1OJ5A

Crystal structure of the nco-a1 pas-b domain bound to the stat6 transactivation domain lxxll motif
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
105
Chain Sequence
VESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPMQPFIMGIHIIDRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STEROID RECEPTOR COACTIVATOR 1A
publication title Structure of the Ncoa-1/Src-1 Pas-B Domain Bound to the Lxxll Motif of the Stat6 Transactivation Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcriptional coactivator
total genus 28
structure length 105
sequence length 109
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1oj5A00
3CLOA 3CWFA 3MQQA 2BASA 2Z6CA 2JHEA 4GS9B 1EW0A 2HV1A 3GDIA 4LRYC 2B02A 1OTAA 4WLAA 5HDDA 4MN5A 2JN7A 1S1YA 2YKFA 4I3JA 3K3DA 2V9AA 4NXFA 2A24A 4EQ1A 3MFXA 1S66L 4F3LB 1F9IA 3SW1A 3H7WB 5HWTA 1JNUA 2INWA 4GW9A 3LIDA 2CMNA 1LL8A 3LUQA 3LI8A 1N9OA 3RTYA 2M1CA 4LPZA 4GCZA 2L1MA 2OOLA 1XJ3A 5IS1A 4JGOA 4BBTA 4I5SA 3IS2B 1UGUA 5F5YA 2PR5A 2PR6A 1ODVA 1MZUA 3BY9A 2PYPA 3HJIA 3HJKA 2ZOIA 1GSXA 5J3WA 2PYRA 1X0OA 1DP9A 2VEAA 2OWHA 2QKPA 2VV8A 2W0NA 5DJUA 4LRXC 5DKLA 4H6JB 1UWPX 3LYXA 4PKYA 3H9WA 4E04A 4XT2B 3F1PB 4GS9A 4JGPA 1XJ6A 2WKRA 4GHIA 4RQ9A 5AVFA 4WF0A 3E4QA 3F1OB 3ULFA 1OTEA 1F98A 2VV7A 4F3LA 4L9GA 1OT9A 5KIZA 3H7WA 3PHYA 3EEHA 2WKPA 3BWLA 3VE4A 4WN5A 2R78A 3NHQA 2D02A 4YWZA 3IS2A 4WUJA 5J4EA 3UB8A 1LSXA 2PHYA 3E4OA 5F69A 3KX0X 5G4ZA 2QJ7A 2W27A 4LRZE 3UMDA 4EESA 4NXGA 4KQDA 4R6LA 4HP9A 1OTDA 4EERA 3LI9A 3UB9A 1S4SA 4I3AA 2OWJA 3H82B 5HDCA 5J7EA 4M4XA 4HJ4A 3LIFA 3NOTC 2Z6DA 1V9ZA 1GSVA 4MN6A 1V9YA 3F1NB 4XT2A 3UB7A 3PYPA 3VOLA 3T50A 1TS0A 4I39A 3F1PA 2L0WA 3D72A 4HY8A 3UMEA 4HHDA 1UWNX 4EXOA 4R38A 4HJ6A 5TBMB 5A8BA 2V1BA 2PDRA 3A0RA 1VB6A 4EEPA 5HZHA 1P0ZA 3F1OA 4NXEA 2VLGA 3NJAA 3E4PA 4L9FA 3LIAA 3MR0A 2KDKA 4HH2A 4JGRA 5DKKA 3ICYA 3MJQA 3OLOA 4PKYG 3MQOA 5AVEA 3LIEA 3C2WA 4DJ2A 1WA9A 2QWSA 5HSQA 1TS8A 5F6AA 1T19A 5I5LA 1XFQA 2V0WA 1P97A 4EETB 2L4RA 3P7NA 1LT0A 3CAXA 5HD3A 4R70A 3K3CA 3VE3A 5HDSA 4JGQA 2QHKA 1OJ5A 2PD7A 3LICA 5HD5A 4KUOA 3MXQA 5EFWA 1DP6A 4HH3A 1TS7A 3H82A 4B9OA 5HWWA 1XJ4A 3A0VA 3G6OA 4I38A 1LSWA 1T18A 3F1NA 4HQAA 2J80A 2PD8A 1S67L 4GHIB 3GECA 1G28A 4WL9A 3RH8B 4I3IA 5TBMA 4HIAA 1T1AA 4BBVA 1S1ZA 1N9NA 2YKHA 1TS6A 3FG8A 5G4YA 2WKQA 4LLOB 3A0SA 4H6JA 3IBRA 1T1CA 1XFNA 2V1AA 4KUKA 1OJGA 1S4RA 2H28A 2I9VA 4K08A 4HNBA 2EA9A 1D06A 4BBUA 3C8CA 1LSVA 1KOUA 4EEUA 4HOIA 2KX6A 3NOPC 3ZQ5A 1XJ2A 1Y28A 1D7EA 2A24B 3LIBA 4NXBA 3UB6A 3UE6A 4L9EA 1BYWA 1OTBA 2QJ5A 4HP4A 3B33A 4EW7A 2VV6A 3NOUC 5IU1A 1NWZA 2GJ3A 1DP8A 1DRMA 3FC7A 3BY8A 3EWKA 1N9LA 2D01A 2P7JA 1OT6A 4DJ3A 5DJTA 5HWVA 2ZBBA 5F68A 4R3AA 4HI4A 1T1BA 1OTIA 2ZOHA 2V0UA 1GSWA 2K7SA 4HJ3A
chains in the Genus database with same CATH superfamily
2ZL1A 2BASA 1E3UA 4GS9B 2HDRA 4MLLA 3MZDA 1H8ZA 2A2LA 2B02A 3BQAA 3IX8A 3BFDA 3ZVWA 3IT9A 1S1YA 4GDBA 1EWZA 1PIOA 2V9AA 5GHXA 3FV7A 2UWXA 3MFXA 4O0PA 1W7FA 3S7NA 3HREA 4Y5FA 1F9IA 3S1YA 2HZ5A 5HWTA 2UV0E 1LL8A 3HUOA 1K4FA 4ETXA 1CEGA 3T4KA 2J9OA 3OCLA 3RTYA 3NY4A 5GLDA 4LPZA 1NJ4A 3ZHHA 2XRNA 3T1QB 5JYOA 5F5YA 5HX9A 4UQIM 3WS5A 4LENA 5FQ9A 2HJEA 3MBZA 4JF5A 3ZNYA 3Q7VB 1W8YA 1PW1A 2ZOIA 5HARA 3GV9A 4Q0JA 1Z6FA 5HL1A 1DP9A 3NDGA 4FSFA 3QP4A 2QKPA 2FZ0A 4IVIA 2W0NA 3MZEA 4LRXC 3IX3A 3LR5A 4H6JB 3QHYA 3LYXA 4PKYA 4XT2B 1BLSA 4QD4A 3OC2A 2EFUA 5CGWA 4RX2A 1FCNA 3BFGA 5DTTA 2E8JA 2G2UA 4JXVA 1DJBA 3WRZA 3NBLA 4S2JA 3F1OB 3ULFA 1OTEA 4IBRA 4LV2A 3L9KA 1MC0A 4RX3A 2OV5A 1CEFA 2VV7A 1HZOA 4F3LA 5KZHA 2J3TD 4OPRA 1RP5A 3QP5A 2B95A 1KE0A 2M7UA 3PHYA 5DVAA 3BFFA 5G18A 4E6XA 1N9BA 4GD8A 3HL9A 1KE3A 3NHQA 2DCFA 1MWSA 5AQBA 4PAUA 3IS2A 3UO9A 2HDQA 4G3KA 1YLYA 1K55C 2PHYA 1SHVA 3S7OA 2W1TA 2G2WA 3C4OA 1K54C 5EECA 3ZGAB 4LRZE 4OOLA 3UMDA 4LCLA 3UE3A 1ACFA 1P9WA 2XLNA 4NEED 1OTDA 4EERA 1WYCA 5DFXA 1RGYA 1SZVA 3UY6A 2OWJA 3H82B 5HDCA 4M4XA 3TOIA 3NOTC 1QMEA 1IFQA 3A3FA 1V9ZA 3UN7A 1K38A 1TS0A 3ZG5A 3DTEA 4WYYA 3UMEA 1UWNX 1OMEA 4R38A 4HJ6A 5A8BA 4Q0IA 1VB6A 1ZG6A 3E4PA 4L9FA 2B18A 3MR0A 2KDKA 5F1GA 4UQIS 4P0MA 5L8MA 2HF6A 1WE4A 3MJQA 4OH0A 5EM1A 2O9CA 3OLOA 4HBTA 4F94A 3M2JA 5AVEA 1IYSA 4Y13A 1ES2A 1P9RA 1K56D 2ZMAA 5EUAA 3TW8A 2JKFA 4DJ2A 5CEDA 4N92A 1TS8A 1T19A 4EV4A 1NZUA 4X1LA 3WS4A 1NLYA 4DXCA 3PAEA 4IUHA 2ZM2A 5FAOA 4XXRA 2IWDA 4CPKA 3P7NA 1ESIA 4XUXA 3BFCA 3ZVTA 3ZYTA 3VE3A 2WKEA 4JGQA 2QHKA 2PD7A 4GN2A 4UA6A 3G31A 3NI9A 4OQHA 5BOHA 1DP6A 4PHTA 2GNXA 3AGDA 1IYPA 4HH3A 4CLCD 2WGIA 3T4QA 3FPWA 2A3UA 5HWWA 5AJGA 1XJ4A 5CHUA 2O99A 4ESPA 2M7VA 2J7VA 5CRFA 2ZC5B 1TDLA 1TDGA 4GHIB 1LI0A 4X25A 3GECA 1G28A 4NKPA 4WL9A 3RH8B 5TBMA 4K0XA 3HLDA 5TR7A 1T1AA 2R9WA 3T4LA 2WKHA 1NYYA 1N9NA 4FH4A 2JC7A 3EGXC 4S2OA 5G4YA 4BL2A 3C7UA 4Y17A 1L0GA 4FCFA 2J9PA 3C4PA 4H6JA 1T1CA 1XFNA 4DRTA 2ZL1B 1RGZA 2VKSA 3MXRA 4K91A 1YLJA 5GHYA 4BWIA 2PBYA 2H28A 4K08A 3OPPA 4QB8A 3Q07A 1ZKJA 1FCOA 1EI5A 4OPZA 3LY3A 4HOIA 4NK3A 1Y28A 3N6IA 3CZDA 2VZWA 4E3KA 5E2FA 2Y4AA 1XA1A 4L9EA 5F1FA 1PI4A 1JTGA 5FAQA 4DF6A 1BYWA 1OTBA 4N1XA 4KZ5A 3KSFA 1KDWA 3TE8A 