1OKEA

Crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
394
structure length
394
Chain Sequence
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKIVQPENLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ligand-Binding Pocket in the Dengue Virus Envelope Glycoprotein.
pubmed doi rcsb
source organism Dengue virus type 2
molecule tags Viral protein
molecule keywords MAJOR ENVELOPE PROTEIN E
total genus 69
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1okeA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 1okeA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 1okeA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 1okeA03
2ALAA 1UZGA 3VTTA 5JHLA 2P5PA 4FFZA 3UYPB 4UT6A 5LBSA 4UTBA 3UAJA 5KVEE 1Z66A 1S6NA 4AM0Q 5LCVA 4BZ1A 5AAMC 2V33A 5B1CA 2HG0A 3UZVA 3N41F 4UTAA 1Z3RA 3MUUA 4GT0A 5H37A 1OKEA 4FFYA 3WE1A 3C5XA 5KVDE 1TG8A 3UZQB 5GZOA 4ALAC 4FG0A 3G7TA 5KVGE 4UTCA 3P54A 2R29A 2GG1A 3UC0A 3J27A 3N43F 2H0PA 2JQMA 5GZNA 2I69A 4AL8C 2R69A 1OANA 4BZ2A 5AAWC 3IRCA 3N42F 1PJWA 3N40F 1RERA 3N44F 3J2PA 1SVBA 4GSXA 4L5FE 4UT9A 5LBVA 3UZEC 5JHMA 5IREA 3I50E 1ZTXE 2JSFA 3C6EA 4X42A 1URZA 2JV6A 5IZ7A 5KVFE 1OK8A
chains in the Genus database with same CATH superfamily
4Y1AA 2OMVB 5CCHE 4HS8L 4JO2H 3N5AA 4Y5YA 4P2YA 3EHBB 4I3RL 1U8MA 3S0PA 4L1SA 1H3PL 4WO4C 4ZO9A 4B9FA 2EJ1A 2Z35B 4NKQB 4IBLT 4Z7WF 4YZFE 4POYA 1NFDA 4E68A 1TJXA 4L1TA 1G6RL 4K5MA 5IROA 4LOVA 2X12A 2VITB 3S36H 2BK8A 2Z8WC 2ATPA 2VUYA 5DD5H 2P1YA 3U9UA 1TQCC 5EPMB 3FH8A 1Q1PA 3BSHA 5DFVD 1E7VA 1UJ3A 3S3CB 1CD1A 3SIKA 2JJUA 3FB6B 5IB4B 5KN5B 1MIEH 5DGRA 4P4KA 2L04A 1HCYA 3MCKB 5IVZA 3BH8A 4YHMH 2VR8A 3UBXA 2VZOA 4LVEA 3HE7D 3O3AB 1GJWA 4K2UH 1P2CA 5CCKH 2OR7A 1VKXB 3TJHC 5AAMA 3FT0A 3QEQB 5GZND 5CZVH 3EXLA 2AAAA 2KC0A 5GIRA 5JHDA 4QHNB 4ZXBB 2XZZA 2X1WL 1INQB 5FFOA 1YO4A 3L3OB 4IBUA 2VDOH 3ZL4L 4BSWA 4YHYB 4WO0A 1A7QL 3OAZK 4Y4HC 5E8EA 5EEXA 4YXKH 5BZDB 2RAMA 1SF5A 1E3XA 3T0EB 3N55A 3LNHA 4QRBA 1EXHA 3SKUD 1FHGA 1S7XB 3RFRA 3H9SB 3EUUA 1J1PL 2L0DA 4D7BA 5KS9B 1ROWA 5DRWA 2BVUA 3UG5A 4EVNA 1TYJA 3RZCC 4B7LA 3HPJA 2YQGA 3QUZB 3P0VH 2NQCA 3VH8B 5JHDE 4BBWA 1QHQA 2X7LA 1UD3A 4NKDA 4FKEA 4DZBB 1BLNB 3JWNE 3RPIB 5AVZB 3MV8B 4QHMB 3CG8A 5AL0A 1TO4A 2C4XA 2GYSA 2XG5B 2BOCA 1CD8A 3NDZE 5ESAB 2K9FB 4WNSA 1QA9A 1FNSL 4FQ2L 5DYOB 4R96B 4A2GA 1HNYA 1UXMA 3TJEL 3AS0A 5FUZH 2HVJA 3BXNB 3BJLA 2DN7A 1KPVA 4W68A 3W3BA 3PWJB 3F6JA 2QADB 3CFTA 1AMXA 1R3HB 4JUSA 4OT1L 2DZEA 4QOKA 4OM1H 4WWKC 3RQ3A 1UH2A 1BVNT 1E4XI 1V7MH 3KBHE 3VFOA 1ZLEA 1IQWH 1MPAL 4U6YB 3HAEA 3UC2A 2JV6A 4HBQA 4Z7WB 1FNGB 4HIHB 1XSKA 1OHZA 4HXAL 2QLVB 5DC9B 1A4JA 1N70A 1T4WA 5CEZL 2G2PA 4P3CH 1NLBH 4C58B 5IVNA 4PREB 1MVYA 1RUPH 4N0RA 1EBAA 4G6AD 3DHUA 3HBPA 4UDTA 5MP6H 3HKFA 3VDBA 2J3SA 4N3TA 5IMOA 3BZEB 5BRZA 4LCCB 4YHYC 2FLRT 3ILPA 1IE5A 2YPLB 2LV4A 3ZOAA 2GUYA 4KKCC 4LU5H 4RWYH 4TTDD 5I16B 4JKWA 3WGVB 4HIXL 4UT7L 1JNHB 2GKIA 3JWDL 4Y5VB 3Q6FA 3IJ8A 4X6BA 3NCFB 1EGJA 3H3BC 4V33A 5DJ2A 2ICEA 3O4OC 4BCZA 1MW3A 1F90H 4PJ7E 2CUAA 4HA1A 5ESVA 2Z4TA 4OQ1A 4NZTL 1LNUB 4F8QA 4XI5D 1LO0H 1EJOH 2YKKA 2WANA 3AFLA 5EOCJ 3RX7A 3GXNA 1I9JL 1BVLB 3KDMA 2P5ED 1S5IL 4GXUN 5E1HB 1K8DB 1MHPL 5D1XE 1E5AA 2VXTH 1X5IA 1ZHBA 5AVSB 4YE0A 1ES0A 2XUWA 3S3SA 4JY5H 4DZ8A 5EC1B 2CZNA 1K8IB 2C5DC 4I88A 3RWIB 4JVWA 3GJEB 3EYOB 4OD2A 4PCTA 1EFXD 2PW1A 4PTUB 3V0VB 4AM0A 3DX6B 5B1JA 4JFQB 3V4PH 2GSGB 1HEZA 3HFFA 3TOPA 4EUPB 1XIWC 3OGCB 4PS4L 1ACCA 4LDEB 3CQQA 2OAAA 3INOA 3K2IA 4NRZB 3HE6A 3SYPA 1LEIA 2XWCA 3QHZH 1CBVH 1NDMA 2F1AA 4JN2B 1FVCB 5HYQB 2GEQA 4KH9A 4TUUA 4A2MA 4RLDA 2YOAA 4YGVA 3VRJA 1KEGH 4AG4L 3ZKXB 4TRPL 3PYCA 2VMCA 3SEPA 1HJBC 2BNRD 4PI0A 4PRIA 4V2BA 1HHJB 4BD4A 2EUZA 2VAAA 3GMMB 3B9KB 3ZHLA 4HJSA 1QSZA 3ML9A 4NO0A 3QYMA 3DJTA 4J3XA 4AZ8B 3MODH 3PGCA 1RL1A 4YE4H 5CP3A 1KULA 3VW3L 3KYNA 5C8JB 5C6PB 2UWEF 2Z92B 5CP7A 3VXTB 5AB0A 3WENA 3L6FA 2HZHA 3MUHL 1S8DA 4DW2H 1T5WA 4FP8H 1NAMA 4AEEA 3O9WC 5ECJE 3RVXC 4AH2B 4EIUA 2PW2B 1NL0H 2R27A 4LBAA 3SBWA 1PKQA 2V9TA 2WN3A 4BWWA 3T0ED 3BWZA 4RFNC 4QRUA 4LOUC 2AS5M 3QH3B 1YY9D 4GKZB 3AUVA 5GRYA 3SDAC 1JPTL 3PAUA 2W0FB 4UT9H 3FB6A 2NNFA 4QT5B 5AW1B 2OPCA 5G55A 1RZFH 4MX7A 3IMWA 4A7VA 4M02A 5DDHB 5JXAL 1BEYH 2O61B 2Z9TA 2VLLB 4AEHH 1E4WH 1Q0XL 3F64A 4IBTA 2ZYRA 2P5WE 4ZTOL 5CEXA 3M6DA 5JIMA 4HCRL 3D3VB 1AFVH 1E5BA 1G1CA 1PVHA 3HE6D 3OXSB 3W9EA 1QHPA 3I6GB 4MAYC 2E47A 1CR9H 1SEQH 3V5DA 1G9EA 4G8GD 2OMTA 2YN5A 4DETA 4JR9H 3D07A 4EOWL 1GGIL 2H7WA 3LH9A 3LIZH 5HI5D 4MD0A 5MENB 2XI9A 1F42A 5F7BA 1I4FB 4YDKH 1R17A 4HUUA 5JXEA 1PMYA 5AD0A 2VQTA 1G7IB 1JZJA 2MCPL 3SCMB 4DN4L 2OMUA 3KLDA 1U8PA 5DMGC 5AYUL 1ORSA 2IBZY 3OC8A 1U8QB 2FL5A 4FNLH 1NBYB 3OAWA 2B0SL 4XAKE 4TNWK 4ADGA 2ZUYA 5CXPA 1U8NA 1W72H 1YNTF 4GW4B 2A77L 1FYTE 3ESVF 3L3DA 4TOYH 2MNWA 1WPCA 4HJIA 4JL1A 5SX5K 3PFUA 1ZLVK 4UV4H 3MOBH 4IOIB 1LQBC 1ADQH 4DTGL 1UJ3B 1IM9B 3FQUA 1UKTA 3QUGA 5FFGA 3KS0J 4NQQA 2A3TA 1IGCH 3KLKA 3MMEA 1FJ1A 1JPEA 1PQZB 1EUUA 4FJ6A 3NACH 4OLEA 1IC4H 4LLMB 4Y4HA 2IVFC 3WMQA 5JXEC 3N41B 5D4JA 1OD7A 1QFUL 1VPOL 