1OKOA

Crystal structure of pseudomonas aeruginosa lectin 1 complexed with galactose at 1.6 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Calcium and Galactose Recognition by the Lectin Pa-Il of Pseudomonas Aeruginosa
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1okoA00
1W8TA 1OKOA 4LJHA 2Q1FA 2C24A 1W8UA 4YW7A 4CP9A 4AL9A 4YWAA 2KR2A 3ZYFA 1WZXA 1W90A 4BQ3A 5D21A 1W8ZA 1GWKA 1WMXA 4A6SA 4BQ4A 2WYFA 2VXJA 1UOJA 1GWLA 4CPBD 4LKEA 1OH3A 1V0AA 1W8WA 2LROA 4LKFA 4YW6A 3ZYHA 1W9FA 3UT0A 2LRPA 4BQ2A 4BQ5A 3F95A 1WCUA 4CPBA 1L7LA 1HN0A 1GWMA 2K46A 4LK7A 4CP9B 4LK6A 3ORJA 2O14A 3ZYBA 2JWPA 4LKDA
chains in the Genus database with same CATH superfamily
1S0GA 2V5DA 4QPGB 2XJQA 4QXHA 4QDRA 1LGBA 1IS4A 4BQ3A 1RMU3 5LA9A 3V0AA 4NIIA 2WA3A 5CADA 3ZXFA 4FFIA 3K4ZA 4TWTA 3FZ3A 2W68A 5CG8A 2VZTA 2RS51 3CKHA 1BEV2 1KDMA 1OOPA 1GOFA 2ORXA 5KC5A 1DP0A 1BEV1 5A7WA 3GBFA 4YW1A 4B3NA 1O7FA 2RM21 3SC7X 4EZ4A 2JD4A 3J8F1 5FZ1A 3VBUB 2Q5TA 3POFA 3ZFGB 5LW9A 4IE7A 4ITCA 1QJY3 2WZR2 4ZZ5A 5J7MA 2QQNA 4Z82A 4Z2AA 4GMP0 1G9FA 2W1UA 3QD6A 4XJ8A 1RIRA 1DHKB 2WO1A 2Y6FA 2Y33A 5C3OA 2GALA 1SFNA 1RUE2 2ZX4A 3OEBA 3J7HA 5T54A 2A6ZA 3NV1A 5L73A 5B2GB 4GWMA 1NZCA 1W6QB 3KV5A 4XQWA 5FY8A 2WUHA 2K2SA 3GHMA 4R8HA 1UY1A 3FLTA 4YARA 3M4FA 4EN9B 3M3EA 4CDQC 2EXJA 1Q8QA 5LBFA 1HXS3 1SBEA 2R072 3ZMOA 4OHZA 2LALA 1VRH3 4AEMA 4BWOA 5KHHA 1JYCA 2BJSA 2V09A 3AYCA 5FZFA 2ES3A 4FPLA 4KU7A 5IVYA 2WYSA 3VLBB 1G9BA 2GP3A 3S5QA 2XPJA 4L99A 1Z78A 3H1YA 1LOFA 4PLOA 2BZDA 2RR11 4YZ3A 1UY4A 3N9QA 1W03A 1NX9A 2P3JA 2L9LA 1MQTB 5DMYA 3IPVB 1AR61 2OX0A 2VNOA 1UXXX 2E32A 2X5IC 4N43C 3GYDA 3OCPA 4P9GA 4Y4RA 1JMUB 3NAPB 4C91A 4BZ4A 5A6XA 2JG9C 5FXVA 3E1F1 1I5PA 3AVRA 1YO8A 4QXCA 4RA0A 5A80A 4JQRA 1O3SA 1ASJ1 1H4HA 1Q8VA 3KM5A 3PTRB 2P3IA 5EPAA 1LOAA 4CDXB 3VDDC 5A3MA 1FATA 4GZ9A 4HFSA 4QMAA 3N4MA 4GXLA 2VUAA 3C7FA 4FPCA 3TNPB 2B9VA 2NLRA 4YFWA 3P3NA 1X8MA 1S0EA 4CU9A 4YVSC 3VDDA 1QNWA 2QZ3A 1LENA 5FZ0A 4QX7A 3RSJA 3AM2A 1F35A 4KBZA 2OUJA 2PHTA 4LBMA 3KLSA 4UT5A 4TTGA 3S30A 1QF3A 4C1WA 5BNOB 4E4SA 5L9BA 5DAXA 4YW3A 4XDPA 3RPQA 3ZR5A 2X8KA 4RS5C 2GN7A 1CD3G 1ULGA 2X5IA 3D8CA 4N43A 3WG4A 3OY8A 2VCCA 1J1LA 5C8CA 3WF3A 3H3ZA 2PHXA 1V6OA 4URAA 1CX1A 3ZO0B 2QCSB 4XF0A 3T4HB 1W3XA 3TN91 4UFLA 5FREA 5K0UB 3W59A 3AXDA 1OHFA 4GJYA 4NWVA 5A3UA 4LXLA 2WS93 4DOUA 2W3JA 3KCYA 3C8XA 2LW8A 3FHIB 2QTWB 4CVUA 4YPJA 2ZGTA 3PTYA 3QACA 4IE6A 2V72A 2GNMA 1AR91 1BK1A 3FFQA 3SH3A 1W3VA 2D5FA 3AL6A 1BKZA 2D3PA 3RZZA 1GZTA 3AMQA 4BDVB 1OUXA 2Y6GA 3VN4A 4D94A 5FOJB 1LHUA 5FZ6A 1K45A 5HPOA 5LY1A 3FLRA 3WF4A 4K20A 3U0ZA 5KXEA 2BV4A 1OQEA 3HJRA 4E8CA 3MEPA 2OW4A 5F3GA 3WD5A 5C70A 3A0NA 3HR9A 1H0BA 4E27A 5C9AA 2KR2A 3MLKA 1WZXA 1REDA 3EBRA 3UK9A 1YIFA 1RUE1 2YFUA 4MXVA 4Q0QA 2JDPA 2P3YA 1OVSA 1UZVA 3RYKA 3TNQA 4INDA 4FAHA 4MHRA 2RS11 1UZ0A 4UFMA 2ET1A 3PVOA 3CLPA 4XILA 4CU8A 4NUBA 3LDBA 4NIHA 3DXTA 4NRMA 1OOPC 2LROA 4QM8A 4AVSA 4YGDA 1K12A 4E9KA 2VMFA 4QPGC 5KHKA 2RS53 3MW4A 1VBC2 1W8HA 2YUEA 5F39A 5DN2A 4YG6A 4Q4W2 4BM8A 5GLWA 1N3PA 1SFYA 3MGUA 1HQNA 4GMP3 1S0IA 3J26N 5A7OA 1PVXA 1WLWA 3ZYBA 5LATA 2KD7A 2WN3A 2E7AA 1QQP2 1RVF3 2FZ1A 2J1AA 2W1WA 4PDWA 5LY2A 4AVCA 2HYXA 3RZLA 3DYOA 1JYWA 2W91A 3MDPA 4EN6B 4FOYA 3C7GA 3HIFA 2YV8A 5FPXA 1V70A 2ZAHA 1ENRA 3DUIA 3Q8AA 1REEA 2RE9A 3M1HA 5CEHA 1MVEA 4R4ZA 3VBUC 3AMNA 3THCA 1QJU2 4PI2A 1DGWX 1PIV3 1ZZ7A 3H9AA 4OMDA 5K0UC 4FPKA 4PJYA 2D6NA 1FOD2 2QQLA 2R061 2Y6KA 5KWRA 3FC0A 1ASJ2 4QAWA 3VGIA 5K4LA 3CU7A 2DUOA 2JIJA 2OPWA 2Y0IA 2CDOA 4AQ6A 4KU8A 4LLFA 3BTAA 1RUJ3 5A6QA 3ES4A 4LLOA 4AEDA 3BPSA 3N7LA 4RR3B 5FP7A 1U5IA 4KH9A 4TXWA 2J7MA 3FBYA 3SNMA 3IDEA 1GQGA 1XNAA 4QPIB 4Y22A 3U07A 4BLIA 5LWBA 3QCWA 2VNGA 4O9GA 4Y5TA 1QNYA 2WR9A 5F5AA 4AG4A 1AUYA 5IYYA 2HWE3 1AR71 5A7QA 1QIQA 3VZLA 2D6PA 2UWBA 1BMV1 1XC6A 5BYNA 3SKVA 1QGLA 5C33A 3ZFGA 2A1XA 1ENQA 3GBWA 3JCIA 4JZRA 1VB2A 1UY0A 1BBT1 4GWJA 3BTXA 1K42A 4XBNA 3HQUA 2O8QA 2MEV2 2DCKA 3WDVA 5CVRA 2P6CA 4WM7A 1O59A 4N43B 1I6XA 1Y43B 3M8LA 3RZKA 1OLMA 2R16A 3ES1A 3CHXA 1TMF3 3PU8A 4LBJA 4M4PA 1W6PA 5IVVA 5J09A 4U36A 1NKGA 5F5CA 4LQRA 2RHPA 2A6WA 2YC2A 1PO23 4XEZA 2VAUA 2HWF3 4HN1A 2WNVC 4QPWA 4AE2A 3ZXKA 3C7EA 2ZGMA 4V2WA 5FZ9A 5CFDC 3AC0A 3WZ1A 1EV13 1X9TA 1EUUA 1ZZBA 2WQZC 4FPEA 4MX3A 3VBUA 3U14A 2VBPA 4EQVA 3I8TA 3SKJE 3ME2A 3OSDA 3WR0A 4CE8A 4UBHA 3BU7A 2MNGA 5H9SA 3PUAA 1C1FA 1UWWA 4QGMA 2RJLA 5EFUA 3AYEA 2FCTA 5FWEA 5LRRA 4RS5B 3K3OA 3HPNA 4LPLA 4D7YA 4XFIA 4B4QA 1E57A 1H8TA 4YZ5A 3VD7A 3UESA 1US3A 3I2HA 3WEZA 5I0UA 3OD4A 3WNXA 4ISQA 2D6OX 1ASJ3 1UYPA 4XXPA 4BQXA 4AFAA 2OA2A 2HWF2 4A42A 1PZ8A 1Q3EA 4JHZA 4D6SA 4TYSA 4Q4X1 3ENRA 1AXZA 5JOWA 1J3QA 2JECA 4AI3A 1H4GA 1VJ2A 4FQZA 4YM2A 2P1BA 1JN2P 1WLCA 2H6CA 3OG2A 1HN0A 1XQNA 3W9AA 4AAPA 2E6VA 1WCQA 4CDUB 5LA1A 1BBT2 3TN92 3B69A 4CU6A 5LK5A 1UOGA 1S2BA 1D0HA 1W06A 4UOJA 4CDUA 4XF4A 1OFNA 1W6OB 1JOPA 1H8TB 1WW7A 2Y34A 4Y4YA 1RJ7A 1WD3A 1PO11 3QOPA 2GNDA 4RQPC 5D8AC 4IDZA 1KJLA 1RTVA 1RUG3 1SMVA 1WW5A 2H0VA 5J36A 1XBFA 2FDGA 3T09A 2I74A 3NKTA 2IVIB 1KITA 1COV3 2EXIA 2PLV2 4CXXA 1O3RA 2VQUA 1H9WA 4GKXA 2WZR3 5C8CB 1V6LA 1ND3C 1L3JA 1VBA1 1YFYA 1TZOA 2JDMA 4XCBA 3VKFC 4ZKTB 3MLJA 1U5YA 5GLVA 4DS0A 5LBBA 1ALYA 1HX6A 2QQUA 3HQXA 4RQPA 1R1A1 1S4CA 4NHXA 4R52A 3OGSA 2AH2A 4LULA 4P14A 5FMOS 5FMOL 3U1XA 4AFCA 4DY3A 3POSA 1IZ3A 2J1SA 2BW8A 4QQHA 5F8PA 3CNAA 1UMHA 4AFDA 5IVFA 3CJXA 5FYYA 5CZKA 3N7MA 1QJX2 1FPN1 2DU0A 2RS12 5FBZA 2P4EA 1F9KA 2C9KA 2X05A 5IWFA 3BOPA 3ZIWA 5IVEA 4EN0A 1W0PA 1XU2A 1GNZA 4IV3A 5JXJA 3ZXEA 3GGLA 3I2GA 1JZ8A 3A21A 5FV3A 4W6XA 1BVVA 1CQ9A 1OLRA 1RUG1 3F95A 4I3PA 2K46A 1VRH1 4JGYA 1BZWA 5FYBA 4Q4W1 5ABJA 4LO6B 4HANA 2WKKA 2A6YA 2GMMA 5GLZA 5CA6A 1AVBA 3QBQA 1RHI2 3EMRA 4YG3A 5FZ8A 3O0XA 2E33A 3ACIA 1AL21 2OIIA 2ZX3A 4JGZA 4YVWA 1RUH2 4C1XA 3OBZA 4F83A 2XL7A 2XDVA 4IUGA 2VOVA 2VW0A 2ZS6B 4TLGA 1PM7A 2VBDA 2WYFA 2ARXA 4GULA 2PHDA 4JRLA 3POJA 2ORZA 4UF0A 1SZBA 4AI1A 5I0TA 3MHZA 1XRUA 4IEXA 4Q4X3 3ZN4A 4CPBD 1Q56A 4YW6A 4IEPA 4OHXA 5GZFA 2K9ZA 3ABZA 5KBFA 2YU2A 1MPXA 2XJTA 5DQ0A 2WLPA 1KQRA 3P3PA 1CZTA 1VIWB 2NQYA 2BERA 2RM22 1NXMA 1DQ0A 1WBFA 4MHUA 1JZ4A 1HQLA 3CDZB 1YNAA 2HWC3 2IXCA 1OVPA 2JDAA 4QGLA 3EQEA 5DZFA 1R1A2 3NAPC 3POYA 4FPGA 5ERLA 3HD8B 1EUTA 1PGW2 3I2FA 1MZ6A 3UETA 2WT2A 4WM7C 1TME3 2A6VA 1QOSA 4WVZA 2V5YA 1T6BX 5SV8A 5FZAA 3ZSLA 2R49A 3NMBA 3INAA 1C8M1 4Q27A 5A32B 1JYIA 4BXFA 1U5ZA 1KJRA 1MEC3 1ULDA 4EJRA 5C8WA 4HLTA 4WZCA 3MV11 4BQWA 2J1RA 1AXKA 2SBAA 4CPBA 1MEC2 2JE9A 5GM0A 2B5HA 5IATA 1NCQB 2HWD3 3PVBB 3PDQA 3ASIA 4GQ7A 3WOGA 1TEIA 1LB2A 4IEWA 1REFA 4XHBA 2WNVB 1W0OA 3IDAA 3POBA 5FY7A 2VQTA 1DCSA 1IHMA 1SG3A 1UN1A 2XBO3 3AJYA 3JB4C 2J1TA 3UNPA 2WFF3 5FTTC 3ZN5A 1ND3A 5DUUA 3VBSA 1FT9A 1O4ZA 2PTMA 5DDJ2 1RJ8A 2PLV1 4AQSA 1ZX5A 3TB0A 1AR92 1RUNA 3AP7A 5HCFA 4KGGA 4P00B 4WV8A 4LA2A 3ZXDA 4I0WB 3KT7A 2TEPA 3LAGA 4CCLA 3Q8CA 5FYUA 1RUF3 3FX3A 4XTPA 1XE7A 1R082 4NN0A 5A7WB 4MSVA 3O7OA 1YQ2A 3EB7A 2ZMKA 4QB2A 3JBG2 4DEVA 3ZSEA 2J22A 1R083 2D97A 3NV2A 2VUCA 1C5HA 4XFBA 5H9RA 5DUWA 1MQTA 2XHNA 1JW6A 3KT1A 2Y6JA 1CVNA 3LE0A 1AR83 3KHCA 1IS5A 4X8PA 4DMIA 4Z8BA 4IL7A 1XYOA 4CEWB 3TEWA 4WM8C 1CAXA 1XE8A 2A6XA 1XYPA 1VBE2 4ZONA 4DINB 2XVKA 1H8TC 3M3IA 4WM7B 1HB4A 5CBLA 1BMV2 2QQIA 2ZHKA 5FZ4A 5JLVA 4X8NA 2AACA 1O91A 4OULA 1QQP1 5LK7B 1JODA 1XPWA 2D5HA 2VPVA 1N1TA 5E8AA 4C0HA 1OOPB 3M3CA 3DGTA 4HXCA 4JGYB 4OI2A 3GHNA 5FPBA 3A0KA 2V73A 1VE0A 2YZ4A 1JU4A 1QWRA 2QKDA 3NRUA 4H7MA 2B7YA 1SHWB 3B9IA 4D0QA 1JYXA 2CY6A 5CFDA 3WV6A 3WP6A 1GP4A 3Q8BA 4CUAA 5L7OB 4S2DA 5ACA3 1C28A 2Q8CA 1PGSA 4AFMA 1DBNA 5LEJA 1JYVA 3MUY1 4KWKA 2VUJA 1CESA 5FK8A 1POV1 2NZ9A 5FPZA 3VBSC 5CG9A 1O6UA 4OHYA 2VG9A 3N7JA 2HWB1 2QBXA 5JCTA 5BNQA 3C7HA 4FO9A 2Z2SB 4IE0A 1VMJA 1DDLA 3APBA 4X6QB 3V56A 3ZXLA 2R0FA 1ST8A 4Q0SA 1SBFA 2TUNA 2PYTA 2VJXA 3T1LA 5JZGC 1IKQA 1W8TA 4XQ4A 1GYKA 3ETQA 2C5DA 1DGLA 3JBG1 3OJBA 4URTA 3VD4A 1WBLA 4JKLA 4YNIA 1XE0A 2D6LX 5HV4A 