1OK3A

Decay accelerating factor (cd55): the structure of an intact human complement regulator.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
254
structure length
254
Chain Sequence
MQDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT DECAY-ACCELERATING FACTOR
publication title Complement Regulation at the Molecular Level: The Structure of Decay-Accelerating Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Regulator of complement pathway
total genus 36
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ok3A04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ok3A03
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ok3A01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ok3A02
2YRAA 4ONTD 2JRAA 3T5OA 4AYIA 4F4OC 1VVDA 2XQWC 1E5GA 1GKGA 1GPZA 1TPMA 2LOJA 2BZMA 2CG6A 2JGWA 4PZ5A 3OP8A 3R62A 3M7PA 1OK1A 4AYMA 4JHSA 2G7IA 2YBYA 3OXUD 2QY0A 5HYUB 3KZJA 1MD8A 1OJVA 2KMSA 5HYTB 5FO8C 2EHFA 5JPMG 1H04P 2WIIC 4LOTA 2MCZA 2CKUA 4B2SA 1OJWA 3ERBA 4ZH1D 1OK3A 4LOSA 3RJ3D 2RKYA 3L89M 1SS2A 2RLPA 3ZRZA 3CALA 3OEDC 2UWNA 3IX0A 2IZ3A 3NFPI 2V8EA 1QUBA 1OK2A 1H03P 1FBRA 4CSYA 1GHQB 2CG7A 4YNXA 1CKLA 1SRZA 1Z92B 1OJYA 4C16A 1VVCA 1LY2A 1Q3XA 1UOTP 4K12A 3MQLA 4FXGG 1H2QP 2IZ4A 1TPGA 1H2PP 3INBC 1C1ZA 4DJZA 4MUCA 3KXVA 1OK9A 2RLQA 1NWVA 2XWBF 2XRDA 1TPNA 2RKZA 2O39C 4A5WB 2RL0A 1HCCA 1ELVA 1MD7A 1E88A 1QO6A 5I0QB 4AYDA 1G4GA 2ERJA 3ZD2A 4KKDA 3O8EB 1HFHA 4AYEA 5HYPA 1ZJKA 3SW0X 3TVJA 1PPQA 2W81A 1HFIA 1O9AA 2XRBA 3ZD1A 5HZPB 1GKNA 2XWJI 4B2RA 2A55A 1G4FA 1U5MA 2B5ID 3EJHA 2JGXA 1E8BA 2EC3A 4J38B 4IGDA 2MCYA 1QGBA 2W80A 3GOVA 2KRIA 3IU3I 4WJG2 3GXEA
chains in the Genus database with same CATH superfamily
3WSXA 2YRAA 4ONTD 2JRAA 3T5OA 3ZLDA 4AYIA 4F4OC 1VVDA 2XQWC 4MSLA 2Y8TA 1E5GA 1GKGA 1GPZA 1TPMA 2LOJA 2BZMA 2CG6A 2JGWA 4PZ5A 3OP8A 3R62A 3M7PA 1OK1A 4AYMA 4JHSA 2G7IA 2YBYA 3OXUD 2QY0A 3FGTA 5HYUB 3KZJA 1MD8A 1OJVA 2KMSA 5HYTB 5FO8C 2EHFA 5JPMG 1H04P 2WIIC 4LOTA 2MCZA 5DN5A 2CKUA 4B2SA 1OJWA 3ERBA 4ZH1D 1OK3A 4LOSA 3RJ3D 3ZLEA 2RKYA 3L89M 1SS2A 