3BN3B 4I2XE 4OKVB 1D3CA 2ERJB 4DFIA 2VDLH 1XGQA 3EGSA 3S35L 3O3UN 1TSHA 1OZTG 3NPZB 2VXVL 8FABA 4UDUA 4Y4FC 3FQRA 1KLGA 4K0OA 5CU5A 4AK1A 4AYEC 1JYNA 5DA4A 5C0AE 4KX8A 3VFRA 5HGBB 4J5VA 2K3TA 4F7CB 1HH9B 4ZAKC 3VCLB 1DEEA 3U46B 3G5YA 4RFEB 4RMUA 5CM1A 4KO6A 4JY4A 3ECVA 2FECL 5E70A 1NEZG 1G0YR 3JT0A 4XO8A 2RH0A 2NSXA 3VGAC 1DBAL 4OGZA 1OE1A 1XR9B 1A1MA 1WFUA 1UB5B 1LTXA 3L9YA 4YSUA 3MRIA 3II3A 1RY7B 1WRFA 2NW2B 1E28A 2OX5A 5IFHH 2ZXBA 1T3FB 3QJUB 2X28A 5DVMA 2OZ4H 3LRKA 4KMLB 4JPVH 3QYCA 4LT7A 4HWNA 1JZHA 4ZSOB 2I9TA 1AP2B 3NFSH 4JQXA 3DOSB 1JHTA 4XNUH 2YOCA 3J7HA 1MPAH 4AQEA 1IBGL 3V4UL 2XQ0A 2NY4D 4EDXA 3LH2L 4U4IA 5JORA 4N85A 5EU5A 3CVIL 3D1MC 1UWEH 3O6KL 4CVWA 4HD5A 3PDOA 4NQDB 3CH1B 4LB8A 1FVEA 1GOGA 2DWEA 2OK0L 1BFVH 3NP3A 5DJXB 2TSAA 5GS2D 1EH9A 3DBXB 1T0OA 4UOZA 3MN8A 1CFNB 4JFFE 2XWTA 3SD2A 5BV7C 2HJKB 3VO0A 1X5AA 2B3RA 1MLBB 1QBAA 4LU5L 4RWYL 4DN3H 3TPUB 4JEGB 1U30A 3FZUD 5EEWA 1MFBH 2XVBA 1CO1A 5LNDA 5DHVH 1U3HA 4I77L 3GPSA 3KBEA 3OGCA 4DKFL 4P2AA 3RGVB 1DFXA 3H55A 5I8KL 3RWCA 3DOIA 4NRYA 1TO5A 2J20A 4K07A 3CPLB 3UABA 4X5PA 5HI4C 3IFNH 2GEEA 2ZCKH 4PG2A 5KJ4A 1NDMB 3CJJA 3N1FC 3AMLA 2C7UA 3VD7A 1S4IA 4DGVH 4N5UA 3VDAA 1L7TL 4WEUD 2UZYB 4LXFA 4KUCF 3DX7B 2ADJB 1AR2A 5E00B 1FLTX 5CSBA 1IBBA 4M61B 1WHOA 1F3DJ 2OKMA 3AM8A 4LSPL 4FI8A 3ZY7A 4FN0A 1DVXA 1EZVY 4G11A 3KGUA 1BLNA 1Y6MR 2MH4A 4B7IA 1IT9L 2NMSA 1EFQA 1UFGA 3FW6A 1G94A 1KY7A 3HC2A 3MA7B 1VFBB 4MJIA 4WWKA 5KANG 3ULAB 3ZYJA 2Z4QB 3LYRA 3AAZA 4KGLA 1I8IA 3O9WD 3OX8B 4G70B 4LEOA 4LQ1A 4TQ8A 5I6PA 2UZXA 4M56A 5DHVA 1BG9A 1EFXB 1QRNE 1HOCA 1U93B 4FCAA 3CN0A 5DD1H 4FYTA 4ETQB 1GGCL 5LCVL 3MOQA 3QEQA 4M7LL 3V6FB 3V6BR 4ZFOA 3VI4F 3EYUH 4IRSD 4PRBB 4B9CA 1ZCRA 3D4YA 2EH7H 5FGBC 4B41A 2WJ5A 4FOMA 5B8CC 4NGHH 2X0WA 1O9WA 3OJDB 2Q86A 3N2JA 2PXYD 2E6QA 1AZBA 4BKLA 4K55A 1J18A 1IGMH 1D2PA 3OLGA 3WDIA 5EBLA 1PEWA 1RHFA 5B38G 1ZHNA 1CFQA 5G4MA 4XC1L 3P4NA 3VSQA 5CNHA 4Y16B 4OZFH 3MUGA 4JN2A 2WXHA 3I9GL 1H6EA 3IXAA 1PJ9A 2B4CH 2ZCLL 3QXDA 4FQ1L 4JE0A 2W95A 1AQKL 2YK1H 2UUDH 1QBMH 2PR9A 3BKCL 4YFLF 1KJ2B 2C9VA 5D1QA 3TYGH 1N9PA 5CMAB 5JMOC 5DS1A 2VJ0A 4UI2A 3QDMD 2JJTC 3U6RB 2Y2YA 4HKXA 4NQEA 3HA0A 4UT6L 4B9YA 1ZT1B 4S0SD 4R6UA 3WHXA 2QHLA 2PTTB 1WC7A 2VQ1B 4FFVD 4AEIH 4CDGC 3AGVA 1NCBL 1U8IB 2WZ6A 5C70A 4WENB 2JF1A 2YPLD 1EEZA 4L3AA 4NNPH 1BQ5A 3NN8B 4UUJA 5CP7B 1DJXA 4P5TD 2WBJD 1KPVB 3B9KC 5MI0B 1TTAA 4G8GA 1HWGB 2N0MA 4A6YL 4ZMTA 2KLSA 2AJSL 1I1FA 4PRHB 1KT2B 5EOCL 1ZEAL 1U3HC 4ISVA 4YC2B 2AQRA 3I75A 3O0RL 5D1QE 3ZTNL 5T1LD 3UAAA 1E4WL 1ZLUH 5CJQH 5CJXA 2FATL 4Z3GA 2XWBA 3ATAA 4JZJB 3ROOB 2KH2B 3B2VH 1TQTA 4IOIA 5DHMC 1J0ZA 1P6WA 3NA9H 3FFDA 3IU3A 1MWOA 3L3OC 5AVVB 4XOEA 3EH4B 2HRHA 3GIVA 4R4BB 1ACYH 2NUTA 5LHDA 3D2TA 4FXGA 4XMKL 2XA3A 4HZAA 3BP7A 4GIPD 2J1KA 2XIDA 1NCAH 3D0LB 1L9MA 2YUVA 4Y9FA 3KXFB 2UZIH 1AGFA 3DX8B 3BAYA 5EU6D 2FWUA 2W0KA 3I3EA 4ELKA 3AS3A 1ZLVH 1EJOL 3B6SB 1CXLA 1JGLH 2DDQL 5HI3D 5JLZB 3NTCH 1PIGA 1SLUA 2WVVA 4E5XA 2AEIT 2B1AL 4ABQA 2E7MA 3HVDA 1F3RB 2BVTA 4I18A 1WO2A 1OTUC 1NGXA 1MCPL 1ZVYA 4EKJA 4K3EH 4M6OH 1MH5A 1RK1A 4A67A 1KLFB 3S3JA 1B9ZA 3MRDB 2AEOA 1RIVH 2PWGA 1SUHA 1NMAH 3HPLA 4LLVA 1VCAA 2ICCA 3H54A 3S6CA 4Z3JA 1MRDH 5TPWL 2AXHA 2PR4L 4FZ8L 4DEPB 1NGQH 2A99A 5FM5M 1JPSL 3V6OE 5BJTB 4JFED 3MLSH 1Y6NR 2YFOA 2BXZA 5J11B 5F71A 2ID5A 2VDRB 4O02B 2NDGA 3NACL 1IMHC 1KZYA 1FQ9C 3WUWA 5AB2A 2KZ1B 1XSJA 3QS3A 1M7XA 3ARFC 5IJKA 2ICWJ 5DMIH 2F8VA 1MWAA 3DOHA 4GAYB 3OJVC 1UB6B 1I1AA 1XCTA 2ZX9A 1H3UA 1GOFA 1S78C 4Z0XB 4AVHA 3KPRB 4UIKL 1RZJC 1HZHH 5BVPH 3MV7D 4OSUL 3D3VE 3F85A 3H3PH 3RX8A 4DERA 1Z66A 2CH8A 2HTLC 5IMLA 5IBUG 3EF7A 1IVLA 4GY4A 4UT7H 2C9XA 3HTLX 3PGFL 2NY5C 1PG7L 2WZPD 6FABH 4IU2A 4TRPH 4FG6D 1DQQA 4J3OG 35C8H 4ZUWB 2J2ZB 3ORJA 4GOSA 4B96A 3OKLA 5E9AA 2KZBA 5DRXA 5EHFA 1GZHA 4FADA 5IF0B 4BE6A 1JZ7A 4WHYH 3VFMA 1ED3B 2QLYA 1O9ZA 4JM2F 2CM5A 2EIBA 3QJOA 5CO1A 3CFBA 1N0LB 4YHZL 4LOFA 1BQSA 1YNKL 1DQKA 4ZTEA 2ZG2A 3NRQA 3QR2A 3BO8B 3N41F 1W80A 3OKDA 4WTQA 4X50A 4ZUSB 3G6DL 2V7NA 4YO0B 4OGQC 1MRCH 4OGAD 5J6HA 1IC0A 3GSRA 4JRYA 2EEDA 1CYGA 5AB1A 3CFEB 5D9SA 5D7IF 1AQ8A 3F7VB 5GGTA 1NSNH 5HHME 2HN7A 4E5XG 1AMYA 1ZANH 3TA3A 5IJCC 1KMGA 4ZFGL 1BOGB 1TCRA 5IZ7A 5D72H 1WWCA 1KJVB 4IRSB 3CFJB 3BDYH 4IMKC 1RV6X 4OJFL 2A73B 5EUOB 2CBMA 4OZGA 4IKIA 3RVVC 1WT5A 4HEPA 2HFGH 3G6AB 5C0JB 1TQVA 5JUEL 3UJTL 4NZUH 4LLAA 2YUWA 4IEFB 5KN5A 1ACXA 5TDPB 4R7DA 2G2RA 2VXUH 2DLIA 3FT9A 2KLTA 4HS3A 4PGEB 4LPCA 1BFSA 3LQAC 4CADA 2BSSB 4L1LA 4ZUUA 4B3EA 3NPSB 4N2GA 3AAZB 4PJDF 3VRIA 2G9KA 3VU2A 4TF4A 1DUYB 3HOGA 3BMVA 3BKML 2EXSA 4NQSB 4S1SL 2VDNH 4I0PB 2D0HA 5DD0H 3SBQA 4JFDE 1BW8A 5JUEH 5FYLD 4XHQA 5TDOA 3U1QA 1TYRA 2H26A 4ENZA 1C16B 5I8EA 4BA0A 5CN1A 1MHEB 3C5ZC 4PP2B 3ZE2B 2VLKA 3RGVD 3OF6D 4KRNA 2WO4A 4Q6KA 5F9WC 3HI6H 3V0WL 5EH1A 2HTKC 1I1YA 3ZKSD 4U6TA 4LCYA 5C86A 5GZOD 1C5BL 5I6XB 3FUMA 4P3DA 5A6IA 5BQDA 1YQVH 4MCNA 1DN0A 2QSQA 5FCSH 1MOEA 1MZYA 4LMQE 4N28A 1G6RA 1UWXK 1XR8B 1NMCB 1NDTA 3MLXH 4IBSA 1G7QA 2ZCHL 4WGKA 1OQXA 5T33H 5SWSB 2OMUB 2V2XA 2Z31D 4H8UA 3HUJF 2WKOA 4ZK8A 