2DNSA 2V8CA 3G32A 2XSSA 5EVEA 5IU1A 3S7QA 1TVFA 2Z2LB 2HGVA 5L07A 3HBRA 2P7JA 1OT6A 2O9AA 3SZTA 5AQ9A 2EWWA 3BYDA 3GSGA 1BUEA 3PBOA 1OTIA 4E3JA 2Y2OA 5EVID 4Y0OA 2V0UA 3BEBA 2H10A 3D9YA 1GSWA 2NUTC 4O01A 4B93A 3B42A 2K7SA 4X68A 3LEQA 3IWQA 4P6BA 3CWFA 3LR3A 3MQQA 4C75A 4BJPA 3BM6A 3FKWA 3U2AA 2XA7M 4LRYC 4PM5A 3I7JA 1MXOA 1YMXA 1PNEA 2W3HA 3K3DA 4NXFA 3LR4A 4KG6A 3E2KA 1S66L 2LB5A 4S2KA 4F3LB 1FSYA 3IF6C 4R4RA 3SW1A 3MSHA 1JNUA 4S2NA 4GW9A 3LIDA 3VOZA 2CMNA 1N9OA 3N8LA 2P9VA 3LFVA 2L1MA 5FDSA 3ZG9B 2IWCA 4LGWA 1MY8A 3IS2B 1UGUA 1LI9A 1VETB 4GDNA 5FQQA 1K56A 4G3VA 2W1TB 3R7WA 1ODVA 2HDSA 3BY9A 4OLDA 3HLGA 2ZMFA 4X69A 4D2OA 2PYPA 3HJKA 4E6WA 3HCYA 5J3WA 2PYRA 3RJUA 5HPFA 1X0OA 2VEAA 3LCEA 4NG2A 4OQ0A 2VV8A 2Y2JA 2ZC7A 3C38A 3OCNA 4WMCD 2PBDP 3MFDA 1PWCA 2KLIA 3HLBA 3SS3A 2RL3A 2PT7A 3SOIA 5CECA 4Y2FA 3EGDC 3H9WA 3VMAA 2WAFA 2LB9A 3FZCA 3N7WA 5FSRA 1XJ6A 1PFLA 3OOVA 4GHIA 4CLCA 1J9MA 5E2EA 5AVFA 4Z1WA 2OAQ1 4WF0A 3E4QA 3VV4A 4U3TA 3VP0A 3PTEA 2P74A 2HJ9C 1N4OA 5D3OA 1OT9A 3SH9A 2QPNA 1FSWA 1GHIA 3HUNA 3EEHA 4HEFA 5E2HA 2VGJA 5HAIA 4ZDXA 3LEZA 1S0WA 3BRMA 1PZPA 1DJCA 5FI7A 2Y59A 3E4OA 2Y55A 4EBNA 3RFBA 1HLUP 1FR6A 3T1RA 4E3IA 2EX6A 4MBKA 2QJ7A 2W27A 3V39A 1JWPA 2OLVA 2VX8A 4EESA 4NXGA 5M19A 3GRJA 3E2LA 3JVVA 1A0KA 4CJNA 1QMFA 4X55A 1O7EA 2XA7S 1K57A 4P87A 3UE0A 1GHMA 1Y54A 2JKRI 5A93A 4HJ4A 3LIFA 1PW8A 2Z6DA 1L0DA 1GSVA 3UPPA 4RYEA 5TFQA 1YLTA 4GZBA 1IYQA 3GQZA 3GVBA 3UB7A 1JWVA 3UB5P 3JPUA 1YAXA 2L0WA 3D72A 2Y8HA 3MXSA 4N9KA 3KO6A 4LV1A 2DRWA 3WS1A 5TBMB 4EEPA 1AXBA 1P0ZA 2VLGA 3NJAA 3W4OA 1JWZA 3DW0A 1K6RA 1I2SA 4HH2A 4X53A 3V3SA 4EBLA 5L09A 5DKKA 1U60A 3SH7A 3MQOA 3G34A 4PPRA 5EVIA 3G30A 3C2WA 3O88A 5HSQA 2QZ6A 4FD8A 2PAVP 4MBFA 3E98A 3V5MA 1L2SA 1BTLA 1Q2QA 1XFQA 4EBPA 3R4KA 1P97A 4KZBA 4EETB 4OLGA 3MZFA 3DTMA 1KGFA 3HLCA 4FTXA 1ES5A 1OJ5A 1TF1A 2ZJ9A 1ERQA 3BW6A 1SDEA 3VOYA 4UAAA 2Q9MA 1VETA 5JYPA 3A0VA 3G6OA 1HVBA 5E43A 1E4DA 1LSWA 2XH9A 1TD5A 2J8YA 2J80A 5EVLA 3JVUA 4D60A 5J8XA 5DTSA 4NETA 1KVMA 3TRCA 2Y2QA 4IVKA 4HIAA 3AGEA 3EOIA 4E3NA 1IYOA 2YKHA 3FG8A 4BL3A 5GLAA 4O7DA 3A0SA 4KUKA 1OJGA 2P08A 3ZFZA 2W3DA 2EA9A 3C8CA 4WMCA 1IELA 1KOUA 4EEUA 5M18A 3W4QA 1DJAA 1ES4A 1CI8A 1D7EA 3LIBA 4Y15A 3UE6A 4X56A 2QYBA 4E3LA 5HAQA 3T4SA 5TGFA 3BJNA 1MWUA 3NCKA 2QJ5A 4BMWA 4E3OA 1SKFA 1W8QA 3B3XA 2VV6A 1K25A 2P9VB 3NOUC 4OP8A 1JTDA 4IBXA 3LO7A 1SKOA 5L2FA 1ES3A 4JKTA 4OQGA 3QP1A 2D01A 2JBFA 2ACGA 3R7WB 4DJ3A 5A91A 4EQIA 5DJTA 1MWTA 5EOEA 2Y2GA 2EX9A 2ZBBA 3KSIA 3VFHA 1M40A 5F68A 5KSCA 3V50A 3QP8A 2ZC4B 2ZOHA 2VK3A 3BQ8A 3T1XA 2JKRM 4WEKA 1W79A 4UEYA 3VSLA 3KYZA 1PI5A 5DFYA 5FEGA 1I2WA 4JXGA 3CLOA 3UDIA 5TJJA 4N9LA 3WS2A 1IKGA 1PWGA 2Z6CA 3W4PA 4LFUA 4R23A 1OPXA 2HV1A 2JKTI 2O0YA 3G4PA 1D1JA 3C7VA 4CLCB 4EWFA 3CUEA 1DY6A 1F2KA 3BLMA 1C3BA 4I3JA 1NRJA 3P98A 5EM0A 2A24A 2V2FF 3VP4A 4KZ6A 1HD8A 2J3TC 4KG2A 4JBFA 4P6ZM 2ZLYA 3ZDJA 3LUQA 3TG9A 2R9XA 5GLBA 4GCZA 1XPBA 3OPLA 4R1GA 5IS1A 4JGOA 4Y0UA 2O9BA 4UA7A 3VP3A 4I5SA 4QY5A 4DE3A 1CQAA 1YKDA 3MKFA 1LHYA 3Q81A 5EV0A 2GX5A 3Q82A 1IOUA 4BLMA 3ITBA 3ZNTA 3D3OA 3B47A 1G5UA 4M3KA 4OP5A 2G7UA 4WEJA 1K0KA 4KZ7A 3FYZA 2OWHA 3WRTA 4DN0A 3V3RA 2BTFP 3PBQA 1SCWA 1FQGA 1KVLA 3G2YA 2XROA 5CERA 4DXBA 3T1SA 2I72A 2WGWA 3QNBA 3SH8A 5GHZA 3IBJA 5CGSA 1HTZA 2WGVA 1YPRA 1JVJA 1GCEA 3IHAA 1H8YA 4MEZA 4ZJ2A 1LLBA 4RA7A 4KQOA 2IA2A 2ZMVA 5FQKA 3KSHA 5M1AA 1F98A 4ZAMA 1XGIA 1NY0A 4MN7A 3H7WA 2XDMA 4IEDA 2ZQCA 3DTIA 2Y2IA 1FIKA 3BECA 4JXWA 4OPQA 4B88A 3VE4A 5EVIB 4GD6A 2D02A 1PYYA 4YWZA 5IHVA 5HFOA 2ZM8A 5J4EA 1ZG4A 5DF7A 3UB8A 1CK3A 3VP1A 1LSXA 5F69A 1SDNA 2Y2LA 4KG5A 3BFEA 2WZXA 3MKEA 1MBLA 3N4IA 4KQDA 1ONHA 3IX4A 4R6LA 3IH8A 3IXBA 3UB9A 4Q0HA 1S4SA 3GMWA 4I3AA 1YLPA 1YSPA 4CLCC 3UDXA 2VGLM 4MN6A 1V9YA 3S22A 3PYPA 4P6ZS 3T50A 4I39A 3F1PA 3NIAA 3IHBA 4HHDA 4EXOA 2XD1A 2ZQ7A 4EU0A 2V1BA 3A0RA 1YLWA 3A3DA 2JE5A 5HZHA 4LCMA 2B5RA 4S2IA 5KMWA 4NXEA 5AQAA 1YSQA 2DMWA 3LIAA 1L3LA 5CHJA 4U0TA 1ZHHB 4JXSA 5DF8A 4YNRA 4JGRA 2A49A 5CEBA 2C5WB 1ERMA 2JKTM 4WZ4A 3DBAA 3DWZA 2Y79A 3QNCA 4PKYG 3CMZA 2HP6A 1KE4A 2W3EA 3LIEA 3S4XA 1BLCA 1WA9A 4DDSA 2QWSA 2WK0A 5F6AA 4MNRA 1YMSA 1BLHA 5CTMA 1FILA 4R3JA 4ME4A 1YM1A 1K57C 4FH2A 1PWDA 1M6KA 3GR2A 1LT0A 4R0QA 5HD3A 4R70A 3CPTA 3PAGA 5HDSA 2QMIA 4ARZA 2HDUA 1BT5A 2XQZA 4HBUA 5AQ7A 4WZ5A 1SKOB 3LICA 3U4LP 4KUOA 3MXQA 4LV3A 4L0LA 1VHMA 1VM1A 5A90A 2K2NA 1H0MA 2Q9NA 4OPYA 5DF9A 1AWIA 3F1NA 4HQAA 4BD1A 4BQMA 3OPRA 3EQVA 2PD8A 1XX2A 4KENB 2WAEA 4KZ9A 4I3IA 4OOYA 4LV0A 4R3BA 3C5AA 5EVIC 1TS6A 2Q0OA 1L0EA 2W3GA 4LLOB 3IXGA 2V1AA 3CI6A 4WM9A 3RXXA 4CQHA 3A3EA 4WELA 5EE8A 4BD0A 4ZBEA 3M2KA 1ESUA 2VGKA 4QY6A 4C3QA 1LSVA 3LGOA 2Y2NA 4ZTKA 4P85A 2ZQ9A 2KX6A 3NOPC 3IWOA 3HUMA 4DKIA 2A24B 3UB6A 3IH9A 2XF3A 3VP2A 2GZAA 3A3JA 4U0XA 2XK1A 2Y2HA 2NUPC 2X01A 3KYEA 3FPVA 2VGLS 4IHQA 2ZD8A 5I94A 3K2NA 1K6SA 2Y2MA 2H5SA 2Y91A 2ZC6B 1NWZA 3T12B 5FEFA 1MKMA 1DP8A 4DE0A 3FC7A 4Z9QA 2WKIA 3CITA 3ISGA 1NZOA 5KSHA 1VQQA 4JPMA 2KOIA 2JCHA 1YLZA 3FWLA 3FKVA 1Y4OA 5HWVA 2W1RA 4GKUA 3Q7ZA 4KZ8A 4R3AA 3ZG8B 1RCJA 2HP9A 1GA9A 