5DAWA 1VMFA 1ZA7A 1LESA 2ZACA 4Y1ZA 3WP5A 4EN8B 2CWMA 4HVOA 4AVVA 1FPN3 4MGKE 2HWD2 2AEZA 3ST7A 3MFCA 5FBJA 4P5YA 1JTZX 2CHHA 3NV3A 4JDMA 4LOTA 3ZYHA 4Z1VA 2P37A 1IG0A 1N47A 4CUCA 3E6DA 2F17A 1SLLA 3HN3A 4L2NA 2BOJA 5FQ0B 5FZ7A 4W8JA 1VBE1 1ND2A 3VBFC 1LAJA 3B01A 5F6KA 1UMZA 2B9UA 2ZBJA 3AK0A 1LECA 4MGYE 3VD9A 1SBDA 2ARAA 4CEWC 3NAPA 3AKTA 1T2XA 1MS4A 2A75A 1EPZA 3D0JA 4XZUG 3M70A 4YGCA 2UU8A 1W8UA 5F2SA 2D43A 3HWJA 3MYXA 4BMEA 1COV1 1RHI1 1DIWA 3BTZA 5H9PA 2PAEA 3ZVXA 2XHKA 3NNFA 1YQ5A 1LJ7A 1ZNPA 2PHRA 4NROA 2EXHA 1W2AX 2E7QA 4K1YA 2HJIA 4HOOA 2CAUA 1C5IA 2D7FA 2X10A 4AQ2A 2FDFA 3RZMA 1XOYA 2GN3A 2R073 4Q4Y1 2ZGSA 5IVJA 4HL0A 3T2PA 5CAZA 3UKNA 5F32A 4PDWB 1JOBA 1JUHA 4ZU7A 1O5UA 2WZR1 3D82A 3T0BA 1LOFC 1BK0A 1ZZ9A 3WG1A 3JBG3 5CKNA 3PVEA 1J83A 4JX0A 4M00A 4AF9A 5CISA 2GC1A 5ABJC 5LZ6A 1BJQA 3OY8B 1FNZA 1JHJA 4MO3M 3SISA 1H1AA 1UZYA 2BEOA 4XETA 3LDRA 4COYA 1QKQA 2FZ2A 2AR6A 3SH5A 5L9RA 2XKPA 2WWJA 1AJOA 3OEAA 4MGTA 2VOTA 3O14A 4ASKA 2WS92 3OGJA 4LE3A 1AR72 1OKQA 1E5IA 3JUUA 4GH4B 1GZCA 1GU3A 3LQCA 1YJLA 1IKPA 1CN1A 3IDBB 4Q1PA 1DU3D 4FSJA 2HWE2 1OI6A 1GFF2 4PI0A 2WINB 5E16A 3I3MA 4YW5A 4IEQA 1VLNA 3AZYA 4P9JA 4XDQA 5ANNA 5FWJA 2CAVA 1WLDA 4KWUA 3ZFEC 5JPNB 4CUGA 1V00A 2VMEA 2XUMA 4ZY9A 3Q9OA 1WA4A 4BXSV 3AP9A 1NOVA 4RL7A 4HSLA 1AL22 1CJPA 4FPYA 5HCBA 1CX4A 3W21A 2WO2A 5D1IA 1H2KA 1XJAA 3A4UA 3LCPA 1VBB1 4Y20A 1CAWA 2WJSA 4O61A 2BGOA 4BU2A 1VBB2 2Y8KA 3I3BA 3KQRA 3ZSJA 4M3CF 1OA4A 2IUWA 5I0RA 3GZAA 3VKLA 4L97A 3IM0A 1LGCA 3RMXA 5IK8A 1RUC1 1RUD1 4W6YA 3ZX7A 4OQ9A 3LFMA 1S55A 2YY1A 2WAAA 2Z4FA 1OBNA 2BGCA 1WKYA 3SEPA 1JXNA 3VHPA 1QHDA 3HNMA 5FY0A 2G9FA 4OI1A 1VBD1 3QH7A 3N9OA 1FV3A 5C8CC 5T52A 3M3OA 1MZEA 1NA1B 3J8F3 5BY5A 1Q8OA 1CAWB 2GH8A 3R05A 1ZVFA 4XUQA 4AEKA 4F8AA 5K8SA 4MGQA 5F2WA 4I2OA 1ZA4A 1F2NA 1NA1A 4CYDA 1GQPA 4HBNA 3ROUA 2VM9A 3S0MA 4M3CB 2BPA2 5I0DA 5H9QA 1VRH2 3VKNA 3V0BB 5C3SA 4JC1A 2VQAA 3HNYM 4Q1RA 3VBRC 4XW3A 5GKAC 3MIEA 3ZOIA 4FPJA 4P9IA 1OA3A 5JIUA 4LKSA 4QHBA 5BNOC 5JSRA 2Q1FA 1WMFA 2B4KA 4ZXKA 3VBSB 3SXWA 3ILFA 1VBD3 1XSQA 1AYM2 1GZWB 1QXJA 2CL2A 3D6EA 4QKNA 3UKTA 3VBOB 4AI0A 2A5ZA 2WWUA 4MXWB 1S1AA 3GF6A 4DXSA 2ADEA 2V4VA 1D0GA 4LBNA 2W87A 4XJZA 4OZXA 1GZWA 5APAA 3VBOA 3ZFFC 2RS52 4NHYA 3I2OA 1K5MB 1W04A 5DG1A 3M7AA 3E97A 4AGRA 4XVHA 1YFUA 3RVHA 3BALA 4DY5A 1K5JA 1ONAA 5FPUA 4LO8A 5JWPA 4ZU5A 2PAKA 4PBOA 1HRV3 2DVGA 2WLQA 3LDKA 1UYZA 3NSTA 2N7GA 5A3OA 1IQDC 1DF0A 4CCOA 1AXYA 4FFFA 5FJKA 2VCMA 3NW4A 4IV3B 4D69A 2P5BA 1IS3A 2ZKLA 1PZ9A 2G19A 1PMIA 3KV9A 1U0AA 4JRAA 1RUE3 1OD5A 1W2NA 4GWIA 5A7PA 1FOD3 3ALQA 3POEA 1A34A 4C8DA 3IT8A 2XJSA 2DDUA 3AZXA 1MS8A 2VMIA 2WNOA 2UY9A 1J3RA 3LEGA 4OI0A 5A1FA 5FYVA 1PK6A 3TRSB 4D7SA 1D2SA 1GWMA 2XOMA 3H42B 3OPZA 5A1LA 1EV12 1T6GC 2CWSA 1KRIA 3ZSKA 2R043 1XNKA 2R1BA 4MH0E 2XWJB 3HNBM 1RYYA 1XU1A 4UF0B 4EWEA 3BB6A 4AW7A 1NLQA 2JIGA 5GZEA 2P3KA 2PMWB 2VVDA 4XF9A 4LBQD 5FKBA 3VBRB 3WQ1A 3O1SA 1GNYA 5KHIA 3FHAA 4NHMA 2WNEA 1POQA 3LEKA 1V9U3 3PJQA 3KGZA 1QOOA 1AHSA 4COZA 3ILRA 3UT0A 5DG2A 1OLQA 2BVBA 2I2SA 3JXSA 4A41A 3PIGA 2XR4A 2HWB2 1W8FA 2A71A 3P5BA 3JZVA 1AR82 3WW3A 5IHRA 1LU2A 4W50A 3WDUA 4AQTA 4DB5A 2WWSA 2JDYA 3I2JA 3FWEA 4RYDA 2QZ2A 5C7GA 1J84A 4FOQA 3HBKA 1K3IA 4Q4V3 3FN9A 1UYXA 3PURA 4ZS2A 3LIHA 1AJKA 3LKJA 5T3NA 4EN7B 3O1MA 2E53A 1SDWA 3I2DA 2D93A 4FQ4A 2WS91 4NO4A 1R093 4OCTA 1E5HA 3NWKA 4NIGA 5T50A 2XUEA 5FYCA 2GMPA 4JCKA 5IW0A 3ZFEB 3BU0A 4Q4V1 2HWD1 5DZEA 4QPIA 3UKVA 4CEYA 2QQOA 3MFAA 4XUPA 2UWCA 4RR3C 3X29B 5J37A 3OYWA 4HONA 2UYBA 5FYSA 3D3AA 2DBIA 2ET7A 1JZ3A 1OH4A 3F2ZA 1MEC1 1GICA 2XJUA 1YI9A 1YYNA 4LIVA 4M3CA 3H3LA 2BRTA 4WM8B 4CDWC 2VCBA 4KBBA 3NO8A 4B7KA 5C3PA 3IN9A 1LOEA 2VZUA 1SCSA 3GCXA 1H6YA 2JXAA 4P9YA 1F8VA 3AP4A 4XF1A 4XABA 4LIUA 4XAAA 4AEJA 3PVNA 2W39A 1YI7A 2ZOEB 1QJX3 4IXLA 5C6CA 4A7YA 5BXXA 1WCSA 1D4M3 4SLIA 1GMMA 3ZM8A 5FLJA 4WVVA 4QQPA 4RD7A 5C5UA 5F3CA 2V4AA 1HDKA 2WO3A 2XKOA 1NYWA 3BTYA 1EAH2 3MW3A 2VVEA 1HJGA 3VZJA 3LOBA 1VAKA 2Q0AA 5EZWA 3OUJA 3CJIC 3PHMA 1NE6A 2AYHA 3O0WA 4TSVA 2YB7A 4XAEA 3MPPG 5L36A 1J3PA 1DYKA 3WCRA 5L9VA 2GNBA 4PIZA 5E1RA 3WP4A 4RS5A 5K7PA 3A22A 4XFFA 3PUHA 1F31A 1XSRA 1QMJA 1V9U1 3ZPYA 4FP3A 5AC92 4RFT0 2UYAA 4AHZA 2G9ZA 2XL9A 4HETA 1HB2A 2UURA 5DXDA 1VBC1 5FZKA 4Q4X2 1G6NA 1PM4A 3WQBA 5HXVA 1L7LA 2QQMA 2VOWA 4JQTA 5A6YA 4PT6A 4CP9B 4QX5A 5JSPA 4F3JA 1GNHA 2XQRA 1RL3A 3HEIA 4NMIA 3TEXA 5F7UA 5JR2A 1PK6B 2YFZA 1W2OA 3OBTA 2P6HA 1UAIA 2AENA 3PMSA 3RS6A 1O8PA 3SH4A 2BNMA 4BIFA 5HBAA 4HK8A 2C26A 5J48A 1DZTA 2D6MA 1G7YA 4I3GA 2LTNA 1GWKA 4CDQB 1W6OA 2AEYA 2YPJA 2R7EB 4AI8A 3L2YA 4MGSA 4Y3OA 5FXWA 4CTEA 3H7YA 3JQXA 4BJ0A 2QDRA 5T5LA 1FOD1 1A8MA 1LR5A 4YGEA 1OQDA 1OURA 3NKGA 2YU1A 4HKWA 3WNPA 2D40A 2RVAA 2YPDA 2WSVA 4K6BA 2Q1ZB 4GMP1 3MI8A 4QPIC 5T55A 3B3QE 2VTXJ 3U37A 1WCKA 1H2NA 4IEOA 4LKDA 5I93A 1H9PA 2P17A 4Q26A 3B7MA 5A33B 1W99A 1N1YA 4Q0PA 2C24A 3SHRA 1RUI2 5LRSA 1FNYA 1VBD2 4CXYA 4YWAA 4CDQA 2EIGA 1RUI1 1HRV2 1MZFA 3BN6A 3IKWA 2OQ6A 4XJUA 4Y33A 4UFKA 2W95A 5FK7A 2QJVA 4A6SA 1QJX1 4ASMB 4Q8KA 2WT0A 3TN93 4AYUA 5FDBA 3LSEA 1B35B 3LPGA 2NPIA 4XCAA 4CCCA 3VB9A 1JUIA 2CNAA 3VDDB 4A2UA 4FAGA 3D4KA 3EJKA 2JICA 4ZS3A 3ILNA 5EJ1B 2F4LA 3MUZ1 2ZGNA 1PVC1 1UKGA 4I30A 4RSUA 5T5JA 1OXCA 5ISLA 1RUG2 5F3EA 2J42A 4LOSA 3THDA 1CIWA 3ZDVA 2AC1A 2HH9A 2OKXA 3WY6A 4MV2A 2ENRA 4LR4A 5JDBA 4MADA 3WNKA 4XBQA 2E51A 5BNNA 2QQWA 2WNUB 3ZYFA 4QX1A 2VMHA 4OHVA 4GD4A 3ZYIB 1DG6A 4FCAA 2XVLA 3GCWA 1B35A 1FXZA 1MS1A 4ZU4A 2ZHMA 4E2GA 5LA0A 3ATGA 2R32A 2WNUA 4UW3A 4NRPA 5CNAA 4BIOA 2H6BA 5IK4A 3PUQA 1Z0HA 2XLAA 2C6SA 1LHVA 4S2GA 2AUYA 5CFCA 4OFGA 4KNCA 2VZOA 3WINE 3PLQA 4J1XA 3SITA 1BVP1 1ULOA 2RS13 2A3WA 5DAPA 3RFRA 3TBDA 1LHOA 1R081 1PX4A 4WVMA 3S6PA 1DQ5A 4BA6A 4AHXA 5AVPA 1RB8G 2H0BA 2XBO2 2OZ6A 3RYPA 1AL23 2E63A 3DEMA 4TZDA 2PHUA 1J1TA 3VHRA 2QQVA 4FPHA 1CR7A 1RUF1 1HKDA 2VECA 5BNPA 4HVRA 5FLIA 1DQ4A 1CAUB 1YLLA 3USSA 4MZUA 5FO7B 3H3UA 1LHWA 1WGPA 2A7AA 4Q4V2 3T2TA 4P9LA 3ACHA 3EHKA 4CSWA 1CAUA 1Z7S1 1H2MA 2MPFA 1DYPA 2VZ3A 4NOTA 2NP0A 3N9PA 1FMD3 3I4IA 3NJYA 3CBNA 1ZM1A 1DLLA 2ILMA 4LO5B 4QKFA 4C0BA 4PIXA 1KGYA 2FHRA 4PQQA 1WW6A 4XJAA 2P2KA 2KM2A 3TOJA 2JX9A 3ZXAC 2VY0A 5ANQA 4XXAA 1UL9A 4IGQA 1PZ7A 2EAKA 4FTEA 5FUNA 4CP9A 4DNYA 1RXFA 4N9HA 5G05L 5HCAA 2VGDA 1NQDA 5A7SA 5HI0A 1A78A 3CO2A 1LOGA 2RS31 3E5UA 2LS6A 5FY4A 3VKOA 1Q5OA 3MZHA 3IIIA 1WCDJ 4CDXC 5IAVA 1GWLA 2ZMNA 5DDJ1 2BBAA 3FUQA 5JR7B 5C9AB 1EY2A 1NCQA 4XUOA 2WDBA 3WF1A 5A3NA 5I8SA 5JXIA 3D0SA 3AYAA 3IMNA 5ACA1 2C1FA 4I02A 4JAAA 2ZGQA 2DFCA 4XF3A 1LODA 1RGSA 4NVPA 1AF9A 2VW2A 2DTYA 4RGAA 2CSGA 2W1QA 4GH4C 2VW1A 3B02A 4LORA 4R9CA 3UGGA 1WMDA 1HV1A 4YW7A 1D4M2 4AHWA 2OYZA 1ULPA 3R0RA 2Z69A 5LEKA 3ZYPA 4LE4A 1F5FA 3LFIA 2ZX1A 3I2IA 2XLGA 1OF4A 1BQPA 1AZDA 1SFPA 2ZPXA 3FBMA 3H8UA 3HBZA 4UXAA 4UFJA 3DPRA 3OGRA 2RDRA 2QNKA 3TYJA 2RJ2A 5IFTA 3WHUA 4KG0A 4YM1A 4GB33 1DQ1A 1UO9A 4IV1A 1X7NA 3NV4A 2GC0A 2VL4A 1QY4A 5AC93 3K51A 4BK5A 3K3NA 5FZLA 4A3XA 5FZ3A 3K4DA 4QXBA 4AVAA 1V6IA 5I91A 5C5TA 5C4WC 4YFZA 4Q8LA 5KXCA 1OKOA 2JB4A 2IXHA 4LJHA 3LF7A 5GLUA 4QX0A 5DAVA 1UKRA 1X36A 3GM8A 1CONA 2R0HA 5AVAA 4LHNA 2VD7A 3WDWA 2HEYF 4ZXEA 1HB3A 4ISRA 2VMDA 2HKXA 2ZAAA 4LHLA 1SPPB 4CDWA 3H8RA 5AFEA 2Y60A 2DURA 4U2AA 4Y20B 1Q8SA 1KFUL 4Y24A 2VTXA 4G3YC 1W0NA 2XH6A 3AXEA 3L2HA 4RHV3 3AP6A 1E5RA 4FTBA 3T30A 2YYOA 3NNGA 2ZEZA 3E5XA 3VZNA 3ZKYA 3DL3A 1ZBE2 3KWVA 1D2QA 4WVMB 4Y1UA 5CFDB 4A44A 4AL9A 1IPJA 2X09A 5BPXA 1QXPA 3WSOA 1F15A 5D21A 2PQQA 5FZDA 2BU9A 3CZUA 3LPFA 4MYEA 3O5SA 4UW5A 1VAMA 2AZ5A 1P8JA 4AXOA 5DAQA 1Y9QA 1PIV1 1W6PB 1YXWA 3EXUA 4FXKB 5FZMA 2ZZJA 3ZXGA 5F9TA 1ZREA 4H7LA 1GOHA 2WC2A 1CGPA 4FFHA 4M3CE 1O3TA 2FQPA 3RWNA 4CCMA 1RMU1 4V1PA 3POGA 1SQ4A 2W1SA 4WBBA 2WSUA 1WUVA 4B29A 4CZSA 2WZPP 2E7TA 2YBSA 1RUJ1 2ZX0A 1RXGA 2Q30A 3PL0A 3O1RA 3G7DA 3OOXA 2ZEXA 3USUA 1DGRA 3E5QA 2DFBA 4IEZA 1CWPA 2WFF1 4QB1A 1ZBA3 1GKBA 3PMEA 4ET7A 3IAPA 2BUKA 3OPWA 2ZJCA 