5I2IB 3PQYB 2H32A 5E2TH 2FB4L 1YAIA 4ZUVA 4PH8A 3KEDA 4G72B 5JYLA 3KYKL 5KS9F 3OPUA 3HI5H 4MXVE 2FZ3A 4KHXL 3KJ4C 3UMTA 2MNJB 3WOVA 4PS8A 3SDXE 5DWUL 2GK0A 1T1YA 4ZSOA 3X3GL 4XMWA 4M7ZC 2CIKA 1RZKH 3GEFA 2ICWA 5D1QD 1ZHKA 2W60A 2VLRE 3CN3A 2Y23A 4LGSB 2B15A 2PYEB 4OZIF 4BFBD 4BGDA 2VDNB 4GW5B 5F6IB 3LQMA 1O0VA 5INCA 4YDIH 3RNQA 3U0WH 4XB7A 3DX9B 4LF3A 1DP0A 1TG8A 2FEJA 3KPSE 1PZSA 1RK0A 2Y4SA 3PE9A 4UQ9A 3AT8A 4I9WE 2Y2WA 4NN5C 4G43A 5DUMH 3N42F 1ZPLA 1C8QA 3PHSA 4I5BB 1CGWA 1R19A 4JG9A 5JQ6L 5MEPA 3KPPA 1FFPB 4OH2A 4QXVA 1WE5A 4P4KD 1MCWM 5FGCB 3FOMA 4K15A 3GTVA 3GIVB 1E9QB 4R4BA 4BH8B 1BQUA 1Z9LA 2H4EA 5J1TC 4RSVA 4X4XA 3MRMA 3Q5YA 3OLEA 3ELQA 3GSQB 4K9EC 3EG9B 3EO0B 4PJHF 3WXWH 5AZEL 4J27A 3M1OA 4N2MA 4PGBA 5CR1A 3WTYA 4KQ4H 5AAPA 1XF4A 1FZMA 2C3HA 3X3FH 1IBGH 3V4UH 4DTGH 5C7XH 4D0DA 4DP1X 3JTSB 3CDGB 3KW8A 1UWEL 4F7CA 5L8JB 3ZYZA 9PCYA 4C4KT 2BNUB 1WAAA 1CGXA 1YEWA 1IRAY 2AJSH 4UM9B 2VIRA 2R2HB 4K71B 3ILQC 2GIYA 5ALBL 5I76B 4TUKL 4ATWA 2F2HA 1CK0H 5HGHA 1PZ2A 5LWYH 4PJ8A 2WXNA 2SODB 3B2VL 4NUQA 2Q6WB 3TL5A 1ETZB 1E5CA 3K2MC 3O6ML 4MQSB 5KOVC 1LK3H 1NAMH 4AYMC 3KVDD 5K59F 4OCWH 2DQEL 5E8DL 4EO5A 1PGRB 3BQVA 4Y2DA 2ADYA 4NP9A 1WTGT 4PI2A 5KTEH 2A9CA 4FAAB 4NC2B 3AY4C 5T1DH 5IP4A 4MCZB 1J0JA 3GPEA 3V5KB 3QUMA 4JM0A 1PLGH 5E8OB 4BZ1L 3VGAB 2NY0B 4EI5C 2Z34A 4JB9L 2HFFA 1I8LC 4BQ8A 4DGYL 5JDJA 1LEIB 3VSVA 1FE8H 1HHHA 2ZXDA 1WZKA 1PCSA 4ZUWA 1S9WB 2EO1A 1FIEA 1KCVH 3D0LA 5BOPA 2QGEA 5F88B 1F11B 3RWDA 5ADPL 4I48B 2G3MA 1X5LA 1DBJH 1EDHA 2XVGA 4APQD 4BCYA 4PJXF 1IM3D 4Z5RB 1J0IA 4Y1AB 3RPKA 1M53A 5DHYA 1F4YH 1ED3A 5EN2B 4DP0X 5EZIH 2XQYK 1JN6A 3POHA 2PO6B 4Z95L 1BBJB 3HJEA 1INDH 1FPTH 4MJID 2XY2A 1Q0XH 1N10A 4X8XA 1WWBX 1UADC 3QCTH 2X4QA 3SE8L 1GIGL 1NGWB 3LXBA 1Y6KR 4XNXL 5SV3A 2PTTA 4DHLA 4RISH 2WO3B 3NQKA 2CRIA 3NCMA 4X0KA 4XP1H 5KYWB 1G9NC 3SPVA 3D25A 3UAFA 2DV6A 3CU7A 1XMWA 3EYFA 2FJUB 3FQNB 4U6XA 3DX7A 3NRPA 2NQDA 3RGBA 4BIKA 1FL3B 4JG5A 5IW3A 1F3JB 1YMMD 3QRLA 3IRPX 4QHKI 2DL9A 5KSBB 35C8L 4XVSH 4U2YA 3G6AA 2DBJA 4MA1B 3A47A 4U1MA 4BEIA 1WCBA 5D2LE 4NNYA 4YDKL 2IPTL 3O8XB 4DO4A 2X4OB 5B7EA 4MS6A 4ZAKB 3QHFH 4Z3HA 3PG2A 2DLTA 2Z4QA 2LT9A 3NJHA 4QXTA 4AT6B 4EBQH 5IQ9B 4IKNA 2E7CA 3JQOB 3OJDA 2E27L 2JKWA 2CHNA 2FT8A 2YC1A 2QFRA 5FX3A 4EDWL 4TOYL 4YSQA 2K4WA 4EN2A 4JKMA 3EH3B 2Y6SD 1R5IA 1AG0A 5D7JB 4W9HC 3BAEH 1MCFA 1ZHLA 4XX1G 3N1MC 2GTZA 5EIQA 5K39A 3QQNA 3SBRA 1I3GH 3CFBB 5DHXB 1SGKA 4B53A 1EO8H 3IMUA 5AOLA 4PHXA 2CR3A 2BVQA 2Q8BL 3DBSA 4P2RA 1X5KA 5IVXA 3MCLL 4TVUA 3ZIYA 4O2CA 1MFDL 4NOBA 3HG1D 4NUPA 2FATH 2R56H 3WTSA 3OLDA 2P48B 1CMOA 4U1KA 4F9LC 1PF3A 3VD4A 1JK8B 1LJMA 2QBWA 5CSGA 3K6SA 5GSRA 1BVLA 2Z0UA 2ZKYA 1O75A 1SYSB 1DBBL 3IAGC 5AZ2L 3DIVA 1YEHH 5E9DD 3LMJH 2LLNA 1MJJA 3REVA 1IGML 2F18A 1USQA 4UTBH 5BJTA 3IJSB 3Q2LA 2HLFC 1EZSA 1AD9A 1CFSA 5EZLB 3UJJH 4NO3B 4FYRA 1DQIA 1HKFA 2HWZH 4U1NA 4HDIB 1B0GB 3HE7B 2EZ0C 2DMBA 5GS0C 3QO0A 3ARDB 4Y1TA 4L8DA 4OCYH 1UWXH 4GUPA 3SHSA 3DXAB 4AMWA 2BINA 5GJTH 1RZ7L 4HCRA 5JHAA 1PFCA 4Y88A 1WBYA 3L5JA 3D30A 2F54A 2OZ4A 5DJCA 1CDYA 1KCRL 1NCBH 3L3JB 5FDWA 1OSYA 5I8EB 2J25A 3CXHJ 5D7LD 3DA0A 3TV3L 4HLEA 4OBRA 4HT1L 3EDFA 1KYAA 2F58H 3KXFA 3UPAA 3QHTC 2HJFA 2IH3B 3CXHK 1UENA 5HGGS 2FJFA 4G6FD 3OSVA 5TJWK 2ZCHH 1M1XA 5D8JH 4NC0B 2D0FA 2DKUA 4Z3IA 4WUUA 3QCUH 4FQCH 2KERA 2YPVA 1J9RA 4R4NC 5DJYB 3KE0A 4Z7OE 4LLDA 4AVKA 5IG7A 1KIPA 4D0CA 1W0VA 5IB3A 4IOFD 1T1XA 3L7FB 4OI9A 3LKSB 2K70A 3MV8D 1ZA3A 2GC4C 3H2QA 3NK4A 4G9FB 4LCWD 4UOJA 4MXWL 5C0AB 2JKIS 3H3PL 3RVUD 3SQBA 4M7ZB 2GITA 1KB5B 3CSPA 4OQTL 1EHAA 1WAEA 3HS8A 2QEJA 2W65A 2XQBL 4JL2A 5I1EL 1UEYA 4I18B 4PP1C 1YDPB 2LHAA 3ARBC 3WY3A 3OVUB 1EJ6A 1Z5LA 3DO7A 2ZJSH 2PPEA 1QATA 5T5NF 3V0IA 2E7BA 2YGNA 4WNJA 1SFHA 2G4EA 3AACA 2CKBA 4NBYB 4LBEB 5JOPE 1MCQA 1T22B 2W91A 3T1WA 2G9HA 3KNBA 1OCWH 1CLCA 2HUHA 2R2EB 1RIUH 2XTSA 4R5VA 5EUOF 5SWSD 3ZBMA 2X4TA 5IEHA 2FHBA 1MJUH 1I8UA 1MKFA 1FZOA 4O9HL 3RI5K 3TBSA 4AY0A 3P3UA 4O2EB 3TPUA 4AYBA 3JWNH 4ZMAT 4XMXA 2EKSB 2DQHL 3EJJX 1OVZA 4LSRL 1ZGLA 3WN6A 4YK4B 5C92A 2EC9U 3IDJA 1UZ8B 5IMMA 1CFMA 1DLFH 5DC4B 1CXFA 2Q87A 4WWID 4FQXC 5FUOL 1DVYA 3LEYH 1I8MA 2XRAL 1A1OA 4M6NL 3BSZH 2LU5A 3TM6A 4JFFB 4S10A 1G9ML 2FJGA 1HE7A 5FA3B 5IESH 4MJIE 3ARGC 2FR4A 2C26A 2C1PA 2M26A 3PS6A 1EGJL 2ITDB 3G9AB 4K9JA 3QT2A 2ORBH 1E4HA 4AH2A 3A6CL 1YYML 5AB9A 2EXTA 3DURA 4J12A 4F7PB 1BJ1J 3O0LA 2CDGB 5CUSH 3RKDC 1QRNA 2MPVA 3CFJA 4TV3A 5DFTA 2QMJA 4L29A 5D93B 3IDGA 3RL2A 5F70A 4XNAA 3UIYA 2E9BA 5HJGA 1P4BL 2J43A 5F7YC 2ZICA 2YPKA 3O41B 4XBEH 1U8OA 3GYRA 4WDIB 2WNXA 3MMEB 4K3GA 3ZKNC 4EI5A 1N3NB 2VLJA 3IN2A 3F7YA 5IT2L 3TZVC 3BZFB 2DJ4A 5JDSB 2Q5BA 5D6DC 5TDNA 4TSCH 1J8HB 3MOAH 1MXDA 4POUB 3WNPA 4YJZL 1TVHA 4N24A 3T3MF 2H1XA 4LHUD 4EZMA 3CAFA 1JV5B 2YMTA 4GRMB 1T2QH 3X2QB 3JV6A 1T0MB 7FABH 3KLLA 3DK0A 3VGFA 5AOKA 1N5YH 2X4OA 3CDFA 4XVUD 3PFQA 4YR6B 4GP8B 4S2SA 4AQ8A 2XQYG 3KCWA 3CX2A 5E1IA 1FDLL 1QFWH 4PG2C 1DUYA 5CF3A 4LARH 1EIBA 1C1EL 1DJHA 1JERA 3H9SE 2R69L 1IFHL 2R29A 2ZOUA 3AWEA 4AEFA 3W82A 3STLA 2ZWNA 3LZNA 4LSQL 4MCYA 2FT6A 