1OJ5A

Crystal structure of the nco-a1 pas-b domain bound to the stat6 transactivation domain lxxll motif
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
105
Chain Sequence
VESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPMQPFIMGIHIIDRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STEROID RECEPTOR COACTIVATOR 1A
publication title Structure of the Ncoa-1/Src-1 Pas-B Domain Bound to the Lxxll Motif of the Stat6 Transactivation Domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcriptional coactivator
total genus 28
structure length 105
sequence length 109
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1oj5A00
1XFQA 2V1AA 3A0SA 1VB6A 5A8BA 5G4ZA 1GSWA 2ZOIA 3BY8A 1S4RA 1JNUA 3ULFA 3GECA 4BBTA 2L4RA 1D7EA 3H7WB 3LICA 2YKHA 1S4SA 4B9OA 4GCZA 5DKLA 1OTIA 4LRXC 5F68A 1T1BA 3C2WA 3LIDA 1LSXA 2PR6A 1LSVA 2HV1A 3KX0X 2PHYA 4WL9A 3H9WA 3VE4A 3NOUC 3UMEA 3D72A 4EESA 1DRMA 1DP6A 3PHYA 4PKYA 4HP4A 1S66L 3C8CA 4JGPA 4R6LA 2QKPA 4HY8A 4BBUA 5HWWA 1NWZA 2PD8A 3LIBA 1V9YA 1S1ZA 1TS0A 4WLAA 5AVFA 3EWKA 2P7JA 1KOUA 1XJ2A 3K3CA 3E4QA 4H6JB 1OTEA 3HJIA 2PD7A 4LPZA 4KUKA 4I5SA 2VV6A 3T50A 5TBMB 5HWTA 5G4YA 2WKPA 4YWZA 2A24A 4KQDA 2INWA 3P7NA 1MZUA 2CMNA 2YKFA 5HDSA 1OT6A 4JGRA 3EEHA 4EW7A 1XJ6A 3VOLA 2EA9A 4HIAA 4EXOA 4K08A 4HOIA 4M4XA 1XJ4A 3B33A 4NXFA 2VEAA 2OWHA 3BWLA 2W0NA 1OT9A 4LRZE 4HJ3A 4F3LA 1OTBA 3UE6A 4HP9A 3A0VA 4GS9B 1T1AA 4PKYG 2D01A 1F98A 5AVEA 3K3DA 3E4PA 4HH2A 2V1BA 2PR5A 3CLOA 3F1PA 4EEUA 3F1NA 4EETB 1OJGA 1TS7A 4GHIB 2QWSA 1OTDA 3IS2B 4I3AA 4MN6A 2QHKA 3NHQA 5HDCA 1BYWA 3MQQA 4LLOB 2V0WA 5HSQA 4DJ2A 3ICYA 2L0WA 3UB6A 2WKQA 4JGQA 1XJ3A 5DKKA 5DJUA 2OOLA 4L9EA 4EERA 1N9OA 3H7WA 3SW1A 2KDKA 1EW0A 4EQ1A 3LIFA 3HJKA 3ZQ5A 4XT2B 3E4OA 3F1OB 1DP8A 3H82A 4WF0A 5HD5A 1OTAA 3FC7A 4L9FA 1DP9A 4NXGA 3RH8B 4HNBA 4WUJA 1LT0A 3VE3A 5J4EA 4GW9A 3RTYA 3LI8A 4I38A 1P0ZA 2GJ3A 1LSWA 1XFNA 2JN7A 2VV7A 1N9NA 2I9VA 1GSVA 5HD3A 1T1CA 1UGUA 1V9ZA 4R3AA 4HJ4A 3LIEA 3OLOA 4H6JA 4L9GA 3FG8A 2KX6A 5HWVA 5F6AA 1OJ5A 2VV8A 2K7SA 3IBRA 5J3WA 2QJ5A 5TBMA 4I3JA 2ZOHA 2J80A 5HZHA 2BASA 4R38A 1TS6A 1N9LA 1LL8A 4NXEA 2OWJA 2W27A 3CAXA 4E04A 4EEPA 2JHEA 3UB9A 3NOTC 3NOPC 1TS8A 1ODVA 4I3IA 4NXBA 4GS9A 4DJ3A 3UB7A 4BBVA 2D02A 1P97A 4HI4A 2QJ7A 1T18A 2M1CA 3H82B 1UWNX 4JGOA 4WN5A 5J7EA 1S67L 1UWPX 5F69A 4HH3A 4HJ6A 5IU1A 4HHDA 4I39A 3A0RA 2A24B 5IS1A 1GSXA 2R78A 4GHIA 2Z6DA 3LIAA 3LYXA 3IS2A 2B02A 5DJTA 1X0OA 5I5LA 1T19A 2ZBBA 2V0UA 3MJQA 4R70A 1G28A 3BY9A 4MN5A 1D06A 5KIZA 3UMDA 3G6OA 2PYPA 5F5YA 3MR0A 5EFWA 4F3LB 3UB8A 2V9AA 3MFXA 1Y28A 2PDRA 2H28A 3LUQA 4HQAA 2VLGA 4RQ9A 2PYRA 4LRYC 2Z6CA 3MQOA 1WA9A 3CWFA 1S1YA 4XT2A 3F1PB 3F1OA 4KUOA 5HDDA 3F1NB 3PYPA 3LI9A 3GDIA 3NJAA 2L1MA 2WKRA 3MXQA 1F9IA
chains in the Genus database with same CATH superfamily
1IYPA 4D60A 2W3EA 4U0XA 1DY6A 3A0SA 3IXHA 1BLCA 2HDRA 4Y13A 1JNUA 4MLLA 3C7UA 1ES3A 1GHIA 3LR3A 3W4PA 1K4EA 3KSHA 4KZ5A 1ZHHB 1OMEA 1PW1A 1VETA 1BLPA 4GCZA 3VV4A 3E0YA 5DKLA 2J3TC 1VHMA 2Y2IA 4WZ5C 4YFMA 3G35A 4S2NA 1IYQA 5EPHA 5KSCA 4KZ6A 3EEAA 4WL9A 3H9WA 3IH8A 3IXGA 3OPLA 2ZL1A 3PR6A 1MBLA 3HLWA 3Q1FA 2P74A 3OOVA 2E8IA 1IELA 1E3UA 1MWUA 4OLDA 3PHYA 4B4XA 1HVBA 4PKYA 3P98A 1O07A 4A5RA 2ZQ8A 4R6LA 4KG5A 2PD8A 4NKPA 4QY6A 1V9YA 3IT9A 4ZRRA 2JKFA 3IX4A 1H0MA 3WWXA 1KOUA 1XJ2A 5FASA 2EX9A 5E2HA 1OTEA 3CITA 1H8MA 2Y4AA 2P08A 2X71A 5K5BA 1YLPA 4IVKA 2OAQ1 1G6OA 2VV6A 1IEMA 5GHYA 3OC2A 3BECA 5TBMB 4ETZA 4QB8A 3MKEA 4E3LA 4S2NC 3BFGA 4OPRA 3P7NA 1MZUA 1FCMA 3GVBA 3EOIA 5HDSA 1OT6A 3EEHA 1VM1A 2Y2JA 1MPLA 5KZHA 4S2IA 4FUWA 4HIAA 1K55C 1O7EA 4UAAA 4K0XA 3HUOA 3VP0A 2G2WA 1YLYA 4Y7PA 4RX3A 2W0NA 2Q9MA 2RCXA 3PBNA 3A0VA 4WMCA 1T1AA 5HARA 1M6KA 2XROA 2UWXA 1LLBA 3V67A 3N6IA 4ARZA 3F1PA 4EETB 3FYZA 1TS7A 1YPRA 4DXCA 1W7FA 2ZQ9A 3IS2B 2ZM8A 4I3AA 3NHQA 4OQIA 5EVID 5FL3A 2FH5A 3KSFA 1PZPA 1L0EA 2FFYA 3D9YA 5CXWA 3LFVA 2E8JA 3ZG9B 3W2ZA 2JKTM 3VOYA 4Y0UA 1YLTA 2PBDP 1MWTA 4JGQA 4ZTKA 5HW3A 5DJUA 4MBHA 1YSQA 3IWOA 4L9EA 4OOLA 5DF7A 1N9OA 2JKGA 1IYSA 1EW0A 4E6XA 1WE4A 1YAXA 5EUAA 1PI4A 3F1OB 3BFEA 1SCWA 1DP8A 4LV3A 5L09A 1BUEA 1EROA 1OTAA 2ZQ7A 4UA6A 1BLSA 3RH8B 3RFBA 3G2ZA 2KOIA 4Q0HA 2HF6A 4LFUA 3ZYTA 2GJ3A 1XP4A 4N1HA 3SS3A 1XFNA 2VV7A 4OOMA 1N9NA 4UHUA 2W3DA 2V8FA 4UEYA 3VP4A 1XPBA 3L7HA 3CZDA 1UGUA 1BLHA 4R3AA 2M7VA 3HREA 3LIEA 3OLOA 2HJ9C 4IJGA 3FG8A 3KYEA 5HWVA 4QHCA 2IWDA 1OJ5A 1GA9A 2K7SA 3IBRA 4DXBA 5DTTA 1FSYA 5HL6A 2XR0A 5TBMA 2VKSA 1KVLA 2WAEA 1NJ4A 4E6WA 2PT7A 2ACGA 4EBLA 4LV0A 3ZCZA 3I7JA 4AFIA 5M1AA 3CPTB 5L07A 2IWBA 3PTEA 4KZ9A 4KQQA 2B18A 2OWJA 3NBLA 1E4DA 1JWPA 3FKWA 5JYOA 2OLVA 2JHEA 5LBRA 3UB9A 4HBUA 2OLUA 3IF6B 1E25A 1BSGA 4R4RA 4BBVA 3ZG7B 3QNBA 1MKMA 3DBAA 5AQBA 3H82B 2A49A 4WN5A 5J7EA 2VGLM 1FR6A 3T1XA 4XUXA 2EWVA 1CI9A 4Y17A 1MKIA 2DRWA 1XX2A 3TJZC 4U3TA 1FR1A 2Z6DA 3TSGA 3IS2A 2H10A 3EQVA 1X0OA 5L8MA 3NY4A 1T19A 2ZBBA 3NULA 4DE2A 2DCFA 2EXAA 3BY9A 2XSSA 2HP5A 3V3SA 4O0PA 3G6OA 4GDBA 3S4XA 3HUMA 3QP6A 2X01A 3MR0A 3Q7VA 4F3LB 1AWIA 2ZMAA 4EUZA 2W3GA 1Y28A 3T4TA 2GNXA 4O01A 5DVAA 3MKFA 2H28A 