2XD5A 3T4OA 3QP6A 3IXHA 3Q1FA 4S2PA 1G6AA 4OVDA 3WS0A 1W5DA 4G3WA 3ZG7B 2WGWB 2WYXA 2MJ6A 2JHEA 2E8IA 1EW0A 4FUWA 4MBHA 3GDIA 2X71A 3CJMA 5DTKA 4MMNA 1K4EA 3UE1A 3TSGA 1OTAA 1G6OA 4OOMA 4WLAA 5HDDA 4MN5A 5HPIA 2ZQAA 2JN7A 1MPLA 2YKFA 1J3WA 3PBSA 4EQ1A 5FL3A 3VSKA 4DMZA 3N8RA 1CI9A 4IUKA 1NLZA 4QU3A 3H7WB 3NC8A 4GNUA 2GDNA 2INWA 3OPHA 3T4TA 4XUZA 3LI8A 1NYMA 3MQ0A 5EOOA 2M1CA 3JYIA 4PM9A 2OOLA 1XJ3A 2EX2A 4BBTA 1PRQA 1GA0A 3DTKA 2PU2A 2V1ZA 5IT5A 3M6HA 4PMAA 4Y0TA 2WUQA 3P09A 2ZQDA 5FATA 4QWOA 2PR5A 4CLCE 2PR6A 5CX7A 1MZUA 1XGJA 1LL9A 1XXMA 5C5KA 1YQSA 3HJIA 2EWVA 1VEUA 1Q2PA 2FFFB 1GSXA 5L10A 5HAPA 2VA0A 1K55A 4Y7PA 4C6YA 3UNWA 4KZAA 2Y2PA 5DJUA 2EFXA 4JF6A 1K54A 5DKLA 3N8SA 3HLWA 1MWRA 2V20A 4AFIA 3CUEC 1UWPX 1E25A 2Y2KA 4E04A 1FCMA 2XGNA 3F1PB 4GS9A 4S2LA 4JGPA 3PBNA 1ONGA 3TJZC 1Z09A 2WKRA 1O07A 2ZC3B 5CHMA 1KGGA 4K0WA 3SS5A 4RQ9A 4II7A 1L0FA 2OSUA 2XR0A 3P01A 4A5RA 3O5YA 2ZM0A 1PZOA 5HW3A 4L9GA 4KQQA 5KIZA 3E0YA 3IQAA 5CXWA 3W8KA 5FAPA 2WKPA 3BWLA 2BLSA 5CTNA 4WN5A 3CHWP 5A92A 2R78A 4OONA 3IF6B 4JF4A 2EXAA 2K31A 2FH5A 5U47A 4WUJA 1BLPA 2OAP1 5CGXA 4DE2A 2PU4A 4EUZA 3KX0X 5G4ZA 4H8RA 2OLUA 3PXPA 4ZJ1A 1NXYA 3CPTB 1W63Q 5GL9A 4YINA 3Q7VA 1FR1A 1BZAA 3HLFA 5F83A 4DDYA 4ARZB 4X6TA 3NECA 3NULA 4HP9A 1E3UD 4FOFA 3LI9A 1KGEA 2V8FA 3L7HA 2VJWA 5F82A 3ZG0A 4B4ZA 4GJ4A 4Y3IA 3PR6A 2C6WB 5J7EA 2WZZA 4Q8IA 3LR0A 3O86A 3SS4A 1YT4A 3F1NB 4B4XA 4XT2A 2EXBA 3VOLA 3HVFA 5K5BA 4HY8A 5FDHA 4GLQA 3AGFA 2PDRA 5FQIA 3G35A 1STZA 3RXWA 3F1OA 4S2MA 5LBRA 2H0YA 3NDEA 4GOGA 1NRFA 1H3QA 4YFMA 3ICYA 3S7PA 3UPNA 3CG5A 4KZ3A 3T4JA 4RVAA 5FQJA 4GB7A 1ZTUA 3O87A 3UDFA 3IWIA 4S2NC 4JLFA 4N1HA 4QHCA 4WBGA 5I5LA 4X1MA 1CF0A 1XA7A 3M6BA 2V0WA 2L4RA 1TEMA 1MKIA 1S6RA 3CAXA 3ZCZA 4PM7A 1G68A 2BG1A 2AVXA 2CC1A 1F5MA 3K3CA 3OBFA 2XEPA 4KQRA 3HLEA 4YOFA 2XFTA 5HD5A 3OZHA 4ID4A 5EFWA 2JKGA 4UHUA 2WADA 4OKPA 1TS7A 3H82A 3IF5A 4R4SA 4UA9A 3DAVA 4O8GA 4B9OA 3LY4A 4PM8A 3KSGA 3ITAA 4I38A 1T18A 4OQIA 2FFYA 4QPRA 4EUVA 1IEMA 3EQUA 1S67L 2RCXA 4HESA 3MF0A 3C30A 1IKIA 1W63M 4IJGA 3BLSA 3VFFA 4BBVA 1S1ZA 3PBTA 4DE1A 1WYBA 2WKQA 3G2ZA 5HL6A 1H8MA 3IBRA 4ZRRA 5FASA 2Z2MB 1S4RA 4BENA 2I9VA 4HNBA 1KDSA 1D06A 4BBUA 3DWKA 5FQMA 5FA7A 2HPBA 3GTCA 4ZJ3A 2W3FA 1BSGA 3ZQ5A 1BULA 1XJ2A 3MS6A 4NXBA 5E2GA 2HP5A 2XFSA 4WZ5C 3D4FA 4ETZA 1CJFA 2IWBA 4KZ4A 1I5QA 4HP4A 1ALQA 1XKZA 3B33A 5MC7A 4EW7A 1FOFA 4E3MA 3PBRA 4MCWA 5EPHA 2GJ3A 1DRMA 3IF6A 3IXDA 3BY8A 5GLCA 5FI6A 3EWKA 1H5XA 1N9LA 5FI2A 2ZQ8A 3MMHA 1EROA 3KYQA 3WWXA 1GHPA 2P04A 4MDZA 2J3WA 1VEUB 1XP4A 1ZC2A 2PRFA 4HI4A 1LL5A 1T1BA 3W2ZA 3EEAA 3UPOA 2EX8A 3QP2A 3V67A 4QJGA 3O3VA 2H0TA 2X02A 3A3IA 4HJ3A 4PM6A
chains in the Genus database with same CATH topology
3CLOA 4G3WA 5TJJA 3CWFA 2MJ6A 3LR3A 3MQQA 2BASA 2Z6CA 2JHEA 4GS9B 1EW0A 1OPXA 2HV1A 3GDIA 4BJPA 2JKTI 2O0YA 3U2AA 2XA7M 4LRYC 4MMNA 2A2LA 2B02A 4CLCB 3BQAA 1OTAA 1G6OA 3CUEA 4OOMA 4WLAA 5HDDA 4MN5A 5HPIA 2JN7A 1S1YA 2YKFA 4I3JA 2W3HA 1NRJA 3K3DA 2V9AA 4NXFA 3PBSA 3LR4A 2A24A 4EQ1A 3MFXA 1S66L 2LB5A 4O0PA 5FL3A 4F3LB 3S7NA 4Y5FA 4DMZA 1F9IA 2J3TC 4IUKA 3SW1A 1NLZA 3H7WB 5HWTA 4P6ZM 1JNUA 2INWA 4GW9A 3LIDA 3T4TA 2CMNA 1LL8A 3LUQA 4ETXA 3LI8A 3T4KA 1N9OA 3MQ0A 3OCLA 3RTYA 2M1CA 4LPZA 3LFVA 4GCZA 2L1MA 2OOLA 1XJ3A 5IS1A 4JGOA 4BBTA 2O9BA 4I5SA 3IS2B 2XRNA 1UGUA 1YKDA 5IT5A 5F5YA 4UQIM 2PR5A 2GX5A 4CLCE 2PR6A 4G3VA 2W1TB 5CX7A 3R7WA 1IOUA 1ODVA 1MZUA 3BY9A 2ZMFA 2HJEA 5C5KA 2PYPA 3HJIA 3HJKA 3D3OA 2EWVA 3B47A 2ZOIA 1GSXA 3HCYA 4Q0JA 5J3WA 2PYRA 2G7UA 4WEJA 2VA0A 5HPFA 1X0OA 1DP9A 2VEAA 2OWHA 4FSFA 2QKPA 2FZ0A 4DN0A 2VV8A 2W0NA 5DJUA 3C38A 4LRXC 3OCNA 3PBQA 5DKLA 2KLIA 3LR5A 4H6JB 4AFIA 2XROA 3CUEC 1UWPX 2PT7A 3LYXA 4Y2FA 3EGDC 4PKYA 3H9WA 4E04A 4XT2B 3F1PB 2LB9A 3IBJA 3OC2A 4GS9A 4JGPA 3PBNA 1XJ6A 3OOVA 3TJZC 2WKRA 4GHIA 4CLCA 4RQ9A 5AVFA 4Z1WA 4II7A 4KQOA 2IA2A 2ZMVA 2OAQ1 3P01A 4WF0A 3E4QA 3F1OB 3ULFA 3O5YA 3KSHA 1OTEA 3VV4A 1F98A 1MC0A 2VV7A 4F3LA 4L9GA 2HJ9C 2J3TD 1OT9A 5KIZA 3E0YA 4MN7A 3H7WA 2M7UA 3PHYA 3EEHA 2WKPA 3BWLA 3VE4A 4WN5A 2R78A 3NHQA 2D02A 4YWZA 2K31A 4PAUA 2FH5A 3IS2A 4WUJA 5J4EA 3UB8A 2OAP1 4G3KA 1LSXA 2PHYA 3E4OA 5F69A 3RFBA 3KX0X 5G4ZA 3S7OA 2W1TA 3PXPA 2QJ7A 2W27A 4LRZE 4OOLA 3UMDA 2VX8A 4EESA 4NXGA 4KQDA 3UE3A 1W63Q 3JVVA 1P9WA 4R6LA 4ARZB 4NEED 2XA7S 4HP9A 4FOFA 1OTDA 4EERA 3LI9A 3UB9A 2VJWA 4GJ4A 5DFXA 4Q0HA 1S4SA 4I3AA 4Y3IA 1YSPA 3PR6A 2OWJA 3H82B 5HDCA 4CLCC 2JKRI 5J7EA 4M4XA 4HJ4A 3LIFA 3NOTC 1IFQA 2Z6DA 1V9ZA 2VGLM 1GSVA 3LR0A 4MN6A 1V9YA 3F1NB 4XT2A 3UB7A 3PYPA 4P6ZS 3T50A 1TS0A 3VOLA 4I39A 3F1PA 5K5BA 1YAXA 2L0WA 3D72A 2Y8HA 4HY8A 3UMEA 4HHDA 1UWNX 3KO6A 4EXOA 4R38A 4EU0A 4GLQA 4HJ6A 5TBMB 2V1BA 5A8BA 2PDRA 3A0RA 4Q0IA 1VB6A 4EEPA 1STZA 5HZHA 1P0ZA 3F1OA 4NXEA 2VLGA 3NJAA 5LBRA 3E4PA 1YSQA 2DMWA 4L9FA 2B18A 3LIAA 3MR0A 2KDKA 4HH2A 4UQIS 1ZHHB 4YNRA 1H3QA 4JGRA 2HF6A 5L8MA 5DKKA 3ICYA 3MJQA 3S7PA 2JKTM 2O9CA 3DBAA 3OLOA 2Y79A 4PKYG 3MQOA 5AVEA 3T4JA 1P9RA 2W3EA 3LIEA 3TW8A 3C2WA 4DJ2A 1WA9A 1ZTUA 2QWSA 5HSQA 1TS8A 5F6AA 1T19A 1NLYA 4ME4A 4IUHA 5I5LA 3E98A 1XFQA 