4U1JB 4XRCB 5EU6A 5A6MA 2VO5A 4P23A 3MCYA 2K7PA 3QNXB 3CUPA 3ZZQA 1HJCA 1F6AB 4MSWA 2D03H 2H41A 3WKNA 4A63A 5TE6L 1HINH 3X14A 2QR0A 4JG0H 4AV0A 1U95A 4PJGA 1UUSA 4WKZA 1L7IH 1YC8A 4RGOL 4YDIL 1VZHA 1D9KA 2YQ2A 4PJ8C 4YBLB 4KHTL 3ILEA 3ZL1A 3N43B 1LHZA 4X99A 1UD2A 4JN1H 4MZRA 5I1LB 4JQIL 5C0CA 3B4NA 4XPHL 4K3DH 2BP3A 3RLSA 2P8LB 5J6SA 4KPHH 3H9SA 1HZKA 1BP3B 1OHQA 4GMSL 5ITFA 1N0XH 2DYPA 2BCKB 4R3SB 1URLA 1KJ3H 3EGSB 1KPRA 4P2RD 4L2YA 1C5BH 3RNKB 3QJHA 4C8XA 5SWSA 2ZKXA 1WAPA 2YGPA 1M2VA 5GGTH 2ZUTA 1TEGA 1CLZH 1O7DC 4JPKH 2ENPA 2XX0A 3VMOA 1CL7L 2DQTH 5CZVL 1UM5H 1LO2L 2ZWSA 4GT0A 2GK0B 5K1JA 2ZX6A 4YSRA 4CBPA 3CFMA 1JDAA 5ESQA 4NM4H 1A4BA 5DZPA 3BE1H 1JPSH 2Y7QB 4BFFA 2UVFA 1F97A 5IB1A 4K4KA 4JO3H 2OBGA 3VD1A 2YKLH 3TZVD 4OFDA 3V0EA 1NGZA 1JVOA 1J10A 4OKDA 4Y5XC 3WYRA 1PZ3A 4UANA 3ZIMA 1H15B 5C9JB 5EF2A 1LEKA 2LFGA 4PV9A 1W0WB 2HFTA 1KB3A 3GF8A 1T20B 3VJ6A 5C08B 2AQ2A 1C9SA 3QNZA 3MLWL 3LV3A 3BSGA 1OPOA 4U6VL 4IBVA 3BIBX 3ZZSA 3ZQ9A 5CJOL 3MGOB 3DRQA 3WUWG 1DVFD 3JTTB 3CSYB 3LS4H 5KSBE 4PUBH 2W80C 3LKOA 3R8BB 1G9NL 2H5UA 1QUNA 5TK4A 3T0XA 1BBJA 1KEMH 4I8DA 2NXZB 5CINH 1GGBL 5JQ6H 1VERA 3RPBA 2PWHA 4R4FH 5DSCA 1PLGL 3FSWA 3UTZB 3FQTB 2VZ1A 1DTUA 1MJJB 1O5DT 3PHAA 2BZ7A 1SJVA 4XP6H 1ZTXL 2IJ0C 5B3JE 1RK7A 3V4PB 4EUPH 4Z77A 1OAYL 5BO0D 3GD1C 4G8AC 2XYCA 4F3FB 4OCLC 3D39E 1SOQA 2MQGA 2EDFA 3PP3H 2FO4B 2G30A 2NY1C 4NQXA 3U0TA 2V17L 1OAQH 4U7MA 1FLRL 2YD4A 4HWZA 2ZOKB 3K91A 2F58L 2CJUH 1RJZA 1JXGA 4ZFGH 2CALA 2CKBB 1CGYA 1E6OL 2QVFB 1JGEA 3IDYB 5L2KE 5D8JL 3TBVB 5FF6B 1KGIA 1NKRA 2DOCA 5AWNH 3WELA 2DQDL 1MAKA 2VRQA 1C5CL 1QNZL 5H35B 3I3BA 2QVIA 5DTFA 4AT6A 2RR3A 2VC2L 1ORQA 4JRYE 3VFMB 4FXTA 4X98B 3KBPA 2QQQA 3L1OH 5CILL 3QRBA 2IDCA 2YAPA 4TMPA 2I27N 3F6LA 4YDMA 3IJEA 3OAZH 4UU9A 1XSIA 5PCYA 1KXVA 3RWIA 4RZCB 1BZ8A 4OCWL 4AWJC 4I89A 1NC2B 3X1GA 3O2DA 3ZU8A 3VH8G 1JF1A 5IG7B 5KBKA 3FRUA 5L2KA 3T09A 1I85A 3UAJC 5K9QI 2IWGA 1G5GA 2JXMB 2A4ZA 1ZT7B 1VFBA 3LSOB 4N9GB 4BELD 2IBGA 3ME0A 3NN8A 5AW6B 1S46A 4BZ2L 3DXAE 5C0EA 2ZKHH 3SCMC 3ARFA 1U8MB 1XF2A 2VC2B 5D7KE 2Z31A 5JO5B 3FTVA 2NXYD 3QO1A 1GZHC 3AREC 4KTDH 4GSUA 3WS6C 4DGIL 4QXGH 5F21B 4OFVA 2LAAA 3DVNB 5CHNB 1CT8B 1SM3H 1HZLA 3KH4A 3UBHA 4NO0D 1SJEA 3IDNA 4CNIB 3MJ9A 3L45A 1QABA 4DAGL 4UIMB 5EG6C 2OQJA 5A2JH 2VDMB 4G6MH 3M7OA 4YEEA 1AGEB 5GZOA 5EZIL 1E5ZA 1Q0YL 5KG9A 3CFDA 5DUPH 1GMIA 3B8YA 1AZRA 4KDTA 3TNMB 1KB5H 1ZHNB 1O6SA 5F9DC 5IBLD 5EUOE 2O6PA 4XNBA 3FTWA 3R8QA 1BHGA 3P1VA 4AIEA 1L3WA 4PJIE 4TUJA 3TTYA 3ZT5A 3GT6A 5D2LA 1L3NA 4UAHA 2ZONA 5E7FA 2C3VB 1L5GA 3OHXC 1JV5A 4QHLB 3L9EA 1CBVL 4Q9RL 2D7NA 3EGDB 3QQ3A 4LSTL 2XPGA 2BJML 3KXFD 2Y25A 2WVVB 4FQHA 4H2AA 1E3FA 3A6CH 3FB8A 3FMGL 1I31A 3RRQA 4AGPA 4U3XA 1RZIB 2FUQA 3IM1A 5F7DB 1VAHA 4NJ9H 2E74C 5AALA 2EDDA 5IV2A 5C0RH 4P2RB 5ERWA 3S2CA 2FJGB 1HEHC 5D7LB 3CMGA 1ANUA 2LVCA 1S9XA 1PSKH 2R4SH 4M1GH 3QFJA 3U30B 3QIBA 4G42A 1WCQA 1PCXA 4HEME 3NRFA 1I9IL 4R7NA 2IMNA 1CU4H 1DHKA 2QR0B 1FG2B 3NEOA 5DGQA 5DR5H 1NGPH 2BOBB 3MV8A 1CFTB 1NM4A 2ITCB 3P77B 4M7KH 2CK0H 1NL0L 4JZJA 3E7JA 1D9KB 4ZO8A 3QJTB 4P5TB 1QYGH 3GSWB 5IFJA 3FRPG 4NZRH 1EXUA 1OLZA 3NJKA 3MI6A 3B8SA 3T8XB 4U1NB 1O9VA 4Z7QB 4I1PA 3BPLB 3BI9X 2WUBL 1TEYA 3VXQA 4AMXA 1FNEB 1YN7A 1RUPL 2BY2A 2F61A 4HJJH 1PDKA 2BIPA 4IHOB 4WCYL 1OSZA 1CGTA 4MKTA 1IILE 2CCVA 4PJXB 4XB8A 2EDRA 2DQGL 5EZJB 4WFFD 1BA9A 3BISA 3EFFB 1HU8A 3MREA 2Y7NA 1FYTA 2XZCH 1BX2B 1JPFB 1J5CA 1YUHA 3UTPD 1BIIA 2FO8A 3O2VL 3WSQL 1TIUA 4BCXA 1WV7T 1WFOA 2Y7QA 4WO4B 1OD9A 3CHRA 2BNQE 5E1QA 1KV3A 3LVEA 4UDTB 3OQRA 2PCXA 3BO8A 2V5MA 5DVKA 1FFNA 2APSA 3AREA 4UTBL 2AV7B 2GI0A 4NWUH 4FC3E 2R23A 3U1SL 4WUUB 1UWGH 4GS7C 4CSPA 1PZUB 1L9OA 1R9FA 1WBZB 2R2CA 4OCNC 2F7QA 3ZSTA 2YAMA 1KIPB 2R4RH 3P0YL 3QDJA 4Y8DC 4WEEA 1WFMA 3C6LA 1HNGA 1IL1A 3APCA 4HH8A 5ICUA 4XH2A 3FH5A 4JKPH 5L8KB 5J4MA 1N2RB 2MHAA 4BZ2A 1M1XB 4MQ7A 2E76C 4XP9L 5F2FA 4ZX3A 4OZGB 3V9EA 3GDBA 4QPEA 2W65B 1ZTXE 2MKLC 1IC1A 1R5WA 2I26N 4A2DA 2E7HA 1J48A 3H7BB 2R0ZL 2GUOB 4NQCE 2ICES 5LG1A 4BQ6A 4JRXD 4OI8A 3TV3H 1RD6A 1NCWL 2MWCA 4A55A 1XGUA 2NX5D 1UWYA 4FQXD 4Y4FA 1UM5L 3LKSA 3K72A 5ACMA 1IEHA 4BFRA 4EXPX 4S1RL 5TE7H 1I8LA 3RIFK 3TZVA 1LXMA 1JGDA 3PAVA 4D8OA 4NQDE 2IPUK 4XR8C 2EDEA 1T22A 4NQUA 4LFHD 4WI5A 4JAMB 2A74C 4ZMLA 4M6ML 3PV7A 3UBXB 2P9RA 3WN5C 3JSSA 3NJIA 2NY6B 4O2FB 4BSVB 1GIGH 1X7TA 2BVPB 2GJ6E 1KN2L 2PETA 5TGBB 2YSSB 4HIJA 4CVZA 5EPMA 5FR3A 1P5VA 2CPUA 2AEPH 4X9IA 1M71B 3MJ8B 1FFOB 4BA8A 3RG1C 3RUGA 3SDCB 5D2LF 1ZV5A 3GSXA 4LCYB 4QTIL 4PJFA 4JFXA 4YFLI 1Z3RA 3UGEA 3V7AE 5E8EB 3OPZL 2RMNA 2E86A 5ANHA 3WXVL 3ZDYB 3M1BA 3AG2B 5IQMA 2BW5A 2GTWA 3R0NA 4QY8B 1QWNA 2F8IA 3CD4A 3PWVB 4JY6A 1T20A 4QRQA 4RGNE 2HPTA 2B5IC 3W9DB 3PL6A 4R0LC 4GUCA 4UINL 2OA9A 3BUYA 2JKLA 3IJHB 1PD1A 3QIWA 5L6YL 3C2AL 2QDVA 1AAJA 1GZQB 4KNSA 2WQUA 1K2DA 1FGNH 4K5OA 3RVUC 2J8UF 2H2PC 4RZCA 1Y1DA 3WKML 1MQKL 2XBZA 1NMBL 2D7TH 3GMMA 3P73B 1PTZA 5FIEA 5FO7A 3IDGB 1QLRA 5CEYA 5GRZA 3KL0A 4RWHA 3U36B 2A9ML 5IJVB 3M86A 2H3KA 3IDIA 2A6KA 2ICWI 1JPTH 2OTUB 1NFIA 1FBIH 4PRPD 3MLRH 4TVSa 3BAIA 