4HQAA 3IQAA 5L10A 1IOUA 1NYYA 4RQ9A 1ZG4A 2PYRA 3A3FA 4C6YA 2WKHA 3HLDA 1K56A 3F1OA 4KUOA 5HDDA 4LENA 4JKTA 3LI9A 3GDIA 3E2LA 3BQAA 2ZM2A 3CMZA 3R7WB 4E3NA 1F9IA 4YOFA 4X25A 1Q2QA 3K2NA 4OPZA 1GHMA 5FQ9A 2HP6A 1GSWA 1FQGA 3O88A 4IUHA 3ULFA 2FZ0A 2Z2LB 5AQ9A 2L4RA 1D7EA 3BEBA 3Q81A 4BL3A 1AXBA 2Y2LA 4JXSA 3HLGA 3LICA 4B9OA 1OTIA 1PRQA 4KENB 3UPOA 4XXRA 4BLMA 5HFOA 4UQIS 4B88A 3LIDA 2PR6A 2WGWB 2W3HA 2Y59A 3DWZA 2ZLYA 4KZAA 2PHYA 4O8GA 3UMEA 5JYPA 4QWOA 4CLCE 2BLSA 4EESA 3CPTA 3IHBA 2G2UA 3HL9A 1ALQA 4Q0IA 4G3WA 4OLGA 2QZ6A 2JCHA 5TGFA 2WZZA 3T1RA 1E3UD 2H0TA 3C8CA 1JWZA 2QKPA 3MSHA 4HY8A 4BBUA 1ES2A 2OAP1 1ZG6A 4WLAA 5FI2A 5M18A 3N8RA 1KDWA 3IF6A 3EWKA 4OQ0A 4DE3A 2WADA 1YT4A 3E4QA 4N9KA 2XA7S 4PM6A 1YKDA 2JKRI 4K91A 2PD7A 4LPZA 2JBFA 1I2WA 5E2FA 4I5SA 4GN2A 3T50A 2WAFA 3IX3A 1JTGA 1ZTUA 3S7NA 3MZDA 3AGEA 2HDSA 3DAVA 4KQOA 4GDNA 4JBFA 1OPXA 4RX2A 4CQHA 1K0KA 2PBYA 4P85A 4EW7A 1XJ6A 3VOLA 4DN0A 4JLFA 4OPYA 2VA0A 5AQ7A 4EXOA 5FI7A 1PI5A 4BD0A 4X1MA 4G3KA 3B33A 4NXFA 4S2JA 4F94A 1OT9A 1RGYA 3KSGA 1W5DA 4F3LA 3UE6A 1L2SA 4GLQA 3O87A 3IF6C 3T4JA 5G18A 2D01A 3VP3A 3NDEA 1LL5A 3K3DA 3E4PA 1QMFA 4HH2A 5FQJA 4RYEA 3ZG5A 1J9MA 4WYYA 2J8YA 1OJGA 3CUEA 4WBGA 1S6RA 5FI6A 4GHIB 3ZVWA 2QWSA 2Y2MA 1HD8A 1OTDA 3U4LP 3R7WA 2QHKA 4GJ4A 2X02A 2W1TA 1K55A 3QP8A 2PU2A 3P01A 3OPRA 5HSQA 3ICYA 2L0WA 2WUQA 3Q07A 4GB7A 1ONHA 2V20A 3TW8A 4CJNA 4EERA 3UE1A 1KDSA 5FSRA 5I94A 4FTXA 4EQ1A 3LIFA 1I5QA 3GTCA 1SKOB 3FV7A 4IUKA 3OCLA 2Y2HA 4PHTA 1IKGA 1KGEA 5EE8A 2WGWA 3NC8A 3MZFA 4P87A 4OOYA 2O0YA 3G32A 2RL3A 5EECA 3CUEC 3C4OA 1LT0A 3MXSA 3HVFA 2Y91A 4GW9A 2MJ6A 1HTZA 1P0ZA 3Q7ZA 3RXXA 3ZDJA 1J3WA 1YMXA 5E2GA 2V8CA 2P04A 4IBXA 4FSFA 4ETXA 3EGDC 4R3BA 2O9BA 3NDGA 3JPUA 3UN7A 4WELA 5EVIB 4X56A 3FZCA 1TEMA 4FH4A 2P9VB 4Q8IA 3GV9A 1ERQA 5DFYA 2ZC7A 5D3OA 5HZHA 4ZDXA 3A3IA 1NZOA 4X69A 3M2KA 3HBRA 5KSHA 4XUZA 5FEFA 4FCFA 3CAXA 4E04A 4QJGA 3IH9A 3BLSA 3NOTC 4JF4A 3NCKA 4I3IA 1TDGA 4BWIA 3BQ8A 1N4OA 5EV0A 5F1FA 4HI4A 2QJ7A 2HDQA 4QPRA 4M3KA 3DTMA 3PBRA 1YMSA 3U2AA 4HH3A 3ZNYA 5IU1A 1CF0A 4MEZA 1MC0A 2ZM0A 4Q0JA 3LCEA 5IS1A 4LV1A 1GSXA 3T4SA 4GHIA 2JKRM 3LIAA 1YLJA 5A93A 4GD6A 3VOZA 4FH2A 4PM7A 3IWIA 3ZGAB 2V0UA 4MNRA 4R70A 2Q0OA 1MXOA 4R4SA 3OPPA 4CLCD 3WS5A 1PWGA 4KZ4A 1QMEA 3SZTA 1ESIA 5EFWA 3KO6A 2XFSA 5AJGA 3MFXA 2A3UA 3TE8A 2PDRA 2EFXA 1Y54A 3T1QB 5IHVA 4C75A 3IXBA 1YM1A 1SKOA 3MQOA 4MBFA 2LB5A 3PYPA 3S7OA 1L0GA 4JPMA 2EWWA 4WM9A 2L1MA 1K56D 4ID4A 1NXYA 2WKRA 3JVUA 1D1JA 2V1ZA 4QY5A 3V3RA 5AQAA 4HESA 2VGJA 4X6TA 4BD1A 1EWZA 4B93A 3O5YA 5G4ZA 2ZOIA 4IHQA 1CJFA 1S4RA 3LEQA 3RJUA 3UE0A 4NETA 4YNRA 5FQIA 3G34A 4JXGA 4BBTA 3LR5A 4UQIM 4NK3A 4DKIA 5L2FA 5HPIA 3L9KA 5HAQA 1S4SA 1G68A 4S2MA 1XA7A 3B3XA 1CEFA 4HBTA 5BOHA 5EVIA 1T1BA 3N8LA 3C2WA 3S22A 3FPWA 3PAEA 3V39A 1LSVA 1RCJA 3BLMA 1W63Q 2P9VA 1MY8A 3FPVA 3VE4A 2XH9A 3NOUC 4BQMA 3D72A 2VGKA 2WYXA 1DP6A 1PW8A 3N8SA 3MZEA 1S66L 4BL2A 3OZHA 2R9WA 5HPFA 5FAQA 5F82A 2XA7M 4X55A 1PWDA 5FQMA 3EGXC 5GLCA 5HWWA 3LIBA 2JC7A 5EVEA 5HAPA 2W3FA 2Y2PA 5CHUA 1S1ZA 4N1XA 1W8YA 1K38A 1GA0A 2P7JA 1DJAA 2XLNA 2ZQAA 5GLDA 4P6ZS 1HZOA 3G2YA 3WS1A 5IT5A 4R3JA 1F2KA 3M6BA 1FCNA 2PAVP 3LO7A 4RA7A 3GMWA 3OCNA 4GOGA 1SDNA 5G4YA 2WKPA 5EVIC 4PM8A 4YWZA 3MFDA 2J3TD 2M7UA 4BENA 4KQDA 3IX8A 2G7UA 5FEGA 4Y5FA 1L3LA 2CMNA 4JGRA 4IVIA 2ZQDA 3LEZA 1XA1A 2EA9A 3T12B 4Y15A 1BULA 3MS6A 4K08A 2OSUA 4ZJ1A 1XJ4A 2Y2NA 1PNEA 1MWSA 3DW0A 1CI8A 1NZUA 2IA2A 4KZ8A 2OWHA 3BWLA 4LCMA 4U0TA 3C4PA 4HP9A 4X1LA 1I2SA 2QPNA 3RXWA 1FSWA 5CHJA 3PBTA 4PKYG 3UDXA 1F98A 3NI9A 3BJNA 4GD8A 5AVEA 3EQUA 2A2LA 2V2FF 1PWCA 2K2NA 2V1BA 2ZL1B 3VFFA 2PR5A 2Q9NA 3CLOA 4EEUA 4PM5A 5FDSA 1BTLA 2DNSA 3SOIA 5KMWA 1ZKJA 5CHMA 1C3BA 1S0WA 3MQQA 3UPNA 4EV4A 2WGIA 4LLOB 4ME4A 4QD4A 3CG5A 1ACFA 3IF5A 2V0WA 3VP2A 3UB6A 2WKQA 3OBFA 3BFFA 4O7DA 3ITBA 5DKKA 2XEPA 2OOLA 1GCEA 1TDLA 1ES4A 3BRMA 2KLIA 4OONA 3C7VA 3QP2A 2HDUA 4OVDA 1K4FA 1FCOA 3E98A 4DDSA 3SW1A 2EX2A 1JWVA 3HLEA 1K57A 2XGNA 4X53A 3CJMA 3ZQ5A 1VEUB 4UA7A 4ZJ2A 3ZNTA 3S1YA 2EXBA 4H8RA 3H82A 4OKPA 4WF0A 3NECA 4JXVA 2ZC3B 5HD5A 1F5MA 3FC7A 1DP9A 4NXGA 5J8XA 3PAGA 4B4ZA 4LGWA 3RTYA 3LI8A 1JVJA 1CEGA 2BTFP 2QMIA 2WKEA 3ZVTA 3VP1A 2B5RA 2Y2OA 2JN7A 5TR7A 1W79A 5GLAA 1T1CA 2XDMA 4S2PA 4Y0OA 4HJ4A 3BYDA 4G3VA 4WEKA 4L9GA 3OPHA 2KX6A 4ZAMA 1LHYA 4MN7A 1Z6FA 3M2JA 5F6AA 5EM1A 3PBSA 5FQQA 2VV8A 4S2OA 4S2LA 1K57C 2JE5A 2Y8HA 3CHWP 4OH0A 3VMAA 5J3WA 1H8YA 3KYQA 1YSPA 3HLCA 4MMNA 4WMCD 5U47A 4FOFA 2ZOHA 4IBRA 2OV5A 1FIKA 2J80A 2XF3A 2BASA 1A0KA 3G4PA 1TS6A 1YLWA 3PBQA 2LB9A 3N4IA 3T4OA 2W27A 3SH7A 2ZC5B 3TOIA 3BFCA 3VSKA 3FKVA 5GHZA 3QHYA 5TJJA 4NXBA 1M40A 4UA9A 4KQRA 3GRJA 3SS4A 5FAPA 3UB7A 1Z09A 1T18A 1DJCA 2O9AA 4E3OA 4DMZA 4FD8A 1UWPX 5F69A 2Y2QA 2XD5A 4R0QA 4I39A 2HJEA 2A24B 3MXRA 3QP4A 4JF6A 4E3MA 5MC7A 2XQZA 2B02A 4Y2FA 1XGIA 4GKUA 4E3KA 4MN5A 1D06A 3TRCA 4EU0A 3UMDA 2PYPA 3C30A 1YLZA 5CX7A 5F5YA 2ZJ9A 5E43A 3UB8A 1NLZA 3DWKA 3LR0A 3MF0A 1Q2PA 2GZAA 1BZAA 1TD5A 5FATA 3LUQA 1EI5A 2O99A 4GNUA 2WZXA 2BG1A 1P9WA 1VQQA 1VEUA 3W8KA 3WRTA 3CWFA 2XRNA 1LI9A 