3WG3A 2R063 1SLBA 4AGGA 3WDXA 4COWA 4CCDA 2Z42A 4XFAA 5A3LA 3I3EA 5FZIA 1SLAA 3AFKA 3DYPA 3MV01 4W4ZA 4CA9A 3KZ4C 1UY2A 1JOJA 3CF6E 3GXUA 2FDJA 3IZOA 4BK4A 5HV0A 1F4HA 1ULEA 4M01A 1W9SA 3GZUC 4KG8A 2BWAA 5FXXA 5KR7A 1YWKA 4NE9A 5GALA 2CGOA 3HN1A 1VR3A 4LT5A 3W5MA 2FDHA 2JD9A 1W28A 1MR5A 1HXS2 2RDSA 3AYDA 3OGGA 5FYHA 1C3HA 1HXS1 5LASA 1V0AA 4HN0A 1W9FA 3VV1A 3AMPA 4P9WA 1Z7S2 2XLFA 3RI8A 2ZABA 2R042 4LITA 5LBEA 3RJRA 4XIKA 2G1MA 2R041 2TNFA 5FY1A 4HSJA 3WX5A 4HK9A 4TN7A 2W47A 5KHJA 1K5MA 3ORJA 2VH9A 4LBLA 3NQHA 4LBKA 3DXUA 2GH2A 1UQXA 2DCTA 4W6WA 2FMDA 3AFGA 4UFIA 1VBE3 1HLCA 4QX8A 5JIAA 5CKMA 1US2A 2YROA 3MIHA 5JMCA 3V0AB 4K7JA 4BCUA 4IGPA 2NMNA 2RDQA 2W2IA 3H0OA 5IUQA 1QDCA 3DYMA 4Q29A 4ARXA 5F1RA 2PHFA 2XONA 1G9DA 2B45X 4NIDA 1NT0A 4RR3A 3VBRA 2J1UA 1HRI3 2WFPA 2O0OA 2UWAA 2ZX2A 4A3ZA 4CRQA 2VE1A 4N7UA 4XE9A 3MIGA 5FLHA 1Q43A 1PX3A 4BQ5A 4DPNA 2GAUA 5DPNA 1JS9A 4V2VA 2VO5A 1QDOA 5ACA2 1M06G 1QU0A 1BHGA 1BLZA 2VOXA 2X53S 1AYM3 2VZVA 2BFUL 5FP8A 1WMEA 3C3VA 3S7IA 1TVGA 3PU3A 5JVVA 2B46X 1YFWA 5FQ0A 1DQ6A 4Y26A 4LEJA 5F6LB 3ZPOA 4NPMA 1IPKA 1W8ZA 4LMFA 4D7TA 3DF0A 3H8XA 2OT7A 1UMIA 2W5FA 3R4DB 3IMMA 2Y38A 4N53C 2Q8DA 1OQ1A 3WW1A 3OBRA 3MF6A 2W0XA 2XGXA 4JTOA 4JGZB 4YVWB 3VD3A 2GU9A 1YQ8A 4LHSA 1W6MB 4HVQA 3V64A 5J3UA 1N1SA 1W6NA 3N36A 3NJVA 1WCUA 4AEDB 3VZOA 1UCXA 5FXZA 2HEWF 3KGLA 3MIDA 3IAQA 4PHZA 3DV8A 1B35C 2Y6LA 3OYWB 3S57A 4K21A 4BPZA 1CAVA 2CTVA 1UNBA 3ZXJA 5BNNC 4OI4A 1AYM1 2JG9B 4E4HA 4COVA 3AKQA 1MS0A 2J1EA 2YG0A 3DPRB 3AZZA 4BHPA 2CGPA 1GLHA 1HV0A 5LB6A 1WMXA 1Y9GA 1KEXA 3J7LA 2EVXA 1ZBA2 1QJU1 3I54A 3T0AA 3N35A 5A1AA 3USUB 2ID4A 3CJIB 2EF6A 1HRI1 2RJKA 3PUSA 4E4ZA 1R1ZA 3CQOA 2A70A 2F4PA 3BYWA 1DZQA 3LA3A 2HBUA 3N9MA 1BCXA 3HMYA 4Y5Z0 4YZ2A 4GIQA 3WT3A 4Z07A 2YXSA 3IBMA 3E6CC 3WCSA 4BISA 5EJ3A 2J1VA 4GAZA 1R1A3 4AAXA 1NG0A 3LSDA 4E8DA 3ZLIA 2IFRA 1KD7A 2C9AA 3WNNA 1NAEA 1KS5A 4BQ4A 2O1QA 3H7JA 3L9JT 1VB4A 2I45A 3TWIA 2XQXA 3OB8A 4ZPIA 2XXZA 2E9QA 2EIDA 2R1DA 3JD72 3BIEA 4S2FA 4Y5SA 2ZMLA 4E2QA 1YRZA 2HWE1 3THTA 4LA3A 3CL1A 1ZRIA 1SLTA 3LA2A 4DXRA 2DBNA 1YUDA 3WQ7A 3ZYJB 1RMU2 2Q1MA 5T5OA 3ZKUA 1GOGA 3KMHA 5FPVA 3VDCA 2FD8A 2JWPA 2Y26A 3MPBA 4M4RA 4DRRA 3T08A 3T2OA 1SPPA 1GP5A 3NJZA 1QJY1 3CMGA 4QU1A 5SV5A 4QT6A 1A6CA 5T5PA 4AI9A 1COV2 2WFF2 5CYYA 4IEYA 3I3QA 1O8SA 3MICA 3KS7A 4GKYA 2JG8C 2WABA 5E89A 3RQ0A 1UX7A 3H1MA 5I8TA 2ZZQA 1NCRA 3ACFA 2R6QA 2UY8A 4X6RB 1QH6A 3THPA 4CCNA 1IGOA 5CU1A 2VNVA 3I3DA 1HRI2 3GJAA 4JGYC 4Q5OA 4LNVA 4W65A 4AGVA 1W8NA 2W46A 5KXBA 3KHBA 1NCRC 2WZ8A 1NA1C 3LEMA 2OVUA 4O7XA 3GJBA 4AVBA 1O3QA 2NM1A 4O9EA 3JQWA 2IXKA 4Q4Y3 3RG0A 2NN8A 2ZA9A 1NE4A 2HBTA 5FRAA 1C8NA 2VVFA 1RUF2 3P1IA 3I49A 5FR3A 4CCKA 4DUVA 4XPVA 3KVBA 1UOFA 2ZHNA 3KB5A 5FP9A 2MEV3 2HWF1 3J9SA 5IFPA 2GP5A 4JDOA 1U12A 1C8M2 1XNBA 2YDEA 2ZGLA 3VKMA 1J59A 3K48A 5FYIA 3ZR6A 4A7ZA 3BI3A 3WUDA 2XG3A 2XJVA 3JD71 4UWDA 1PO22 2B39A 2GMEA 1UF2C 4YZ4A 1AYN1 1W6MA 1CIYA 2A3YA 3ITQA 5JI9A 1GUIA 1VBC3 2FBEA 5JSOA 2DYCA 4ATEA 3U4XA 4IE5A 4LO4B 4QXKA 3ACLA 5DABA 2KA3A 1G8WA 3ZFEA 1POV0 4YZ1A 4CDUC 1O4TA 4FOVA 4QX2A 4RGKA 1UOJA 3ETPA 5FY5A 2OZJA 4ES9A 3J7MA 5C4WB 5JAXA 1YQCA 3O1OA 3RYRA 1YC61 2A3XA 4A7KA 3RZJA 4NIAA 1RVF1 1ZYBA 4R9AA 4RQPB 2DCYA 2IXIA 1LOBA 4GA9A 2JG8B 1W9WA 4N53B 4QQLA 5CKQA 1GP6A 3T0DA 3HT2A 4FT8A 4H3WA 2ZHLA 5IT6A 5CB7A 4E2SA 1TQ5A 4B1MA 5FMBA 1RHI3 3H1WA 4PBPA 5BUVA 2E31A 5FOBB 1I3HA 1S0CA 2RM23 2BP6A 4BE3A 3KQ4B 3KVAA 1MACA 3I59B 1X82A 4OMCA 5FYZA 4DUWA 4FPFA 5AC91 3K46A 3BUCA 1PGL1 4DIQA 4IV1C 2HYKA 1JH5A 4KGQA 5BNNB 2W9XA 3LWCA 1HB1A 3RI9A 4QKDA 4FOWA 1TE1B 3DPRC 4N53A 5JXGA 1HJFA 2JE7A 4L92A 1JZ5A 1H2LA 5L7OC 1YQ6A 1TNFA 4UW4A 2JEMA 5FZCA 1DLCA 5CFCB 5E88A 2PLV3 4BH9A 1JZ2A 5FCCA 1MS3A 1E5SA 1KXGA 2QQPA 2Z5WA 3J4UH 5A70A 1VALA 3RRDA 2IXJA 4J1WA 3SEEA 1MS9A 2BOIA 3BCWA 3G6JB 4HZFA 4MVTA 4YYOA 3UJOA 3B94A 1UPIA 5LCWL 2PHLA 2PFWA 1G9CA 1PK6C 1Y7BA 1JU3A 3AB0A 5FZBA 1FV2A 1M4WA 4OUEA 4Q0VA 2LUWA 2PHWA 4PCRA 2C0ZA 4Q4Y2 3WHTA 3AL5A 4BMBA 5FMDA 5FPLA 1WLTA 2K0GA 4LK6A 4EWAA 1I9RA 2CV6A 1MVQA 3J8F2 1EYBA 1GQHA 2JB8A 2CU5A 3SLIA 1ZBE1 5A3WA 5M0TA 1QJFA 5AFBA 3GDBA 2OXBA 1XYNA 4ARYA 5JZGA 1OPMA 3JU9A 1HRV1 3WLUA 3N7KA 4AWDA 2BVVA 2PN5A 2NYYA 3FLPA 3FHQA 2QDNA 3N9LA 1CJDA 2EIEA 1SCRA 1LNSA 2JDZA 3VUOA 3FL7A 3O1TA 2JENA 1LCLA 5FAXA 3ZN6B 4ASLA 3ZFFA 4NWWA 2R071 1R092 1YJKA 1L7RA 2Y64A 3A23A 2DUQA 2B8MA 5BNPC 4IV1B 1OUSA 1TME2 3POWA 3ZN6A 2YGMA 1ODMA 1LTEA 1N3QA 4YM0A 5FZOB 1ND3B 3FUOA 4IGOA 3OBAA 5BNOA 2ZGPA 4XHXA 1DGRN 3IPVA 2G9GA 1A3KA 3LD8A 2HLEA 2Q8OA 4AI2A 4BLJA 2G4IA 5L19A 1UY3A 2D98A 4AK3A 3B93A 3IB3A 4PDWC 3O0VA 3POIA 4NRQA 3NNLA 5CFCC 4PLNA 4DXTA 4YG0A 1RUD2 1RUC2 2DUPA 4XURA 2NMOA 1OFSA 4AZZA 5J96B 2WNUC 1PHMA 4B7EA 3OF1A 4XYXA 2ARCA 4QPGA 2JKXA 4OUSA 3TAYA 1N1VA 3UGFA 1W9TA 2BGPA 2DVBA 2GSYA 4QQ2A 5GZDA 1AX1A 4I09A 3J7NA 5L7OA 2GDFA 2PAMA 2XBO1 4N9IA 1HN1A 1PGW1 2WQ8A 3IIAA 5G04L 5JUVA 2AREA 1CAXB 2DV9A 5FMCA 2XVGA 1SLCA 4S2HA 5EJZB 1S2EA 5F3IA 2IZWA 3B00A 1F4AA 1W8WA 4Z2WA 2WIIB 4D3WA 3KV4A 1OA2A 2WT1A 3LZZA 4M0HA 3SCFA 5B4NA 1BXHA 4XJWA 4B1LA 3RZHA 1AYN3 1VPHA 3I97A 4COUA 3M3QA 4H55A 1O4YA 3OUIA 2XJRA 2YBKA 3AZWA 1UIKA 2JJ6A 3O12A 1WA6X 4MGZE 3VL8A 4B8EA 4EWDA 4K9SA 1ZRFA 4R4XA 3W5NA 4JKKA 1VRBA 4N8MA 3OGVA 1LU1A 3WDYA 1W6QA 3UL2A 4Y1XA 2PELA 4YGBA 4XUTA 2YHJA 2W08A 3T4VA 1IS6A 1GV9A 1NY72 2WRAA 3BPZA 5DDJ3 1NXD1 4XBLA 3QH6A 2RV9A 3SCHA 4OVEA 4B4PA 4XFCA 3ZIXA 1QQP3 1RVF2 4O65A 4N7IA 2VOKA 3OPTA 2ZGRA 5JI7A 3NNMA 1OF3A 4A4AA 3AKSA 3U10A 4QPYA 4GJZA 3T2QA 4IEUA 4XMIA 3MBWA 4RN5A 4DO0A 2VZPA 3NL1A 5KHGA 3MO4A 4BQ1A 4JDNA 3FFZA 4EZHA 2ZGOA 3B5LB 4FVVA 2BTVC 5C4WA 1IQAA 2HWC2 2DU1A 4C90A 4NJ4A 4PF5A 1H1MA 4K1ZA 5JZGB 1LHNA 1X50A 2D3SA 1LEMA 2IXLA 2RMU3 4R9BA 4QGNA 3WW4A 5JXHA 3GZEA 1JYNA 1UU5A 3S5AA 4L11A 1UW8A 2I07B 2WBKA 3LB9A 4SBVA 4R9DA 4E4DX 3ZMNA 1CAVB 3E6BA 1LRHA 2JG9A 4KWLA 2WNVA 2WZEA 3VZKA 3FE5A 3V0BA 4NPLA 2VR4A 3ZFFB 1SDDB 4I01A 4MOAA 4LBQA 3WW2A 2VZRA 3GZTB 3R6SA 5DUVA 3RNSA 4AHYA 4EE2A 2OS2A 2IFWA 2WQ4A 4CU7A 4PF1A 4K40A 3CEWA 4GH4A 3HAGA 3CJIA 2Q4SA 4K8FA 5EYYA 1UPSA 3U4SA 2IVJA 2W94A 1LEDA 1LKNA 1UD1A 3VL9A 5GZCA 3WQ0A 1EP0A 4DZGA 2VUDA 5FJHA 1YIPA 2GC2A 3DKQA 3SCGA 2QQKA 3K75B 3PNAA 4D8MA 5JMOA 5A6ZA 4UAPA 3VBFA 1ND2C 5B4XA 1W2UA 3OUHA 3DN7A 4H14A 1UU4A 2Q8EA 4CDWB 2DVFA 2VBBA 2JG8A 1FYUA 2JDKA 5FUIA 3BOWA 1L7QA 4ES8A 5J1XA 2CGNA 1VBB3 4IV3C 4CDXA 4MG2A 3WNLA 3MIBA 4XQDA 3KF5A 4RHV1 2ZEYA 4ORFA 3O1UA 4LBQB 1AX0A 4RHV2 3AX4A 4LBOA 2DF7A 1XNCA 1C8M3 2GZWA 3VBHB 3LOIA 2YGLA 4XIOA 1JZ7A 5EV7A 4AEDC 4IETA 4JVAA 4WZFA 1CPMA 3KCXA 4YSFA 3M2MA 2W92A 1V6KA 2ZKNA 4IQPA 3FMGA 1DQ2A 3VD5A 4DUXA 3LGRA 4M0NA 4MXWA 4CP0A 3TEYA 1APNA 1UOBA 2GC3A 1R091 2ERFA 3JD73 1SACA 1XNDA 5FUPA 4NR1A 4XTMA 1MZ5A 1S2KA 2RG4A 3K2OA 5K0UA 2ZCWA 5JOYA 2X29A 1DGWA 2PA7A 5A3TA 2YBPA 1A8DA 3WP3A 3I2KA 4HKOA 1PVC3 3T3YA 5EIYB 1N3OA 5IK5A 4KL1A 1XXNA 4CP2A 4AOCA 4DQAA 1AR73 2JDUA 1ULCA 1QJY2 1NY71 2ARBA 2EIBA 2JDNA 3QLQA 5EP9A 3UGHA 4CUBA 5HCHA 5GLTA 3UV9A 1FMD1 5C3QA 1YCIA 1G9AA 2O8OA 1SLIA 1FAYA 4QWNA 1Z7S3 5A3PA 1AR62 4FFGA 1RUI3 3SMHA 3EYPA 3BODA 4RFRB 5K9YA 5FO9B 1SEFA 4MGIE 1QOTA 4AFBA 2R062 4IE4A 3WDTA 2Z79A 4UYBA 1ZRDA 5J98B 3K77A 2E26A 3OD0A 4TLFA 5FYTA 2JKBA 1VP6A 4NHKA 4BYYA 1V6JA 3ECQA 5EQUA 2P34A 1AR81 4L9BA 2AGSA 1JHNA 4JV4A 5F5QA 3Q8EA 4NHLA 4IESA 4QX3A 1S0JA 1W90A 2VULA 1PGL2 2XMLA 1PO13 4XOGA 1UU6A 3H8OA 1W2TA 5BV6A 4KWJA 3KD4A 1H1IA 3KSCA 4BQYA 3AVSA 3C7OA 4YW2A 1RUD3 1RUC3 1V6NA 2FDIA 2VZ1A 3MW2A 4MUVA 5D8AB 2PQSA 2ZGUA 3DKWA 1ZRCA 1VBA3 4XZPA 4YRDA 1X9PA 1DZRA 4Z92B 1RINA 3ACGA 4GALA 5FFOC 5FY9A 1BYHA 1ZZCA 5FPAA 1GBGA 4BB3A 1Y3TA 1S0FA 1X8EA 3VDAA 3K4AA 5EXOA 1NUKA 3SQOA 1PNFA 5I8YA 4LTAA 1ZBE3 4HG6B 3HVDA 3O1PA 4NAMA 5JOZA 4ONUA 1NCQC 1RUH3 3U78A 2VC9A 3HQRA 4OHWA 2PXJA 3N9NA 3AP5A 2ETEA 4META 1KFXL 1QEXA 4EV0A 3WG2A 1QJEA 5IVCA 4PIYA 5C3RA 1DFQA 3VBOC 1IPSA 4YVSB 4RGGA 2RDNA 1CZSA 