1NIEA 1M7DA 3UO1H 2IAMC 1KPUB 3L8QA 3EJTA 4L4JA 4NHCH 4NNYB 1CN4A 2DBLH 4X7DC 1XVSA 5DCCA 3O8XA 2XXMB 1FNLA 3L5XL 2FO1A 2RALA 4QYAA 4BGLA 3FULA 4ONHB 3WTVA 1AHMA 3PAZA 4Z3TA 4KRMB 1FNAA 2BRQA 2QHRL 2XFGB 1DBBH 5J06A 1YYMH 3PWJA 4YXHH 5EU4B 4XMPL 4K8RH 4M9OA 5L2KD 1HS6A 4BWUA 3ZKND 1TMCB 1S9VA 2R29L 2UY6A 2VLLA 2DTMH 3UJTH 3BRDA 4Z7NB 2MOGA 2HT4D 4LDLB 1SRDA 4C56E 1GGIH 1UOVA 3MODL 1FZJB 2ZTBA 4FJYA 3D0AA 2RTTA 2HLFD 1BVOA 2HKHL 3KG5A 3RKDD 1FORL 4WVRA 3P2DA 1FFTB 2PXYA 1Z3GL 2OYLA 5C08A 4ZMWA 1NC2A 4J6RH 4HPOL 2VQUA 4C4UA 2ZIDA 3WS6A 3BPOB 3MRLB 5GGTL 2YMOA 4YAQB 5SWQA 3AXLA 5I0XA 5J5EA 5IMOB 2F0CA 4NPKA 3MLYL 4GH7B 3LZRA 5D5MB 4FQJH 4CU8A 1PYWA 4Y4KC 4XO3A 4RNRA 5DQJA 4JE4B 5KVMC 4C56A 4L4TB 5AG8A 3S37L 2NNAB 3OV6A 4PJGE 5DRNB 3IXAB 4PRHE 1I75A 1AS8A 4BQCA 2K0RA 1KIUB 5BRQA 4LARL 3ULVC 3N06B 1MCKA 5D1QB 3FFCB 3II1A 1TTFA 4URTB 3VFOB 4GRLD 2ZD0A 2JB5H 5FV1L 3OB8A 4S0TD 3KPMA 3NUKA 3SPGA 3ATEA 5I26A 3P3TA 3ZO9A 1XT5A 4GG6A 2NY3C 3T71A 1S5HA 1M05A 1SDAB 2FO4A 3ARXA 2DMGA 4OQTH 5LNEA 1SN2A 3SY0B 2BJMH 2BCKA 4J8RA 3RA7L 4NS0A 3BGAA 4MMXC 1OPGL 1PDKB 2JWYA 3BKJH 5E6IA 2G5BA 4FQLL 2Q7YB 1IGFL 1PFOA 4TUJB 5FO8A 2EDMA 4U1HA 2C9SA 4FMVA 4Y8AA 2F5BH 5KOMC 5GISH 4ENEC 5FF6A 1JZ5A 3ZUNC 2DICA 1E9OA 1NJ9B 2AEQL 2OULB 3MREB 4KPHL 2ZXWB 4UB0L 2ZXAA 5CINL 3N40P 3WIHL 5JHMA 4HU2A 5ABDE 2Y1VA 5DK2B 4AIZB 2O5YH 1OTSD 2XWBB 4I3GA 4KUZL 4ZRGA 4HMDA 2OMXA 3VJ6B 1KJ3L 3L1EA 1T1WB 3MV9B 2B0SH 4TLUA 1XBRA 5ALCH 4F7MB 4CN1A 4XZUB 3GMQB 4QWWC 3SDYL 5A40E 1KBWA 4NO2A 3EH5B 3DO3A 5FHAL 3T65A 4ORZC 2OSLA 3PWPB 4GLRH 4N22A 1IU1A 1M7IB 3O4LA 1LNUA 3QDME 4HS6A 3KEHA 4L4VE 5IVOA 3EOBA 4KY1H 2IWEA 3SPVB 3VD0A 4HJGA 3SBWC 1A3QA 4JRXE 5CIPA 5E8PB 4KAQH 1ML0A 5KWYC 5LXGL 2VDLL 4BM7A 4KQ0A 1UZ6E 1S8DB 4PJ7A 2BY3A 3LEYL 4ODTL 4ZS7H 3ZDWA 1HYSD 4KO5A 4FA7B 3CSYA 2XV2A 3AXHA 4HSAC 3L3IB 2GUOA 5F9AC 2JCCB 3OKNB 4PN6A 4ZW6A 2Z6FA 1EGJH 5LQBL 4HC1A 4HWZB 4PRAB 3CFUA 3QZMA 4J1UA 1PJWA 5FM4A 1UVQB 1T5WB 1AQHA 3S5YA 4DSYA 4X8GA 1PD0A 2LW5A 3FT4A 3VTTA 4JFZH 3WFBL 1DLHB 1QPXA 2BY1A 2QT6A 5C0DB 5INDA 1N4XL 2PPFA 4M9PA 1SXAA 2GTZB 3DETD 1LK2B 3ASNB 1KN4L 5HYEA 2ZCKL 4OU3A 2M1KA 5F89A 2M8XA 5JOFA 5JW4Q 4JMXA 2VABB 3L9RB 5TQ2H 3HMWH 2CHDA 3DGGA 3HZYB 3RWHA 4XXDB 5HJDA 3QQ4B 1NC2D 1XGYL 2X70B 4Z0BL 2WXKA 2R83A 1MFAH 2J1WA 1EZVX 2QTEA 3B3BA 3CFIC 4R9HA 1B0RB 2OMTB 1R3KB 32C2B 4R2GB 1UASA 2TRHA 2R0ZH 3B7SA 5C97A 4F2ME 3W11C 4EN3A 1UXLA 5I24A 5HP5A 4LL4A 3PL6B 1G43A 4LRNH 4ATTA 3MV7A 3NFPA 5FB8A 2WLKA 5C0EB 3MACL 4XNZB 3CZFA 4PWJA 1T03H 3MBXL 3PWPD 4OTXH 1BM3H 1C1EH 5B22A 1KGYE 3JWOC 4QD2E 2AMUA 2H8PA 4UQ2A 1AS6A 5KSAD 1OCOB 1U58A 3EH1A 1KENL 2I32A 2VCOA 3L1OL 3VVWA 3QZWA 2F53A 1ZT7A 3LSOA 5D7JC 3IJYA 4KROD 4HWBA 4M7LH 1ETB1 3J07A 3P3RA 2HLAB 4PWEA 4RAVB 4D9RE 1AHWA 2YARA 4HW6A 2DKMA 2NUPB 4FA6A 4E9VA 1HAUA 4ZD3H 1S7UA 2VE6B 1TENA 3NCYP 4ZPVB 3RTQC 4HISA 1QR4A 4GKSB 4Q97A 2DLHA 5E6ZA 3UOAB 4HH9B 3MV7E 5DDHA 2IGFL 2KPNA 2XT1B 1DFBH 1KJVA 3LIZL 1IEAB 4ZQTA 5FPIA 3SGJA 4JQIH 1J1OH 1KTDB 3WNIA 4TSBL 1NBCA 1NIDA 3K6NA 3SZ6A 2V5YA 4Z18A 5JIKA 2Z8RA 3DTXA 4MMYB 2PNDA 2B9AA 3MRKB 2Q86B 1AQKH 1F1AA 2YK1L 3QI9A 2RJMA 2X3AA 3FBKA 1WBXB 1QTSA 5LBSA 4GSRA 5EDSA 4KROC 1B3JA 4D8PA 4ZPTB 5B1BB 1W0VB 2OL3H 5IB3B 1JVKA 1F6FB 4MSWB 2AV7A 3BZEA 1EHNA 2H45A 2DQCH 3O4LD 3QUKB 3X14B 3UIZA 1VEPA 1A1MB 1XR9A 4Z8FH 4GUOA 3ARTA 2VZTA 2MQ3A 3IGAB 4ODSL 4XPBL 1RKRA 2VDKH 3ECUA 3V4VH 3QJZA 2JJSC 4WU7A 4HUVA 2VSMB 4ZQKB 3VGBA 1FBIL 1JZFA 2XCMC 5L2JA 4J3OC 5I66B 4I0PC 1JZ3A 3ZGHA 1UZGA 5DLLA 3VFTA 5GGSY 3GMPB 3L4YA 3F62A 3W11D 3RVWC 5E99H 1E27B 2Z1KA 1MHHA 4XP4L 4RSYA 1QFHA 2HG0A 4R3SA 2VZUA 4AQEB 2ARJQ 1UM6L 1BZ7A 3FU7B 4R83A 3A24A 3V0DA 4D9LL 2NOYA 2W9DL 1W2KT 2WUCH 3G5ZB 4AL8H 1X44A 3W2DH 1NCTA 4JRWA 2JH2A 3Q48A 3WTTA 3CWGA 5DJCB 1I1FB 4LEEA 4LSDA 2N0KA 1VFOA 1SOKA 1JRHL 2TSBA 2OTWB 4QO1B 2QPFA 3A67L 3MLZL 5IGXL 4W4OC 4LNVA 2C9PA 5SWZD 4ZMQA 3VD5A 3U7AA 4RGNB 3TT3L 1HXYB 4K7PL 3F3HA 4AX3A 1FG9C 3G6JA 1PEZA 3VFUB 3SDXA 2GY7B 5I1DA 2YS4A 5HD8C 2NNCA 3WEAA 4RIRB 2DDQH 1MLBA 3L4TA 2VDQL 4DOHE 1K6QH 5BOJA 3AVEA 1S7WA 1K5NB 2EVFA 1TXKA 3KLSA 3RUGB 1RJYA 1JNJA 2JNZA 2IF7A 3N04A 1PKOA 3A23A 3WLBA 4C56D 5EBWA 4JCLA 2XNAB 5C0AA 3RVVD 4TQIA 2NTSP 3G5WA 4KK9D 4YZFF 2XIBA 1CF8L 1OARH 2LW3A 3LDBB 4L8BB 4OJCA 5HBBA 2RGSA 4IGBD 4ZYKA 4CU7A 2GBAA 4WCYH 1S9YB 5MEQB 4ZFQA 3VXRD 5HHPB 4AZUA 4BRJA 5T33L 2P7TB 4L3ED 4ZTPL 1A4KB 4X6FA 2QKIC 3EXJA 3HPLB 3N40F 2XETA 3QDJE 3QDHA 4WDIA 5IJDC 1WSST 3D9AL 2ESVE 3QEUA 1I7ZB 3MV01 1K3IA 2DTSA 4OIBA 4JFVA 2OM5A 2OLDA 2WKGA 3VRLE 1I8IB 2AEWA 3ZUCA 3HR5A 1VENA 1UWGL 3CK0H 2COVD 4LDCA 1JWUA 1NDGA 4OB5H 2JKJA 2Z93B 3EYQC 1NCDH 3EHBD 4GSDL 1L0XA 2AV1B 3CDCA 3ALWA 3OKYA 4Y89A 4HAKA 3TIEA 5BMFH 2B4CC 1S7VA 5EIIG 4KITB 4S2SB 1MLCB 3SGKC 2WXFA 1NCUA 3U25A 5HHOE 3SGEH 4F5CA 4G82A 3BZ4B 4KTDL 3KWXA 1CGUA 2Z0BA 2AHIA 4K23L 3OKLB 3KPNB 3LPWA 2OMVA 4GS7B 1L0QA 1IT9H 4IOSD 3GIZH 1AQDA 4FNSA 4GRLB 4GRLC 5D6CA 4QCIA 4CSZA 1SMDA 5E51A 3Q3GB 3QFGA 2PR4H 3OHMB 3SE4C 1YEGH 2CRZA 2PYFB 5I1CL 4H8PA 1JF1B 2A6JA 4XBMA 2NZ9D 