1W8QA 3F1NB 2ZD8A 3IHAA 1K6SA 3N7WA 3NJAA 1ESUA 5GLBA 4K0WA 3DTIA 4ZJ3A 3NIAA 3BFDA 3MXQA 1XFQA 3V5MA 4P0MA 2V1AA 1NY0A 1L0DA 4ZBEA 4D2OA 2ZMFA 2CC1A 2QYBA 1VB6A 1PYYA 5A8BA 3BY8A 3UB5P 3E2KA 3GECA 5HAIA 1G6AA 4MBKA 3UNWA 2ZC4B 2EX8A 4KZ3A 3GR2A 3H7WB 2J7VA 2YKHA 2W1RA 1H3QA 2ZMVA 1PIOA 4LRXC 5F68A 3HCYA 3QP5A 3WRZA 2HZ5A 5CGXA 1LSXA 1SHVA 1XGJA 3UO9A 2HV1A 3B47A 4CLCB 3KX0X 1NRFA 5F1GA 5EOEA 3M6HA 3T1SA 3LR4A 3G30A 1DRMA 4S2KA 3ZG0A 3IXDA 1LL9A 3GSGA 3Q7VB 4HP4A 3O86A 3WS0A 1ONGA 3AGFA 1XKZA 2IWCA 4P6ZM 1KGGA 1NLYA 3JYIA 4JGPA 4DDYA 5DTKA 3UPPA 2NUPC 3A3JA 5TFQA 1NWZA 1K54A 2VX8A 3D3OA 1SKFA 1TS0A 3T4QA 5AVFA 2Z2MB 3K3CA 4H6JB 3HJIA 5DTSA 5DFXA 4KUKA 5GHXA 5CEDA 1CK3A 4IEDA 5HWTA 2ZQCA 2EFUA 3QNCA 2A24A 4E3JA 4OPQA 3V50A 3UDFA 2C5WB 2INWA 2YKFA 1JTDA 3D4FA 1RGZA 3GQZA 5CGSA 3R4KA 2XFTA 1PFLA 3QP1A 2WGVA 4HOIA 2C6WB 4M4XA 3HLBA 5DF9A 3ZFZA 5HL1A 1TVFA 5CTNA 2VEAA 1G5UA 4LRZE 4KZ7A 4HJ3A 1OTBA 5CERA 4BMWA 3W4QA 2PRFA 1K54C 3SH9A 5CECA 4Y0TA 4GS9B 1DJBA 1N9BA 3ISGA 4QU3A 1LI0A 2GDNA 2K31A 1W63M 4L0LA 1HLUP 4EWFA 3BW6A 5A92A 5E2EA 3DTKA 3UY6A 5A91A 3F1NA 5EOOA 3MBZA 3VSLA 1WYCA 5EVLA 1ERMA 4MN6A 1SZVA 4Y3IA 5CRFA 5HDCA 4NEED 1BYWA 3C5AA 1H5XA 2Y55A 3TG9A 3UE3A 2O9CA 3JVVA 4DJ2A 4GZBA 4P6BA 1XJ3A 4Z1WA 1P9RA 2HGVA 3PXPA 4JXWA 5CGWA 2PU4A 4WEJA 2VZWA 1STZA 3H7WA 2KDKA 2FFFB 3KYZA 4N9LA 4LCLA 3HJKA 4OQHA 4CPKA 1WYBA 4EUVA 4X68A 4XT2B 1IKIA 3E4OA 4KG2A 2B95A 1YQSA 2Y2GA 4CLCA 2EX6A 4R1GA 4OQGA 5C5KA 2H5SA 3CI6A 3SS5A 4NG2A 1TF1A 4II7A 4L9FA 4HNBA 4WUJA 5FDHA 3W4OA 3VE3A 5J4EA 1FOFA 4I38A 4KZBA 4EQIA 1KVMA 3VFHA 4RVAA 1LSWA 1RP5A 1KE3A 2I9VA 1GSVA 2UV0E 4PAUA 3WS4A 5HD3A 2Y2KA 3B42A 1V9ZA 1VETB 2VK3A 4MDZA 4H6JA 4JF5A 5F83A 4HEFA 2HPBA 3A3DA 5CTMA 4MCWA 1ZC2A 1GHPA 3Q82A 2QJ5A 3SH8A 1KE4A 2AVXA 4OP5A 2NUTC 1BT5A 2J3WA 2I72A 4I3JA 4LV2A 3UDIA 1Y4OA 3G31A 3AGDA 5A90A 2W1TB 3PBOA 1PZOA 4CLCC 1FILA 3LY4A 2WK0A 4R38A 1SDEA 3LY3A 1L0FA 1N9LA 1LL8A 5DF8A 4NXEA 3FWLA 3P09A 4E3IA 3MMHA 3MQ0A 4EEPA 4PM9A 2Y79A 3BM6A 5FQKA 3C38A 1U60A 3NOPC 1TS8A 4EBNA 4Z9QA 1ODVA 1ES5A 5HX9A 1IFQA 1K25A 1NRJA 4ESPA 1IYOA 4GS9A 4N92A 4DJ3A 3DTEA 2D02A 1P97A 2M1CA 1H8ZA 1UWNX 2J9PA 3IBJA 4JGOA 5CEBA 3HUNA 1S67L 5EM0A 2H0YA 4C3QA 4PMAA 4DE1A 1CQAA 4HJ6A 4HHDA 5M19A 3A0RA 1XXMA 3T4LA 2R78A 3T4KA 4BJPA 4WZ4A 2JKTI 1KE0A 3LYXA 1K6RA 5GL9A 2J9OA 2VGLS 2XK1A 3O3VA 3HLFA 1NYMA 5DJTA 5I5LA 3LGOA 1KGFA 2DMWA 4EBPA 2WKIA 2ZC6B 3MJQA 1G28A 5FA7A 5KIZA 4OP8A 3WS2A 4PPRA 2VJWA 4R23A 3ITAA 3ZHHA 2V9AA 1MWRA 3KSIA 4YINA 4WZ5A 2R9XA 3IWQA 2VLGA 3A3EA 4LRYC 2Z6CA 4KG6A 2XD1A 4ARZB 1WA9A 1S1YA 4XT2A 3F1PB 3ZG8B 3S7QA 3S7PA 5FAOA 2GX5A 2HP9A 4DF6A 4DRTA 4DE0A
chains in the Genus database with same CATH topology
1XFQA 2W3EA 2V1AA 2ZMFA 2QYBA 3A0SA 1VB6A 4B93A 5A8BA 3O5YA 5G4ZA 1GSWA 2ZOIA 3BY8A 4IHQA 1S4RA 1JNUA 4IUHA 3ULFA 2FZ0A 4YNRA 3GECA 3LR3A 4BBTA 3LR5A 4UQIM 2L4RA 1D7EA 3KSHA 5HPIA 1ZHHB 3H7WB 3LICA 2YKHA 1S4SA 4B9OA 4GCZA 3VV4A 2W1RA 3E0YA 5DKLA 1H3QA 1OTIA 2ZMVA 4LRXC 2J3TC 1VHMA 5F68A 3HCYA 1T1BA 4UQIS 3C2WA 3FPWA 3LIDA 1LSXA 2PR6A 1LSVA 2W3HA 2HV1A 3B47A 4CLCB 1W63Q 3EEAA 3KX0X 2PHYA 4WL9A 3H9WA 4O8GA 3FPVA 3VE4A 3NOUC 3UMEA 3LR4A 4CLCE 3D72A 3PR6A 4EESA 1DRMA 3OOVA 4Q0IA 4G3WA 1DP6A 3PHYA 4PKYA 4HP4A 1S66L 5HPFA 4P6ZM 2XA7M 3C8CA 1NLYA 4JGPA 3EGXC 2QKPA 4HY8A 4R6LA 2NUPC 4BBUA 5HWWA 1NWZA 2PD8A 3LIBA 4NKPA 2OAP1 1V9YA 2VX8A 3D3OA 2W3FA 1S1ZA 4ZRRA 1TS0A 4WLAA 3T4QA 5AVFA 3EWKA 2P7JA 1KOUA 1XJ2A 3K3CA 3E4QA 4H6JB 1OTEA 4P6ZS 2XA7S 3HJIA 3CITA 1H8MA 1YKDA 2JKRI 2P08A 5K5BA 5DFXA 2PD7A 4LPZA 5IT5A 4KUKA 2OAQ1 1G6OA 4I5SA 2VV6A 3T50A 3OCNA 3OC2A 5TBMB 5HWTA 4ETZA 5G4YA 2WKPA 1ZTUA 4YWZA 3S7NA 2J3TD 2M7UA 2A24A 4KQDA 2INWA 2G7UA 3P7NA 4KQOA 1MZUA 4Y5FA 1OPXA 3EOIA 2CMNA 2YKFA 4CQHA 5HDSA 1OT6A 4JGRA 3EEHA 4EW7A 1XJ6A 3VOLA 2EA9A 4DN0A 4HIAA 3R4KA 2VA0A 4EXOA 4K08A 4HOIA 4M4XA 5DF9A 1XJ4A 4G3KA 3B33A 4NXFA 2IA2A 2VEAA 2OWHA 3BWLA 2W0NA 1OT9A 4LRZE 3KSGA 4HJ3A 3PBNA 4F3LA 1OTBA 4BMWA 3UE6A 4HP9A 4GLQA 3A0VA 4GS9B 1T1AA 3PBTA 3T4JA 4PKYG 2D01A 1F98A 3BJNA 2XROA 5AVEA 3EQUA 2K31A 1W63M 2A2LA 3K3DA 3E4PA 4L0LA 3V67A 4HH2A 2K2NA 3BW6A 4ARZA 2V1BA 2PR5A 3CLOA 3F1PA 4EEUA 3F1NA 4EETB 1OJGA 3CUEA 1TS7A 4GHIB 2QWSA 1OTDA 3IS2B 3R7WA 4I3AA 4MN6A 2QHKA 4Y3IA 3NHQA 5HDCA 4NEED 5FL3A 1BYWA 2FH5A 4GJ4A 3MQQA 3KSFA 3LFVA 4LLOB 4ME4A 2W1TA 3P01A 2V0WA 3UE3A 5HSQA 3W2ZA 2O9CA 2JKTM 3ICYA 3JVVA 4DJ2A 2L0WA 3UB6A 2WKQA 3OBFA 4JGQA 1XJ3A 5DKKA 3TW8A 5DJUA 2OOLA 1YSQA 4Z1WA 4L9EA 2KLIA 1P9RA 2HGVA 3PXPA 4OOLA 4EERA 4WEJA 2VZWA 3E98A 1N9OA 3H7WA 1STZA 3SW1A 2KDKA 1EW0A 4EQ1A 3LIFA 3KYZA 1YAXA 3HJKA 3ZQ5A 4EUVA 4IUKA 3OCLA 4XT2B 3E4OA 4PHTA 3F1OB 1DP8A 4CLCA 3H82A 5C5KA 4WF0A 3CI6A 2O0YA 1TF1A 4II7A 1OTAA 5HD5A 1F5MA 3FC7A 1DP9A 4L9FA 4NXGA 3CUEC 3RH8B 4HNBA 4WUJA 3RFBA 1LT0A 3VE3A 5J4EA 2KOIA 4GW9A 3RTYA 4Q0HA 3LI8A 2HF6A 2MJ6A 4I38A 3ZYTA 1P0ZA 2GJ3A 1LSWA 1XFNA 2JN7A 2VV7A 4OOMA 1N9NA 2I9VA 2P04A 1GSVA 2W3DA 4PAUA 4FSFA 5HD3A 1T1CA 4ETXA 4UEYA 3B42A 1UGUA 3EGDC 1V9ZA 4R3AA 2M7VA 2O9BA 4HJ4A 4MDZA 3LIEA 3OLOA 