3R4KA 2V0WA 1P97A 4EETB 2L4RA 3P7NA 1LT0A 3CAXA 5HD3A 4R70A 3ZYTA 1F5MA 3K3CA 3VE3A 5HDSA 3OBFA 4ARZA 4JGQA 2QHKA 4YOFA 1OJ5A 2PD7A 3LICA 5HD5A 1TF1A 4KUOA 3MXQA 4L0LA 1VHMA 1DP6A 4PHTA 5EFWA 2GNXA 4HH3A 4CLCD 3BW6A 1TS7A 3H82A 2K2NA 3T4QA 3FPWA 4O8GA 4B9OA 5HWWA 5AJGA 1XJ4A 3A0VA 2O99A 3G6OA 3KSGA 4I38A 1LSWA 1T18A 5DF9A 1TD5A 4QPRA 2M7VA 3F1NA 4HQAA 2J80A 4EUVA 3JVUA 3EQVA 2PD8A 3EQUA 1S67L 4GHIB 3GECA 1G28A 3MF0A 3C30A 4NKPA 4WL9A 3RH8B 4I3IA 3TRCA 1W63M 5TBMA 4HIAA 4IJGA 3EOIA 1T1AA 4BBVA 1S1ZA 3T4LA 3PBTA 1N9NA 2YKHA 1TS6A 3FG8A 3EGXC 5G4YA 2WKQA 5HL6A 1H8MA 2W3GA 4LLOB 3A0SA 4H6JA 3IBRA 1T1CA 1XFNA 2V1AA 4ZRRA 3CI6A 4KUKA 2VKSA 4BWIA 4CQHA 1OJGA 1S4RA 4WELA 2H28A 2I9VA 4K08A 2P08A 4HNBA 2W3DA 2EA9A 1D06A 4BBUA 3C8CA 1LSVA 1KOUA 2W3FA 4EEUA 4HOIA 2KX6A 3NOPC 3ZQ5A 1XJ2A 1Y28A 1D7EA 2A24B 3LIBA 4NXBA 3UB6A 2GZAA 2VZWA 3UE6A 2QYBA 4L9EA 2NUPC 4ETZA 3FPVA 2VGLS 3T4SA 3BJNA 1BYWA 1OTBA 2QJ5A 4IHQA 4BMWA 3KSFA 4HP4A 3B33A 5MC7A 3TE8A 4EW7A 2VV6A 3K2NA 2XSSA 3NOUC 3PBRA 4MCWA 5IU1A 3S7QA 1NWZA 2GJ3A 1MKMA 1DP8A 1DRMA 3FC7A 3BY8A 3CITA 3EWKA 2HGVA 1N9LA 5KSHA 2D01A 2P7JA 3MMHA 1OT6A 2KOIA 3R7WB 2O9AA 4DJ3A 3KYQA 5DJTA 2EWWA 2P04A 4MDZA 2J3WA 5HWVA 3KSIA 2ZBBA 5F68A 2W1RA 4R3AA 3PBOA 4HI4A 1T1BA 1OTIA 2ZOHA 2V0UA 3W2ZA 3BQ8A 3EEAA 2JKRM 4WEKA 3T4OA 3V67A 1GSWA 2NUTC 4UEYA 3KYZA 4O01A 4B93A 5DFYA 3B42A 2K7SA 4HJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLO A;  3CWF A;  3MQQ A;  2BAS A;  2Z6C A;  2JHE A;  4GS9 B;  1EW0 A;  2HV1 A;  3GDI A;  4LRY C;  2B02 A;  1OTA A;  4WLA A;  5HDD A;  4MN5 A;  2JN7 A;  1S1Y A;  2YKF A;  4I3J A;  3K3D A;  2V9A A;  4NXF A;  2A24 A;  4EQ1 A;  3MFX A;  1S66 L;  4F3L B;  1F9I A;  3SW1 A;  3H7W B;  5HWT A;  1JNU A;  2INW A;  4GW9 A;  3LID A;  2CMN A;  1LL8 A;  3LUQ A;  3LI8 A;  1N9O A;  3RTY A;  2M1C A;  4LPZ A;  4GCZ A;  2L1M A;  2OOL A;  1XJ3 A;  5IS1 A;  4JGO A;  4BBT A;  4I5S A;  3IS2 B;  1UGU A;  5F5Y A;  2PR5 A;  2PR6 A;  1ODV A;  1MZU A;  3BY9 A;  2PYP A;  3HJI A;  3HJK A;  2ZOI A;  1GSX A;  5J3W A;  2PYR A;  1X0O A;  1DP9 A;  2VEA A;  2OWH A;  2QKP A;  2VV8 A;  2W0N A;  5DJU A;  4LRX C;  5DKL A;  4H6J B;  1UWP X;  3LYX A;  4PKY A;  3H9W A;  4E04 A;  4XT2 B;  3F1P B;  4GS9 A;  4JGP A;  1XJ6 A;  2WKR A;  4GHI A;  4RQ9 A;  5AVF A;  4WF0 A;  3E4Q A;  3F1O B;  3ULF A;  1OTE A;  1F98 A;  2VV7 A;  4F3L A;  4L9G A;  1OT9 A;  5KIZ A;  3H7W A;  3PHY A;  3EEH A;  2WKP A;  3BWL A;  3VE4 A;  4WN5 A;  2R78 A;  3NHQ A;  2D02 A;  4YWZ A;  3IS2 A;  4WUJ A;  5J4E A;  3UB8 A;  1LSX A;  2PHY A;  3E4O A;  5F69 A;  3KX0 X;  5G4Z A;  2QJ7 A;  2W27 A;  4LRZ E;  3UMD A;  4EES A;  4NXG A;  4KQD A;  4R6L A;  4HP9 A;  1OTD A;  4EER A;  3LI9 A;  3UB9 A;  1S4S A;  4I3A A;  2OWJ A;  3H82 B;  5HDC A;  5J7E A;  4M4X A;  4HJ4 A;  3LIF A;  3NOT C;  2Z6D A;  1V9Z A;  1GSV A;  4MN6 A;  1V9Y A;  3F1N B;  4XT2 A;  3UB7 A;  3PYP A;  3VOL A;  3T50 A;  1TS0 A;  4I39 A;  3F1P A;  2L0W A;  3D72 A;  4HY8 A;  3UME A;  4HHD A;  1UWN X;  4EXO A;  4R38 A;  4HJ6 A;  5TBM B;  5A8B A;  2V1B A;  2PDR A;  3A0R A;  1VB6 A;  4EEP A;  5HZH A;  1P0Z A;  3F1O A;  4NXE A;  2VLG A;  3NJA A;  3E4P A;  4L9F A;  3LIA A;  3MR0 A;  2KDK A;  4HH2 A;  4JGR A;  5DKK A;  3ICY A;  3MJQ A;  3OLO A;  4PKY G;  3MQO A;  5AVE A;  3LIE A;  3C2W A;  4DJ2 A;  1WA9 A;  2QWS A;  5HSQ A;  1TS8 A;  5F6A A;  1T19 A;  5I5L A;  1XFQ A;  2V0W A;  1P97 A;  4EET B;  2L4R A;  3P7N A;  1LT0 A;  3CAX A;  5HD3 A;  4R70 A;  3K3C A;  3VE3 A;  5HDS A;  4JGQ A;  2QHK A;  1OJ5 A;  2PD7 A;  3LIC A;  5HD5 A;  4KUO A;  3MXQ A;  5EFW A;  1DP6 A;  4HH3 A;  1TS7 A;  3H82 A;  4B9O A;  5HWW A;  1XJ4 A;  3A0V A;  3G6O A;  4I38 A;  1LSW A;  1T18 A;  3F1N A;  4HQA A;  2J80 A;  2PD8 A;  1S67 L;  4GHI B;  3GEC A;  1G28 A;  4WL9 A;  3RH8 B;  4I3I A;  5TBM A;  4HIA A;  1T1A A;  4BBV A;  1S1Z A;  1N9N A;  2YKH A;  1TS6 A;  3FG8 A;  5G4Y A;  2WKQ A;  4LLO B;  3A0S A;  4H6J A;  3IBR A;  1T1C A;  1XFN A;  2V1A A;  4KUK A;  1OJG A;  1S4R A;  2H28 A;  2I9V A;  4K08 A;  4HNB A;  2EA9 A;  1D06 A;  4BBU A;  3C8C A;  1LSV A;  1KOU A;  4EEU A;  4HOI A;  2KX6 A;  3NOP C;  3ZQ5 A;  1XJ2 A;  1Y28 A;  1D7E A;  2A24 B;  3LIB A;  4NXB A;  3UB6 A;  3UE6 A;  4L9E A;  1BYW A;  1OTB A;  2QJ5 A;  4HP4 A;  3B33 A;  4EW7 A;  2VV6 A;  3NOU C;  5IU1 A;  1NWZ A;  2GJ3 A;  1DP8 A;  1DRM A;  3FC7 A;  3BY8 A;  3EWK A;  1N9L A;  2D01 A;  2P7J A;  1OT6 A;  4DJ3 A;  5DJT A;  5HWV A;  2ZBB A;  5F68 A;  4R3A A;  4HI4 A;  1T1B A;  1OTI A;  2ZOH A;  2V0U A;  1GSW A;  2K7S A;  4HJ3 A; 
#chains in the Genus database with same CATH topology