3AQXA 5L2KB 3HZYA 2NYKA 3MLRL 1P6AB 4UQDA 3RYMA 2X4SB 5EF0A 1ASQA 1TTRA 5J13B 1TJHL 3CN2A 4IDLA 5DD1L 3VFPA 2VDPB 1Z5YD 3F7LA 1OTTD 3MJWA 2KQNA 2EUVA 3L5XH 3Q9PA 3EBHA 1WITA 2J8HA 4LSTH 4Y9CA 2B1HH 3KYOB 2X2IA 1WS8A 1QI5A 1IAII 1VACA 2HSIA 4OCMC 1PG7H 1LK3L 1NAML 1Q9LA 1S7SA 1TZIA 1NBVH 3TXAA 4XHJC 4B0MM 2A73A 5EUOA 5CLXA 1WTLA 2AQNA 5GIRB 1I1AC 1BREA 1VIWA 2JE8A 3HLKA 4J3TA 4OCSL 3HC3L 1XL6A 5LBVA 1HOCB 5C3LD 4H0HB 1QWUA 4ADIA 4PLKC 1H8SA 3T3PF 3MLUL 1AHWB 1YEKH 1CD9B 1FGNL 2CO3A 4LEOB 5ANMA 4DGYH 2DQJH 2PO6C 5DO2C 4L2LA 5EULV 1MQKH 1TNNA 3WO3B 3VFVB 4DK5A 1WYJA 3V52L 1F4WH 2YJQA 3L81A 4MCYB 1GCFA 3BIKB 4ZZFA 4XXWC 3MX0A 1EAJA 4XN2A 5AQ0A 1DSYA 2QVTA 1M6UA 2GI7A 2P8PB 2XXFA 3D12B 3HC0B 5GGQL 4ZFOB 3V6FA 4UOQA 4F8LA 4FYSA 3FTXA 4HEMA 5EUKB 5GRVK 2IAMD 4Q6IC 2XU9A 2XFXA 4ZOCA 3MRHB 5JIPA 3CHQA 3I50H 3DRQB 5EOCH 2FNWA 4G2AA 1DEEB 3D2UD 4R96A 4X8JB 1UA3A 4HP5A 1R3KA 2FB4H 1FPTL 1INDL 4W1TA 3SKJH 1LO3L 4HULB 1P1ZB 4H4NA 3KYKH 1U8LB 3IPBA 4Y16A 2H0PA 2CHZA 4A68A 1WWWX 4F37K 4KJWC 5J9PA 1J87A 2B9BA 1ZWIB 2F74B 3ATBA 4LP4A 3UAJD 3IGAA 4XN4A 4QNPE 1UKSA 4UUJB 2NY5H 3CVBA 1A6ZB 1G4RA 4RGMB 1ZHLB 5JPMB 1ACYL 1G6VK 2HH0L 2WTOA 2IANB 3EOBB 2O4EA 3CFQA 5L2JB 4H8WH 1CE6B 4LSSL 1DSFH 4N5EC 5ISZA 1WC7B 2VQ1A 1C5DB 1MH5B 3P9WB 4OJDH 5ELIA 5ESQB 4P2RE 2MOVA 1OAKH 1V27A 1ZV2A 3RHWF 2AEQH 3HLAA 4UB0H 5TE4H 3V0WH 4FG6C 3S96A 1HEZB 2X0VA 2B59A 4QAWA 4LCCA 3QWQB 1D5ZA 3RNQB 4Q6IA 2E5EA 4UZGA 4MQTB 1OP4A 1KG0B 4J1UB 3I6LD 5E03A 4XVUC 4GQQA 4KFMA 4Y5YC 2HVBA 1CVSC 5FO8B 1NMAL 2QSVA 2V2WB 3CZSA 2XWTB 1NGQL 4NO3A 3BGFC 2OJEA 5MEOA 2Z91B 4AW4A 3KYMA 1SZNA 4NM8H 3GXTA 2R69A 2XHNA 5F89B 3FQWB 1PG7X 2AK1L 1HXMA 4NN7B 2A74A 4O4YL 1OF2A 3ZW3A 2JXMA 4AGMA 3TA3C 3TH4T 3UTQA 5DWUH 5TF1L 5EORL 2JB6B 3GLEA 4OSUH 1KCKA 5J6GA 2NY2B 4YHKH 3ZRSA 2OSLB 2CR6A 3HFML 5DUBA 3QUXD 4HCGA 4YWGL 4EN3B 4JJ5A 3QO1B 2YEVB 4X9BA 3H7BA 5HDQH 3UTTE 1WVZA 1QKZH 4OD3L 4LASL 1WUZA 2UZYA 4MB4A 3RI5F 3DWTA 3BZ5A 3HJ0A 3Q44A 1EAPA 2O5ZL 4XWOD 1IAIH 1OB0A 2WWOA 3JXAA 4QRAA 2F5BL 2X4PB 4F24A 1E6JH 3APNA 1ET8A 3E1ZA 1T5XB 3QDMA 2P5EA 4XBGA 1B4JH 3FTGB 4I1NB 4QTHA 4F93B 1P53A 5KYYB 1BJ8A 3VI3B 5HJ3B 1AJ7L 2WP3T 1XGTA 4G8EB 1K4DB 4HC1H 5BOZG 4WV1B 3NZ8A 1XIWD 4DKEH 4OZHA 1K6QL 2ZUUA 1OP5K 2D7TL 2WNWA 1MFAL 3WXWL 5JIQA 4JDTL 3PJNA 1NDGB 4NQCB 1CQKA 3IJEB 2NSQA 1OGPA 5F1IB 4BK8A 5EZOL 4PU2A 1TQWA 4P2QA 1HAWA 1UATA 3T4AA 1HHJA 1JNLL 2WQWA 4KV5E 4YSSA 4KAQL 4P5TC 3NIFF 4PCYA 2R2BB 5HGDB 4CADB 1MCIA 3KR3L 3DTXB 3GWJA 2A6DA 2O6CA 2ODHA 3LNDA 4NUGL 2NY3B 4OLWL 5F3BA 1PW3A 1OO2A 2YHGA 4AJVA 5TF0A 5KS9E 4XX5A 1DVFB 2QKIB 5AAWA 3SOBH 2QVMA 4JREB 5DZNA 3ZR6A 3SGJC 5L4JA 2OJZH 4BH7A 1XR8A 1KBGL 1JFHA 3ZO0A 4BHUI 1GPOL 4FG2A 4NENB 4E41E 1DANT 1C7SA 3O6FD 5LGHH 5A1AA 6PAZA 1U8NB 2HRGA 1NBZA 3US1A 1J86A 4TULL 1D2OA 5J3HD 1JTOA 3QZNA 2Y69B 2EIEA 3ARSA 2H32B 3IDJB 4XVSL 3J8F7 3WMSA 3HHSA 3QJRB 5HPMA 1SBSH 5GHWH 2SEBB 4P57A 4OKVA 5K69A 1QBBA 5CZXC 1GHFL 3NFPB 1IIIA 1I9JH 4HPOH 4LFHG 4IGBB 3SPCA 2N56A 3HAEG 4JFEE 3IFPA 4DUVA 5CCGE 8FABB 1L9RA 1NFDE 2V7HB 2IGTA 5IB5A 4HU8A 3QI9D 5DK0A 2JQAA 3OXRA 1YUHB 2F53E 3UJIH 2XLLA 4UZUA 4M00A 1ILSA 2BC4A 2W5PA 4LDOB 4L8CA 1T89A 4ANVA 1HWWA 3KPPB 4AIOA 3B1UA 4Y9GA 2X5PA 4WWKD 3RY6A 3VSUA 3NFNA 1AHKA 1X7QA 1XWVA 4X4ZA 4C59B 1KCWA 2WSPA 1KGWA 3DC0A 1KENH 3F7YB 5FOBA 1R5IB 1SY6L 1RK0B 3VA2C 1Y0LA 4M3JA 3QFJB 1VKXA 2Y7OA 1J1PH 5ENWB 3TBCA 2FGZA 5AUMB 1OGAE 3VWKC 3E6FA 3C60D 1NPJA 2B1HL 3X1NA 3C5SA 1A6AA 2OP4H 1CFTA 3P77A 5TQ0H 9CGTA 3B6SA 2O26U 4OQTA 3P4OB 5JYMA 1WFIA 5DJAB 1HT6A 4LZKA 5J7CC 2IGFH 2LU7A 2ZF8A 4M29A 1QSEE 3V5HB 2Y07L 2B5IB 4C56B 1VFMA 5DD5L 1Q72L 5KVGH 4GRWB 3HR6A 2NYYC 3EJRA 1T83A 2J1YA 3F7RA 1SYVB 3K6FA 1T0NA 1OSZB 3GUTB 2ZX7A 1WFNA 1Q9LB 4WJ5B 4EBQL 1D5BB 5I0VA 2PN5A 1OGAA 4F20A 5FECB 4ZUVB 2DQJL 4ES9A 4NO5A 3DTDA 4NKDB 4WY7L 2VMJA 4E0RA 1A7PH 4HF5L 1F4AA 1VEOA 3KLHD 4YHPB 4CVZB 1NA8A 2MRYA 3D48R 4HXAH 4JY4B 2EVIA 1GY1A 2R8SH 4FNPA 1X5JA 1BFOB 4WU5B 1GW0A 3L3GB 2YLKA 4U1GB 5I1DB 3HE7C 3KPSA 1E9QA 2CUIA 2FD6L 1A14L 4APQB 3RWCB 3GHEL 3MCLH 5GS1B 3KVQA 5KBNC 1AIZA 3H9HB 1KG0A 3SKJL 2VR5A 3GJFH 3T0EC 2WSKA 5KEZA 2HG5A 4FABL 5LWYL 2V2WA 5DEZA 3CIQA 3II2A 4PJBF 4R7LA 1UZ6F 4X5XA 1JRHH 2VW4A 2DQEH 5E8DH 4CU6A 1PZ5B 3C60A 1IJ9A 1DSFL 1A64A 3HG1E 2MEJB 1RULH 5CD3A 1AXTL 5CSZA 3QJFA 2ZJSL 1AO7E 4X5WA 4IJ3C 2DWYA 3F00A 2CJTA 1NUFA 4MMXA 3RY5A 5H2BB 5JHBA 1X4ZA 3GMLB 3IU4L 4OT1H 1IEBB 3SDDC 3D09A 3BVVA 3DV6B 4LAQL 1I7TA 4JPIA 4PY7A 4HUMB 5EFIB 2WIIB 1EQWA 4L3FA 3MRQB 1UA7A 4NKOA 1J8RA 1OCWL 1HE8A 5M94B 4WW1B 4JFPB 2V2TB 1KXVC 4Y4FD 3TIDB 4KK9C 5F7WC 3SKNB 5KSBA 2Z35A 4TXVB 1OXYA 3NIFE 4TL4A 3T77A 1CLYH 3WKYA 1T5XA 3QDMB 3HMXH 5F6IC 2B59B 1RPKA 1YEGL 4KXZI 3N85L 3FCTB 2WM0A 3QIUA 3VG9C 4LLYA 4G8EA 4UF7C 3CX5J 3Q8FA 3T0EE 2J57A 4G6JL 43C9A 1JPST 4JCMA 2WQSA 4FQXA 3VYNA 1SXSA 2Z93A 1IGJB 2Q3AA 2BLFA 5CFAA 3L48A 1H9DA 4XNXH 4K94H 1YJDH 4AQ1A 5DLML 1L0PA 1S6NA 5AG9A 1VGEL 3DDFA 2HJLA 3CFKA 3D69B 3VGDA 1M3IA 1MCSA 2XZAL 3MDJA 4HUWA 4NQEB 5BCAA 5E56A 3VI4A 1QPPA 1VCBC 2CAKA 3LNIA 