1VBA2 1YEWA 4CP1A 3GALA 3PUIA 4FPOB 1EAH1 2QFEA 1ENXA 2QE3A 5IK7A 2ATFA 1ODNA 3RDIA 1K5MC 1C4RA 2D6KA 3R4SA 5KXDA 3UYJA 3CIHA 2QUOA 1D4M1 4DXZA 1GZ9A 3LEIA 4D6RA 1D4VB 2D44A 2HWC1 1ULFA 2BQPA 2VXRA 3I7DA 3PJYA 1I5ZA 1Y4WA 2VXJA 2QQJA 3WVJA 4FTSA 2VMCA 3S7EA 2BFUS 3W20A 4P5HA 1V9U2 5D2AA 1W9YA 2OQ7A 3AZVA 2B42B 2DWRA 1PVC2 1J58A 2EALA 2LRPA 5A7NA 3U11A 3U75A 4EROA 1JZ6A 4XACA 1OPOA 4HPKA 1WW4A 4XDOA 2IWGB 2F6BA 4Y1YA 1EV11 1ZRRA 4DFSA 2DVDA 2BYVE 4G4FA 2FCUA 5IVBA 1VAVA 1ZZ8A 4JHTA 1RC6A 2VNRA 2FMYA 3IWZA 4QKBA 1C1LA 3LIGA 1W39A 3HT1A 4QB6A 4JGZC 4YVWC 1AR63 4EYUA 5TSWA 3C2UA 4KI5M 4BOWA 1IG3A 5FP3A 5IJRA 2XJPA 2ZGKA 4QDSA 1RUH1 1QJU3 4JKMA 1QH7A 4KQ7A 2DCJA 4FXGB 2EAAA 2HEVF 4LO7A 1JI6A 4Y22B 1VMHA 1OH3A 2BNOA 2D3RA 2OUHA 4LKFA 3VBHC 3W58A 5CIRA 5JPMB 1OMIA 1AR93 1BBT3 3BVCA 4PQ9A 2VTFA 3NJXA 4P9XA 3V65A 4FBFA 4XFHA 3N3HA 1V6MA 1XNTA 2DCZA 3ZYRA 4CCJA 2FCVA 1W6NB 4N90A 3AKPA 5C9AC 1NLSA 4WVWA 3LA7A 5FKCA 5GZGA 5JOXA 5FZGA 2BBVA 2VZQA 1O5LA 5FZHA 4FI9A 3RJ2X 5GJ6A 1FPN2 3KCCA 2VQ0A 1H30A 3I59A 3HOBA 2W52A 1STMA 3WNMA 4CCEA 3TEZA 4B4RA 3MLLA 4FP2A 1FI2A 4DRVA 3GNEA 4OUMA 4XJ9A 4NPRA 1JBCA 5E6HA 1WWYA 4XUNA 4CEYC 4ZZ8A 5FO8B 2QVSB 3RZGA 3MF9A 3RWKX 2CYFA 3B9CA 4I0BA 1AX2A 3VBHA 3WF0A 3VDBA 1QXRA 1GR3A 1TME1 2OPKA 4Q2FA 1DYOA 3NVCA 4J6GA 4UFHA 4DEQA 2JDHA 2YC4A 4K8RB 5D8AA 1TMF2 4G9SB 2TBVA 3BIWE 3BGAA 3FJSA 3R4UA 2RR12 3AMMA 3O1VA 1G86A 1TG7A 1RUJ2 3VBFB 2BDRA 3ELNA 4P02B 1GSLA 5F37A 4L8QA 2DTWA 2VCAA 4HMZA 4LUMA 1UZWA 5EWSA 1Y9MA 1NLRA 1FMD2 1HIXA 3AKRA 2DVAA 3AMHA 4K3UA 5F5IA 1B09A 3URFA 1Q8PA 1RITA 1ZZ6A 3WNOA 2WL1A 1HW5A 1CZVA 5DUXA 3VHOA 4H2AA 3ON7A 1D7PM 1KS4A 5FYMA 2BNNA 2LM3A 1NZIA 3VZMA 1OT5A 1TNRA 3ZDSA 1S0DA 4UI9L 2KXLA 1OC1A 1GANA 4UBGA 3WXPA 3BKZA 2XWBB 2X5IB 4YVSA 4AVTA 1JYTA 3VHNA 3AJZA 3A7QA 1UYYA 1BEV3 2A73B 2RMU2 2RR13 3ZSMA 5C71A 3DECA 2YMZA 1NCRB 4Q4W3 3MIFA 4IEVA 4CEWA 5EHDA 2MHFA 4AR2A 4F7ZA 2RS33 4LHKA 4HKLA 4QD2A 5BNPB 2VZSA 4IERA 5EYXA 5FZEA 1LGNA 4YLZA 2JE8A 2Y6HA 3JB8A 2C4XA 3CZJA 5ABJB 3UJQA 1W8OA 4GB32 3WF2A 1W05A 4BQ2A 3IDCB 1F5JA 1UIJA 4UW6A 1PO21 2WO7A 1S0BA 1ACCA 1QJZA 2ZEWA 2IC1A 3OTFA 1AYN2 4HPKB 1YFXA 1C57A 4QQOA 5A32A 3KV6A 4ZHNA 1TMF1 3DCQA 4A6OA 4CEYB 2SLIA 2VMGA 4LUKA 4QM9A 2CDPA 3P6BA 5LBCA 1ZBA1 1LOCA 2RS32 1PO12 4Q0UA 4CXWA 2WN2A 4MLOA 5I0SA 1ENSA 4QDQA 3KF3A 3KT4A 5KC6A 3ZFGC 3EO6A 1XB9A 2YC0A 4A45A 3T1MA 2ADDA 1NQJA 1PMJX 4QHZA 2ZTNA 4Y1VA 2BWCA 3RMYA 2R30A 1RUOA 1OD3A 1OSGA 1IOAA 2VU9A 1PNGA 3ZYGA 2WA4A 4LK7A 3NNJA 4NAOA 1EAH3 1URXA 4QHOA 5A33A 4OQ8A 2Y0OA 1FX5A 4HT1T 1CPNA 5FIXA 3RGBA 4YM3A 1WD4A 5HXMA 4KMQA 4YW4A 1ND2B 1LULA 4D6QA 1PMHX 5LA2A 2EA7A 1H6XA 1YHFA 2EICA 4L0PA 4QU2A 2RMU1 1H8VA 3WUCA 2WAOA 3H50A 1R64A 4IW3A 5FP4A 3D5OA 2HWB3 4JTNA 4PLMA 4XFGA 1OLME 4GWNA 4OZOA 1U5XA 4XC9A 4XMAA 5DZGA 1POV3 5FZOA 4LKEA 1PIV2 4OYUA 1UZZA 2XB6C 4I0AA 1UXZA 1HQWA 1UX6A 4OLLA 3Q8FA 1I1EA 4J25A 1EPWA 4WM8A 3PIJA 2FDKA 2GNTA 4GB31 2MEV1 4ATFA 5IAXA 1X33A 4P08A 1MQTC 1AL0G 2O14A 3GBGA 2ZXQA 1MS5A 2EXKA 1KDKA
chains in the Genus database with same CATH topology
1W8TA 1OKOA 4LJHA 2Q1FA 2C24A 1W8UA 4YW7A 4CP9A 4AL9A 4YWAA 2KR2A 3ZYFA 1WZXA 1W90A 4BQ3A 5D21A 1W8ZA 1GWKA 1WMXA 4A6SA 4BQ4A 2WYFA 2VXJA 1UOJA 1GWLA 4CPBD 4LKEA 1OH3A 1V0AA 1W8WA 2LROA 4LKFA 4YW6A 3ZYHA 1W9FA 3UT0A 2LRPA 4BQ2A 4BQ5A 3F95A 1WCUA 4CPBA 1L7LA 1HN0A 1GWMA 2K46A 4LK7A 4CP9B 4LK6A 3ORJA 2O14A 3ZYBA 2JWPA 4LKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8T A;  1OKO A;  4LJH A;  2Q1F A;  2C24 A;  1W8U A;  4YW7 A;  4CP9 A;  4AL9 A;  4YWA A;  2KR2 A;  3ZYF A;  1WZX A;  1W90 A;  4BQ3 A;  5D21 A;  1W8Z A;  1GWK A;  1WMX A;  4A6S A;  4BQ4 A;  2WYF A;  2VXJ A;  1UOJ A;  1GWL A;  4CPB D;  4LKE A;  1OH3 A;  1V0A A;  1W8W A;  2LRO A;  4LKF A;  4YW6 A;  3ZYH A;  1W9F A;  3UT0 A;  2LRP A;  4BQ2 A;  4BQ5 A;  3F95 A;  1WCU A;  4CPB A;  1L7L A;  1HN0 A;  1GWM A;  2K46 A;  4LK7 A;  4CP9 B;  4LK6 A;  3ORJ A;  2O14 A;  3ZYB A;  2JWP A;  4LKD A; 
#chains in the Genus database with same CATH topology
 1S0G A;  2V5D A;  4QPG B;  2XJQ A;  4QXH A;  4QDR A;  1LGB A;  1IS4 A;  4BQ3 A;  1RMU 3;  5LA9 A;  3V0A A;  4NII A;  2WA3 A;  5CAD A;  3ZXF A;  4FFI A;  3K4Z A;  4TWT A;  3FZ3 A;  2W68 A;  5CG8 A;  2VZT A;  2RS5 1;  3CKH A;  1BEV 2;  1KDM A;  1OOP A;  1GOF A;  2ORX A;  5KC5 A;  1DP0 A;  1BEV 1;  5A7W A;  3GBF A;  4YW1 A;  4B3N A;  1O7F A;  2RM2 1;  3SC7 X;  4EZ4 A;  2JD4 A;  3J8F 1;  5FZ1 A;  3VBU B;  2Q5T A;  3POF A;  3ZFG B;  5LW9 A;  4IE7 A;  4ITC A;  1QJY 3;  2WZR 2;  4ZZ5 A;  5J7M A;  2QQN A;  4Z82 A;  4Z2A A;  4GMP 0;  1G9F A;  2W1U A;  3QD6 A;  4XJ8 A;  1RIR A;  1DHK B;  2WO1 A;  2Y6F A;  2Y33 A;  5C3O A;  2GAL A;  1SFN A;  1RUE 2;  2ZX4 A;  3OEB A;  3J7H A;  5T54 A;  2A6Z A;  3NV1 A;  5L73 A;  5B2G B;  4GWM A;  1NZC A;  1W6Q B;  3KV5 A;  4XQW A;  5FY8 A;  2WUH A;  2K2S A;  3GHM A;  4R8H A;  1UY1 A;  3FLT A;  4YAR A;  3M4F A;  4EN9 B;  3M3E A;  4CDQ C;  2EXJ A;  1Q8Q A;  5LBF A;  1HXS 3;  1SBE A;  2R07 2;  3ZMO A;  4OHZ A;  2LAL A;  1VRH 3;  4AEM A;  4BWO A;  5KHH A;  1JYC A;  2BJS A;  2V09 A;  3AYC A;  5FZF A;  2ES3 A;  4FPL A;  4KU7 A;  5IVY A;  2WYS A;  3VLB B;  1G9B A;  2GP3 A;  3S5Q A;  2XPJ A;  4L99 A;  1Z78 A;  3H1Y A;  1LOF A;  4PLO A;  2BZD A;  2RR1 1;  4YZ3 A;  1UY4 A;  3N9Q A;  1W03 A;  1NX9 A;  2P3J A;  2L9L A;  1MQT B;  5DMY A;  3IPV B;  1AR6 1;  2OX0 A;  2VNO A;  1UXX X;  2E32 A;  2X5I C;  4N43 C;  3GYD A;  3OCP A;  4P9G A;  4Y4R A;  1JMU B;  3NAP B;  4C91 A;  4BZ4 A;  5A6X A;  2JG9 C;  5FXV A;  3E1F 1;  1I5P A;  3AVR A;  1YO8 A;  4QXC A;  4RA0 A;  5A80 A;  4JQR A;  1O3S A;  1ASJ 1;  1H4H A;  1Q8V A;  3KM5 A;  3PTR B;  2P3I A;  5EPA A;  1LOA A;  4CDX B;  3VDD C;  5A3M A;  1FAT A;  4GZ9 A;  4HFS A;  4QMA A;  3N4M A;  4GXL A;  2VUA A;  3C7F A;  4FPC A;  3TNP B;  2B9V A;  2NLR A;  4YFW A;  3P3N A;  1X8M A;  1S0E A;  4CU9 A;  4YVS C;  3VDD A;  1QNW A;  2QZ3 A;  1LEN A;  5FZ0 A;  4QX7 A;  3RSJ A;  3AM2 A;  1F35 A;  4KBZ A;  2OUJ A;  2PHT A;  4LBM A;  3KLS A;  4UT5 A;  4TTG A;  3S30 A;  1QF3 A;  4C1W A;  5BNO B;  4E4S A;  5L9B A;  5DAX A;  4YW3 A;  4XDP A;  3RPQ A;  3ZR5 A;  2X8K A;  4RS5 C;  2GN7 A;  1CD3 G;  1ULG A;  2X5I A;  3D8C A;  4N43 A;  3WG4 A;  3OY8 A;  2VCC A;  1J1L A;  5C8C A;  3WF3 A;  3H3Z A;  2PHX A;  1V6O A;  4URA A;  1CX1 A;  3ZO0 B;  2QCS B;  4XF0 A;  3T4H B;  1W3X A;  3TN9 1;  4UFL A;  5FRE A;  5K0U B;  3W59 A;  3AXD A;  1OHF A;  4GJY A;  4NWV A;  5A3U A;  4LXL A;  2WS9 3;  4DOU A;  2W3J A;  3KCY A;  3C8X A;  2LW8 A;  3FHI B;  2QTW B;  4CVU A;  4YPJ A;  2ZGT A;  3PTY A;  3QAC A;  4IE6 A;  2V72 A;  2GNM A;  1AR9 1;  1BK1 A;  3FFQ A;  3SH3 A;  1W3V A;  2D5F A;  3AL6 A;  1BKZ A;  2D3P A;  3RZZ A;  1GZT A;  3AMQ A;  4BDV B;  1OUX A;  2Y6G A;  3VN4 A;  4D94 A;  5FOJ B;  1LHU A;  5FZ6 A;  1K45 A;  5HPO A;  5LY1 A;  3FLR A;  3WF4 A;  4K20 A;  3U0Z A;  5KXE A;  2BV4 A;  1OQE A;  3HJR A;  4E8C A;  3MEP A;  2OW4 A;  5F3G A;  3WD5 A;  5C70 A;  3A0N A;  3HR9 A;  1H0B A;  4E27 A;  5C9A A;  2KR2 A;  3MLK A;  1WZX A;  1RED A;  3EBR A;  3UK9 A;  1YIF A;  1RUE 1;  2YFU A;  4MXV A;  4Q0Q A;  2JDP A;  2P3Y A;  1OVS A;  1UZV A;  3RYK A;  3TNQ A;  4IND A;  4FAH A;  4MHR A;  2RS1 1;  1UZ0 A;  4UFM A;  2ET1 A;  3PVO A;  3CLP A;  4XIL A;  4CU8 A;  4NUB A;  3LDB A;  4NIH A;  3DXT A;  4NRM A;  1OOP C;  2LRO A;  4QM8 A;  4AVS A;  4YGD A;  1K12 A;  4E9K A;  2VMF A;  4QPG C;  5KHK A;  2RS5 3;  3MW4 A;  1VBC 2;  1W8H A;  2YUE A;  5F39 A;  5DN2 A;  4YG6 A;  4Q4W 2;  4BM8 A;  5GLW A;  1N3P A;  1SFY A;  3MGU A;  1HQN A;  4GMP 3;  1S0I A;  3J26 N;  5A7O A;  1PVX A;  1WLW A;  3ZYB A;  5LAT A;  2KD7 A;  2WN3 A;  2E7A A;  1QQP 2;  1RVF 3;  2FZ1 A;  2J1A A;  2W1W A;  4PDW A;  5LY2 A;  4AVC A;  2HYX A;  3RZL A;  3DYO A;  1JYW A;  2W91 A;  3MDP A;  4EN6 B;  4FOY A;  3C7G A;  3HIF A;  2YV8 A;  5FPX A;  1V70 