 2ZL1 A;  2BAS A;  1E3U A;  4GS9 B;  2HDR A;  4MLL A;  3MZD A;  1H8Z A;  2A2L A;  2B02 A;  3BQA A;  3IX8 A;  3BFD A;  3ZVW A;  3IT9 A;  1S1Y A;  4GDB A;  1EWZ A;  1PIO A;  2V9A A;  5GHX A;  3FV7 A;  2UWX A;  3MFX A;  4O0P A;  1W7F A;  3S7N A;  3HRE A;  4Y5F A;  1F9I A;  3S1Y A;  2HZ5 A;  5HWT A;  2UV0 E;  1LL8 A;  3HUO A;  1K4F A;  4ETX A;  1CEG A;  3T4K A;  2J9O A;  3OCL A;  3RTY A;  3NY4 A;  5GLD A;  4LPZ A;  1NJ4 A;  3ZHH A;  2XRN A;  3T1Q B;  5JYO A;  5F5Y A;  5HX9 A;  4UQI M;  3WS5 A;  4LEN A;  5FQ9 A;  2HJE A;  3MBZ A;  4JF5 A;  3ZNY A;  3Q7V B;  1W8Y A;  1PW1 A;  2ZOI A;  5HAR A;  3GV9 A;  4Q0J A;  1Z6F A;  5HL1 A;  1DP9 A;  3NDG A;  4FSF A;  3QP4 A;  2QKP A;  2FZ0 A;  4IVI A;  2W0N A;  3MZE A;  4LRX C;  3IX3 A;  3LR5 A;  4H6J B;  3QHY A;  3LYX A;  4PKY A;  4XT2 B;  1BLS A;  4QD4 A;  3OC2 A;  2EFU A;  5CGW A;  4RX2 A;  1FCN A;  3BFG A;  5DTT A;  2E8J A;  2G2U A;  4JXV A;  1DJB A;  3WRZ A;  3NBL A;  4S2J A;  3F1O B;  3ULF A;  1OTE A;  4IBR A;  4LV2 A;  3L9K A;  1MC0 A;  4RX3 A;  2OV5 A;  1CEF A;  2VV7 A;  1HZO A;  4F3L A;  5KZH A;  2J3T D;  4OPR A;  1RP5 A;  3QP5 A;  2B95 A;  1KE0 A;  2M7U A;  3PHY A;  5DVA A;  3BFF A;  5G18 A;  4E6X A;  1N9B A;  4GD8 A;  3HL9 A;  1KE3 A;  3NHQ A;  2DCF A;  1MWS A;  5AQB A;  4PAU A;  3IS2 A;  3UO9 A;  2HDQ A;  4G3K A;  1YLY A;  1K55 C;  2PHY A;  1SHV A;  3S7O A;  2W1T A;  2G2W A;  3C4O A;  1K54 C;  5EEC A;  3ZGA B;  4LRZ E;  4OOL A;  3UMD A;  4LCL A;  3UE3 A;  1ACF A;  1P9W A;  2XLN A;  4NEE D;  1OTD A;  4EER A;  1WYC A;  5DFX A;  1RGY A;  1SZV A;  3UY6 A;  2OWJ A;  3H82 B;  5HDC A;  4M4X A;  3TOI A;  3NOT C;  1QME A;  1IFQ A;  3A3F A;  1V9Z A;  3UN7 A;  1K38 A;  1TS0 A;  3ZG5 A;  3DTE A;  4WYY A;  3UME A;  1UWN X;  1OME A;  4R38 A;  4HJ6 A;  5A8B A;  4Q0I A;  1VB6 A;  1ZG6 A;  3E4P A;  4L9F A;  2B18 A;  3MR0 A;  2KDK A;  5F1G A;  4UQI S;  4P0M A;  5L8M A;  2HF6 A;  1WE4 A;  3MJQ A;  4OH0 A;  5EM1 A;  2O9C A;  3OLO A;  4HBT A;  4F94 A;  3M2J A;  5AVE A;  1IYS A;  4Y13 A;  1ES2 A;  1P9R A;  1K56 D;  2ZMA A;  5EUA A;  3TW8 A;  2JKF A;  4DJ2 A;  5CED A;  4N92 A;  1TS8 A;  1T19 A;  4EV4 A;  1NZU A;  4X1L A;  3WS4 A;  1NLY A;  4DXC A;  3PAE A;  4IUH A;  2ZM2 A;  5FAO A;  4XXR A;  2IWD A;  4CPK A;  3P7N A;  1ESI A;  4XUX A;  3BFC A;  3ZVT A;  3ZYT A;  3VE3 A;  2WKE A;  4JGQ A;  2QHK A;  2PD7 A;  4GN2 A;  4UA6 A;  3G31 A;  3NI9 A;  4OQH A;  5BOH A;  1DP6 A;  4PHT A;  2GNX A;  3AGD A;  1IYP A;  4HH3 A;  4CLC D;  2WGI A;  3T4Q A;  3FPW A;  2A3U A;  5HWW A;  5AJG A;  1XJ4 A;  5CHU A;  2O99 A;  4ESP A;  2M7V A;  2J7V A;  5CRF A;  2ZC5 B;  1TDL A;  1TDG A;  4GHI B;  1LI0 A;  4X25 A;  3GEC A;  1G28 A;  4NKP A;  4WL9 A;  3RH8 B;  5TBM A;  4K0X A;  3HLD A;  5TR7 A;  1T1A A;  2R9W A;  3T4L A;  2WKH A;  1NYY A;  1N9N A;  4FH4 A;  2JC7 A;  3EGX C;  4S2O A;  5G4Y A;  4BL2 A;  3C7U A;  4Y17 A;  1L0G A;  4FCF A;  2J9P A;  3C4P A;  4H6J A;  1T1C A;  1XFN A;  4DRT A;  2ZL1 B;  1RGZ A;  2VKS A;  3MXR A;  4K91 A;  1YLJ A;  5GHY A;  4BWI A;  2PBY A;  2H28 A;  4K08 A;  3OPP A;  4QB8 A;  3Q07 A;  1ZKJ A;  1FCO A;  1EI5 A;  4OPZ A;  3LY3 A;  4HOI A;  4NK3 A;  1Y28 A;  3N6I A;  3CZD A;  2VZW A;  4E3K A;  5E2F A;  2Y4A A;  1XA1 A;  4L9E A;  5F1F A;  1PI4 A;  1JTG A;  5FAQ A;  4DF6 A;  1BYW A;  1OTB A;  4N1X A;  4KZ5 A;  3KSF A;  1KDW A;  3TE8 A;  2DNS A;  2V8C A;  3G32 A;  2XSS A;  5EVE A;  5IU1 A;  3S7Q A;  1TVF A;  2Z2L B;  2HGV A;  5L07 A;  3HBR A;  2P7J A;  1OT6 A;  2O9A A;  3SZT A;  5AQ9 A;  2EWW A;  3BYD A;  3GSG A;  1BUE A;  3PBO A;  1OTI A;  4E3J A;  2Y2O A;  5EVI D;  4Y0O A;  2V0U A;  3BEB A;  2H10 A;  3D9Y A;  1GSW A;  2NUT C;  4O01 A;  4B93 A;  3B42 A;  2K7S A;  4X68 A;  3LEQ A;  3IWQ A;  4P6B A;  3CWF A;  3LR3 A;  3MQQ A;  4C75 A;  4BJP A;  3BM6 A;  3FKW A;  3U2A A;  2XA7 M;  4LRY C;  4PM5 A;  3I7J A;  1MXO A;  1YMX A;  1PNE A;  2W3H A;  3K3D A;  4NXF A;  3LR4 A;  4KG6 A;  3E2K A;  1S66 L;  2LB5 A;  4S2K A;  4F3L B;  1FSY A;  3IF6 C;  4R4R A;  3SW1 A;  3MSH A;  1JNU A;  4S2N A;  4GW9 A;  3LID A;  3VOZ A;  2CMN A;  1N9O A;  3N8L A;  2P9V A;  3LFV A;  2L1M A;  5FDS A;  3ZG9 B;  2IWC A;  4LGW A;  1MY8 A;  3IS2 B;  1UGU A;  1LI9 A;  1VET B;  4GDN A;  5FQQ A;  1K56 A;  4G3V A;  2W1T B;  3R7W A;  1ODV A;  2HDS A;  3BY9 A;  4OLD A;  3HLG A;  2ZMF A;  4X69 A;  4D2O A;  2PYP A;  3HJK A;  4E6W A;  3HCY A;  5J3W A;  2PYR A;  3RJU A;  5HPF A;  1X0O A;  2VEA A;  3LCE A;  4NG2 A;  4OQ0 A;  2VV8 A;  2Y2J A;  2ZC7 A;  3C38 A;  3OCN A;  4WMC D;  2PBD P;  3MFD A;  1PWC A;  2KLI A;  3HLB A;  3SS3 A;  2RL3 A;  2PT7 A;  3SOI A;  5CEC A;  4Y2F A;  3EGD C;  3H9W A;  3VMA A;  2WAF A;  2LB9 A;  3FZC A;  3N7W A;  5FSR A;  1XJ6 A;  1PFL A;  3OOV A;  4GHI A;  4CLC A;  1J9M A;  5E2E A;  5AVF A;  4Z1W A;  2OAQ 1;  4WF0 A;  3E4Q A;  3VV4 A;  4U3T A;  3VP0 A;  3PTE A;  2P74 A;  2HJ9 C;  1N4O A;  5D3O A;  1OT9 A;  3SH9 A;  2QPN A;  1FSW A;  1GHI A;  3HUN A;  3EEH A;  4HEF A;  5E2H A;  2VGJ A;  5HAI A;  4ZDX A;  3LEZ A;  1S0W A;  3BRM A;  1PZP A;  1DJC A;  5FI7 A;  2Y59 A;  3E4O A;  2Y55 A;  4EBN A;  3RFB A;  1HLU P;  1FR6 A;  3T1R A;  4E3I A;  2EX6 A;  4MBK A;  2QJ7 A;  2W27 A;  3V39 A;  1JWP A;  2OLV A;  2VX8 A;  4EES A;  4NXG A;  5M19 A;  3GRJ A;  3E2L A;  3JVV A;  1A0K A;  4CJN A;  1QMF A;  4X55 A;  1O7E A;  2XA7 S;  1K57 A;  4P87 A;  3UE0 A;  1GHM A;  1Y54 A;  2JKR I;  5A93 A;  4HJ4 A;  3LIF A;  1PW8 A;  2Z6D A;  1L0D A;  1GSV A;  3UPP A;  4RYE