4G3VA 4WEKA 4H6JA 2HJ9C 4IJGA 4L9GA 3FG8A 2KX6A 5HWVA 4MN7A 4WELA 5F6AA 1OJ5A 3PBSA 2VV8A 2K7SA 3IBRA 4MCWA 2Y8HA 5J3WA 2QJ5A 5HL6A 5TBMA 2VKSA 3KYQA 1YSPA 4MMNA 2NUTC 2J3WA 4I3JA 4FOFA 2PT7A 2ZOHA 2J80A 2W1TB 3PBOA 5DFYA 4CLCC 5HZHA 4AFIA 2BASA 4R38A 1TS6A 3PBQA 2LB9A 1N9LA 1LL8A 5KSHA 4NXEA 2B18A 3MMHA 2OWJA 3T4OA 2W27A 3CAXA 4E04A 3MQ0A 4EEPA 2Y79A 2JHEA 5LBRA 3C38A 3UB9A 3NOTC 3NOPC 1TS8A 1ODVA 4I3IA 5TJJA 1IFQA 4NXBA 4BWIA 1NRJA 3BQ8A 4GS9A 4DJ3A 3UB7A 4BBVA 2D02A 1P97A 4HI4A 1MKMA 3DBAA 2QJ7A 1T18A 2M1CA 3H82B 2O9AA 1UWNX 3IBJA 4JGOA 4QPRA 4WN5A 5J7EA 2VGLM 4DMZA 1S67L 1UWPX 5F69A 3PBRA 3U2AA 4HH3A 4HJ6A 5IU1A 4HHDA 2EWVA 4I39A 1MC0A 3A0RA 2HJEA 2A24B 4Q0JA 5IS1A 1GSXA 3T4SA 2R78A 3T4LA 3TJZC 4GHIA 2Z6DA 2JKRM 3T4KA 3LIAA 4BJPA 5MC7A 2JKTI 3LYXA 3IS2A 2B02A 2VGLS 4Y2FA 3EQVA 5DJTA 1X0OA 5L8MA 5I5LA 2DMWA 1T19A 2ZBBA 2V0UA 3MJQA 4R70A 1G28A 3BY9A 4MN5A 1D06A 4CLCD 3TRCA 5KIZA 4EU0A 2XSSA 4O0PA 3UMDA 3G6OA 2PYPA 3C30A 5CX7A 2VJWA 3MR0A 5F5YA 5EFWA 3KO6A 4F3LB 3UB8A 1NLZA 2V9AA 5AJGA 2W3GA 3MFXA 1Y28A 3T4TA 3TE8A 2PDRA 3KSIA 3LR0A 3MF0A 2GNXA 2GZAA 4O01A 1TD5A 2H28A 3LUQA 2O99A 4HQAA 1IOUA 2VLGA 4RQ9A 2PYRA 4LRYC 2Z6CA 1P9WA 3MQOA 4ARZB 1WA9A 3CWFA 1S1YA 4XT2A 2XRNA 3F1PB 3F1OA 4KUOA 5HDDA 3F1NB 3S7QA 2LB5A 3PYPA 3LI9A 3GDIA 3S7OA 2EWWA 3S7PA 3NJAA 2L1MA 3BQAA 2WKRA 3R7WB 2GX5A 3MXQA 3JVUA 1F9IA 4YOFA 3K2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFQ A;  2V1A A;  3A0S A;  1VB6 A;  5A8B A;  5G4Z A;  1GSW A;  2ZOI A;  3BY8 A;  1S4R A;  1JNU A;  3ULF A;  3GEC A;  4BBT A;  2L4R A;  1D7E A;  3H7W B;  3LIC A;  2YKH A;  1S4S A;  4B9O A;  4GCZ A;  5DKL A;  1OTI A;  4LRX C;  5F68 A;  1T1B A;  3C2W A;  3LID A;  1LSX A;  2PR6 A;  1LSV A;  2HV1 A;  3KX0 X;  2PHY A;  4WL9 A;  3H9W A;  3VE4 A;  3NOU C;  3UME A;  3D72 A;  4EES A;  1DRM A;  1DP6 A;  3PHY A;  4PKY A;  4HP4 A;  1S66 L;  3C8C A;  4JGP A;  4R6L A;  2QKP A;  4HY8 A;  4BBU A;  5HWW A;  1NWZ A;  2PD8 A;  3LIB A;  1V9Y A;  1S1Z A;  1TS0 A;  4WLA A;  5AVF A;  3EWK A;  2P7J A;  1KOU A;  1XJ2 A;  3K3C A;  3E4Q A;  4H6J B;  1OTE A;  3HJI A;  2PD7 A;  4LPZ A;  4KUK A;  4I5S A;  2VV6 A;  3T50 A;  5TBM B;  5HWT A;  5G4Y A;  2WKP A;  4YWZ A;  2A24 A;  4KQD A;  2INW A;  3P7N A;  1MZU A;  2CMN A;  2YKF A;  5HDS A;  1OT6 A;  4JGR A;  3EEH A;  4EW7 A;  1XJ6 A;  3VOL A;  2EA9 A;  4HIA A;  4EXO A;  4K08 A;  4HOI A;  4M4X A;  1XJ4 A;  3B33 A;  4NXF A;  2VEA A;  2OWH A;  3BWL A;  2W0N A;  1OT9 A;  4LRZ E;  4HJ3 A;  4F3L A;  1OTB A;  3UE6 A;  4HP9 A;  3A0V A;  4GS9 B;  1T1A A;  4PKY G;  2D01 A;  1F98 A;  5AVE A;  3K3D A;  3E4P A;  4HH2 A;  2V1B A;  2PR5 A;  3CLO A;  3F1P A;  4EEU A;  3F1N A;  4EET B;  1OJG A;  1TS7 A;  4GHI B;  2QWS A;  1OTD A;  3IS2 B;  4I3A A;  4MN6 A;  2QHK A;  3NHQ A;  5HDC A;  1BYW A;  3MQQ A;  4LLO B;  2V0W A;  5HSQ A;  4DJ2 A;  3ICY A;  2L0W A;  3UB6 A;  2WKQ A;  4JGQ A;  1XJ3 A;  5DKK A;  5DJU A;  2OOL A;  4L9E A;  4EER A;  1N9O A;  3H7W A;  3SW1 A;  2KDK A;  1EW0 A;  4EQ1 A;  3LIF A;  3HJK A;  3ZQ5 A;  4XT2 B;  3E4O A;  3F1O B;  1DP8 A;  3H82 A;  4WF0 A;  5HD5 A;  1OTA A;  3FC7 A;  4L9F A;  1DP9 A;  4NXG A;  3RH8 B;  4HNB A;  4WUJ A;  1LT0 A;  3VE3 A;  5J4E A;  4GW9 A;  3RTY A;  3LI8 A;  4I38 A;  1P0Z A;  2GJ3 A;  1LSW A;  1XFN A;  2JN7 A;  2VV7 A;  1N9N A;  2I9V A;  1GSV A;  5HD3 A;  1T1C A;  1UGU A;  1V9Z A;  4R3A A;  4HJ4 A;  3LIE A;  3OLO A;  4H6J A;  4L9G A;  3FG8 A;  2KX6 A;  5HWV A;  5F6A A;  1OJ5 A;  2VV8 A;  2K7S A;  3IBR A;  5J3W A;  2QJ5 A;  5TBM A;  4I3J A;  2ZOH A;  2J80 A;  5HZH A;  2BAS A;  4R38 A;  1TS6 A;  1N9L A;  1LL8 A;  4NXE A;  2OWJ A;  2W27 A;  3CAX A;  4E04 A;  4EEP A;  2JHE A;  3UB9 A;  3NOT C;  3NOP C;  1TS8 A;  1ODV A;  4I3I A;  4NXB A;  4GS9 A;  4DJ3 A;  3UB7 A;  4BBV A;  2D02 A;  1P97 A;  4HI4 A;  2QJ7 A;  1T18 A;  2M1C A;  3H82 B;  1UWN X;  4JGO A;  4WN5 A;  5J7E A;  1S67 L;  1UWP X;  5F69 A;  4HH3 A;  4HJ6 A;  5IU1 A;  4HHD A;  4I39 A;  3A0R A;  2A24 B;  5IS1 A;  1GSX A;  2R78 A;  4GHI A;  2Z6D A;  3LIA A;  3LYX A;  3IS2 A;  2B02 A;  5DJT A;  1X0O A;  5I5L A;  1T19 A;  2ZBB A;  2V0U A;  3MJQ A;  4R70 A;  1G28 A;  3BY9 A;  4MN5 A;  1D06 A;  5KIZ A;  3UMD A;  3G6O A;  2PYP A;  5F5Y A;  3MR0 A;  5EFW A;  4F3L B;  3UB8 A;  2V9A A;  3MFX A;  1Y28 A;  2PDR A;  2H28 A;  3LUQ A;  4HQA A;  2VLG A;  4RQ9 A;  2PYR A;  4LRY C;  2Z6C A;  3MQO A;  1WA9 A;  3CWF A;  1S1Y A;  4XT2 A;  3F1P B;  3F1O A;  4KUO A;  5HDD A;  3F1N B;  3PYP A;  3LI9 A;  3GDI A;  3NJA A;  2L1M A;  2WKR A;  3MXQ A;  1F9I A; 
#chains in the Genus database with same CATH topology