A;  2ZAH A;  1ENR A;  3DUI A;  3Q8A A;  1REE A;  2RE9 A;  3M1H A;  5CEH A;  1MVE A;  4R4Z A;  3VBU C;  3AMN A;  3THC A;  1QJU 2;  4PI2 A;  1DGW X;  1PIV 3;  1ZZ7 A;  3H9A A;  4OMD A;  5K0U C;  4FPK A;  4PJY A;  2D6N A;  1FOD 2;  2QQL A;  2R06 1;  2Y6K A;  5KWR A;  3FC0 A;  1ASJ 2;  4QAW A;  3VGI A;  5K4L A;  3CU7 A;  2DUO A;  2JIJ A;  2OPW A;  2Y0I A;  2CDO A;  4AQ6 A;  4KU8 A;  4LLF A;  3BTA A;  1RUJ 3;  5A6Q A;  3ES4 A;  4LLO A;  4AED A;  3BPS A;  3N7L A;  4RR3 B;  5FP7 A;  1U5I A;  4KH9 A;  4TXW A;  2J7M A;  3FBY A;  3SNM A;  3IDE A;  1GQG A;  1XNA A;  4QPI B;  4Y22 A;  3U07 A;  4BLI A;  5LWB A;  3QCW A;  2VNG A;  4O9G A;  4Y5T A;  1QNY A;  2WR9 A;  5F5A A;  4AG4 A;  1AUY A;  5IYY A;  2HWE 3;  1AR7 1;  5A7Q A;  1QIQ A;  3VZL A;  2D6P A;  2UWB A;  1BMV 1;  1XC6 A;  5BYN A;  3SKV A;  1QGL A;  5C33 A;  3ZFG A;  2A1X A;  1ENQ A;  3GBW A;  3JCI A;  4JZR A;  1VB2 A;  1UY0 A;  1BBT 1;  4GWJ A;  3BTX A;  1K42 A;  4XBN A;  3HQU A;  2O8Q A;  2MEV 2;  2DCK A;  3WDV A;  5CVR A;  2P6C A;  4WM7 A;  1O59 A;  4N43 B;  1I6X A;  1Y43 B;  3M8L A;  3RZK A;  1OLM A;  2R16 A;  3ES1 A;  3CHX A;  1TMF 3;  3PU8 A;  4LBJ A;  4M4P A;  1W6P A;  5IVV A;  5J09 A;  4U36 A;  1NKG A;  5F5C A;  4LQR A;  2RHP A;  2A6W A;  2YC2 A;  1PO2 3;  4XEZ A;  2VAU A;  2HWF 3;  4HN1 A;  2WNV C;  4QPW A;  4AE2 A;  3ZXK A;  3C7E A;  2ZGM A;  4V2W A;  5FZ9 A;  5CFD C;  3AC0 A;  3WZ1 A;  1EV1 3;  1X9T A;  1EUU A;  1ZZB A;  2WQZ C;  4FPE A;  4MX3 A;  3VBU A;  3U14 A;  2VBP A;  4EQV A;  3I8T A;  3SKJ E;  3ME2 A;  3OSD A;  3WR0 A;  4CE8 A;  4UBH A;  3BU7 A;  2MNG A;  5H9S A;  3PUA A;  1C1F A;  1UWW A;  4QGM A;  2RJL A;  5EFU A;  3AYE A;  2FCT A;  5FWE A;  5LRR A;  4RS5 B;  3K3O A;  3HPN A;  4LPL A;  4D7Y A;  4XFI A;  4B4Q A;  1E57 A;  1H8T A;  4YZ5 A;  3VD7 A;  3UES A;  1US3 A;  3I2H A;  3WEZ A;  5I0U A;  3OD4 A;  3WNX A;  4ISQ A;  2D6O X;  1ASJ 3;  1UYP A;  4XXP A;  4BQX A;  4AFA A;  2OA2 A;  2HWF 2;  4A42 A;  1PZ8 A;  1Q3E A;  4JHZ A;  4D6S A;  4TYS A;  4Q4X 1;  3ENR A;  1AXZ A;  5JOW A;  1J3Q A;  2JEC A;  4AI3 A;  1H4G A;  1VJ2 A;  4FQZ A;  4YM2 A;  2P1B A;  1JN2 P;  1WLC A;  2H6C A;  3OG2 A;  1HN0 A;  1XQN A;  3W9A A;  4AAP A;  2E6V A;  1WCQ A;  4CDU B;  5LA1 A;  1BBT 2;  3TN9 2;  3B69 A;  4CU6 A;  5LK5 A;  1UOG A;  1S2B A;  1D0H A;  1W06 A;  4UOJ A;  4CDU A;  4XF4 A;  1OFN A;  1W6O B;  1JOP A;  1H8T B;  1WW7 A;  2Y34 A;  4Y4Y A;  1RJ7 A;  1WD3 A;  1PO1 1;  3QOP A;  2GND A;  4RQP C;  5D8A C;  4IDZ A;  1KJL A;  1RTV A;  1RUG 3;  1SMV A;  1WW5 A;  2H0V A;  5J36 A;  1XBF A;  2FDG A;  3T09 A;  2I74 A;  3NKT A;  2IVI B;  1KIT A;  1COV 3;  2EXI A;  2PLV 2;  4CXX A;  1O3R A;  2VQU A;  1H9W A;  4GKX A;  2WZR 3;  5C8C B;  1V6L A;  1ND3 C;  1L3J A;  1VBA 1;  1YFY A;  1TZO A;  2JDM A;  4XCB A;  3VKF C;  4ZKT B;  3MLJ A;  1U5Y A;  5GLV A;  4DS0 A;  5LBB A;  1ALY A;  1HX6 A;  2QQU A;  3HQX A;  4RQP A;  1R1A 1;  1S4C A;  4NHX A;  4R52 A;  3OGS A;  2AH2 A;  4LUL A;  4P14 A;  5FMO S;  5FMO L;  3U1X A;  4AFC A;  4DY3 A;  3POS A;  1IZ3 A;  2J1S A;  2BW8 A;  4QQH A;  5F8P A;  3CNA A;  1UMH A;  4AFD A;  5IVF A;  3CJX A;  5FYY A;  5CZK A;  3N7M A;  1QJX 2;  1FPN 1;  2DU0 A;  2RS1 2;  5FBZ A;  2P4E A;  1F9K A;  2C9K A;  2X05 A;  5IWF A;  3BOP A;  3ZIW A;  5IVE A;  4EN0 A;  1W0P A;  1XU2 A;  1GNZ A;  4IV3 A;  5JXJ A;  3ZXE A;  3GGL A;  3I2G A;  1JZ8 A;  3A21 A;  5FV3 A;  4W6X A;  1BVV A;  1CQ9 A;  1OLR A;  1RUG 1;  3F95 A;  4I3P A;  2K46 A;  1VRH 1;  4JGY A;  1BZW A;  5FYB A;  4Q4W 1;  5ABJ A;  4LO6 B;  4HAN A;  2WKK A;  2A6Y A;  2GMM A;  5GLZ A;  5CA6 A;  1AVB A;  3QBQ A;  1RHI 2;  3EMR A;  4YG3 A;  5FZ8 A;  3O0X A;  2E33 A;  3ACI A;  1AL2 1;  2OII A;  2ZX3 A;  4JGZ A;  4YVW A;  1RUH 2;  4C1X A;  3OBZ A;  4F83 A;  2XL7 A;  2XDV A;  4IUG A;  2VOV A;  2VW0 A;  2ZS6 B;  4TLG A;  1PM7 A;  2VBD A;  2WYF A;  2ARX A;  4GUL A;  2PHD A;  4JRL A;  3POJ A;  2ORZ A;  4UF0 A;  1SZB A;  4AI1 A;  5I0T A;  3MHZ A;  1XRU A;  4IEX A;  4Q4X 3;  3ZN4 A;  4CPB D;  1Q56 A;  4YW6 A;  4IEP A;  4OHX A;  5GZF A;  2K9Z A;  3ABZ A;  5KBF A;  2YU2 A;  1MPX A;  2XJT A;  5DQ0 A;  2WLP A;  1KQR A;  3P3P A;  1CZT A;  1VIW B;  2NQY A;  2BER A;  2RM2 2;  1NXM A;  1DQ0 A;  1WBF A;  4MHU A;  1JZ4 A;  1HQL A;  3CDZ B;  1YNA A;  2HWC 3;  2IXC A;  1OVP A;  2JDA A;  4QGL A;  3EQE A;  5DZF A;  1R1A 2;  3NAP C;  3POY A;  4FPG A;  5ERL A;  3HD8 B;  1EUT A;  1PGW 2;  3I2F A;  1MZ6 A;  3UET A;  2WT2 A;  4WM7 C;  1TME 3;  2A6V A;  1QOS A;  4WVZ A;  2V5Y A;  1T6B X;  5SV8 A;  5FZA A;  3ZSL A;  2R49 A;  3NMB A;  3INA A;  1C8M 1;  4Q27 A;  5A32 B;  1JYI A;  4BXF A;  1U5Z A;  1KJR A;  1MEC 3;  1ULD A;  4EJR A;  5C8W A;  4HLT A;  4WZC A;  3MV1 1;  4BQW A;  2J1R A;  1AXK A;  2SBA A;  4CPB A;  1MEC 2;  2JE9 A;  5GM0 A;  2B5H A;  5IAT A;  1NCQ B;  2HWD 3;  3PVB B;  3PDQ A;  3ASI A;  4GQ7 A;  3WOG A;  1TEI A;  1LB2 A;  4IEW A;  1REF A;  4XHB A;  2WNV B;  1W0O A;  3IDA A;  3POB A;  5FY7 A;  2VQT A;  1DCS A;  1IHM A;  1SG3 A;  1UN1 A;  2XBO 3;  3AJY A;  3JB4 C;  2J1T A;  3UNP A;  2WFF 3;  5FTT C;  3ZN5 A;  1ND3 A;  5DUU A;  3VBS A;  1FT9 A;  1O4Z A;  2PTM A;  5DDJ 2;  1RJ8 A;  2PLV 1;  4AQS A;  1ZX5 A;  3TB0 A;  1AR9 2;  1RUN A;  3AP7 A;  5HCF A;  4KGG A;  4P00 B;  4WV8 A;  4LA2 A;  3ZXD A;  4I0W B;  3KT7 A;  2TEP A;  3LAG A;  4CCL A;  3Q8C A;  5FYU A;  1RUF 3;  3FX3 A;  4XTP A;  1XE7 A;  1R08 2;  4NN0 A;  5A7W B;  4MSV A;  3O7O A;  1YQ2 A;  3EB7 A;  2ZMK A;  4QB2 A;  3JBG 2;  4DEV A;  3ZSE A;  2J22 A;  1R08 3;  2D97 A;  3NV2 A;  2VUC A;  1C5H A;  4XFB A;  5H9R A;  5DUW A;  1MQT A;  2XHN A;  1JW6 A;  3KT1 A;  2Y6J A;  1CVN A;  3LE0 A;  1AR8 3;  3KHC A;  1IS5 A;  4X8P A;  4DMI A;  4Z8B A;  4IL7 A;  1XYO A;  4CEW B;  3TEW A;  4WM8 C;  1CAX A;  1XE8 A;  2A6X A;  1XYP A;  1VBE 2;  4ZON A;  4DIN B;  2XVK A;  1H8T C;  3M3I A;  4WM7 B;  1HB4 A;  5CBL A;  1BMV 2;  2QQI A;  2ZHK A;  5FZ4 A;  5JLV A;  4X8N A;  2AAC A;  1O91 A;  4OUL A;  1QQP 1;  5LK7 B;  1JOD A;  1XPW A;  2D5H A;  2VPV A;  1N1T A;  5E8A A;  4C0H A;  1OOP B;  3M3C A;  3DGT A;  4HXC A;  4JGY B;  4OI2 A;  3GHN A;  5FPB A;  3A0K A;  2V73 A;  1VE0 A;  2YZ4 A;  1JU4 A;  1QWR A;  2QKD A;  3NRU A;  4H7M A;  2B7Y A;  1SHW B;  3B9I A;  4D0Q A;  1JYX A;  2CY6 A;  5CFD A;  3WV6 A;  3WP6 A;  1GP4 A;  3Q8B A;  4CUA A;  5L7O B;  4S2D A;  5ACA 3;  1C28 A;  2Q8C A;  1PGS A;  4AFM A;  1DBN A;  5LEJ A;  1JYV A;  3MUY 1;  4KWK A;  2VUJ A;  1CES A;  5FK8 A;  1POV 1;  2NZ9 A;  5FPZ A;  3VBS C;  5CG9 A;  1O6U A;  4OHY A;  2VG9 A;  3N7J A;  2HWB 1;  2QBX A;  5JCT A;  5BNQ A;  3C7H A;  4FO9 A;  2Z2S B;  4IE0 A;  1VMJ A;  1DDL A;  3APB A;  4X6Q B;  3V56 A;  3ZXL A;  2R0F A;  1ST8 A;  4Q0S A;  1SBF A;  2TUN A;  2PYT A;  2VJX A;  3T1L A;  5JZG C;  1IKQ A;  1W8T A;  4XQ4 A;  1GYK A;  3ETQ A;  2C5D A;  1DGL A;  3JBG 1;  3OJB A;  4URT A;  3VD4 A;  1WBL A;  4JKL A;  4YNI A;  1XE0 A;  2D6L X;  5HV4 A;  5DAW A;  1VMF A;  1ZA7 A;  1LES A;  2ZAC A;  4Y1Z A;  3WP5 A;  4EN8 B;  2CWM A;  4HVO A;  4AVV A;  1FPN 3;  4MGK E;  2HWD 2;  2AEZ A;  3ST7 A;  3MFC A;  5FBJ A;  4P5Y A;  1JTZ X;  2CHH A;  3NV3 A;  4JDM A;  4LOT A;  3ZYH A;  4Z1V A;  2P37 A;  1IG0 A;  1N47 A;  4CUC A;  3E6D A;  2F17 A;  1SLL A;  3HN3 A;  4L2N A;  2BOJ A;  5FQ0 B;  5FZ7 A;  4W8J A;  1VBE 1;  1ND2 A;  3VBF C;  1LAJ A;  3B01 A;  5F6K A;  1UMZ A;  2B9U A;  2ZBJ A;  3AK0 A;  1LEC A;  4MGY E;  3VD9 A;  1SBD A;  2ARA A;  4CEW C;  3NAP A;  3AKT A;  1T2X A;  1MS4 A;  2A75 A;  1EPZ A;  3D0J A;  4XZU G;  3M70 A;  4YGC A;  2UU8 A;  1W8U A;  5F2S A;  2D43 A;  3HWJ A;  3MYX A;  4BME A;  1COV 1;  1RHI 1;  1DIW A;  3BTZ A;  5H9P A;  2PAE A;  3ZVX A;  2XHK A;  3NNF A;  1YQ5 A;  1LJ7 A;  1ZNP A;  2PHR A;  4NRO A;  2EXH A;  1W2A X;  2E7Q A;  4K1Y A;  2HJI A;  4HOO A;  2CAU A;  1C5I A;  2D7F A;  2X10 A;  4AQ2 A;  2FDF A;  3RZM A;  1XOY A;  