A;  5TFQ A;  1YLT A;  4GZB A;  1IYQ A;  3GQZ A;  3GVB A;  3UB7 A;  1JWV A;  3UB5 P;  3JPU A;  1YAX A;  2L0W A;  3D72 A;  2Y8H A;  3MXS A;  4N9K A;  3KO6 A;  4LV1 A;  2DRW A;  3WS1 A;  5TBM B;  4EEP A;  1AXB A;  1P0Z A;  2VLG A;  3NJA A;  3W4O A;  1JWZ A;  3DW0 A;  1K6R A;  1I2S A;  4HH2 A;  4X53 A;  3V3S A;  4EBL A;  5L09 A;  5DKK A;  1U60 A;  3SH7 A;  3MQO A;  3G34 A;  4PPR A;  5EVI A;  3G30 A;  3C2W A;  3O88 A;  5HSQ A;  2QZ6 A;  4FD8 A;  2PAV P;  4MBF A;  3E98 A;  3V5M A;  1L2S A;  1BTL A;  1Q2Q A;  1XFQ A;  4EBP A;  3R4K A;  1P97 A;  4KZB A;  4EET B;  4OLG A;  3MZF A;  3DTM A;  1KGF A;  3HLC A;  4FTX A;  1ES5 A;  1OJ5 A;  1TF1 A;  2ZJ9 A;  1ERQ A;  3BW6 A;  1SDE A;  3VOY A;  4UAA A;  2Q9M A;  1VET A;  5JYP A;  3A0V A;  3G6O A;  1HVB A;  5E43 A;  1E4D A;  1LSW A;  2XH9 A;  1TD5 A;  2J8Y A;  2J80 A;  5EVL A;  3JVU A;  4D60 A;  5J8X A;  5DTS A;  4NET A;  1KVM A;  3TRC A;  2Y2Q A;  4IVK A;  4HIA A;  3AGE A;  3EOI A;  4E3N A;  1IYO A;  2YKH A;  3FG8 A;  4BL3 A;  5GLA A;  4O7D A;  3A0S A;  4KUK A;  1OJG A;  2P08 A;  3ZFZ A;  2W3D A;  2EA9 A;  3C8C A;  4WMC A;  1IEL A;  1KOU A;  4EEU A;  5M18 A;  3W4Q A;  1DJA A;  1ES4 A;  1CI8 A;  1D7E A;  3LIB A;  4Y15 A;  3UE6 A;  4X56 A;  2QYB A;  4E3L A;  5HAQ A;  3T4S A;  5TGF A;  3BJN A;  1MWU A;  3NCK A;  2QJ5 A;  4BMW A;  4E3O A;  1SKF A;  1W8Q A;  3B3X A;  2VV6 A;  1K25 A;  2P9V B;  3NOU C;  4OP8 A;  1JTD A;  4IBX A;  3LO7 A;  1SKO A;  5L2F A;  1ES3 A;  4JKT A;  4OQG A;  3QP1 A;  2D01 A;  2JBF A;  2ACG A;  3R7W B;  4DJ3 A;  5A91 A;  4EQI A;  5DJT A;  1MWT A;  5EOE A;  2Y2G A;  2EX9 A;  2ZBB A;  3KSI A;  3VFH A;  1M40 A;  5F68 A;  5KSC A;  3V50 A;  3QP8 A;  2ZC4 B;  2ZOH A;  2VK3 A;  3BQ8 A;  3T1X A;  2JKR M;  4WEK A;  1W79 A;  4UEY A;  3VSL A;  3KYZ A;  1PI5 A;  5DFY A;  5FEG A;  1I2W A;  4JXG A;  3CLO A;  3UDI A;  5TJJ A;  4N9L A;  3WS2 A;  1IKG A;  1PWG A;  2Z6C A;  3W4P A;  4LFU A;  4R23 A;  1OPX A;  2HV1 A;  2JKT I;  2O0Y A;  3G4P A;  1D1J A;  3C7V A;  4CLC B;  4EWF A;  3CUE A;  1DY6 A;  1F2K A;  3BLM A;  1C3B A;  4I3J A;  1NRJ A;  3P98 A;  5EM0 A;  2A24 A;  2V2F F;  3VP4 A;  4KZ6 A;  1HD8 A;  2J3T C;  4KG2 A;  4JBF A;  4P6Z M;  2ZLY A;  3ZDJ A;  3LUQ A;  3TG9 A;  2R9X A;  5GLB A;  4GCZ A;  1XPB A;  3OPL A;  4R1G A;  5IS1 A;  4JGO A;  4Y0U A;  2O9B A;  4UA7 A;  3VP3 A;  4I5S A;  4QY5 A;  4DE3 A;  1CQA A;  1YKD A;  3MKF A;  1LHY A;  3Q81 A;  5EV0 A;  2GX5 A;  3Q82 A;  1IOU A;  4BLM A;  3ITB A;  3ZNT A;  3D3O A;  3B47 A;  1G5U A;  4M3K A;  4OP5 A;  2G7U A;  4WEJ A;  1K0K A;  4KZ7 A;  3FYZ A;  2OWH A;  3WRT A;  4DN0 A;  3V3R A;  2BTF P;  3PBQ A;  1SCW A;  1FQG A;  1KVL A;  3G2Y A;  2XRO A;  5CER A;  4DXB A;  3T1S A;  2I72 A;  2WGW A;  3QNB A;  3SH8 A;  5GHZ A;  3IBJ A;  5CGS A;  1HTZ A;  2WGV A;  1YPR A;  1JVJ A;  1GCE A;  3IHA A;  1H8Y A;  4MEZ A;  4ZJ2 A;  1LLB A;  4RA7 A;  4KQO A;  2IA2 A;  2ZMV A;  5FQK A;  3KSH A;  5M1A A;  1F98 A;  4ZAM A;  1XGI A;  1NY0 A;  4MN7 A;  3H7W A;  2XDM A;  4IED A;  2ZQC A;  3DTI A;  2Y2I A;  1FIK A;  3BEC A;  4JXW A;  4OPQ A;  4B88 A;  3VE4 A;  5EVI B;  4GD6 A;  2D02 A;  1PYY A;  4YWZ A;  5IHV A;  5HFO A;  2ZM8 A;  5J4E A;  1ZG4 A;  5DF7 A;  3UB8 A;  1CK3 A;  3VP1 A;  1LSX A;  5F69 A;  1SDN A;  2Y2L A;  4KG5 A;  3BFE A;  2WZX A;  3MKE A;  1MBL A;  3N4I A;  4KQD A;  1ONH A;  3IX4 A;  4R6L A;  3IH8 A;  3IXB A;  3UB9 A;  4Q0H A;  1S4S A;  3GMW A;  4I3A A;  1YLP A;  1YSP A;  4CLC C;  3UDX A;  2VGL M;  4MN6 A;  1V9Y A;  3S22 A;  3PYP A;  4P6Z S;  3T50 A;  4I39 A;  3F1P A;  3NIA A;  3IHB A;  4HHD A;  4EXO A;  2XD1 A;  2ZQ7 A;  4EU0 A;  2V1B A;  3A0R A;  1YLW A;  3A3D A;  2JE5 A;  5HZH A;  4LCM A;  2B5R A;  4S2I A;  5KMW A;  4NXE A;  5AQA A;  1YSQ A;  2DMW A;  3LIA A;  1L3L A;  5CHJ A;  4U0T A;  1ZHH B;  4JXS A;  5DF8 A;  4YNR A;  4JGR A;  2A49 A;  5CEB A;  2C5W B;  1ERM A;  2JKT M;  4WZ4 A;  3DBA A;  3DWZ A;  2Y79 A;  3QNC A;  4PKY G;  3CMZ A;  2HP6 A;  1KE4 A;  2W3E A;  3LIE A;  3S4X A;  1BLC A;  1WA9 A;  4DDS A;  2QWS A;  2WK0 A;  5F6A A;  4MNR A;  1YMS A;  1BLH A;  5CTM A;  1FIL A;  4R3J A;  4ME4 A;  1YM1 A;  1K57 C;  4FH2 A;  1PWD A;  1M6K A;  3GR2 A;  1LT0 A;  4R0Q A;  5HD3 A;  4R70 A;  3CPT A;  3PAG A;  5HDS A;  2QMI A;  4ARZ A;  2HDU A;  1BT5 A;  2XQZ A;  4HBU A;  5AQ7 A;  4WZ5 A;  1SKO B;  3LIC A;  3U4L P;  4KUO A;  3MXQ A;  4LV3 A;  4L0L A;  1VHM A;  1VM1 A;  5A90 A;  2K2N A;  1H0M A;  2Q9N A;  4OPY A;  5DF9 A;  1AWI A;  3F1N A;  4HQA A;  4BD1 A;  4BQM A;  3OPR A;  3EQV A;  2PD8 A;  1XX2 A;  4KEN B;  2WAE A;  4KZ9 A;  4I3I A;  4OOY A;  4LV0 A;  4R3B A;  3C5A A;  5EVI C;  1TS6 A;  2Q0O A;  1L0E A;  2W3G A;  4LLO B;  3IXG A;  2V1A A;  3CI6 A;  4WM9 A;  3RXX A;  4CQH A;  3A3E A;  4WEL A;  5EE8 A;  4BD0 A;  4ZBE A;  3M2K A;  1ESU A;  2VGK A;  4QY6 A;  4C3Q A;  1LSV A;  3LGO A;  2Y2N A;  4ZTK A;  4P85 A;  2ZQ9 A;  2KX6 A;  3NOP C;  3IWO A;  3HUM A;  4DKI A;  2A24 B;  3UB6 A;  3IH9 A;  2XF3 A;  3VP2 A;  2GZA A;  3A3J A;  4U0X A;  2XK1 A;  2Y2H A;  2NUP C;  2X01 