 1IYP A;  4D60 A;  2W3E A;  4U0X A;  1DY6 A;  3A0S A;  3IXH A;  1BLC A;  2HDR A;  4Y13 A;  1JNU A;  4MLL A;  3C7U A;  1ES3 A;  1GHI A;  3LR3 A;  3W4P A;  1K4E A;  3KSH A;  4KZ5 A;  1ZHH B;  1OME A;  1PW1 A;  1VET A;  1BLP A;  4GCZ A;  3VV4 A;  3E0Y A;  5DKL A;  2J3T C;  1VHM A;  2Y2I A;  4WZ5 C;  4YFM A;  3G35 A;  4S2N A;  1IYQ A;  5EPH A;  5KSC A;  4KZ6 A;  3EEA A;  4WL9 A;  3H9W A;  3IH8 A;  3IXG A;  3OPL A;  2ZL1 A;  3PR6 A;  1MBL A;  3HLW A;  3Q1F A;  2P74 A;  3OOV A;  2E8I A;  1IEL A;  1E3U A;  1MWU A;  4OLD A;  3PHY A;  4B4X A;  1HVB A;  4PKY A;  3P98 A;  1O07 A;  4A5R A;  2ZQ8 A;  4R6L A;  4KG5 A;  2PD8 A;  4NKP A;  4QY6 A;  1V9Y A;  3IT9 A;  4ZRR A;  2JKF A;  3IX4 A;  1H0M A;  3WWX A;  1KOU A;  1XJ2 A;  5FAS A;  2EX9 A;  5E2H A;  1OTE A;  3CIT A;  1H8M A;  2Y4A A;  2P08 A;  2X71 A;  5K5B A;  1YLP A;  4IVK A;  2OAQ 1;  1G6O A;  2VV6 A;  1IEM A;  5GHY A;  3OC2 A;  3BEC A;  5TBM B;  4ETZ A;  4QB8 A;  3MKE A;  4E3L A;  4S2N C;  3BFG A;  4OPR A;  3P7N A;  1MZU A;  1FCM A;  3GVB A;  3EOI A;  5HDS A;  1OT6 A;  3EEH A;  1VM1 A;  2Y2J A;  1MPL A;  5KZH A;  4S2I A;  4FUW A;  4HIA A;  1K55 C;  1O7E A;  4UAA A;  4K0X A;  3HUO A;  3VP0 A;  2G2W A;  1YLY A;  4Y7P A;  4RX3 A;  2W0N A;  2Q9M A;  2RCX A;  3PBN A;  3A0V A;  4WMC A;  1T1A A;  5HAR A;  1M6K A;  2XRO A;  2UWX A;  1LLB A;  3V67 A;  3N6I A;  4ARZ A;  3F1P A;  4EET B;  3FYZ A;  1TS7 A;  1YPR A;  4DXC A;  1W7F A;  2ZQ9 A;  3IS2 B;  2ZM8 A;  4I3A A;  3NHQ A;  4OQI A;  5EVI D;  5FL3 A;  2FH5 A;  3KSF A;  1PZP A;  1L0E A;  2FFY A;  3D9Y A;  5CXW A;  3LFV A;  2E8J A;  3ZG9 B;  3W2Z A;  2JKT M;  3VOY A;  4Y0U A;  1YLT A;  2PBD P;  1MWT A;  4JGQ A;  4ZTK A;  5HW3 A;  5DJU A;  4MBH A;  1YSQ A;  3IWO A;  4L9E A;  4OOL A;  5DF7 A;  1N9O A;  2JKG A;  1IYS A;  1EW0 A;  4E6X A;  1WE4 A;  1YAX A;  5EUA A;  1PI4 A;  3F1O B;  3BFE A;  1SCW A;  1DP8 A;  4LV3 A;  5L09 A;  1BUE A;  1ERO A;  1OTA A;  2ZQ7 A;  4UA6 A;  1BLS A;  3RH8 B;  3RFB A;  3G2Z A;  2KOI A;  4Q0H A;  2HF6 A;  4LFU A;  3ZYT A;  2GJ3 A;  1XP4 A;  4N1H A;  3SS3 A;  1XFN A;  2VV7 A;  4OOM A;  1N9N A;  4UHU A;  2W3D A;  2V8F A;  4UEY A;  3VP4 A;  1XPB A;  3L7H A;  3CZD A;  1UGU A;  1BLH A;  4R3A A;  2M7V A;  3HRE A;  3LIE A;  3OLO A;  2HJ9 C;  4IJG A;  3FG8 A;  3KYE A;  5HWV A;  4QHC A;  2IWD A;  1OJ5 A;  1GA9 A;  2K7S A;  3IBR A;  4DXB A;  5DTT A;  1FSY A;  5HL6 A;  2XR0 A;  5TBM A;  2VKS A;  1KVL A;  2WAE A;  1NJ4 A;  4E6W A;  2PT7 A;  2ACG A;  4EBL A;  4LV0 A;  3ZCZ A;  3I7J A;  4AFI A;  5M1A A;  3CPT B;  5L07 A;  2IWB A;  3PTE A;  4KZ9 A;  4KQQ A;  2B18 A;  2OWJ A;  3NBL A;  1E4D A;  1JWP A;  3FKW A;  5JYO A;  2OLV A;  2JHE A;  5LBR A;  3UB9 A;  4HBU A;  2OLU A;  3IF6 B;  1E25 A;  1BSG A;  4R4R A;  4BBV A;  3ZG7 B;  3QNB A;  1MKM A;  3DBA A;  5AQB A;  3H82 B;  2A49 A;  4WN5 A;  5J7E A;  2VGL M;  1FR6 A;  3T1X A;  4XUX A;  2EWV A;  1CI9 A;  4Y17 A;  1MKI A;  2DRW A;  1XX2 A;  3TJZ C;  4U3T A;  1FR1 A;  2Z6D A;  3TSG A;  3IS2 A;  2H10 A;  3EQV A;  1X0O A;  5L8M A;  3NY4 A;  1T19 A;  2ZBB A;  3NUL A;  4DE2 A;  2DCF A;  2EXA A;  3BY9 A;  2XSS A;  2HP5 A;  3V3S A;  4O0P A;  3G6O A;  4GDB A;  3S4X A;  3HUM A;  3QP6 A;  2X01 A;  3MR0 A;  3Q7V A;  4F3L B;  1AWI A;  2ZMA A;  4EUZ A;  2W3G A;  1Y28 A;  3T4T A;  2GNX A;  4O01 A;  5DVA A;  3MKF A;  2H28 A;  4HQA A;  3IQA A;  5L10 A;  1IOU A;  1NYY A;  4RQ9 A;  1ZG4 A;  2PYR A;  3A3F A;  4C6Y A;  2WKH A;  3HLD A;  1K56 A;  3F1O A;  4KUO A;  5HDD A;  4LEN A;  4JKT A;  3LI9 A;  3GDI A;  3E2L A;  3BQA A;  2ZM2 A;  3CMZ A;  3R7W B;  4E3N A;  1F9I A;  4YOF A;  4X25 A;  1Q2Q A;  3K2N A;  4OPZ A;  1GHM A;  5FQ9 A;  2HP6 A;  1GSW A;  1FQG A;  3O88 A;  4IUH A;  3ULF A;  2FZ0 A;  2Z2L B;  5AQ9 A;  2L4R A;  1D7E A;  3BEB A;  3Q81 A;  4BL3 A;  1AXB A;  2Y2L A;  4JXS A;  3HLG A;  3LIC A;  4B9O A;  1OTI A;  1PRQ A;  4KEN B;  3UPO A;  4XXR A;  4BLM A;  5HFO A;  4UQI S;  4B88 A;  3LID A;  2PR6 A;  2WGW B;  2W3H A;  2Y59 A;  3DWZ A;  2ZLY A;  4KZA A;  2PHY A;  4O8G A;  3UME A;  5JYP A;  4QWO A;  4CLC E;  2BLS A;  4EES A;  3CPT A;  3IHB A;  2G2U A;  3HL9 A;  1ALQ A;  4Q0I A;  4G3W A;  4OLG A;  2QZ6 A;  2JCH A;  5TGF A;  2WZZ A;  3T1R A;  1E3U D;  2H0T A;  3C8C A;  1JWZ A;  2QKP A;  3MSH A;  4HY8 A;  4BBU A;  1ES2 A;  2OAP 1;  1ZG6 A;  4WLA A;  5FI2 A;  5M18 A;  3N8R A;  1KDW A;  3IF6 A;  3EWK A;  4OQ0 A;  4DE3 A;  2WAD A;  1YT4 A;  3E4Q A;  4N9K A;  2XA7 S;  4PM6 A;  1YKD A;  2JKR I;  4K91 A;  2PD7 A;  4LPZ A;  2JBF A;  1I2W A;  5E2F A;  4I5S A;  4GN2 A;  3T50 A;  2WAF A;  3IX3 A;  1JTG A;  1ZTU A;  3S7N A;  3MZD A;  3AGE A;  2HDS A;  3DAV A;  4KQO A;  4GDN A;  4JBF A;  1OPX A;  4RX2 A;  4CQH A;  1K0K A;  2PBY A;  4P85 A;  4EW7 A;  1XJ6 A;  3VOL A;  4DN0 A;  4JLF A;  4OPY A;  2VA0 A;  5AQ7 A;  4EXO A;  5FI7 A;  1PI5 A;  4BD0 A;  4X1M A;  4G3K A;  3B33 A;  4NXF A;  4S2J A;  4F94 A;  1OT9 A;  1RGY A;  3KSG A;  1W5D A;  4F3L A;  3UE6 A;  1L2S A;  4GLQ A;  3O87 A;  3IF6 C;  3T4J A;  5G18 A;  2D01 A;  3VP3 A;  3NDE A;  1LL5 A;  3K3D A;  3E4P A;  1QMF A;  4HH2 A;  5FQJ A;  4RYE A;  3ZG5 A;  1J9M A;  4WYY A;  2J8Y A;  1OJG A;  3CUE A;  4WBG A;  1S6R A;  5FI6 A;  4GHI B;  3ZVW A;  2QWS A;  2Y2M A;  1HD8 A;  1OTD A;  3U4L P;  3R7W A;  2QHK A;  4GJ4 A;  2X02 A;  2W1T A;  1K55 A;  3QP8 A;  2PU2 A;  3P01 A;  3OPR A;  5HSQ A;  3ICY A;  2L0W A;  2WUQ A;  3Q07 A;  4GB7 A;  1ONH A;  2V20 A;  3TW8 A;  4CJN A;  4EER A;  3UE1 A;  1KDS