2GN3 A;  2R07 3;  4Q4Y 1;  2ZGS A;  5IVJ A;  4HL0 A;  3T2P A;  5CAZ A;  3UKN A;  5F32 A;  4PDW B;  1JOB A;  1JUH A;  4ZU7 A;  1O5U A;  2WZR 1;  3D82 A;  3T0B A;  1LOF C;  1BK0 A;  1ZZ9 A;  3WG1 A;  3JBG 3;  5CKN A;  3PVE A;  1J83 A;  4JX0 A;  4M00 A;  4AF9 A;  5CIS A;  2GC1 A;  5ABJ C;  5LZ6 A;  1BJQ A;  3OY8 B;  1FNZ A;  1JHJ A;  4MO3 M;  3SIS A;  1H1A A;  1UZY A;  2BEO A;  4XET A;  3LDR A;  4COY A;  1QKQ A;  2FZ2 A;  2AR6 A;  3SH5 A;  5L9R A;  2XKP A;  2WWJ A;  1AJO A;  3OEA A;  4MGT A;  2VOT A;  3O14 A;  4ASK A;  2WS9 2;  3OGJ A;  4LE3 A;  1AR7 2;  1OKQ A;  1E5I A;  3JUU A;  4GH4 B;  1GZC A;  1GU3 A;  3LQC A;  1YJL A;  1IKP A;  1CN1 A;  3IDB B;  4Q1P A;  1DU3 D;  4FSJ A;  2HWE 2;  1OI6 A;  1GFF 2;  4PI0 A;  2WIN B;  5E16 A;  3I3M A;  4YW5 A;  4IEQ A;  1VLN A;  3AZY A;  4P9J A;  4XDQ A;  5ANN A;  5FWJ A;  2CAV A;  1WLD A;  4KWU A;  3ZFE C;  5JPN B;  4CUG A;  1V00 A;  2VME A;  2XUM A;  4ZY9 A;  3Q9O A;  1WA4 A;  4BXS V;  3AP9 A;  1NOV A;  4RL7 A;  4HSL A;  1AL2 2;  1CJP A;  4FPY A;  5HCB A;  1CX4 A;  3W21 A;  2WO2 A;  5D1I A;  1H2K A;  1XJA A;  3A4U A;  3LCP A;  1VBB 1;  4Y20 A;  1CAW A;  2WJS A;  4O61 A;  2BGO A;  4BU2 A;  1VBB 2;  2Y8K A;  3I3B A;  3KQR A;  3ZSJ A;  4M3C F;  1OA4 A;  2IUW A;  5I0R A;  3GZA A;  3VKL A;  4L97 A;  3IM0 A;  1LGC A;  3RMX A;  5IK8 A;  1RUC 1;  1RUD 1;  4W6Y A;  3ZX7 A;  4OQ9 A;  3LFM A;  1S55 A;  2YY1 A;  2WAA A;  2Z4F A;  1OBN A;  2BGC A;  1WKY A;  3SEP A;  1JXN A;  3VHP A;  1QHD A;  3HNM A;  5FY0 A;  2G9F A;  4OI1 A;  1VBD 1;  3QH7 A;  3N9O A;  1FV3 A;  5C8C C;  5T52 A;  3M3O A;  1MZE A;  1NA1 B;  3J8F 3;  5BY5 A;  1Q8O A;  1CAW B;  2GH8 A;  3R05 A;  1ZVF A;  4XUQ A;  4AEK A;  4F8A A;  5K8S A;  4MGQ A;  5F2W A;  4I2O A;  1ZA4 A;  1F2N A;  1NA1 A;  4CYD A;  1GQP A;  4HBN A;  3ROU A;  2VM9 A;  3S0M A;  4M3C B;  2BPA 2;  5I0D A;  5H9Q A;  1VRH 2;  3VKN A;  3V0B B;  5C3S A;  4JC1 A;  2VQA A;  3HNY M;  4Q1R A;  3VBR C;  4XW3 A;  5GKA C;  3MIE A;  3ZOI A;  4FPJ A;  4P9I A;  1OA3 A;  5JIU A;  4LKS A;  4QHB A;  5BNO C;  5JSR A;  2Q1F A;  1WMF A;  2B4K A;  4ZXK A;  3VBS B;  3SXW A;  3ILF A;  1VBD 3;  1XSQ A;  1AYM 2;  1GZW B;  1QXJ A;  2CL2 A;  3D6E A;  4QKN A;  3UKT A;  3VBO B;  4AI0 A;  2A5Z A;  2WWU A;  4MXW B;  1S1A A;  3GF6 A;  4DXS A;  2ADE A;  2V4V A;  1D0G A;  4LBN A;  2W87 A;  4XJZ A;  4OZX A;  1GZW A;  5APA A;  3VBO A;  3ZFF C;  2RS5 2;  4NHY A;  3I2O A;  1K5M B;  1W04 A;  5DG1 A;  3M7A A;  3E97 A;  4AGR A;  4XVH A;  1YFU A;  3RVH A;  3BAL A;  4DY5 A;  1K5J A;  1ONA A;  5FPU A;  4LO8 A;  5JWP A;  4ZU5 A;  2PAK A;  4PBO A;  1HRV 3;  2DVG A;  2WLQ A;  3LDK A;  1UYZ A;  3NST A;  2N7G A;  5A3O A;  1IQD C;  1DF0 A;  4CCO A;  1AXY A;  4FFF A;  5FJK A;  2VCM A;  3NW4 A;  4IV3 B;  4D69 A;  2P5B A;  1IS3 A;  2ZKL A;  1PZ9 A;  2G19 A;  1PMI A;  3KV9 A;  1U0A A;  4JRA A;  1RUE 3;  1OD5 A;  1W2N A;  4GWI A;  5A7P A;  1FOD 3;  3ALQ A;  3POE A;  1A34 A;  4C8D A;  3IT8 A;  2XJS A;  2DDU A;  3AZX A;  1MS8 A;  2VMI A;  2WNO A;  2UY9 A;  1J3R A;  3LEG A;  4OI0 A;  5A1F A;  5FYV A;  1PK6 A;  3TRS B;  4D7S A;  1D2S A;  1GWM A;  2XOM A;  3H42 B;  3OPZ A;  5A1L A;  1EV1 2;  1T6G C;  2CWS A;  1KRI A;  3ZSK A;  2R04 3;  1XNK A;  2R1B A;  4MH0 E;  2XWJ B;  3HNB M;  1RYY A;  1XU1 A;  4UF0 B;  4EWE A;  3BB6 A;  4AW7 A;  1NLQ A;  2JIG A;  5GZE A;  2P3K A;  2PMW B;  2VVD A;  4XF9 A;  4LBQ D;  5FKB A;  3VBR B;  3WQ1 A;  3O1S A;  1GNY A;  5KHI A;  3FHA A;  4NHM A;  2WNE A;  1POQ A;  3LEK A;  1V9U 3;  3PJQ A;  3KGZ A;  1QOO A;  1AHS A;  4COZ A;  3ILR A;  3UT0 A;  5DG2 A;  1OLQ A;  2BVB A;  2I2S A;  3JXS A;  4A41 A;  3PIG A;  2XR4 A;  2HWB 2;  1W8F A;  2A71 A;  3P5B A;  3JZV A;  1AR8 2;  3WW3 A;  5IHR A;  1LU2 A;  4W50 A;  3WDU A;  4AQT A;  4DB5 A;  2WWS A;  2JDY A;  3I2J A;  3FWE A;  4RYD A;  2QZ2 A;  5C7G A;  1J84 A;  4FOQ A;  3HBK A;  1K3I A;  4Q4V 3;  3FN9 A;  1UYX A;  3PUR A;  4ZS2 A;  3LIH A;  1AJK A;  3LKJ A;  5T3N A;  4EN7 B;  3O1M A;  2E53 A;  1SDW A;  3I2D A;  2D93 A;  4FQ4 A;  2WS9 1;  4NO4 A;  1R09 3;  4OCT A;  1E5H A;  3NWK A;  4NIG A;  5T50 A;  2XUE A;  5FYC A;  2GMP A;  4JCK A;  5IW0 A;  3ZFE B;  3BU0 A;  4Q4V 1;  2HWD 1;  5DZE A;  4QPI A;  3UKV A;  4CEY A;  2QQO A;  3MFA A;  4XUP A;  2UWC A;  4RR3 C;  3X29 B;  5J37 A;  3OYW A;  4HON A;  2UYB A;  5FYS A;  3D3A A;  2DBI A;  2ET7 A;  1JZ3 A;  1OH4 A;  3F2Z A;  1MEC 1;  1GIC A;  2XJU A;  1YI9 A;  1YYN A;  4LIV A;  4M3C A;  3H3L A;  2BRT A;  4WM8 B;  4CDW C;  2VCB A;  4KBB A;  3NO8 A;  4B7K A;  5C3P A;  3IN9 A;  1LOE A;  2VZU A;  1SCS A;  3GCX A;  1H6Y A;  2JXA A;  4P9Y A;  1F8V A;  3AP4 A;  4XF1 A;  4XAB A;  4LIU A;  4XAA A;  4AEJ A;  3PVN A;  2W39 A;  1YI7 A;  2ZOE B;  1QJX 3;  4IXL A;  5C6C A;  4A7Y A;  5BXX A;  1WCS A;  1D4M 3;  4SLI A;  1GMM A;  3ZM8 A;  5FLJ A;  4WVV A;  4QQP A;  4RD7 A;  5C5U A;  5F3C A;  2V4A A;  1HDK A;  2WO3 A;  2XKO A;  1NYW A;  3BTY A;  1EAH 2;  3MW3 A;  2VVE A;  1HJG A;  3VZJ A;  3LOB A;  1VAK A;  2Q0A A;  5EZW A;  3OUJ A;  3CJI C;  3PHM A;  1NE6 A;  2AYH A;  3O0W A;  4TSV A;  2YB7 A;  4XAE A;  3MPP G;  5L36 A;  1J3P A;  1DYK A;  3WCR A;  5L9V A;  2GNB A;  4PIZ A;  5E1R A;  3WP4 A;  4RS5 A;  5K7P A;  3A22 A;  4XFF A;  3PUH A;  1F31 A;  1XSR A;  1QMJ A;  1V9U 1;  3ZPY A;  4FP3 A;  5AC9 2;  4RFT 0;  2UYA A;  4AHZ A;  2G9Z A;  2XL9 A;  4HET A;  1HB2 A;  2UUR A;  5DXD A;  1VBC 1;  5FZK A;  4Q4X 2;  1G6N A;  1PM4 A;  3WQB A;  5HXV A;  1L7L A;  2QQM A;  2VOW A;  4JQT A;  5A6Y A;  4PT6 A;  4CP9 B;  4QX5 A;  5JSP A;  4F3J A;  1GNH A;  2XQR A;  1RL3 A;  3HEI A;  4NMI A;  3TEX A;  5F7U A;  5JR2 A;  1PK6 B;  2YFZ A;  1W2O A;  3OBT A;  2P6H A;  1UAI A;  2AEN A;  3PMS A;  3RS6 A;  1O8P A;  3SH4 A;  2BNM A;  4BIF A;  5HBA A;  4HK8 A;  2C26 A;  5J48 A;  1DZT A;  2D6M A;  1G7Y A;  4I3G A;  2LTN A;  1GWK A;  4CDQ B;  1W6O A;  2AEY A;  2YPJ A;  2R7E B;  4AI8 A;  3L2Y A;  4MGS A;  4Y3O A;  5FXW A;  4CTE A;  3H7Y A;  3JQX A;  4BJ0 A;  2QDR A;  5T5L A;  1FOD 1;  1A8M A;  1LR5 A;  4YGE A;  1OQD A;  1OUR A;  3NKG A;  2YU1 A;  4HKW A;  3WNP A;  2D40 A;  2RVA A;  2YPD A;  2WSV A;  4K6B A;  2Q1Z B;  4GMP 1;  3MI8 A;  4QPI C;  5T55 A;  3B3Q E;  2VTX J;  3U37 A;  1WCK A;  1H2N A;  4IEO A;  4LKD A;  5I93 A;  1H9P A;  2P17 A;  4Q26 A;  3B7M A;  5A33 B;  1W99 A;  1N1Y A;  4Q0P A;  2C24 A;  3SHR A;  1RUI 2;  5LRS A;  1FNY A;  1VBD 2;  4CXY A;  4YWA A;  4CDQ A;  2EIG A;  1RUI 1;  1HRV 2;  1MZF A;  3BN6 A;  3IKW A;  2OQ6 A;  4XJU A;  4Y33 A;  4UFK A;  2W95 A;  5FK7 A;  2QJV A;  4A6S A;  1QJX 1;  4ASM B;  4Q8K A;  2WT0 A;  3TN9 3;  4AYU A;  5FDB A;  3LSE A;  1B35 B;  3LPG A;  2NPI A;  4XCA A;  4CCC A;  3VB9 A;  1JUI A;  2CNA A;  3VDD B;  4A2U A;  4FAG A;  3D4K A;  3EJK A;  2JIC A;  4ZS3 A;  3ILN A;  5EJ1 B;  2F4L A;  3MUZ 1;  2ZGN A;  1PVC 1;  1UKG A;  4I30 A;  4RSU A;  5T5J A;  1OXC A;  5ISL A;  1RUG 2;  5F3E A;  2J42 A;  4LOS A;  3THD A;  1CIW A;  3ZDV A;  2AC1 A;  2HH9 A;  2OKX A;  3WY6 A;  4MV2 A;  2ENR A;  4LR4 A;  5JDB A;  4MAD A;  3WNK A;  4XBQ A;  2E51 A;  5BNN A;  2QQW A;  2WNU B;  3ZYF A;  4QX1 A;  2VMH A;  4OHV A;  4GD4 A;  3ZYI B;  1DG6 A;  4FCA A;  2XVL A;  3GCW A;  1B35 A;  1FXZ A;  1MS1 A;  4ZU4 A;  2ZHM A;  4E2G A;  5LA0 A;  3ATG A;  2R32 A;  2WNU A;  4UW3 A;  4NRP A;  5CNA A;  4BIO A;  2H6B A;  5IK4 A;  3PUQ A;  1Z0H A;  2XLA A;  2C6S A;  1LHV A;  4S2G A;  2AUY A;  5CFC A;  4OFG A;  4KNC A;  2VZO A;  3WIN E;  3PLQ A;  4J1X A;  3SIT A;  1BVP 1;  1ULO A;  2RS1 3;  2A3W A;  5DAP A;  3RFR A;  3TBD A;  1LHO A;  1R08 1;  1PX4 A;  4WVM A;  3S6P A;  1DQ5 A;  4BA6 A;  4AHX A;  5AVP A;  1RB8 G;  2H0B A;  2XBO 2;  2OZ6 A;  3RYP A;  1AL2 3;  2E63 A;  3DEM A;  4TZD A;  2PHU A;  1J1T A;  3VHR A;  2QQV A;  4FPH A;  1CR7 A;  1RUF 1;  1HKD A;  2VEC A;  5BNP A;  4HVR A;  5FLI A;  1DQ4 A;  1CAU B;  1YLL A;  3USS A;  4MZU A;  5FO7 