2RLPA 3ZRZA 3CALA 3OEDC 2UWNA 3IX0A 2IZ3A 3NFPI 2V8EA 3K3TA 2Y8RA 1QUBA 1OK2A 1H03P 1FBRA 4CSYA 1GHQB 2CG7A 4YNXA 1CKLA 2Y8SA 1SRZA 1Z92B 1OJYA 4C16A 1VVCA 1LY2A 1Q3XA 2ZYCA 1UOTP 4K12A 3MQLA 4APLA 4FXGG 1H2QP 2IZ4A 4PO7A 1TPGA 1H2PP 3F6KA 3INBC 1C1ZA 4DJZA 1RLHA 4MUCA 3KXVA 1OK9A 2RLQA 3WSYA 1NWVA 2XWBF 2RKZA 1TPNA 2XRDA 2O39C 4A5WB 2RL0A 1HCCA 1ELVA 1MD7A 1E88A 1QO6A 3VWOA 5I0QB 4AYDA 3NJAA 1G4GA 5DN4A 2ERJA 3ZD2A 4KKDA 3O8EB 1HFHA 4AYEA 5HYPA 1ZJKA 4YIZA 3SW0X 3TVJA 1PPQA 2W81A 1HFIA 3CI0J 1O9AA 4BWCA 2XRBA 3ZD1A 2X2ZA 5HZPB 1GKNA 2XWJI 4B2RA 2A55A 1G4FA 1U5MA 2B5ID 3EJHA 2JGXA 1E8BA 2EC3A 4J38B 4IGDA 2MCYA 1QGBA 2W80A 3GOVA 2KRIA 3IU3I 4WJG2 3FGRA 3GXEA 4N7EA 2I2LA
chains in the Genus database with same CATH topology
2YRAA 4ONTD 2JRAA 3T5OA 4AYIA 4F4OC 1VVDA 2XQWC 1E5GA 1GKGA 1GPZA 1TPMA 2LOJA 2BZMA 2CG6A 2JGWA 4PZ5A 3OP8A 3R62A 3M7PA 1OK1A 4AYMA 4JHSA 2G7IA 2YBYA 3OXUD 2QY0A 5HYUB 3KZJA 1MD8A 1OJVA 2KMSA 5HYTB 5FO8C 2EHFA 5JPMG 1H04P 2WIIC 4LOTA 2MCZA 2CKUA 4B2SA 1OJWA 3ERBA 4ZH1D 1OK3A 4LOSA 3RJ3D 2RKYA 3L89M 1SS2A 2RLPA 3ZRZA 3CALA 3OEDC 2UWNA 3IX0A 2IZ3A 3NFPI 2V8EA 1QUBA 1OK2A 1H03P 1FBRA 4CSYA 1GHQB 2CG7A 4YNXA 1CKLA 1SRZA 1Z92B 1OJYA 4C16A 1VVCA 1LY2A 1Q3XA 1UOTP 4K12A 3MQLA 4FXGG 1H2QP 2IZ4A 1TPGA 1H2PP 3INBC 1C1ZA 4DJZA 4MUCA 3KXVA 1OK9A 2RLQA 1NWVA 2XWBF 2XRDA 1TPNA 2RKZA 2O39C 4A5WB 2RL0A 1HCCA 1ELVA 1MD7A 1E88A 1QO6A 5I0QB 4AYDA 1G4GA 2ERJA 3ZD2A 4KKDA 3O8EB 1HFHA 4AYEA 5HYPA 1ZJKA 3SW0X 3TVJA 1PPQA 2W81A 1HFIA 1O9AA 2XRBA 3ZD1A 5HZPB 1GKNA 2XWJI 4B2RA 2A55A 1G4FA 1U5MA 2B5ID 3EJHA 2JGXA 1E8BA 2EC3A 4J38B 4IGDA 2MCYA 1QGBA 2W80A 3GOVA 2KRIA 3IU3I 4WJG2 3GXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRA A;  4ONT D;  2JRA A;  3T5O A;  4AYI A;  4F4O C;  1VVD A;  2XQW C;  1E5G A;  1GKG A;  1GPZ A;  1TPM A;  2LOJ A;  2BZM A;  2CG6 A;  2JGW A;  4PZ5 A;  3OP8 A;  3R62 A;  3M7P A;  1OK1 A;  4AYM A;  4JHS A;  2G7I A;  2YBY A;  3OXU D;  2QY0 A;  5HYU B;  3KZJ A;  1MD8 A;  1OJV A;  2KMS A;  5HYT B;  5FO8 C;  2EHF A;  5JPM G;  1H04 P;  2WII