A;  3KYE A;  3FPV A;  2VGL S;  4IHQ A;  2ZD8 A;  5I94 A;  3K2N A;  1K6S A;  2Y2M A;  2H5S A;  2Y91 A;  2ZC6 B;  1NWZ A;  3T12 B;  5FEF A;  1MKM A;  1DP8 A;  4DE0 A;  3FC7 A;  4Z9Q A;  2WKI A;  3CIT A;  3ISG A;  1NZO A;  5KSH A;  1VQQ A;  4JPM A;  2KOI A;  2JCH A;  1YLZ A;  3FWL A;  3FKV A;  1Y4O A;  5HWV A;  2W1R A;  4GKU A;  3Q7Z A;  4KZ8 A;  4R3A A;  3ZG8 B;  1RCJ A;  2HP9 A;  1GA9 A;  2XD5 A;  3T4O A;  3QP6 A;  3IXH A;  3Q1F A;  4S2P A;  1G6A A;  4OVD A;  3WS0 A;  1W5D A;  4G3W A;  3ZG7 B;  2WGW B;  2WYX A;  2MJ6 A;  2JHE A;  2E8I A;  1EW0 A;  4FUW A;  4MBH A;  3GDI A;  2X71 A;  3CJM A;  5DTK A;  4MMN A;  1K4E A;  3UE1 A;  3TSG A;  1OTA A;  1G6O A;  4OOM A;  4WLA A;  5HDD A;  4MN5 A;  5HPI A;  2ZQA A;  2JN7 A;  1MPL A;  2YKF A;  1J3W A;  3PBS A;  4EQ1 A;  5FL3 A;  3VSK A;  4DMZ A;  3N8R A;  1CI9 A;  4IUK A;  1NLZ A;  4QU3 A;  3H7W B;  3NC8 A;  4GNU A;  2GDN A;  2INW A;  3OPH A;  3T4T A;  4XUZ A;  3LI8 A;  1NYM A;  3MQ0 A;  5EOO A;  2M1C A;  3JYI A;  4PM9 A;  2OOL A;  1XJ3 A;  2EX2 A;  4BBT A;  1PRQ A;  1GA0 A;  3DTK A;  2PU2 A;  2V1Z A;  5IT5 A;  3M6H A;  4PMA A;  4Y0T A;  2WUQ A;  3P09 A;  2ZQD A;  5FAT A;  4QWO A;  2PR5 A;  4CLC E;  2PR6 A;  5CX7 A;  1MZU A;  1XGJ A;  1LL9 A;  1XXM A;  5C5K A;  1YQS A;  3HJI A;  2EWV A;  1VEU A;  1Q2P A;  2FFF B;  1GSX A;  5L10 A;  5HAP A;  2VA0 A;  1K55 A;  4Y7P A;  4C6Y A;  3UNW A;  4KZA A;  2Y2P A;  5DJU A;  2EFX A;  4JF6 A;  1K54 A;  5DKL A;  3N8S A;  3HLW A;  1MWR A;  2V20 A;  4AFI A;  3CUE C;  1UWP X;  1E25 A;  2Y2K A;  4E04 A;  1FCM A;  2XGN A;  3F1P B;  4GS9 A;  4S2L A;  4JGP A;  3PBN A;  1ONG A;  3TJZ C;  1Z09 A;  2WKR A;  1O07 A;  2ZC3 B;  5CHM A;  1KGG A;  4K0W A;  3SS5 A;  4RQ9 A;  4II7 A;  1L0F A;  2OSU A;  2XR0 A;  3P01 A;  4A5R A;  3O5Y A;  2ZM0 A;  1PZO A;  5HW3 A;  4L9G A;  4KQQ A;  5KIZ A;  3E0Y A;  3IQA A;  5CXW A;  3W8K A;  5FAP A;  2WKP A;  3BWL A;  2BLS A;  5CTN A;  4WN5 A;  3CHW P;  5A92 A;  2R78 A;  4OON A;  3IF6 B;  4JF4 A;  2EXA A;  2K31 A;  2FH5 A;  5U47 A;  4WUJ A;  1BLP A;  2OAP 1;  5CGX A;  4DE2 A;  2PU4 A;  4EUZ A;  3KX0 X;  5G4Z A;  4H8R A;  2OLU A;  3PXP A;  4ZJ1 A;  1NXY A;  3CPT B;  1W63 Q;  5GL9 A;  4YIN A;  3Q7V A;  1FR1 A;  1BZA A;  3HLF A;  5F83 A;  4DDY A;  4ARZ B;  4X6T A;  3NEC A;  3NUL A;  4HP9 A;  1E3U D;  4FOF A;  3LI9 A;  1KGE A;  2V8F A;  3L7H A;  2VJW A;  5F82 A;  3ZG0 A;  4B4Z A;  4GJ4 A;  4Y3I A;  3PR6 A;  2C6W B;  5J7E A;  2WZZ A;  4Q8I A;  3LR0 A;  3O86 A;  3SS4 A;  1YT4 A;  3F1N B;  4B4X A;  4XT2 A;  2EXB A;  3VOL A;  3HVF A;  5K5B A;  4HY8 A;  5FDH A;  4GLQ A;  3AGF A;  2PDR A;  5FQI A;  3G35 A;  1STZ A;  3RXW A;  3F1O A;  4S2M A;  5LBR A;  2H0Y A;  3NDE A;  4GOG A;  1NRF A;  1H3Q A;  4YFM A;  3ICY A;  3S7P A;  3UPN A;  3CG5 A;  4KZ3 A;  3T4J A;  4RVA A;  5FQJ A;  4GB7 A;  1ZTU A;  3O87 A;  3UDF A;  3IWI A;  4S2N C;  4JLF A;  4N1H A;  4QHC A;  4WBG A;  5I5L A;  4X1M A;  1CF0 A;  1XA7 A;  3M6B A;  2V0W A;  2L4R A;  1TEM A;  1MKI A;  1S6R A;  3CAX A;  3ZCZ A;  4PM7 A;  1G68 A;  2BG1 A;  2AVX A;  2CC1 A;  1F5M A;  3K3C A;  3OBF A;  2XEP A;  4KQR A;  3HLE A;  4YOF A;  2XFT A;  5HD5 A;  3OZH A;  4ID4 A;  5EFW A;  2JKG A;  4UHU A;  2WAD A;  4OKP A;  1TS7 A;  3H82 A;  3IF5 A;  4R4S A;  4UA9 A;  3DAV A;  4O8G A;  4B9O A;  3LY4 A;  4PM8 A;  3KSG A;  3ITA A;  4I38 A;  1T18 A;  4OQI A;  2FFY A;  4QPR A;  4EUV A;  1IEM A;  3EQU A;  1S67 L;  2RCX A;  4HES A;  3MF0 A;  3C30 A;  1IKI A;  1W63 M;  4IJG A;  3BLS A;  3VFF A;  4BBV A;  1S1Z A;  3PBT A;  4DE1 A;  1WYB A;  2WKQ A;  3G2Z A;  5HL6 A;  1H8M A;  3IBR A;  4ZRR A;  5FAS A;  2Z2M B;  1S4R A;  4BEN A;  2I9V A;  4HNB A;  1KDS A;  1D06 A;  4BBU A;  3DWK A;  5FQM A;  5FA7 A;  2HPB A;  3GTC A;  4ZJ3 A;  2W3F A;  1BSG A;  3ZQ5 A;  1BUL A;  1XJ2 A;  3MS6 A;  4NXB A;  5E2G A;  2HP5 A;  2XFS A;  4WZ5 C;  3D4F A;  4ETZ A;  1CJF A;  2IWB A;  4KZ4 A;  1I5Q A;  4HP4 A;  1ALQ A;  1XKZ A;  3B33 A;  5MC7 A;  4EW7 A;  1FOF A;  4E3M A;  3PBR A;  4MCW A;  5EPH A;  2GJ3 A;  1DRM A;  3IF6 A;  3IXD A;  3BY8 A;  5GLC A;  5FI6 A;  3EWK A;  1H5X A;  1N9L A;  5FI2 A;  2ZQ8 A;  3MMH A;  1ERO A;  3KYQ A;  3WWX A;  1GHP A;  2P04 A;  4MDZ A;  2J3W A;  1VEU B;  1XP4 A;  1ZC2 A;  2PRF A;  4HI4 A;  1LL5 A;  1T1B A;  3W2Z A;  3EEA A;  3UPO A;  2EX8 A;  3QP2 A;  3V67 A;  4QJG A;  3O3V A;  2H0T A;  2X02 A;  3A3I A;  4HJ3 A;  4PM6 A; 
#chains in the Genus database with same CATH homology