B;  3H3U A;  1LHW A;  1WGP A;  2A7A A;  4Q4V 2;  3T2T A;  4P9L A;  3ACH A;  3EHK A;  4CSW A;  1CAU A;  1Z7S 1;  1H2M A;  2MPF A;  1DYP A;  2VZ3 A;  4NOT A;  2NP0 A;  3N9P A;  1FMD 3;  3I4I A;  3NJY A;  3CBN A;  1ZM1 A;  1DLL A;  2ILM A;  4LO5 B;  4QKF A;  4C0B A;  4PIX A;  1KGY A;  2FHR A;  4PQQ A;  1WW6 A;  4XJA A;  2P2K A;  2KM2 A;  3TOJ A;  2JX9 A;  3ZXA C;  2VY0 A;  5ANQ A;  4XXA A;  1UL9 A;  4IGQ A;  1PZ7 A;  2EAK A;  4FTE A;  5FUN A;  4CP9 A;  4DNY A;  1RXF A;  4N9H A;  5G05 L;  5HCA A;  2VGD A;  1NQD A;  5A7S A;  5HI0 A;  1A78 A;  3CO2 A;  1LOG A;  2RS3 1;  3E5U A;  2LS6 A;  5FY4 A;  3VKO A;  1Q5O A;  3MZH A;  3III A;  1WCD J;  4CDX C;  5IAV A;  1GWL A;  2ZMN A;  5DDJ 1;  2BBA A;  3FUQ A;  5JR7 B;  5C9A B;  1EY2 A;  1NCQ A;  4XUO A;  2WDB A;  3WF1 A;  5A3N A;  5I8S A;  5JXI A;  3D0S A;  3AYA A;  3IMN A;  5ACA 1;  2C1F A;  4I02 A;  4JAA A;  2ZGQ A;  2DFC A;  4XF3 A;  1LOD A;  1RGS A;  4NVP A;  1AF9 A;  2VW2 A;  2DTY A;  4RGA A;  2CSG A;  2W1Q A;  4GH4 C;  2VW1 A;  3B02 A;  4LOR A;  4R9C A;  3UGG A;  1WMD A;  1HV1 A;  4YW7 A;  1D4M 2;  4AHW A;  2OYZ A;  1ULP A;  3R0R A;  2Z69 A;  5LEK A;  3ZYP A;  4LE4 A;  1F5F A;  3LFI A;  2ZX1 A;  3I2I A;  2XLG A;  1OF4 A;  1BQP A;  1AZD A;  1SFP A;  2ZPX A;  3FBM A;  3H8U A;  3HBZ A;  4UXA A;  4UFJ A;  3DPR A;  3OGR A;  2RDR A;  2QNK A;  3TYJ A;  2RJ2 A;  5IFT A;  3WHU A;  4KG0 A;  4YM1 A;  4GB3 3;  1DQ1 A;  1UO9 A;  4IV1 A;  1X7N A;  3NV4 A;  2GC0 A;  2VL4 A;  1QY4 A;  5AC9 3;  3K51 A;  4BK5 A;  3K3N A;  5FZL A;  4A3X A;  5FZ3 A;  3K4D A;  4QXB A;  4AVA A;  1V6I A;  5I91 A;  5C5T A;  5C4W C;  4YFZ A;  4Q8L A;  5KXC A;  1OKO A;  2JB4 A;  2IXH A;  4LJH A;  3LF7 A;  5GLU A;  4QX0 A;  5DAV A;  1UKR A;  1X36 A;  3GM8 A;  1CON A;  2R0H A;  5AVA A;  4LHN A;  2VD7 A;  3WDW A;  2HEY F;  4ZXE A;  1HB3 A;  4ISR A;  2VMD A;  2HKX A;  2ZAA A;  4LHL A;  1SPP B;  4CDW A;  3H8R A;  5AFE A;  2Y60 A;  2DUR A;  4U2A A;  4Y20 B;  1Q8S A;  1KFU L;  4Y24 A;  2VTX A;  4G3Y C;  1W0N A;  2XH6 A;  3AXE A;  3L2H A;  4RHV 3;  3AP6 A;  1E5R A;  4FTB A;  3T30 A;  2YYO A;  3NNG A;  2ZEZ A;  3E5X A;  3VZN A;  3ZKY A;  3DL3 A;  1ZBE 2;  3KWV A;  1D2Q A;  4WVM B;  4Y1U A;  5CFD B;  4A44 A;  4AL9 A;  1IPJ A;  2X09 A;  5BPX A;  1QXP A;  3WSO A;  1F15 A;  5D21 A;  2PQQ A;  5FZD A;  2BU9 A;  3CZU A;  3LPF A;  4MYE A;  3O5S A;  4UW5 A;  1VAM A;  2AZ5 A;  1P8J A;  4AXO A;  5DAQ A;  1Y9Q A;  1PIV 1;  1W6P B;  1YXW A;  3EXU A;  4FXK B;  5FZM A;  2ZZJ A;  3ZXG A;  5F9T A;  1ZRE A;  4H7L A;  1GOH A;  2WC2 A;  1CGP A;  4FFH A;  4M3C E;  1O3T A;  2FQP A;  3RWN A;  4CCM A;  1RMU 1;  4V1P A;  3POG A;  1SQ4 A;  2W1S A;  4WBB A;  2WSU A;  1WUV A;  4B29 A;  4CZS A;  2WZP P;  2E7T A;  2YBS A;  1RUJ 1;  2ZX0 A;  1RXG A;  2Q30 A;  3PL0 A;  3O1R A;  3G7D A;  3OOX A;  2ZEX A;  3USU A;  1DGR A;  3E5Q A;  2DFB A;  4IEZ A;  1CWP A;  2WFF 1;  4QB1 A;  1ZBA 3;  1GKB A;  3PME A;  4ET7 A;  3IAP A;  2BUK A;  3OPW A;  2ZJC A;  3WG3 A;  2R06 3;  1SLB A;  4AGG A;  3WDX A;  4COW A;  4CCD A;  2Z42 A;  4XFA A;  5A3L A;  3I3E A;  5FZI A;  1SLA A;  3AFK A;  3DYP A;  3MV0 1;  4W4Z A;  4CA9 A;  3KZ4 C;  1UY2 A;  1JOJ A;  3CF6 E;  3GXU A;  2FDJ A;  3IZO A;  4BK4 A;  5HV0 A;  1F4H A;  1ULE A;  4M01 A;  1W9S A;  3GZU C;  4KG8 A;  2BWA A;  5FXX A;  5KR7 A;  1YWK A;  4NE9 A;  5GAL A;  2CGO A;  3HN1 A;  1VR3 A;  4LT5 A;  3W5M A;  2FDH A;  2JD9 A;  1W28 A;  1MR5 A;  1HXS 2;  2RDS A;  3AYD A;  3OGG A;  5FYH A;  1C3H A;  1HXS 1;  5LAS A;  1V0A A;  4HN0 A;  1W9F A;  3VV1 A;  3AMP A;  4P9W A;  1Z7S 2;  2XLF A;  3RI8 A;  2ZAB A;  2R04 2;  4LIT A;  5LBE A;  3RJR A;  4XIK A;  2G1M A;  2R04 1;  2TNF A;  5FY1 A;  4HSJ A;  3WX5 A;  4HK9 A;  4TN7 A;  2W47 A;  5KHJ A;  1K5M A;  3ORJ A;  2VH9 A;  4LBL A;  3NQH A;  4LBK A;  3DXU A;  2GH2 A;  1UQX A;  2DCT A;  4W6W A;  2FMD A;  3AFG A;  4UFI A;  1VBE 3;  1HLC A;  4QX8 A;  5JIA A;  5CKM A;  1US2 A;  2YRO A;  3MIH A;  5JMC A;  3V0A B;  4K7J A;  4BCU A;  4IGP A;  2NMN A;  2RDQ A;  2W2I A;  3H0O A;  5IUQ A;  1QDC A;  3DYM A;  4Q29 A;  4ARX A;  5F1R A;  2PHF A;  2XON A;  1G9D A;  2B45 X;  4NID A;  1NT0 A;  4RR3 A;  3VBR A;  2J1U A;  1HRI 3;  2WFP A;  2O0O A;  2UWA A;  2ZX2 A;  4A3Z A;  4CRQ A;  2VE1 A;  4N7U A;  4XE9 A;  3MIG A;  5FLH A;  1Q43 A;  1PX3 A;  4BQ5 A;  4DPN A;  2GAU A;  5DPN A;  1JS9 A;  4V2V A;  2VO5 A;  1QDO A;  5ACA 2;  1M06 G;  1QU0 A;  1BHG A;  1BLZ A;  2VOX A;  2X53 S;  1AYM 3;  2VZV A;  2BFU L;  5FP8 A;  1WME A;  3C3V A;  3S7I A;  1TVG A;  3PU3 A;  5JVV A;  2B46 X;  1YFW A;  5FQ0 A;  1DQ6 A;  4Y26 A;  4LEJ A;  5F6L B;  3ZPO A;  4NPM A;  1IPK A;  1W8Z A;  4LMF A;  4D7T A;  3DF0 A;  3H8X A;  2OT7 A;  1UMI A;  2W5F A;  3R4D B;  3IMM A;  2Y38 A;  4N53 C;  2Q8D A;  1OQ1 A;  3WW1 A;  3OBR A;  3MF6 A;  2W0X A;  2XGX A;  4JTO A;  4JGZ B;  4YVW B;  3VD3 A;  2GU9 A;  1YQ8 A;  4LHS A;  1W6M B;  4HVQ A;  3V64 A;  5J3U A;  1N1S A;  1W6N A;  3N36 A;  3NJV A;  1WCU A;  4AED B;  3VZO A;  1UCX A;  5FXZ A;  2HEW F;  3KGL A;  3MID A;  3IAQ A;  4PHZ A;  3DV8 A;  1B35 C;  2Y6L A;  3OYW B;  3S57 A;  4K21 A;  4BPZ A;  1CAV A;  2CTV A;  1UNB A;  3ZXJ A;  5BNN C;  4OI4 A;  1AYM 1;  2JG9 B;  4E4H A;  4COV A;  3AKQ A;  1MS0 A;  2J1E A;  2YG0 A;  3DPR B;  3AZZ A;  4BHP A;  2CGP A;  1GLH A;  1HV0 A;  5LB6 A;  1WMX A;  1Y9G A;  1KEX A;  3J7L A;  2EVX A;  1ZBA 2;  1QJU 1;  3I54 A;  3T0A A;  3N35 A;  5A1A A;  3USU B;  2ID4 A;  3CJI B;  2EF6 A;  1HRI 1;  2RJK A;  3PUS A;  4E4Z A;  1R1Z A;  3CQO A;  2A70 A;  2F4P A;  3BYW A;  1DZQ A;  3LA3 A;  2HBU A;  3N9M A;  1BCX A;  3HMY A;  4Y5Z 0;  4YZ2 A;  4GIQ A;  3WT3 A;  4Z07 A;  2YXS A;  3IBM A;  3E6C C;  3WCS A;  4BIS A;  5EJ3 A;  2J1V A;  4GAZ A;  1R1A 3;  4AAX A;  1NG0 A;  3LSD A;  4E8D A;  3ZLI A;  2IFR A;  1KD7 A;  2C9A A;  3WNN A;  1NAE A;  1KS5 A;  4BQ4 A;  2O1Q A;  3H7J A;  3L9J T;  1VB4 A;  2I45 A;  3TWI A;  2XQX A;  3OB8 A;  4ZPI A;  2XXZ A;  2E9Q A;  2EID A;  2R1D A;  3JD7 2;  3BIE A;  4S2F A;  4Y5S A;  2ZML A;  4E2Q A;  1YRZ A;  2HWE 1;  3THT A;  4LA3 A;  3CL1 A;  1ZRI A;  1SLT A;  3LA2 A;  4DXR A;  2DBN A;  1YUD A;  3WQ7 A;  3ZYJ B;  1RMU 2;  2Q1M A;  5T5O A;  3ZKU A;  1GOG A;  3KMH A;  5FPV A;  3VDC A;  2FD8 A;  2JWP A;  2Y26 A;  3MPB A;  4M4R A;  4DRR A;  3T08 A;  3T2O A;  1SPP A;  1GP5 A;  3NJZ A;  1QJY 1;  3CMG A;  4QU1 A;  5SV5 A;  4QT6 A;  1A6C A;  5T5P A;  4AI9 A;  1COV 2;  2WFF 2;  5CYY A;  4IEY A;  3I3Q A;  1O8S A;  3MIC A;  3KS7 A;  4GKY A;  2JG8 C;  2WAB A;  5E89 A;  3RQ0 A;  1UX7 A;  3H1M A;  5I8T A;  2ZZQ A;  1NCR A;  3ACF A;  2R6Q A;  2UY8 A;  4X6R B;  1QH6 A;  3THP A;  4CCN A;  1IGO A;  5CU1 A;  2VNV A;  3I3D A;  1HRI 2;  3GJA A;  4JGY C;  4Q5O A;  4LNV A;  4W65 A;  4AGV A;  1W8N A;  2W46 A;  5KXB A;  3KHB A;  1NCR C;  2WZ8 A;  1NA1 C;  3LEM A;  2OVU A;  4O7X A;  3GJB A;  4AVB A;  1O3Q A;  2NM1 A;  4O9E A;  3JQW A;  2IXK A;  4Q4Y 3;  3RG0 A;  2NN8 A;  2ZA9 A;  1NE4 A;  2HBT A;  5FRA A;  1C8N A;  2VVF A;  1RUF 2;  3P1I A;  3I49 A;  5FR3 A;  4CCK A;  4DUV A;  4XPV A;  3KVB A;  1UOF A;  2ZHN A;  3KB5 A;  5FP9 A;  2MEV 3;  2HWF 1;  3J9S A;  5IFP A;  2GP5 A;  4JDO A;  1U12 A;  1C8M 2;  1XNB A;  2YDE A;  2ZGL A;  3VKM A;  1J59 A;  3K48 A;  5FYI A;  3ZR6 A;  4A7Z A;  3BI3 A;  3WUD A;  2XG3 A;  2XJV A;  3JD7 1;  4UWD A;  1PO2 2;  2B39 A;  2GME A;  1UF2 C;  4YZ4 A;  1AYN 1;  1W6M A;  1CIY A;  2A3Y A;  3ITQ A;  5JI9 A;  1GUI A;  1VBC 3;  2FBE A;  5JSO A;  2DYC A;  4ATE A;  3U4X A;  4IE5 A;  4LO4 B;  4QXK A;  3ACL A;  5DAB A;  2KA3 A;  1G8W A;  3ZFE A;  1POV 0;  4YZ1 A;  4CDU C;  1O4T A;  4FOV A;  4QX2 A;  4RGK A;  1UOJ A;  3ETP A;  5FY5 A;  2OZJ A;  4ES9 A;  3J7M A;  5C4W B;  5JAX A;  1YQC A;  3O1O A;  3RYR A;  1YC6 1;  2A3X A;  4A7K A;  3RZJ A;  4NIA A;  1RVF 1;  1ZYB A;  4R9A A;  4RQP B;  2DCY A;  2IXI A;  1LOB A;  4GA9 A;  2JG8 B;  1W9W A;  