A3E A;  4HBU A;  4N1H A;  4KUO A;  4OVD A;  3N4I A;  3E98 A;  5EVI D;  4Y17 A;  5FI6 A;  5U47 A;  2H28 A;  4Y0T A;  3A0V A;  3T1Q B;  5HZH A;  3WS1 A;  2HZ5 A;  2XRO A;  3BFD A;  4NKP A;  5HD5 A;  5CGS A;  1P9W A;  1PYY A;  4EWF A;  4GDN A;  4GW9 A;  3HLC A;  3JVU A;  5CER A;  5G4Z A;  1AWI A;  4I3I A;  2IWD A;  3NEC A;  4IVI A;  1EI5 A;  4MBH A;  5L07 A;  4C75 A;  3QP2 A;  1GHP A;  4OP5 A;  3B47 A;  4ARZ B;  2XFS A;  1XX2 A;  1CK3 A;  3T4J A;  2VGL M;  2PYR A;  3IBR A;  4S2L A;  4F3L B;  2OSU A;  1FCO A;  4JF6 A;  4LV0 A;  3ZFZ A;  2KOI A;  4JXW A;  3CLO A;  4BMW A;  3L7H A;  2D02 A;  1KOU A;  3QP4 A;  1NRJ A;  4EBL A;  1PNE A;  1ZC2 A;  5DTK A;  1TEM A;  4GS9 A;  5FDS A;  3FV7 A;  1P0Z A;  3NCK A;  3A3F A;  4EW7 A;  3LIA A;  5AQA A;  3LI8 A;  4KZ4 A;  2VEA A;  4DE1 A;  3W4Q A;  4BBT A;  3T4L A;  3KSG A;  4N1X A;  2J80 A;  3T1X A;  3OOV A;  3N8R A;  1TS6 A;  4KQR A;  2ZQD A;  2X02 A;  4C6Y A;  2ZMA A;  1PZO A;  2EX8 A;  2WKH A;  5FA7 A;  3HUN A;  2LB9 A;  2X01 A;  4NK3 A;  3H82 A;  3W8K A;  4WN5 A;  3UN7 A;  4HEF A;  5EFW A;  3A3I A;  3LIE A;  5FL3 A;  3IXG A;  2KLI A;  4JF5 A;  3QNB A;  5EM1 A;  5IS1 A;  2HP9 A;  4R23 A;  1NRF A;  4K08 A;  3MR0 A;  2C6W B;  3OC2 A;  3A3D A;  2HDU A;  2J7V A;  4II7 A;  3LI9 A;  4G3V A;  1BLC A;  4BD0 A;  3T4S A;  3T4T A;  1PW8 A;  1ES3 A;  2K7S A;  2JKG A;  5GLC A;  4WEK A;  4UAA A;  1YQS A;  1ODV A;  1S6R A;  3UDX A;  2RCX A;  2M7U A;  2B95 A;  3D4F A;  2GJ3 A;  5HDD A;  3ZNY A;  2H0T A;  2OWJ A;  4HJ3 A;  3UMD A;  3N6I A;  2PYP A;  3VP4 A;  4OP8 A;  3D9Y A;  5EOE A;  1FOF A;  1PZP A;  2NUT C;  4KZ8 A;  2Y8H A;  2E8I A;  1WYB A;  1OJG A;  1XA7 A;  3LR5 A;  4PPR A;  2ZM0 A;  4LEN A;  3RFB A;  1P9R A;  4P6Z M;  1OME A;  5DJT A;  4HNB A;  2I72 A;  4QHC A;  3PAG A;  2XD5 A;  1J9M A;  4EES A;  1F98 A;  3HUM A;  3DTI A;  1Z09 A;  4S2I A;  3NOP C;  3W4P A;  3Q7Z A;  4L9E A;  5I94 A;  4LFU A;  5HSQ A;  4JKT A;  4GOG A;  5DTS A;  2V8C A; 
#chains in the Genus database with same CATH homology
 3B42 A;  1UWP X;  3KYQ A;  4O0P A;  3MFX A;  3E4Q A;  2J3W A;  4KUK A;  3EEA A;  1YSP A;  4CLC D;  2V1A A;  2VKS A;  4WEJ A;  4JGQ A;  3R4K A;  4M4X A;  4EUV A;  2J3T D;  2R78 A;  2VV7 A;  4MDZ A;  3ZQ5 A;  1ZHH B;  4Y3I A;  5DF9 A;  2O9A A;  3W2Z A;  3HJI A;  4LLO B;  3MMH A;  2OAP 1;  1N9N A;  2BAS A;  2NUP C;  3H9W A;  3SW1 A;  4WUJ A;  4E04 A;  1XJ3 A;  2KDK A;  1IFQ A;  3VE4 A;  2MJ6 A;  3K2N A;  1BYW A;  4DJ3 A;  3BJN A;  3DBA A;  2JKR I;  4NXE A;  3TW8 A;  1S4S A;  1LL8 A;  4HIA A;  