C;  4LOT A;  2MCZ A;  2CKU A;  4B2S A;  1OJW A;  3ERB A;  4ZH1 D;  1OK3 A;  4LOS A;  3RJ3 D;  2RKY A;  3L89 M;  1SS2 A;  2RLP A;  3ZRZ A;  3CAL A;  3OED C;  2UWN A;  3IX0 A;  2IZ3 A;  3NFP I;  2V8E A;  1QUB A;  1OK2 A;  1H03 P;  1FBR A;  4CSY A;  1GHQ B;  2CG7 A;  4YNX A;  1CKL A;  1SRZ A;  1Z92 B;  1OJY A;  4C16 A;  1VVC A;  1LY2 A;  1Q3X A;  1UOT P;  4K12 A;  3MQL A;  4FXG G;  1H2Q P;  2IZ4 A;  1TPG A;  1H2P P;  3INB C;  1C1Z A;  4DJZ A;  4MUC A;  3KXV A;  1OK9 A;  2RLQ A;  1NWV A;  2XWB F;  2XRD A;  1TPN A;  2RKZ A;  2O39 C;  4A5W B;  2RL0 A;  1HCC A;  1ELV A;  1MD7 A;  1E88 A;  1QO6 A;  5I0Q B;  4AYD A;  1G4G A;  2ERJ A;  3ZD2 A;  4KKD A;  3O8E B;  1HFH A;  4AYE A;  5HYP A;  1ZJK A;  3SW0 X;  3TVJ A;  1PPQ A;  2W81 A;  1HFI A;  1O9A A;  2XRB A;  3ZD1 A;  5HZP B;  1GKN A;  2XWJ I;  4B2R A;  2A55 A;  1G4F A;  1U5M A;  2B5I D;  3EJH A;  2JGX A;  1E8B A;  2EC3 A;  4J38 B;  4IGD A;  2MCY A;  1QGB A;  2W80 A;  3GOV A;  2KRI A;  3IU3 I;  4WJG 2;  3GXE A; 
#chains in the Genus database with same CATH topology
 3WSX A;  2YRA A;  4ONT D;  2JRA A;  3T5O A;  3ZLD A;  4AYI A;  4F4O C;  1VVD A;  2XQW C;  4MSL A;  2Y8T A;  1E5G A;  1GKG A;  1GPZ A;  1TPM A;  2LOJ A;  2BZM A;  2CG6 A;  2JGW A;  4PZ5 A;  3OP8 A;  3R62 A;  3M7P A;  1OK1 A;  4AYM A;  4JHS A;  2G7I A;  2YBY A;  3OXU D;  2QY0 A;  3FGT A;  5HYU B;  3KZJ A;  1MD8 A;  1OJV A;  2KMS A;  5HYT B;  5FO8 C;  2EHF A;  5JPM G;  1H04 P;  2WII C;  4LOT A;  2MCZ A;  5DN5 A;  2CKU A;  4B2S A;  1OJW A;  3ERB A;  4ZH1 D;  1OK3 A;  4LOS A;  3RJ3 D;  3ZLE A;  2RKY A;  3L89 M;  1SS2 A;  2RLP A;  3ZRZ A;  3CAL A;  3OED C;  2UWN A;  3IX0 A;  2IZ3 A;  3NFP I;  2V8E A;  3K3T A;  2Y8R A;  1QUB A;  1OK2 A;  1H03 P;  1FBR A;  4CSY A;  1GHQ B;  2CG7 A;  4YNX A;  1CKL A;  2Y8S A;  1SRZ A;  1Z92 B;  1OJY A;  4C16 A;  1VVC A;  1LY2 A;  1Q3X A;  2ZYC A;  1UOT P;  4K12 A;  3MQL A;  4APL A;  4FXG G;  1H2Q P;  2IZ4 A;  4PO7 A;  1TPG A;  1H2P P;  3F6K A;  3INB C;  1C1Z A;  4DJZ A;  1RLH A;  4MUC A;  3KXV A;  1OK9 A;  2RLQ A;  3WSY A;  