4B95C 5BO1H 3BZ4A 2CBPA 1GOHA 4FLOA 3FSZA 2WVTA 3ROLA 3BYYA 4GSDH 4N8UA 2HVKA 3ZMRA 3H42H 4PUBL 4G8IA 4HHAA 5I1AA 4W9GC 3PNWA 4PGJA 3N44F 4PJ8D 1QQDB 1T6WA 3AXIA 3HCVA 2BS9A 5EF1A 5DTFB 3LEVL 2EE3A 2KHAA 4YVUA 1INEH 5CGBA 1TQBC 3QHFL 4R97C 3CVHB 1F4XH 2W88A 5DC0A 1HHIB 2WNKA 4J3OD 5LAXB 3NQIA 2X4UB 1S7QB 3LY6A 4K23H 4MA8H 2BVQB 4PJ6A 5DD6A 4XMLH 4HOWA 2DF3A 5ECGA 2VXQH 3QQ9C 4JQXC 3D4ZA 7PAZA 4JDTH 5J12C 3BEVA 4I0CC 2BSTB 4B9IA 2C3GA 1RURH 3I74A 4F2MB 3T4YA 3VE0A 3PV6A 1QO3A 1A6WL 1GSMA 1BPVA 4EI5B 1B6DA 1ONQB 4GFTB 3RJQB 5L4FA 1A6VH 1P5UC 1P7KA 1T21B 4WTZA 4WV1A 4GUPB 5GS0L 2KKQA 1G9HA 3MJ9H 3SDCD 3W0WA 4N2LA 4HX1A 5H94A 3KR3H 4XN5A 1RZFL 1ZVHA 1TQUA 4LOUD 2XWDA 5FO9B 2Q20A 3SQRA 1G9MH 2W9LA 1IFHH 2YRZA 3SO3C 2W9EH 2R7EB 3PL6D 4JW3A 4NLAA 4NJAL 3QAZB 1ZSDA 3IFOB 4QLRA 5HDLA 4FGMA 2R1YA 2WWNA 3WHXB 1AXSA 4B9ZA 5ANME 1B6UA 1O7VA 3O2DH 3O2WH 4HJ1A 3TF7C 4JZNA 2DD8L 4Z7UB 3RTQD 4P3WA 3WN5A 1L7IL 3KCPB 2OCCB 1AG6A 2ED8A 2EXWC 4G7SB 4N8VG 3CIAA 3P69A 4LVOC 2Y0SA 3AS2A 2C9RA 4ZOAA 2CM6A 1U8JA 4OLUH 4R90L 1HIML 1I9RH 1U91A 3FQXB 5I1KL 2A0LD 1RZPA 1SBSL 4UWQB 3UTQB 1GGYA 3X12B 3UEZA 1XMEB 1RPUA 3NCYS 4RDQG 2J8UE 4R84A 5IVXE 5DURD 4AKQA 1OANA 2CDFA 2ZSWB 1KCRH 2ED9A 4B60A 4LNRA 4KXBA 1BAFH 3U30C 2Z8SA 4K7FB 4Z7QE 2FDBP 1SOXA 1CICD 4P99A 4APQC 1RJCA 4MJJA 1L6XA 3ARWA 3FUFA 4HGWB 4NM4L 3DX1A 3L3KA 1NKGA 1J0YA 3WEXB 25C8L 2IEPA 5H37G 5LBSH 1KB5A 4PJEA 12E8L 4M62H 3F5WB 4ZTPH 4OJEH 2F19H 1I3RB 1IC5L 3FUHA 1LO3H 4IS6A 4I9WD 5BZZA 5BXFA 3A22A 3ETSA 3DETC 2I9LA 2VXVH 4WZ9A 1VSCA 2G0LA 4I13B 2AVFA 3SQOH 3N6YA 3V4VA 4GKLA 4Z7AA 3RGHA 3HG0A 4WEBH 2PP8A 3EYUL 3OLIA 1ADQA 3T0WA 2BSDA 3MLVL 3C9NA 3S96B 3WJJA 2OMBA 3QQ4A 3DTUB 3ES6B 4PGCA 3NFNB 3OSKA 4XI5C 2ZG3A 2V8MA 3QAZC 4NDMA 1NCDL 4KFZC 3ARPA 1E67A 4PS7A 3TO2A 3FHEA 5K9JH 3KXFE 5C0RL 2KUTA 3SGDI 1NQBA 1AIFB 2ED7A 1LWRA 3BVUA 2V8LA 4BK5C 4MJ5A 3B83A 3OAUL 2X10A 4R4FL 3RBSA 5IK3A 3MXWL 1XEDA 1BSIA 1HYSC 4KKLC 1LVEA 1R5VB 2FX8L 2VDPH 2LTQC 1FGVL 1ZTXH 3DJZA 4NUJB 4AI7A 1OAYH 2EYSB 3WIIH 2OYMA 2ADGA 3E1F1 3GIZL 4MVBD 3WNNA 1CL7H 2DQTL 3DK2A 3IETA 3QUMH 3O6LL 3BGMB 3RTLA 4H8HA 5BV7H 3GXIA 4LHUG 4R4ND 3QDJD 3H4FA 3EYSL 3KPRD 4Y5YB 3A4FA 2R0KH 4LPWA 4OLYH 3VXOA 4F5CE 2NW2A 3TBBA 4RCAA 4PJBB 1WIOA 1J8HD 2X89A 1F2XK 3VG0L 4X4YA 1KCLA 4K3JH 1NIAA 3QORA 5KVEE 3MRJB 4N1HB 4MDJA 1RUMH 1BMWA 2BHUA 4HK0A 1LP9A 3HC4L 5GS1C 2BVOB 5FM8A 1XEUA 5IOKA 5AYTA 3SOBL 3BCFA 2E6PA 5F0JB 4PM1A 3OL2A 5CCJA 5EO1B 4YWGH 2AAVA 1GPOH 4DEWA 2GJJA 1Z32X 1BXUA 1LM8V 1SHSA 1NBVL 4KJPC 2ZX5A 4J39A 3K72B 1ZLSL 5CUSL 4J4PA 2R2EA 3T3PE 5JMRA 4GW1A 3UDWA 4JHZA 3HB3D 2VRAA 1AD0B 1BZ9A 4NWUL 5GJSL 3WFEH 3BUTA 3CBKB 3V6ZB 1R75A 1C8PA 4ZI8A 1KEML 3TA3B 2BNQD 4JFFA 1G7QB 3VAEA 2IAMA 5G5DB 1INQA 1FCCA 3PP4L 5B1AB 1U93A 5L4IA 2ITDA 1KJ2L 5FYLL 3QNXA 1YCSA 5I18H 4FMFA 5IT2H 1J0KA 1U3NA 1Z9OA 1IZJA 3FSAA 3AGWA 2X4RB 4QHUB 3TVMB 3GRBA 5CGMA 1MNNA 3PABB 1KNOB 3L13A 3FB7B 1D7DA 4LKCB 3ZVVA 5BS0A 2I60L 1X4XA 1A1OB 5B39G 1KXTB 3UX9B 3D08A 4WRLA 4CN4A 1UCTA 5CD3B 4ZS6C 3O3BB 3RL2B 1IBYA 3QDGD 4LVNC 4H8QA 3B7UX 4P23B 1PY4A 4DAGH 4MTMA 5EEUA 2WKOF 2DQMA 2NDFA 2JKXA 4AGOA 1YEFL 4YDLC 1JNLH 1IEBA 4WW2C 1AZZC 1D5XB 4E41A 2WTRB 1UD6A 4RQQB 4MD0B 5MENA 5GZOC 1NIBA 3N85H 2YUXA 1CIDA 1DQJB 4XOAA 3E8VA 3BQUA 2DWDB 3EBIA 3M46A 2A4EA 4AEHL 1SMOA 4M4RB 5TDNB 1N8ZB 3CFCL 5IB5B 5I1GL 4LE8A 3HZVB 4OZFB 5FLVA 3O11A 5LCVH 3N9GL 4HIEB 1IQDA 3QRGL 3HE7A 1MG2C 2VLJE 5DJ6A 1N3NA 4DP2X 1M6OA 1MFVA 3MXVL 3TASA 5I6LA 1T80A 4X4XB 2ZG1A 4HUXB 4AM0Q 4DCQA 1DQTA 3WEBA 2OMWB 3MRGB 4PGBB 1NFIB 4QDGA 1LO4L 1QPKA 1NH6A 1M2VB 3ETBJ 4YDZA 3KWTA 2JIXA 1A3RL 3GKZA 4JN1L 5K59E 3IFNL 1KF9B 3BQUC 4KRLB 3K4DA 2IWKA 2WO2B 2CRMA 1FO0A 4TUOB 3BW9A 1UEMA 1EO7A 1TQSA 4H88H 2Q8AL 2AXGA 3ET9F 4ZMZA 4EN3C 2GIMA 1E9PA 4WO4D 5MI0C 2VOTA 1OAJA 1RFDL 2IG2H 2WLLB 3C5SB 2H6PA 3HIZA 2CCLA 3QNYB 1V55B 2WW8A 4KKBD 3TBTB 4OCXL 3FF8A 4RFNB 1NFAA 2WY3B 5DRZB 4DVBB 1ASOA 1V8HA 1QYGL 1JGVH 2YPLA 2D9QB 4N2BA 5IQ7H 5K1NA 2CIIA 4QIRA 2F5AL 2GAZB 3U83A 5I1HL 3C5JA 2O6DA 1IC4L 2HUEA 5ISZB 4YGAB 5I30L 2F1BA 2M83A 3JT2A 1X4YA 1CICC 5J1AB 1AZCA 1JDCA 2G2NA 5I1IH 1MFCH 2VGLM 3SDXB 4WUKL 4XNMB 1U4EA 4MJ6A 1XFPA 3H9YA 1QO3B 2W9EL 3HKZA 4GBXB 2NX5B 3VWKA 4WTZG 2ATPB 3HFMH 2BIOA 3L95A 4PHZA 2AC0A 4UMGA 3NG5A 4ZW5A 1QRND 1CI5A 1A9BA 2A9NL 2D2CC 2CO4A 1EEZB 4LBEA 3AT0A 1S3KL 1ZHBB 2PXYC 5FAAA 5IBTH 5DMKB 3KPNA 4Q9QL 3BRGC 3Q6GH 2VYRE 1E6JL 2UVEA 2R7EA 3HNVH 1D7CA 4BE5A 5DQDL 3UG3A 3WJLC 2GK2A 3P9MB 4ODXA 5J89A 5C0FB 2R1YB 1I1AB 1XCTB 1I9IH 3CZJA 4FE9A 1SDYA 4OZIB 5FGCE 2ZUQC 1S5HB 4F2EA 2EIZB 2QMKA 1PZBA 1NCNA 1W8NA 5FHBL 2JQMA 4NNXB 2KLRA 1NWPA 3LKRA 2CQVA 3VXSE 4WIQA 3ZDXB 2FQFA 4W4NA 4DPAX 3V79C 2WWMD 4BDVA 2D3VA 1RU9H 2D8KA 3HUJE 1OAQL 3DSFH 3DRTA 3HZKB 1X5FA 4ZFZA 3QJFB 5D71H 5ADOH 4JZOB 3IRZA 4WF7A 5CN2A 1FN4A 4UU9B 4AITA 3BPNB 4HJJL 1AC6A 2H32H 2WP3O 1T7YA 3FH7A 3HPJB 4AQ8C 5ES4B 4X5XB 3PHQB 3POCA 4OLWH 1U8CB 1UT1A 4WLCA 5D1ZD 5E6IC 4NO0B 2WMPA 5I73B 5JW3L 3N1PC 1CL7I 1HQRA 1HL9A 1T66D 2VKWA 3BPCA 3TGXA 2DEWX 5SWZB 4HYTB 