4NEE D;  5AVE A;  1MC0 A;  2WKQ A;  1OTD A;  2QHK A;  3C2W A;  3C38 A;  3FPW A;  3OCN A;  4WL9 A;  1NLY A;  3BY8 A;  4HQA A;  2HJ9 C;  5I5L A;  3RH8 B;  2VV6 A;  1XJ6 A;  4FOF A;  1S67 L;  4ZRR A;  5HD3 A;  1YSQ A;  3OBF A;  3BWL A;  2W1T B;  3CAX A;  4NXF A;  3LUQ A;  1YAX A;  3F1P B;  4CLC C;  5MC7 A;  2EWV A;  1LSW A;  4Q0I A;  3BY9 A;  3BQA A;  1H8M A;  2W3E A;  2PHY A;  1G6O A;  3PXP A;  1VB6 A;  4ETX A;  2GZA A;  4L9F A;  3ICY A;  3H7W A;  5J3W A;  4UQI S;  5F69 A;  2PD7 A;  2Z6C A;  4NXG A;  2VJW A;  4R70 A;  3P7N A;  2HGV A;  2PR6 A;  4I38 A;  3PBO A;  4PHT A;  3LR4 A;  2W3H A;  4WEL A;  2WKP A;  1GSW A;  3FG8 A;  4DN0 A;  1STZ A;  2ZOI A;  5HWW A;  5HPF A;  4MN6 A;  4UEY A;  3EQU A;  4GHI B;  2QJ7 A;  1OJ5 A;  4I3A A;  4IHQ A;  2O9C A;  5HWT A;  4EEP A;  2V0W A;  1OT9 A;  2L1M A;  5TBM A;  4RQ9 A;  4ETZ A;  3P01 A;  4Z1W A;  1XJ4 A;  4EER A;  1S4R A;  5KIZ A;  2B02 A;  2L0W A;  1T18 A;  3EQV A;  2JKT M;  1OPX A;  2VLG A;  5F6A A;  3ULF A;  4AFI A;  3C8C A;  1S1Y A;  2WKR A;  3F1O A;  3JVV A;  1LT0 A;  5DKL A;  3UME A;  4HH2 A;  3EGX C;  3LID A;  1W63 Q;  4H6J B;  3V67 A;  3F1N B;  3E0Y A;  3T50 A;  5HWV A;  2PR5 A;  1T1B A;  4CLC A;  4I3J A;  1S1Z A;  4B9O A;  2M7V A;  1LSX A;  3OCL A;  3UE3 A;  1NLZ A;  1OTA A;  3C30 A;  4XT2 B;  2QWS A;  4DJ2 A;  2B18 A;  4BWI A;  4EEU A;  1OTB A;  1W63 M;  3E4P A;  3MJQ A;  2W3D A;  2O9B A;  1WA9 A;  3FC7 A;  4QPR A;  3IBJ A;  1T1C A;  2PD8 A;  4BBV A;  3D3O A;  3BQ8 A;  5DKK A;  3D72 A;  4L9G A;  3A0S A;  3K3C A;  3LIB A;  4LRY C;  3TRC A;  1UGU A;  4MN5 A;  4O8G A;  1TS0 A;  1ZTU A;  3PYP A;  3UB7 A;  2JN7 A;  3U2A A;  4CLC E;  3S7Q A;  3LFV A;  3CIT A;  3PR6 A;  1S66 L;  3NOU C;  4HH3 A;  5IU1 A;  2J3T C;  5AJG A;  3B33 A;  3F1O B;  5DFY A;  4LRX C;  5LBR A;  5HDS A;  5C5K A;  2M1C A;  2HV1 A;  4G3W A;  2L4R A;  4HHD A;  1X0O A;  3KSF A;  3PBT A;  3PBQ A;  2KX6 A;  4GS9 B;  5HPI A;  3E4O A;  5DFX A;  1JNU A;  4EET B;  5IT5 A;  2O99 A;  4MCW A;  1IOU A;  4ME4 A;  5AVF A;  3LIF A;  2W3F A;  2W3G A;  3TJZ C;  4OOM A;  4O01 A;  2OWH A;  3LYX A;  4R3A A;  4PKY G;  4DMZ A;  2PT7 A;  3HCY A;  4KUO A;  3EOI A;  3T4Q A;  4JGR A;  3E98 A;  1TS8 A;  3MQO A;  3UB8 A;  2H28 A;  3GEC A;  3A0V A;  3HJK A;  1N9O A;  5HZH A;  3NOT C;  2K2N A;  3KYZ A;  2XRO A;  1XFQ A;  4WLA A;  1LSV A;  3F1P A;  4NKP A;  5HD5 A;  2V0U A;  2A24 A;  3R7W B;  2W1T A;  2ZMV A;  1TS7 A;  5A8B A;  2VA0 A;  1P9W A;  3EGD C;  4GW9 A;  4KQD A;  3JVU A;  2ZMF A;  4HP9 A;  2QYB A;  5G4Z A;  1DP9 