A;  5FSR A;  5I94 A;  4FTX A;  4EQ1 A;  3LIF A;  1I5Q A;  3GTC A;  1SKO B;  3FV7 A;  4IUK A;  3OCL A;  2Y2H A;  4PHT A;  1IKG A;  1KGE A;  5EE8 A;  2WGW A;  3NC8 A;  3MZF A;  4P87 A;  4OOY A;  2O0Y A;  3G32 A;  2RL3 A;  5EEC A;  3CUE C;  3C4O A;  1LT0 A;  3MXS A;  3HVF A;  2Y91 A;  4GW9 A;  2MJ6 A;  1HTZ A;  1P0Z A;  3Q7Z A;  3RXX A;  3ZDJ A;  1J3W A;  1YMX A;  5E2G A;  2V8C A;  2P04 A;  4IBX A;  4FSF A;  4ETX A;  3EGD C;  4R3B A;  2O9B A;  3NDG A;  3JPU A;  3UN7 A;  4WEL A;  5EVI B;  4X56 A;  3FZC A;  1TEM A;  4FH4 A;  2P9V B;  4Q8I A;  3GV9 A;  1ERQ A;  5DFY A;  2ZC7 A;  5D3O A;  5HZH A;  4ZDX A;  3A3I A;  1NZO A;  4X69 A;  3M2K A;  3HBR A;  5KSH A;  4XUZ A;  5FEF A;  4FCF A;  3CAX A;  4E04 A;  4QJG A;  3IH9 A;  3BLS A;  3NOT C;  4JF4 A;  3NCK A;  4I3I A;  1TDG A;  4BWI A;  3BQ8 A;  1N4O A;  5EV0 A;  5F1F A;  4HI4 A;  2QJ7 A;  2HDQ A;  4QPR A;  4M3K A;  3DTM A;  3PBR A;  1YMS A;  3U2A A;  4HH3 A;  3ZNY A;  5IU1 A;  1CF0 A;  4MEZ A;  1MC0 A;  2ZM0 A;  4Q0J A;  3LCE A;  5IS1 A;  4LV1 A;  1GSX A;  3T4S A;  4GHI A;  2JKR M;  3LIA A;  1YLJ A;  5A93 A;  4GD6 A;  3VOZ A;  4FH2 A;  4PM7 A;  3IWI A;  3ZGA B;  2V0U A;  4MNR A;  4R70 A;  2Q0O A;  1MXO A;  4R4S A;  3OPP A;  4CLC D;  3WS5 A;  1PWG A;  4KZ4 A;  1QME A;  3SZT A;  1ESI A;  5EFW A;  3KO6 A;  2XFS A;  5AJG A;  3MFX A;  2A3U A;  3TE8 A;  2PDR A;  2EFX A;  1Y54 A;  3T1Q B;  5IHV A;  4C75 A;  3IXB A;  1YM1 A;  1SKO A;  3MQO A;  4MBF A;  2LB5 A;  3PYP A;  3S7O A;  1L0G A;  4JPM A;  2EWW A;  4WM9 A;  2L1M A;  1K56 D;  4ID4 A;  1NXY A;  2WKR A;  3JVU A;  1D1J A;  2V1Z A;  4QY5 A;  3V3R A;  5AQA A;  4HES A;  2VGJ A;  4X6T A;  4BD1 A;  1EWZ A;  4B93 A;  3O5Y A;  5G4Z A;  2ZOI A;  4IHQ A;  1CJF A;  1S4R A;  3LEQ A;  3RJU A;  3UE0 A;  4NET A;  4YNR A;  5FQI A;  3G34 A;  4JXG A;  4BBT A;  3LR5 A;  4UQI M;  4NK3 A;  4DKI A;  5L2F A;  5HPI A;  3L9K A;  5HAQ A;  1S4S A;  1G68 A;  4S2M A;  1XA7 A;  3B3X A;  1CEF A;  4HBT A;  5BOH A;  5EVI A;  1T1B A;  3N8L A;  3C2W A;  3S22 A;  3FPW A;  3PAE A;  3V39 A;  1LSV A;  1RCJ A;  3BLM A;  1W63 Q;  2P9V A;  1MY8 A;  3FPV A;  3VE4 A;  2XH9 A;  3NOU C;  4BQM A;  3D72 A;  2VGK A;  2WYX A;  1DP6 A;  1PW8 A;  3N8S A;  3MZE A;  1S66 L;  4BL2 A;  3OZH A;  2R9W A;  5HPF A;  5FAQ A;  5F82 A;  2XA7 M;  4X55 A;  1PWD A;  5FQM A;  3EGX C;  5GLC A;  5HWW A;  3LIB A;  2JC7 A;  5EVE A;  5HAP A;  2W3F A;  2Y2P A;  5CHU A;  1S1Z A;  4N1X A;  1W8Y A;  1K38 A;  1GA0 A;  2P7J A;  1DJA A;  2XLN A;  2ZQA A;  5GLD A;  4P6Z S;  1HZO A;  3G2Y A;  3WS1 A;  5IT5 A;  4R3J A;  1F2K A;  3M6B A;  1FCN A;  2PAV P;  3LO7 A;  4RA7 A;  3GMW A;  3OCN A;  4GOG A;  1SDN A;  5G4Y A;  2WKP A;  5EVI C;  4PM8 A;  4YWZ A;  3MFD A;  2J3T D;  2M7U A;  4BEN A;  4KQD A;  3IX8 A;  2G7U A;  5FEG A;  4Y5F A;  1L3L A;  2CMN A;  4JGR A;  4IVI A;  2ZQD A;  3LEZ A;  1XA1 A;  2EA9 A;  3T12 B;  4Y15 A;  1BUL A;  3MS6 A;  4K08 A;  2OSU A;  4ZJ1 A;  1XJ4 A;  2Y2N A;  1PNE A;  1MWS A;  3DW0 A;  1CI8 A;  1NZU A;  2IA2 A;  4KZ8 A;  2OWH A;  3BWL A;  4LCM A;  4U0T A;  3C4P A;  4HP9 A;  4X1L A;  1I2S A;  2QPN A;  3RXW A;  1FSW A;  5CHJ A;  3PBT A;  4PKY G;  3UDX A;  1F98 A;  3NI9 A;  3BJN A;  4GD8 A;  5AVE A;  3EQU A;  2A2L A;  2V2F F;  1PWC A;  2K2N A;  2V1B A;  2ZL1 B;  3VFF A;  2PR5 A;  2Q9N A;  3CLO A;  4EEU A;  4PM5 A;  5FDS A;  1BTL A;  2DNS A;  3SOI A;  5KMW A;  1ZKJ A;  5CHM A;  1C3B A;  1S0W A;  3MQQ A;  3UPN A;  4EV4 A;  2WGI A;  4LLO B;  4ME4 A;  4QD4 A;  3CG5 A;  1ACF A;  3IF5 A;  2V0W A;  3VP2 A;  3UB6 A;  2WKQ A;  3OBF A;  3BFF A;  4O7D A;  3ITB A;  5DKK A;  2XEP A;  2OOL A;  1GCE A;  1TDL A;  1ES4 A;  3BRM A;  2KLI A;  4OON A;  3C7V A;  3QP2 A;  2HDU A;  4OVD A;  1K4F A;  1FCO A;  3E98 A;  4DDS A;  3SW1 A;  2EX2 A;  1JWV A;  3HLE A;  1K57 A;  2XGN A;  4X53 A;  3CJM A;  3ZQ5 A;  1VEU B;  4UA7 A;  4ZJ2 A;  3ZNT A;  3S1Y A;  2EXB A;  4H8R A;  3H82 A;  4OKP A;  4WF0 A;  3NEC A;  4JXV A;  2ZC3 B;  5HD5 A;  1F5M A;  3FC7 A;  1DP9 A;  4NXG A;  5J8X A;  3PAG A;  4B4Z A;  4LGW A;  3RTY A;  3LI8 A;  1JVJ A;  1CEG A;  2BTF P;  2QMI A;  2WKE A;  3ZVT A;  3VP1 A;  2B5R A;  2Y2O A;  2JN7 A;  5TR7 A;  1W79 A;  5GLA A;  1T1C A;  2XDM A;  4S2P A;  4Y0O A;  4HJ4 A;  3BYD A;  4G3V A;  4WEK A;  4L9G A;  3OPH A;  2KX6 A;  4ZAM A;  1LHY A;  4MN7 A;  1Z6F A;  3M2J A;  5F6A A;  5EM1 A;  3PBS A;  5FQQ A;  2VV8 A;  4S2O A;  4S2L A;  1K57 C;  2JE5 A;  2Y8H A;  3CHW P;  4OH0 A;  3VMA A;  5J3W A;  1H8Y A;  3KYQ A;  1YSP A;  3HLC A;  4MMN A;  4WMC D;  5U47 A;  4FOF A;  2ZOH A;  4IBR A;  2OV5 A;  1FIK A;  2J80 A;  2XF3 A;  2BAS A;  1A0K A;  3G4P A;  1TS6 A;  1YLW A;  3PBQ A;  2LB9 A;  3N4I A;  3T4O A;  2W27 A;  3SH7 A;  2ZC5 B;  3TOI A;  3BFC A;  3VSK A;  3FKV A;  5GHZ A;  3QHY A;  5TJJ A;  4NXB A;  1M40 A;  4UA9 A;  4KQR A;  3GRJ A;  3SS4 A;  5FAP A;  3UB7 A;  1Z09 A;  1T18 A;  1DJC A;  2O9A A;  4E3O A;  4DMZ A;  4FD8 A;  1UWP X;  5F69 A;  2Y2Q A;  2XD5 A;  4R0Q A;  4I39 A;  2HJE A;  2A24 B;  3MXR A;  3QP4 A;  4JF6 A;  4E3M A;  5MC7 