1NWV A;  2XWB F;  2RKZ A;  1TPN A;  2XRD A;  2O39 C;  4A5W B;  2RL0 A;  1HCC A;  1ELV A;  1MD7 A;  1E88 A;  1QO6 A;  3VWO A;  5I0Q B;  4AYD A;  3NJA A;  1G4G A;  5DN4 A;  2ERJ A;  3ZD2 A;  4KKD A;  3O8E B;  1HFH A;  4AYE A;  5HYP A;  1ZJK A;  4YIZ A;  3SW0 X;  3TVJ A;  1PPQ A;  2W81 A;  1HFI A;  3CI0 J;  1O9A A;  4BWC A;  2XRB A;  3ZD1 A;  2X2Z A;  5HZP B;  1GKN A;  2XWJ I;  4B2R A;  2A55 A;  1G4F A;  1U5M A;  2B5I D;  3EJH A;  2JGX A;  1E8B A;  2EC3 A;  4J38 B;  4IGD A;  2MCY A;  1QGB A;  2W80 A;  3GOV A;  2KRI A;  3IU3 I;  4WJG 2;  3FGR A;  3GXE A;  4N7E A;  2I2L A; 
#chains in the Genus database with same CATH homology
 2YRA A;  4ONT D;  2JRA A;  3T5O A;  4AYI A;  4F4O C;  1VVD A;  2XQW C;  1E5G A;  1GKG A;  1GPZ A;  1TPM A;  2LOJ A;  2BZM A;  2CG6 A;  2JGW A;  4PZ5 A;  3OP8 A;  3R62 A;  3M7P A;  1OK1 A;  4AYM A;  4JHS A;  2G7I A;  2YBY A;  3OXU D;  2QY0 A;  5HYU B;  3KZJ A;  1MD8 A;  1OJV A;  2KMS A;  5HYT B;  5FO8 C;  2EHF A;  5JPM G;  1H04 P;  2WII C;  4LOT A;  2MCZ A;  2CKU A;  4B2S A;  1OJW A;  3ERB A;  4ZH1 D;  1OK3 A;  4LOS A;  3RJ3 D;  2RKY A;  3L89 M;  1SS2 A;  2RLP A;  3ZRZ A;  3CAL A;  3OED C;  2UWN A;  3IX0 A;  2IZ3 A;  3NFP I;  2V8E A;  1QUB A;  1OK2 A;  1H03 P;  1FBR A;  4CSY A;  1GHQ B;  2CG7 A;  4YNX A;  1CKL A;  1SRZ A;  1Z92 B;  1OJY A;  4C16 A;  1VVC A;  1LY2 A;  1Q3X A;  1UOT P;  4K12 A;  3MQL A;  4FXG G;  1H2Q P;  2IZ4 A;  1TPG A;  1H2P P;  3INB C;  1C1Z A;  4DJZ A;  4MUC A;  3KXV A;  1OK9 A;  2RLQ A;  1NWV A;  2XWB F;  2XRD A;  1TPN A;  2RKZ A;  2O39 C;  4A5W B;  2RL0 A;  1HCC A;  1ELV A;  1MD7 A;  1E88 A;  1QO6 A;  5I0Q B;  4AYD A;  1G4G A;  2ERJ A;  3ZD2 A;  4KKD A;  3O8E B;  1HFH A;  4AYE A;  5HYP A;  1ZJK A;  3SW0 X;  3TVJ A;  1PPQ A;  2W81 A;  1HFI A;  1O9A A;  2XRB A;  3ZD1 A;  5HZP B;  1GKN A;  2XWJ I;  4B2R A;  2A55 A;  1G4F A;  1U5M A;  2B5I D;  3EJH A;  2JGX A;  1E8B A;  2EC3 A;  4J38 B;  4IGD A;  2MCY A;  1QGB A;  2W80 A;  3GOV A;  2KRI A;  3IU3 I;  4WJG 2;  3GXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...