A;  3LIC A;  3LR0 A;  4I3I A;  1G28 A;  2OAQ 1;  3S7N A;  2QJ5 A;  3TE8 A;  1TD5 A;  2JKR M;  2XRN A;  4BJP A;  1XJ2 A;  3B47 A;  2A2L A;  4ARZ B;  2VGL S;  1P97 A;  3T4J A;  1V9Y A;  4YWZ A;  4JGO A;  2VGL M;  2PYR A;  4GJ4 A;  2G7U A;  3IBR A;  4F3L B;  1D7E A;  3S7O A;  4Q0J A;  2HF6 A;  3VE3 A;  3PHY A;  2XA7 M;  3MQQ A;  2KOI A;  5K5B A;  3KO6 A;  1MZU A;  3CLO A;  4Y5F A;  4BMW A;  2D02 A;  1KOU A;  2YKH A;  5G4Y A;  4IUK A;  4KQO A;  3VV4 A;  3MF0 A;  4YOF A;  3FPV A;  1NRJ A;  2Y79 A;  2P04 A;  3UE6 A;  3CWF A;  4GS9 A;  1XFN A;  2LB5 A;  2V1B A;  5L8M A;  1P0Z A;  2D01 A;  2XA7 S;  2IA2 A;  4EW7 A;  5DJU A;  2O0Y A;  3LIA A;  3LI8 A;  2VEA A;  3NJA A;  4EU0 A;  4HP4 A;  4F3L A;  4BBT A;  3T4L A;  3K3D A;  3KSG A;  4BBU A;  2J80 A;  4EXO A;  1NWZ A;  3OOV A;  1EW0 A;  1TS6 A;  1T1A A;  4B93 A;  3H7W B;  1DP6 A;  2EWW A;  3VOL A;  2OOL A;  4NXB A;  1GSX A;  2FH5 A;  3RTY A;  4GLQ A;  1TF1 A;  4R38 A;  2LB9 A;  2Z6D A;  3KSI A;  2W0N A;  1N9L A;  1F5M A;  1UWN X;  2FZ0 A;  3H82 A;  4MMN A;  2A24 B;  3R7W A;  4P6Z S;  4WN5 A;  2QKP A;  2V9A A;  4GHI A;  4YNR A;  1GSV A;  2CMN A;  5TJJ A;  5EFW A;  3CUE A;  3LIE A;  5FL3 A;  2VX8 A;  2KLI A;  2YKF A;  4CQH A;  2GNX A;  5IS1 A;  4Q0H A;  4K08 A;  3MR0 A;  2JHE A;  3OC2 A;  5F5Y A;  3GDI A;  1DP8 A;  3T4K A;  4II7 A;  1MKM A;  3LI9 A;  4G3V A;  2XSS A;  3MXQ A;  3MQ0 A;  2ZBB A;  3T4S A;  3T4T A;  4LPZ A;  2K7S A;  2HJE A;  3H82 B;  2ZOH A;  4WEK A;  4HJ4 A;  1ODV A;  5HL6 A;  4IUH A;  1T19 A;  2P08 A;  4FSF A;  2M7U A;  2GJ3 A;  5HDD A;  4IJG A;  5TBM B;  1Y28 A;  2OWJ A;  1VHM A;  4XT2 A;  1OTI A;  4HJ3 A;  3UMD A;  2PYP A;  4Y2F A;  3O5Y A;  3EWK A;  4LRZ E;  5J4E A;  4OOL A;  3NHQ A;  2JKT I;  4L0L A;  1OT6 A;  3IS2 B;  2DMW A;  2NUT C;  3CUE C;  4I5S A;  3IS2 A;  3S7P A;  2VZW A;  4I39 A;  2PDR A;  2Y8H A;  3UB9 A;  1YKD A;  4UQI M;  1OJG A;  3F1N A;  4H6J A;  3LR5 A;  3PBR A;  4CLC B;  3RFB A;  3BW6 A;  1P9R A;  3KX0 X;  4P6Z M;  3T4O A;  2INW A;  5DJT A;  4HOI A;  3G6O A;  4HNB A;  4HI4 A;  3PBN A;  3UB6 A;  1V9Z A;  4PAU A;  1DRM A;  4HY8 A;  5J7E A;  4EES A;  1F98 A;  3KSH A;  4EQ1 A;  1F9I A;  3OLO A;  3PBS A;  4WF0 A;  5KSH A;  2EA9 A;  5CX7 A;  5F68 A;  3ZYT A;  4G3K A;  2P7J A;  3A0R A;  2GX5 A;  4PKY A;  3NOP C;  1D06 A;  3CI6 A;  4GCZ A;  1H3Q A;  2VV8 A;  4HJ6 A;  1OTE A;  4L9E A;  4MN7 A;  4ARZ A;  2W1R A;  2I9V A;  2K31 A;  5HSQ A;  3LR3 A;  3EEH A;  2W27 A;  5HDC A;  4JGP A;  4R6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...