A;  2XQZ A;  2B02 A;  4Y2F A;  1XGI A;  4GKU A;  4E3K A;  4MN5 A;  1D06 A;  3TRC A;  4EU0 A;  3UMD A;  2PYP A;  3C30 A;  1YLZ A;  5CX7 A;  5F5Y A;  2ZJ9 A;  5E43 A;  3UB8 A;  1NLZ A;  3DWK A;  3LR0 A;  3MF0 A;  1Q2P A;  2GZA A;  1BZA A;  1TD5 A;  5FAT A;  3LUQ A;  1EI5 A;  2O99 A;  4GNU A;  2WZX A;  2BG1 A;  1P9W A;  1VQQ A;  1VEU A;  3W8K A;  3WRT A;  3CWF A;  2XRN A;  1LI9 A;  1W8Q A;  3F1N B;  2ZD8 A;  3IHA A;  1K6S A;  3N7W A;  3NJA A;  1ESU A;  5GLB A;  4K0W A;  3DTI A;  4ZJ3 A;  3NIA A;  3BFD A;  3MXQ A;  1XFQ A;  3V5M A;  4P0M A;  2V1A A;  1NY0 A;  1L0D A;  4ZBE A;  4D2O A;  2ZMF A;  2CC1 A;  2QYB A;  1VB6 A;  1PYY A;  5A8B A;  3BY8 A;  3UB5 P;  3E2K A;  3GEC A;  5HAI A;  1G6A A;  4MBK A;  3UNW A;  2ZC4 B;  2EX8 A;  4KZ3 A;  3GR2 A;  3H7W B;  2J7V A;  2YKH A;  2W1R A;  1H3Q A;  2ZMV A;  1PIO A;  4LRX C;  5F68 A;  3HCY A;  3QP5 A;  3WRZ A;  2HZ5 A;  5CGX A;  1LSX A;  1SHV A;  1XGJ A;  3UO9 A;  2HV1 A;  3B47 A;  4CLC B;  3KX0 X;  1NRF A;  5F1G A;  5EOE A;  3M6H A;  3T1S A;  3LR4 A;  3G30 A;  1DRM A;  4S2K A;  3ZG0 A;  3IXD A;  1LL9 A;  3GSG A;  3Q7V B;  4HP4 A;  3O86 A;  3WS0 A;  1ONG A;  3AGF A;  1XKZ A;  2IWC A;  4P6Z M;  1KGG A;  1NLY A;  3JYI A;  4JGP A;  4DDY A;  5DTK A;  3UPP A;  2NUP C;  3A3J A;  5TFQ A;  1NWZ A;  1K54 A;  2VX8 A;  3D3O A;  1SKF A;  1TS0 A;  3T4Q A;  5AVF A;  2Z2M B;  3K3C A;  4H6J B;  3HJI A;  5DTS A;  5DFX A;  4KUK A;  5GHX A;  5CED A;  1CK3 A;  4IED A;  5HWT A;  2ZQC A;  2EFU A;  3QNC A;  2A24 A;  4E3J A;  4OPQ A;  3V50 A;  3UDF A;  2C5W B;  2INW A;  2YKF A;  1JTD A;  3D4F A;  1RGZ A;  3GQZ A;  5CGS A;  3R4K A;  2XFT A;  1PFL A;  3QP1 A;  2WGV A;  4HOI A;  2C6W B;  4M4X A;  3HLB A;  5DF9 A;  3ZFZ A;  5HL1 A;  1TVF A;  5CTN A;  2VEA A;  1G5U A;  4LRZ E;  4KZ7 A;  4HJ3 A;  1OTB A;  5CER A;  4BMW A;  3W4Q A;  2PRF A;  1K54 C;  3SH9 A;  5CEC A;  4Y0T A;  4GS9 B;  1DJB A;  1N9B A;  3ISG A;  4QU3 A;  1LI0 A;  2GDN A;  2K31 A;  1W63 M;  4L0L A;  1HLU P;  4EWF A;  3BW6 A;  5A92 A;  5E2E A;  3DTK A;  3UY6 A;  5A91 A;  3F1N A;  5EOO A;  3MBZ A;  3VSL A;  1WYC A;  5EVL A;  1ERM A;  4MN6 A;  1SZV A;  4Y3I A;  5CRF A;  5HDC A;  4NEE D;  1BYW A;  3C5A A;  1H5X A;  2Y55 A;  3TG9 A;  3UE3 A;  2O9C A;  3JVV A;  4DJ2 A;  4GZB A;  4P6B A;  1XJ3 A;  4Z1W A;  1P9R A;  2HGV A;  3PXP A;  4JXW A;  5CGW A;  2PU4 A;  4WEJ A;  2VZW A;  1STZ A;  3H7W A;  2KDK A;  2FFF B;  3KYZ A;  4N9L A;  4LCL A;  3HJK A;  4OQH A;  4CPK A;  1WYB A;  4EUV A;  4X68 A;  4XT2 B;  1IKI A;  3E4O A;  4KG2 A;  2B95 A;  1YQS A;  2Y2G A;  4CLC A;  2EX6 A;  4R1G A;  4OQG A;  5C5K A;  2H5S A;  3CI6 A;  3SS5 A;  4NG2 A;  1TF1 A;  4II7 A;  4L9F A;  4HNB A;  4WUJ A;  5FDH A;  3W4O A;  3VE3 A;  5J4E A;  1FOF A;  4I38 A;  4KZB A;  4EQI A;  1KVM A;  3VFH A;  4RVA A;  1LSW A;  1RP5 A;  1KE3 A;  2I9V A;  1GSV A;  2UV0 E;  4PAU A;  3WS4 A;  5HD3 A;  2Y2K A;  3B42 A;  1V9Z A;  1VET B;  2VK3 A;  4MDZ A;  4H6J A;  4JF5 A;  5F83 A;  4HEF A;  2HPB A;  3A3D A;  5CTM A;  4MCW A;  1ZC2 A;  1GHP A;  3Q82 A;  2QJ5 A;  3SH8 A;  1KE4 A;  2AVX A;  4OP5 A;  2NUT C;  1BT5 A;  2J3W A;  2I72 A;  4I3J A;  4LV2 A;  3UDI A;  1Y4O A;  3G31 A;  3AGD A;  5A90 A;  2W1T B;  3PBO A;  1PZO A;  4CLC C;  1FIL A;  3LY4 A;  2WK0 A;  4R38 A;  1SDE A;  3LY3 A;  1L0F A;  1N9L A;  1LL8 A;  5DF8 A;  4NXE A;  3FWL A;  3P09 A;  4E3I A;  3MMH A;  3MQ0 A;  4EEP A;  4PM9 A;  2Y79 A;  3BM6 A;  5FQK A;  3C38 A;  1U60 A;  3NOP C;  1TS8 A;  4EBN A;  4Z9Q A;  1ODV A;  1ES5 A;  5HX9 A;  1IFQ A;  1K25 A;  1NRJ A;  4ESP A;  1IYO A;  4GS9 A;  4N92 A;  4DJ3 A;  3DTE A;  2D02 A;  1P97 A;  2M1C A;  1H8Z A;  1UWN X;  2J9P A;  3IBJ A;  4JGO A;  5CEB A;  3HUN A;  1S67 L;  5EM0 A;  2H0Y A;  4C3Q A;  4PMA A;  4DE1 A;  1CQA A;  4HJ6 A;  4HHD A;  5M19 A;  3A0R A;  1XXM A;  3T4L A;  2R78 A;  3T4K A;  4BJP A;  4WZ4 A;  2JKT I;  1KE0 A;  3LYX A;  1K6R A;  5GL9 A;  2J9O A;  2VGL S;  2XK1 A;  3O3V A;  3HLF A;  1NYM A;  5DJT A;  5I5L A;  3LGO A;  1KGF A;  2DMW A;  4EBP A;  2WKI A;  2ZC6 B;  3MJQ A;  1G28 A;  5FA7 A;  5KIZ A;  4OP8 A;  3WS2 A;  4PPR A;  2VJW A;  4R23 A;  3ITA A;  3ZHH A;  2V9A A;  1MWR A;  3KSI A;  4YIN A;  4WZ5 A;  2R9X A;  3IWQ A;  2VLG A;  3A3E A;  4LRY C;  2Z6C A;  4KG6 A;  2XD1 A;  4ARZ B;  1WA9 A;  1S1Y A;  4XT2 A;  3F1P B;  3ZG8 B;  3S7Q A;  3S7P A;  5FAO A;  2GX5 A;  2HP9 A;  4DF6 A;  4DRT A;  4DE0 A; 
#chains in the Genus database with same CATH homology