 3CLO A;  4G3W A;  5TJJ A;  3CWF A;  2MJ6 A;  3LR3 A;  3MQQ A;  2BAS A;  2Z6C A;  2JHE A;  4GS9 B;  1EW0 A;  1OPX A;  2HV1 A;  3GDI A;  4BJP A;  2JKT I;  2O0Y A;  3U2A A;  2XA7 M;  4LRY C;  4MMN A;  2A2L A;  2B02 A;  4CLC B;  3BQA A;  1OTA A;  1G6O A;  3CUE A;  4OOM A;  4WLA A;  5HDD A;  4MN5 A;  5HPI A;  2JN7 A;  1S1Y A;  2YKF A;  4I3J A;  2W3H A;  1NRJ A;  3K3D A;  2V9A A;  4NXF A;  3PBS A;  3LR4 A;  2A24 A;  4EQ1 A;  3MFX A;  1S66 L;  2LB5 A;  4O0P A;  5FL3 A;  4F3L B;  3S7N A;  4Y5F A;  4DMZ A;  1F9I A;  2J3T C;  4IUK A;  3SW1 A;  1NLZ A;  3H7W B;  5HWT A;  4P6Z M;  1JNU A;  2INW A;  4GW9 A;  3LID A;  3T4T A;  2CMN A;  1LL8 A;  3LUQ A;  4ETX A;  3LI8 A;  3T4K A;  1N9O A;  3MQ0 A;  3OCL A;  3RTY A;  2M1C A;  4LPZ A;  3LFV A;  4GCZ A;  2L1M A;  2OOL A;  1XJ3 A;  5IS1 A;  4JGO A;  4BBT A;  2O9B A;  4I5S A;  3IS2 B;  2XRN A;  1UGU A;  1YKD A;  5IT5 A;  5F5Y A;  4UQI M;  2PR5 A;  2GX5 A;  4CLC E;  2PR6 A;  4G3V A;  2W1T B;  5CX7 A;  3R7W A;  1IOU A;  1ODV A;  1MZU A;  3BY9 A;  2ZMF A;  2HJE A;  5C5K A;  2PYP A;  3HJI A;  3HJK A;  3D3O A;  2EWV A;  3B47 A;  2ZOI A;  1GSX A;  3HCY A;  4Q0J A;  5J3W A;  2PYR A;  2G7U A;  4WEJ A;  2VA0 A;  5HPF A;  1X0O A;  1DP9 A;  2VEA A;  2OWH A;  4FSF A;  2QKP A;  2FZ0 A;  4DN0 A;  2VV8 A;  2W0N A;  5DJU A;  3C38 A;  4LRX C;  3OCN A;  3PBQ A;  5DKL A;  2KLI A;  3LR5 A;  4H6J B;  4AFI A;  2XRO A;  3CUE C;  1UWP X;  2PT7 A;  3LYX A;  4Y2F A;  3EGD C;  4PKY A;  3H9W A;  4E04 A;  4XT2 B;  3F1P B;  2LB9 A;  3IBJ A;  3OC2 A;  4GS9 A;  4JGP A;  3PBN A;  1XJ6 A;  3OOV A;  3TJZ C;  2WKR A;  4GHI A;  4CLC A;  4RQ9 A;  5AVF A;  4Z1W A;  4II7 A;  4KQO A;  2IA2 A;  2ZMV A;  2OAQ 1;  3P01 A;  4WF0 A;  3E4Q A;  3F1O B;  3ULF A;  3O5Y A;  3KSH A;  1OTE A;  3VV4 A;  1F98 A;  1MC0 A;  2VV7 A;  4F3L A;  4L9G A;  2HJ9 C;  2J3T D;  1OT9 A;  5KIZ A;  3E0Y A;  4MN7 A;  3H7W A;  2M7U A;  3PHY A;  3EEH A;  2WKP A;  3BWL A;  3VE4 A;  4WN5 A;  2R78 A;  3NHQ A;  2D02 A;  4YWZ A;  2K31 A;  4PAU A;  2FH5 A;  3IS2 A;  4WUJ A;  5J4E A;  3UB8 A;  2OAP 1;  4G3K A;  1LSX A;  2PHY A;  3E4O A;  5F69 A;  3RFB A;  3KX0 X;  5G4Z A;  3S7O A;  2W1T A;  3PXP A;  2QJ7 A;  2W27 A;  4LRZ E;  4OOL A;  3UMD A;  2VX8 A;  4EES A;  4NXG A;  4KQD A;  3UE3 A;  1W63 Q;  3JVV A;  1P9W A;  4R6L A;  4ARZ B;  4NEE D;  2XA7 S;  4HP9 A;  4FOF A;  1OTD A;  4EER A;  3LI9 A;  3UB9 A;  2VJW A;  4GJ4 A;  5DFX A;  4Q0H A;  1S4S A;  4I3A A;  4Y3I A;  1YSP A;  3PR6 A;  2OWJ A;  3H82 B;  5HDC A;  4CLC C;  2JKR I;  5J7E A;  4M4X A;  4HJ4 A;  3LIF A;  3NOT C;  1IFQ A;  2Z6D A;  1V9Z A;  2VGL M;  1GSV A;  3LR0 A;  4MN6 A;  1V9Y A;  3F1N B;  4XT2 A;  3UB7 A;  3PYP A;  4P6Z S;  3T50 A;  1TS0 A;  3VOL A;  4I39 A;  3F1P A;  5K5B A;  1YAX A;  2L0W A;  3D72 A;  2Y8H A;  4HY8 A;  3UME A;  4HHD A;  1UWN X;  3KO6 A;  4EXO A;  4R38 A;  4EU0 A;  4GLQ A;  4HJ6 A;  5TBM B;  2V1B A;  5A8B A;  2PDR A;  3A0R A;  4Q0I A;  1VB6 A;  4EEP A;  1STZ A;  5HZH A;  1P0Z A;  3F1O A;  4NXE A;  2VLG A;  3NJA A;  5LBR A;  3E4P A;  1YSQ A;  2DMW A;  4L9F A;  2B18 A;  3LIA A;  3MR0 A;  2KDK A;  4HH2 A;  4UQI S;  1ZHH B;  4YNR A;  1H3Q A;  4JGR A;  2HF6 A;  5L8M A;  5DKK A;  3ICY A;  3MJQ A;  3S7P A;  2JKT M;  2O9C A;  3DBA A;  3OLO A;  2Y79 A;  4PKY G;  3MQO A;  5AVE A;  3T4J A;  1P9R A;  2W3E A;  3LIE A;  3TW8 A;  3C2W A;  4DJ2 A;  1WA9 A;  1ZTU A;  2QWS A;  5HSQ A;  1TS8 A;  5F6A A;  1T19 A;  1NLY A;  4ME4 A;  4IUH A;  5I5L A;  3E98 A;  1XFQ A;  3R4K A;  2V0W A;  1P97 A;  4EET B;  2L4R A;  3P7N A;  1LT0 A;  3CAX A;  5HD3 A;  4R70 A;  3ZYT A;  1F5M A;  3K3C A;  3VE3 A;  5HDS A;  3OBF A;  4ARZ A;  4JGQ A;  2QHK A;  4YOF A;  1OJ5 A;  2PD7 A;  3LIC A;  5HD5 A;  1TF1 A;  4KUO A;  3MXQ A;  4L0L A;  1VHM A;  1DP6 A;  4PHT A;  5EFW A;  2GNX A;  4HH3 A;  4CLC D;  3BW6 A;  1TS7 A;  3H82 A;  2K2N A;  3T4Q A;  3FPW A;  4O8G A;  4B9O A;  5HWW A;  5AJG A;  1XJ4 A;  3A0V A;  2O99 A;  3G6O A;  3KSG A;  4I38 A;  1LSW A;  1T18 A;  5DF9 A;  1TD5 A;  4QPR A;  2M7V A;  3F1N A;  4HQA A;  2J80 A;  4EUV A;  3JVU A;  3EQV A;  2PD8 A;  3EQU A;  1S67 L;  4GHI B;  3GEC A;  1G28 A;  3MF0 A;  3C30 A;  4NKP A;  4WL9 A;  3RH8 B;  4I3I A;  3TRC A;  1W63 M;  5TBM A;  4HIA A;  4IJG A;  3EOI A;  1T1A A;  4BBV A;  1S1Z A;  3T4L A;  3PBT A;  1N9N A;  2YKH A;  1TS6 A;  3FG8 A;  3EGX C;  5G4Y A;  2WKQ A;  5HL6 A;  1H8M A;  2W3G A;  4LLO B;  3A0S A;  4H6J A;  3IBR A;  1T1C A;  1XFN A;  2V1A A;  4ZRR A;  3CI6 A;  4KUK A;  2VKS A;  4BWI A;  4CQH A;  1OJG A;  1S4R A;  4WEL A;  2H28 A;  2I9V A;  4K08 A;  2P08 A;  4HNB A;  2W3D A;  2EA9 A;  1D06 A;  4BBU A;  3C8C A;  1LSV A;  1KOU A;  2W3F A;  4EEU A;  4HOI A;  2KX6 A;  3NOP C;  3ZQ5 A;  1XJ2 A;  1Y28 A;  1D7E A;  2A24 B;  3LIB A;  4NXB A;  3UB6 A;  2GZA A;  2VZW A;  3UE6 A;  2QYB A;  4L9E A;  2NUP C;  4ETZ A;  3FPV A;  2VGL S;  3T4S A;  3BJN A;  1BYW A;  1OTB A;  2QJ5 A;  4IHQ A;  4BMW A;  3KSF A;  4HP4 A;  3B33 A;  5MC7 A;  3TE8 A;  4EW7 A;  2VV6 A;  3K2N A;  2XSS A;  3NOU C;  3PBR A;  4MCW A;  5IU1 A;  3S7Q A;  1NWZ A;  2GJ3 A;  1MKM A;  1DP8 A;  1DRM A;  3FC7 A;  3BY8 A;  3CIT A;  3EWK A;  2HGV A;  1N9L A;  5KSH A;  2D01 A;  2P7J A;  3MMH A;  1OT6 A;  2KOI A;  3R7W B;  2O9A A;  4DJ3 A;  3KYQ A;  5DJT A;  2EWW A;  2P04 A;  4MDZ A;  2J3W A;  5HWV A;  3KSI A;  2ZBB A;  5F68 A;  2W1R A;  4R3A A;  3PBO A;  4HI4 A;  1T1B A;  1OTI A;  2ZOH A;  2V0U A;  3W2Z A;  3BQ8 A;  3EEA A;  2JKR M;  4WEK A;  3T4O A;  3V67 A;  1GSW A;  2NUT C;  4UEY A;  3KYZ A;  4O01 A;  4B93 A;  5DFY A;  3B42 A;  2K7S A;  4HJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...