1EX0A 2ERJC 4L3EB 1SN5A 5IFAH 5FUCE 1HZHL 3A3YB 4Q6YA 3WEXA 1KYDA 5DEGB 3UYOD 2VN5A 2XN9E 4P4KB 5F7AA 3GBMH 3QZOA 4Z7UE 2ZSVB 4DZ8B 2WIIA 3BSZA 3S9DB 3T6ZA 3FT3A 3BKJL 4LLUB 4NRZA 4YBHA 1RULL 3S5LB 8CGTA 4Q9CA 3Q3GA 3HW7A 4XO4A 1LP9B 2EDWA 2R4RL 3HMXA 4OZ4A 3UFIA 1J0HA 4PJDE 5E2JA 1GL4B 4DGVL 5IW1A 3OAUH 3IGFA 4S1DC 4FQIH 4QT5A 2WQAA 2ROXA 2ZX8A 3MXWH 4NQED 3D5OF 4JO1H 4DQOH 5FYLE 3FCTA 3QIUB 4S1QL 3E3QC 4UT6A 1YEDB 4JO8A 3WKMH 1D9KC 1U8LA 4AKPA 4IW4C 43C9B 1R1CA 4X6EA 5HJBA 5FHAH 1H9VA 4IRZA 2QQLH 5KUMA 3O6LH 3OB0H 2G3ZA 5C0BE 2D31A 3ME0B 3X3FL 4ANWA 1A6WH 3GXDA 4YH6A 3AITA 3L6FB 3X1FA 3HVNA 1A3ZA 3HG5A 3P4NB 4LGRB 1R5VA 4E9SA 1BIHA 4YX2H 2CNZA 3UO1L 5A2LH 2K78A 4HDIA 2EEAA 5I15L 5CMAA 1GC1L 2ICEB 4ORGA 4ADJA 4P5TA 4NJAH 2VISA 5BS0D 4NKMA 4AGNA 4ODBD 5HYIA 3FQUB 3RU8L 2EYRA 1Q94B 4P59L 1WF5A 3CC5B 2D7PA 4OGYH 5LQBH 2VMDA 4Q6IB 4XCCL 5LGJB 4DVRH 3QZBA 4XMPH 4HQQH 3APMA 3L3JA 2WZPA 5C09A 3RGVC 3BOVA 4F8TA 1A9VA 4CC1A 2R29H 3WEMA 4G3YL 1JYWA 4L8CB 3WFEL 5HYSA 2ATKA 1O6TA 4JDEA 3L54A 1YEEL 5KBLA 1FL6A 1EAQA 1BOYA 1FZKB 4H0GA 4L8SA 3SDDB 3I9GH 2ZUXA 3CCHA 1N4XH 4PSRA 5B3NA 4Y5VC 1K9TA 4J4PD 3KYMB 2QQKL 5BV7B 3QA3B 4OF8A 3IBEA 5AKVA 3S5ZA 4NZFA 5D2NC 4CVXB 3FL7A 4M1CC 2YFNA 4Z9KB 3PP3K 5IHUL 3MRBB 1P1VA 1KCVL 4DNLA 3E6FB 5C3IA 4TVPE 2EVJA 3GSNL 4GT7A 1BX2A 3CFNA 2VLKE 5DUBB 2EIKB 2CLVB 1QASA 1MF2H 1U8JB 3B34A 1JUFB 4GI6A 5EO9B 5EOTA 3VGGA 5DJDA 2VSDA 4J3WA 3BAKA 2PXYB 2CLRA 1XL4A 1T7WA 3EBAA 1W72A 1RZJL 4X7SL 2NY4B 1SLWA 1QEWA 2DLGA 4Y5VA 4A7QA 43CAB 2DBLL 4JZNB 3WN5B 3MBXH 3MGOA 2XACC 3H56A 1QLEL 1OOWA 5EBMB 4BSJA 1I3UA 2X9YA 5D4QA 1TJMA 3QFJE 4ZFFB 3QXUA 1YY8A 3OKMA 4W6XB 3FTGA 3T8XA 4M03A 1EMTL 2XVLA 4HJTA 1XGUB 1FJ1B 2G9HB 1J05A 1JP5A 1UJTA 4HMCA 4RQQA 3MQIA 2DAVA 1AZUA 2DYRB 3QIWD 4I3RH 3VU1A 4KMQA 3RA7H 2VDNL 5DD0L 5FO2A 4P9ML 4G9FD 5D5MF 4B9KC 3DX3A 4M4RA 3T2LA 4X6CA 3HE6C 2D9CA 1AXTH 3PXLA 2WCGA 2VZ3A 1T4KA 3IDMA 3TONA 3GSWA 4YPJA 5I66A 15C8H 5J11C 1WA0X 2GSMB 4O02A 3FN0L 1JFQL 4DO5A 1Z9NA 3CMOL 4MJ6B 1ZLWK 1DBML 1SDDB 3SYQA 2HJKA 3FTUA 2I9LB 5L8LB 1E27A 3KPQA 4WI3A 2NY2C 4FS0A 3OJMB 5FV2A 1DEDA 4LAQH 4TSAH 4FNUA 4LRIC 4F57H 2FH8A 5EIVA 4YBQD 2HTLD 2Q6WA 3C60C 2DWEB 5HHVL 3AREB 2IMMA 1U3YA 3HZMB 4LIQH 3TBVA 5KSUB 2YLHA 2NLJA 3EYVA 1I7UA 4GRWF 4GW1B 2J88H 2AF2A 3FPXA 5KUKA 4ZNEA 3IDXL 2P5WD 2YIHA 4OFPA 2F68X 4PVBA 1BIIB 2X53A 4JQIA 4ONGL 4S1RH 5TE7L 5TPWH 5TGBA 3ZYOA 3ULUL 1TT6A 1FVCA 4PBDA 2APWA 1IL1B 4QRTA 4BHUA 1E9PB 5C0ND 2VDKL 2ZOOA 5F1NA 5G5DA 1I3GL 1IBZA 3Q8EA 4YOKA 1H5BA 2H6PB 1GZQA 2CGZA 1QW9A 1YA5A 3P40A 1U8HB 3ARGB 3C2SA 3DIFA 4Z7OB 2KS0A 3LQAL 4XN9A 2VERA 1MY5A 5E4AA 3VFGL 5GRVL 2QTVA 4U1LB 4AUYA 1E28B 2OX5B 3DNKA 1LE9B 3ASWA 2R56L 3GXPA 4AE1A 1XF4B 2GB2A 4Y19A 2WOYA 4MDIA 2X4TB 5IEHB 4HWUA 1H0DA 5E8PA 1H6UA 4OLZH 1XB3A 6FABL 5HHNB 3IKCA 4AXWB 5BO1L 3S35X 5F7LB 4BUGA 4WEMB 4RX4A 4B50A 1X5ZA 4O2EA 1WAAE 2HCZX 2XWJB 4YHNB 1MHCA 2VDMH 1NM9A 1A02N 1MCNA 2ZWKA 5EEVA 1PKQB 3DX0A 2XN9D 3QAQA 3VQLA 2CLZA 1C08A 2BSRA 4NUMA 4DK3A 4P8QA 2ZAHA 3T0BA 1M1SA 2CMRH 1CT8A 2DWDA 3DARA 3ATFA 1CXKA 1B9KA 4NEHB 1WGOA 3F6IA 3OTTA 3F65A 3OZLA 4ODHH 4FULA 4B97A 3PDOB 4NQDA 2E9IA 4LLWB 3HZVA 3MU3A 5IKCB 3VI4E 2JK5A 2ESVA 1Q9KA 5TDPA 5ETUB 1PQZA 2XICA 4F80A 1AZNA 1P9MA 3G5XA 3SDYH 1I7ZA 5KBPA 3WIIL 1LILA 4KX7A 3SZKC 3NPSC 5HSFA 1MUJB 2G60L 2PP9A 1A0QL 1LK2A 3EW3B 3S3BB 4HT1H 3EYSH 4MCZA 4A7UA 2JIXB 3RFZC 5F72S 3V5KA 1KBKA 3RWJB 1FP5A 1HK6A 4L23A 1Q9WA 5GSVA 1QFWM 2VR9A 1K2DB 1WFJA 3WFDL 1S7VB 2G5UA 2N7SA 4DH2A 2EYTA 4AOFA 5J8OA 4DWHA 1BZEA 4Q2ZA 4A2HA 5EBLB 4RDBA 3TH2T 3PABA 3P73A 5E9DA 3HC4H 3OAYH 2WPGA 3UP6A 3ZKQD 5ITFB 5I1GH 4L4VD 5A7BA 1I4FA 2QHRH 1B2WH 3CZNA 4FEMA 4QOKD 4HS8H 4N6RA 1AHWC 4QCIB 3JVGC 2FNBA 2ISDA 4G7YH 4ZD3L 3REWA 2A83B 3QUYA 4PGZA 2V7HA 3U6RA 5BS0E 1HHGA 4K73A 2XVKA 4UM8A 1KGCD 4UM9D 2H47C 5FXCH 1BD2A 1FL5A 1N6QL 1E3ZA 1WLHA 5T5FH 1ZMYA 3QIUC 3ARZA 1PX3A 4CGTA 5I2IA 5EA0L 2HLAA 4RRPG 2X4QB 1JSYA 1E4KA 3LKPB 1IKNC 4ZMOA 4D2NA 5KYXA 3AB0C 4KVCL 1OCZB 2APFA 1TLMA 1V10A 3PIQB 4HHWA 1KT2A 2E9GA 1FNEA 3K5RA 3S37X 3UTSD 2YD7A 1ZVSA 4AQ1C 2XV3A 4FZEH 4MYPA 1FV1B 1A25A 1MDAA 3MLYH 1JAEA 4M3HA 3REVB 2O93L 4HGMA 2X88A 4UDUB 4OZ4B 1G84A 4QRSA 5ICYB 2ZP9A 3BAEL 3UBXI 1XZ0A 4Z78B 2AXWA 2GJ6D 3KWVA 3QG6B 5F6HJ 3QI9B 5EU4A 4FA8A 2IV9A 1DVZA 3AWGA 4FNRA 4G43B 4E5XB 5HXMA 4UAOC 4QRFA 3U6XA 1QSFA 3R4RA 4CKQA 4M6AA 1I3VA 4HFWA 2KI6A 5AVWB 3KGSA 1RZQA 4MGXA 2FSDA 4U1IB 1FO0H 1ECYA 5T1MA 4EIZC 3IMSA 3LXUX 4CW1A 1NGYB 1SJXA 3GTNA 2FT7A 5AW3B 1OF0A 3MXVH 4N90E 5E5RB 4WHTA 5FKPA 1BM7A 3DRTB 5SX4I 2CNYA 2A9NH 4LNRB 4UCFA 1TJIH 4F3FA 3C12A 1IX2A 5KYUB 2PCPA 3OM3B 3VQMA 5IOPB 5C2UB 4G3YH 3O4OB 3EJSA 1QSFE 1ACZA 4P5RA 4UM9A 2VZVA 3CBJB 1UGNA 3K8MA 3F5WA 4N5ED 1OCCB 4YE4L 4PVMA 4L0PB 3STZA 4M4PA 2LE9A 1YG9A 4W9ZA 3QWNA 1T1XB 2GHWB 5I76A 4PRHA 2WBWB 3STBA 3OR6B 5IBUB 4YHML 2VDPL 3M8OL 5FKAA 5C09B 3ABLB 5JHLH 1OY3B 4Y4HD 4Y7MA 1EBPA 4KJYA 1NUNB 2HG5B 3Q13A 4NWTH 5KW9L 1L4IA 4YSTA 1E40A 1BF8A 3QNZB 4MMZA 1Z7JA 3S4SA 3HN5A 3ZK0A 2QADD 5IEKA 3L95B 2NUTB 4EIG