 1XFQ A;  2W3E A;  2V1A A;  2ZMF A;  2QYB A;  3A0S A;  1VB6 A;  4B93 A;  5A8B A;  3O5Y A;  5G4Z A;  1GSW A;  2ZOI A;  3BY8 A;  4IHQ A;  1S4R A;  1JNU A;  4IUH A;  3ULF A;  2FZ0 A;  4YNR A;  3GEC A;  3LR3 A;  4BBT A;  3LR5 A;  4UQI M;  2L4R A;  1D7E A;  3KSH A;  5HPI A;  1ZHH B;  3H7W B;  3LIC A;  2YKH A;  1S4S A;  4B9O A;  4GCZ A;  3VV4 A;  2W1R A;  3E0Y A;  5DKL A;  1H3Q A;  1OTI A;  2ZMV A;  4LRX C;  2J3T C;  1VHM A;  5F68 A;  3HCY A;  1T1B A;  4UQI S;  3C2W A;  3FPW A;  3LID A;  1LSX A;  2PR6 A;  1LSV A;  2W3H A;  2HV1 A;  3B47 A;  4CLC B;  1W63 Q;  3EEA A;  3KX0 X;  2PHY A;  4WL9 A;  3H9W A;  4O8G A;  3FPV A;  3VE4 A;  3NOU C;  3UME A;  3LR4 A;  4CLC E;  3D72 A;  3PR6 A;  4EES A;  1DRM A;  3OOV A;  4Q0I A;  4G3W A;  1DP6 A;  3PHY A;  4PKY A;  4HP4 A;  1S66 L;  5HPF A;  4P6Z M;  2XA7 M;  3C8C A;  1NLY A;  4JGP A;  3EGX C;  2QKP A;  4HY8 A;  4R6L A;  2NUP C;  4BBU A;  5HWW A;  1NWZ A;  2PD8 A;  3LIB A;  4NKP A;  2OAP 1;  1V9Y A;  2VX8 A;  3D3O A;  2W3F A;  1S1Z A;  4ZRR A;  1TS0 A;  4WLA A;  3T4Q A;  5AVF A;  3EWK A;  2P7J A;  1KOU A;  1XJ2 A;  3K3C A;  3E4Q A;  4H6J B;  1OTE A;  4P6Z S;  2XA7 S;  3HJI A;  3CIT A;  1H8M A;  1YKD A;  2JKR I;  2P08 A;  5K5B A;  5DFX A;  2PD7 A;  4LPZ A;  5IT5 A;  4KUK A;  2OAQ 1;  1G6O A;  4I5S A;  2VV6 A;  3T50 A;  3OCN A;  3OC2 A;  5TBM B;  5HWT A;  4ETZ A;  5G4Y A;  2WKP A;  1ZTU A;  4YWZ A;  3S7N A;  2J3T D;  2M7U A;  2A24 A;  4KQD A;  2INW A;  2G7U A;  3P7N A;  4KQO A;  1MZU A;  4Y5F A;  1OPX A;  3EOI A;  2CMN A;  2YKF A;  4CQH A;  5HDS A;  1OT6 A;  4JGR A;  3EEH A;  4EW7 A;  1XJ6 A;  3VOL A;  2EA9 A;  4DN0 A;  4HIA A;  3R4K A;  2VA0 A;  4EXO A;  4K08 A;  4HOI A;  4M4X A;  5DF9 A;  1XJ4 A;  4G3K A;  3B33 A;  4NXF A;  2IA2 A;  2VEA A;  2OWH A;  3BWL A;  2W0N A;  1OT9 A;  4LRZ E;  3KSG A;  4HJ3 A;  3PBN A;  4F3L A;  1OTB A;  4BMW A;  3UE6 A;  4HP9 A;  4GLQ A;  3A0V A;  4GS9 B;  1T1A A;  3PBT A;  3T4J A;  4PKY G;  2D01 A;  1F98 A;  3BJN A;  2XRO A;  5AVE A;  3EQU A;  2K31 A;  1W63 M;  2A2L A;  3K3D A;  3E4P A;  4L0L A;  3V67 A;  4HH2 A;  2K2N A;  3BW6 A;  4ARZ A;  2V1B A;  2PR5 A;  3CLO A;  3F1P A;  4EEU A;  3F1N A;  4EET B;  1OJG A;  3CUE A;  1TS7 A;  4GHI B;  2QWS A;  1OTD A;  3IS2 B;  3R7W A;  4I3A A;  4MN6 A;  2QHK A;  4Y3I A;  3NHQ A;  5HDC A;  4NEE D;  5FL3 A;  1BYW A;  2FH5 A;  4GJ4 A;  3MQQ A;  3KSF A;  3LFV A;  4LLO B;  4ME4 A;  2W1T A;  3P01 A;  2V0W A;  3UE3 A;  5HSQ A;  3W2Z A;  2O9C A;  2JKT M;  3ICY A;  3JVV A;  4DJ2 A;  2L0W A;  3UB6 A;  2WKQ A;  3OBF A;  4JGQ A;  1XJ3 A;  5DKK A;  3TW8 A;  5DJU A;  2OOL A;  1YSQ A;  4Z1W A;  4L9E A;  2KLI A;  1P9R A;  2HGV A;  3PXP A;  4OOL A;  4EER A;  4WEJ A;  2VZW A;  3E98 A;  1N9O A;  3H7W A;  1STZ A;  3SW1 A;  2KDK A;  1EW0 A;  4EQ1 A;  3LIF A;  3KYZ A;  1YAX A;  3HJK A;  3ZQ5 A;  4EUV A;  4IUK A;  3OCL A;  4XT2 B;  3E4O A;  4PHT A;  3F1O B;  1DP8 A;  4CLC A;  3H82 A;  5C5K A;  4WF0 A;  3CI6 A;  2O0Y A;  1TF1 A;  4II7 A;  1OTA A;  5HD5 A;  1F5M A;  3FC7 A;  1DP9 A;  4L9F A;  4NXG A;  3CUE C;  3RH8 B;  4HNB A;  4WUJ A;  3RFB A;  1LT0 A;  3VE3 A;  5J4E A;  2KOI A;  4GW9 A;  3RTY A;  4Q0H A;  3LI8 A;  2HF6 A;  2MJ6 A;  4I38 A;  3ZYT A;  1P0Z A;  2GJ3 A;  1LSW A;  1XFN A;  2JN7 A;  2VV7 A;  4OOM A;  1N9N A;  2I9V A;  2P04 A;  1GSV A;  2W3D A;  4PAU A;  4FSF A;  5HD3 A;  1T1C A;  4ETX A;  4UEY A;  3B42 A;  1UGU A;  3EGD C;  1V9Z A;  4R3A A;  2M7V A;  2O9B A;  4HJ4 A;  4MDZ A;  3LIE A;  3OLO A;  4G3V A;  4WEK A;  4H6J A;  2HJ9 C;  4IJG A;  4L9G A;  3FG8 A;  2KX6 A;  5HWV A;  4MN7 A;  4WEL A;  5F6A A;  1OJ5 A;  3PBS A;  2VV8 A;  2K7S A;  3IBR A;  4MCW A;  2Y8H A;  5J3W A;  2QJ5 A;  5HL6 A;  5TBM A;  2VKS A;  3KYQ A;  1YSP A;  4MMN A;  2NUT C;  2J3W A;  4I3J A;  4FOF A;  2PT7 A;  2ZOH A;  2J80 A;  2W1T B;  3PBO A;  5DFY A;  4CLC C;  5HZH A;  4AFI A;  2BAS A;  4R38 A;  1TS6 A;  3PBQ A;  2LB9 A;  1N9L A;  1LL8 A;  5KSH A;  4NXE A;  2B18 A;  3MMH A;  2OWJ A;  3T4O A;  2W27 A;  3CAX A;  4E04 A;  3MQ0 A;  4EEP A;  2Y79 A;  2JHE A;  5LBR A;  3C38 A;  3UB9 A;  3NOT C;  3NOP C;  1TS8 A;  1ODV A;  4I3I A;  5TJJ A;  1IFQ A;  4NXB A;  4BWI A;  1NRJ A;  3BQ8 A;  4GS9 A;  4DJ3 A;  3UB7 A;  4BBV A;  2D02 A;  1P97 A;  4HI4 A;  1MKM A;  3DBA A;  2QJ7 A;  1T18 A;  2M1C A;  3H82 B;  2O9A A;  1UWN X;  3IBJ A;  4JGO A;  4QPR A;  4WN5 A;  5J7E A;  2VGL M;  4DMZ A;  1S67 L;  1UWP X;  5F69 A;  3PBR A;  3U2A A;  4HH3 A;  4HJ6 A;  5IU1 A;  4HHD A;  2EWV A;  4I39 A;  1MC0 A;  3A0R A;  2HJE A;  2A24 B;  4Q0J A;  5IS1 A;  1GSX A;  3T4S A;  2R78 A;  3T4L A;  3TJZ C;  4GHI A;  2Z6D A;  2JKR M;  3T4K A;  3LIA A;  4BJP A;  5MC7 A;  2JKT I;  3LYX A;  3IS2 A;  2B02 A;  2VGL S;  4Y2F A;  3EQV A;  5DJT A;  1X0O A;  5L8M A;  5I5L A;  2DMW A;  1T19 A;  2ZBB A;  2V0U A;  3MJQ A;  4R70 A;  1G28 A;  3BY9 A;  4MN5 A;  1D06 A;  4CLC D;  3TRC A;  5KIZ A;  4EU0 A;  2XSS A;  4O0P A;  3UMD A;  3G6O A;  2PYP A;  3C30 A;  5CX7 A;  2VJW A;  3MR0 A;  5F5Y A;  5EFW A;  3KO6 A;  4F3L B;  3UB8 A;  1NLZ A;  2V9A A;  5AJG A;  2W3G A;  3MFX A;  1Y28 A;  3T4T A;  3TE8 A;  2PDR A;  3KSI A;  3LR0 A;  3MF0 A;  2GNX A;  2GZA A;  4O01 A;  1TD5 A;  2H28 A;  3LUQ A;  2O99 A;  4HQA A;  1IOU A;  2VLG A;  4RQ9 A;  2PYR A;  4LRY C;  2Z6C A;  1P9W A;  3MQO A;  4ARZ B;  1WA9 A;  3CWF A;  1S1Y A;  4XT2 A;  2XRN A;  3F1P B;  3F1O A;  4KUO A;  5HDD A;  3F1N B;  3S7Q A;  2LB5 A;  3PYP A;  3LI9 A;  3GDI A;  3S7O A;  2EWW A;  3S7P A;  3NJA A;  2L1M A;  3BQA A;  2WKR A;  3R7W B;  2GX5 A;  3MXQ A;  3JVU A;  1F9I A;  4YOF A;  3K2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...