4N53 B;  4QQL A;  5CKQ A;  1GP6 A;  3T0D A;  3HT2 A;  4FT8 A;  4H3W A;  2ZHL A;  5IT6 A;  5CB7 A;  4E2S A;  1TQ5 A;  4B1M A;  5FMB A;  1RHI 3;  3H1W A;  4PBP A;  5BUV A;  2E31 A;  5FOB B;  1I3H A;  1S0C A;  2RM2 3;  2BP6 A;  4BE3 A;  3KQ4 B;  3KVA A;  1MAC A;  3I59 B;  1X82 A;  4OMC A;  5FYZ A;  4DUW A;  4FPF A;  5AC9 1;  3K46 A;  3BUC A;  1PGL 1;  4DIQ A;  4IV1 C;  2HYK A;  1JH5 A;  4KGQ A;  5BNN B;  2W9X A;  3LWC A;  1HB1 A;  3RI9 A;  4QKD A;  4FOW A;  1TE1 B;  3DPR C;  4N53 A;  5JXG A;  1HJF A;  2JE7 A;  4L92 A;  1JZ5 A;  1H2L A;  5L7O C;  1YQ6 A;  1TNF A;  4UW4 A;  2JEM A;  5FZC A;  1DLC A;  5CFC B;  5E88 A;  2PLV 3;  4BH9 A;  1JZ2 A;  5FCC A;  1MS3 A;  1E5S A;  1KXG A;  2QQP A;  2Z5W A;  3J4U H;  5A70 A;  1VAL A;  3RRD A;  2IXJ A;  4J1W A;  3SEE A;  1MS9 A;  2BOI A;  3BCW A;  3G6J B;  4HZF A;  4MVT A;  4YYO A;  3UJO A;  3B94 A;  1UPI A;  5LCW L;  2PHL A;  2PFW A;  1G9C A;  1PK6 C;  1Y7B A;  1JU3 A;  3AB0 A;  5FZB A;  1FV2 A;  1M4W A;  4OUE A;  4Q0V A;  2LUW A;  2PHW A;  4PCR A;  2C0Z A;  4Q4Y 2;  3WHT A;  3AL5 A;  4BMB A;  5FMD A;  5FPL A;  1WLT A;  2K0G A;  4LK6 A;  4EWA A;  1I9R A;  2CV6 A;  1MVQ A;  3J8F 2;  1EYB A;  1GQH A;  2JB8 A;  2CU5 A;  3SLI A;  1ZBE 1;  5A3W A;  5M0T A;  1QJF A;  5AFB A;  3GDB A;  2OXB A;  1XYN A;  4ARY A;  5JZG A;  1OPM A;  3JU9 A;  1HRV 1;  3WLU A;  3N7K A;  4AWD A;  2BVV A;  2PN5 A;  2NYY A;  3FLP A;  3FHQ A;  2QDN A;  3N9L A;  1CJD A;  2EIE A;  1SCR A;  1LNS A;  2JDZ A;  3VUO A;  3FL7 A;  3O1T A;  2JEN A;  1LCL A;  5FAX A;  3ZN6 B;  4ASL A;  3ZFF A;  4NWW A;  2R07 1;  1R09 2;  1YJK A;  1L7R A;  2Y64 A;  3A23 A;  2DUQ A;  2B8M A;  5BNP C;  4IV1 B;  1OUS A;  1TME 2;  3POW A;  3ZN6 A;  2YGM A;  1ODM A;  1LTE A;  1N3Q A;  4YM0 A;  5FZO B;  1ND3 B;  3FUO A;  4IGO A;  3OBA A;  5BNO A;  2ZGP A;  4XHX A;  1DGR N;  3IPV A;  2G9G A;  1A3K A;  3LD8 A;  2HLE A;  2Q8O A;  4AI2 A;  4BLJ A;  2G4I A;  5L19 A;  1UY3 A;  2D98 A;  4AK3 A;  3B93 A;  3IB3 A;  4PDW C;  3O0V A;  3POI A;  4NRQ A;  3NNL A;  5CFC C;  4PLN A;  4DXT A;  4YG0 A;  1RUD 2;  1RUC 2;  2DUP A;  4XUR A;  2NMO A;  1OFS A;  4AZZ A;  5J96 B;  2WNU C;  1PHM A;  4B7E A;  3OF1 A;  4XYX A;  2ARC A;  4QPG A;  2JKX A;  4OUS A;  3TAY A;  1N1V A;  3UGF A;  1W9T A;  2BGP A;  2DVB A;  2GSY A;  4QQ2 A;  5GZD A;  1AX1 A;  4I09 A;  3J7N A;  5L7O A;  2GDF A;  2PAM A;  2XBO 1;  4N9I A;  1HN1 A;  1PGW 1;  2WQ8 A;  3IIA A;  5G04 L;  5JUV A;  2ARE A;  1CAX B;  2DV9 A;  5FMC A;  2XVG A;  1SLC A;  4S2H A;  5EJZ B;  1S2E A;  5F3I A;  2IZW A;  3B00 A;  1F4A A;  1W8W A;  4Z2W A;  2WII B;  4D3W A;  3KV4 A;  1OA2 A;  2WT1 A;  3LZZ A;  4M0H A;  3SCF A;  5B4N A;  1BXH A;  4XJW A;  4B1L A;  3RZH A;  1AYN 3;  1VPH A;  3I97 A;  4COU A;  3M3Q A;  4H55 A;  1O4Y A;  3OUI A;  2XJR A;  2YBK A;  3AZW A;  1UIK A;  2JJ6 A;  3O12 A;  1WA6 X;  4MGZ E;  3VL8 A;  4B8E A;  4EWD A;  4K9S A;  1ZRF A;  4R4X A;  3W5N A;  4JKK A;  1VRB A;  4N8M A;  3OGV A;  1LU1 A;  3WDY A;  1W6Q A;  3UL2 A;  4Y1X A;  2PEL A;  4YGB A;  4XUT A;  2YHJ A;  2W08 A;  3T4V A;  1IS6 A;  1GV9 A;  1NY7 2;  2WRA A;  3BPZ A;  5DDJ 3;  1NXD 1;  4XBL A;  3QH6 A;  2RV9 A;  3SCH A;  4OVE A;  4B4P A;  4XFC A;  3ZIX A;  1QQP 3;  1RVF 2;  4O65 A;  4N7I A;  2VOK A;  3OPT A;  2ZGR A;  5JI7 A;  3NNM A;  1OF3 A;  4A4A A;  3AKS A;  3U10 A;  4QPY A;  4GJZ A;  3T2Q A;  4IEU A;  4XMI A;  3MBW A;  4RN5 A;  4DO0 A;  2VZP A;  3NL1 A;  5KHG A;  3MO4 A;  4BQ1 A;  4JDN A;  3FFZ A;  4EZH A;  2ZGO A;  3B5L B;  4FVV A;  2BTV C;  5C4W A;  1IQA A;  2HWC 2;  2DU1 A;  4C90 A;  4NJ4 A;  4PF5 A;  1H1M A;  4K1Z A;  5JZG B;  1LHN A;  1X50 A;  2D3S A;  1LEM A;  2IXL A;  2RMU 3;  4R9B A;  4QGN A;  3WW4 A;  5JXH A;  3GZE A;  1JYN A;  1UU5 A;  3S5A A;  4L11 A;  1UW8 A;  2I07 B;  2WBK A;  3LB9 A;  4SBV A;  4R9D A;  4E4D X;  3ZMN A;  1CAV B;  3E6B A;  1LRH A;  2JG9 A;  4KWL A;  2WNV A;  2WZE A;  3VZK A;  3FE5 A;  3V0B A;  4NPL A;  2VR4 A;  3ZFF B;  1SDD B;  4I01 A;  4MOA A;  4LBQ A;  3WW2 A;  2VZR A;  3GZT B;  3R6S A;  5DUV A;  3RNS A;  4AHY A;  4EE2 A;  2OS2 A;  2IFW A;  2WQ4 A;  4CU7 A;  4PF1 A;  4K40 A;  3CEW A;  4GH4 A;  3HAG A;  3CJI A;  2Q4S A;  4K8F A;  5EYY A;  1UPS A;  3U4S A;  2IVJ A;  2W94 A;  1LED A;  1LKN A;  1UD1 A;  3VL9 A;  5GZC A;  3WQ0 A;  1EP0 A;  4DZG A;  2VUD A;  5FJH A;  1YIP A;  2GC2 A;  3DKQ A;  3SCG A;  2QQK A;  3K75 B;  3PNA A;  4D8M A;  5JMO A;  5A6Z A;  4UAP A;  3VBF A;  1ND2 C;  5B4X A;  1W2U A;  3OUH A;  3DN7 A;  4H14 A;  1UU4 A;  2Q8E A;  4CDW B;  2DVF A;  2VBB A;  2JG8 A;  1FYU A;  2JDK A;  5FUI A;  3BOW A;  1L7Q A;  4ES8 A;  5J1X A;  2CGN A;  1VBB 3;  4IV3 C;  4CDX A;  4MG2 A;  3WNL A;  3MIB A;  4XQD A;  3KF5 A;  4RHV 1;  2ZEY A;  4ORF A;  3O1U A;  4LBQ B;  1AX0 A;  4RHV 2;  3AX4 A;  4LBO A;  2DF7 A;  1XNC A;  1C8M 3;  2GZW A;  3VBH B;  3LOI A;  2YGL A;  4XIO A;  1JZ7 A;  5EV7 A;  4AED C;  4IET A;  4JVA A;  4WZF A;  1CPM A;  3KCX A;  4YSF A;  3M2M A;  2W92 A;  1V6K A;  2ZKN A;  4IQP A;  3FMG A;  1DQ2 A;  3VD5 A;  4DUX A;  3LGR A;  4M0N A;  4MXW A;  4CP0 A;  3TEY A;  1APN A;  1UOB A;  2GC3 A;  1R09 1;  2ERF A;  3JD7 3;  1SAC A;  1XND A;  5FUP A;  4NR1 A;  4XTM A;  1MZ5 A;  1S2K A;  2RG4 A;  3K2O A;  5K0U A;  2ZCW A;  5JOY A;  2X29 A;  1DGW A;  2PA7 A;  5A3T A;  2YBP A;  1A8D A;  3WP3 A;  3I2K A;  4HKO A;  1PVC 3;  3T3Y A;  5EIY B;  1N3O A;  5IK5 A;  4KL1 A;  1XXN A;  4CP2 A;  4AOC A;  4DQA A;  1AR7 3;  2JDU A;  1ULC A;  1QJY 2;  1NY7 1;  2ARB A;  2EIB A;  2JDN A;  3QLQ A;  5EP9 A;  3UGH A;  4CUB A;  5HCH A;  5GLT A;  3UV9 A;  1FMD 1;  5C3Q A;  1YCI A;  1G9A A;  2O8O A;  1SLI A;  1FAY A;  4QWN A;  1Z7S 3;  5A3P A;  1AR6 2;  4FFG A;  1RUI 3;  3SMH A;  3EYP A;  3BOD A;  4RFR B;  5K9Y A;  5FO9 B;  1SEF A;  4MGI E;  1QOT A;  4AFB A;  2R06 2;  4IE4 A;  3WDT A;  2Z79 A;  4UYB A;  1ZRD A;  5J98 B;  3K77 A;  2E26 A;  3OD0 A;  4TLF A;  5FYT A;  2JKB A;  1VP6 A;  4NHK A;  4BYY A;  1V6J A;  3ECQ A;  5EQU A;  2P34 A;  1AR8 1;  4L9B A;  2AGS A;  1JHN A;  4JV4 A;  5F5Q A;  3Q8E A;  4NHL A;  4IES A;  4QX3 A;  1S0J A;  1W90 A;  2VUL A;  1PGL 2;  2XML A;  1PO1 3;  4XOG A;  1UU6 A;  3H8O A;  1W2T A;  5BV6 A;  4KWJ A;  3KD4 A;  1H1I A;  3KSC A;  4BQY A;  3AVS A;  3C7O A;  4YW2 A;  1RUD 3;  1RUC 3;  1V6N A;  2FDI A;  2VZ1 A;  3MW2 A;  4MUV A;  5D8A B;  2PQS A;  2ZGU A;  3DKW A;  1ZRC A;  1VBA 3;  4XZP A;  4YRD A;  1X9P A;  1DZR A;  4Z92 B;  1RIN A;  3ACG A;  4GAL A;  5FFO C;  5FY9 A;  1BYH A;  1ZZC A;  5FPA A;  1GBG A;  4BB3 A;  1Y3T A;  1S0F A;  1X8E A;  3VDA A;  3K4A A;  5EXO A;  1NUK A;  3SQO A;  1PNF A;  5I8Y A;  4LTA A;  1ZBE 3;  4HG6 B;  3HVD A;  3O1P A;  4NAM A;  5JOZ A;  4ONU A;  1NCQ C;  1RUH 3;  3U78 A;  2VC9 A;  3HQR A;  4OHW A;  2PXJ A;  3N9N A;  3AP5 A;  2ETE A;  4MET A;  1KFX L;  1QEX A;  4EV0 A;  3WG2 A;  1QJE A;  5IVC A;  4PIY A;  5C3R A;  1DFQ A;  3VBO C;  1IPS A;  4YVS B;  4RGG A;  2RDN A;  1CZS A;  1VBA 2;  1YEW A;  4CP1 A;  3GAL A;  3PUI A;  4FPO B;  1EAH 1;  2QFE A;  1ENX A;  2QE3 A;  5IK7 A;  2ATF A;  1ODN A;  3RDI A;  1K5M C;  1C4R A;  2D6K A;  3R4S A;  5KXD A;  3UYJ A;  3CIH A;  2QUO A;  1D4M 1;  4DXZ A;  1GZ9 A;  3LEI A;  4D6R A;  1D4V B;  2D44 A;  2HWC 1;  1ULF A;  2BQP A;  2VXR A;  3I7D A;  3PJY A;  1I5Z A;  1Y4W A;  2VXJ A;  2QQJ A;  3WVJ A;  4FTS A;  2VMC A;  3S7E A;  2BFU S;  3W20 A;  4P5H A;  1V9U 2;  5D2A A;  1W9Y A;  2OQ7 A;  3AZV A;  2B42 B;  2DWR A;  1PVC 2;  1J58 A;  2EAL A;  2LRP A;  5A7N A;  3U11 A;  3U75 A;  4ERO A;  1JZ6 A;  4XAC A;  1OPO A;  4HPK A;  1WW4 A;  4XDO A;  2IWG B;  2F6B A;  4Y1Y A;  1EV1 1;  1ZRR A;  4DFS A;  2DVD A;  2BYV E;  4G4F A;  2FCU A;  5IVB A;  1VAV A;  1ZZ8 A;  4JHT A;  1RC6 A;  2VNR A;  2FMY A;  3IWZ A;  4QKB A;  1C1L A;  3LIG A;  1W39 A;  3HT1 A;  4QB6 A;  4JGZ C;  4YVW C;  1AR6 3;  4EYU A;  5TSW A;  3C2U A;  4KI5 M;  4BOW A;  1IG3 A;  5FP3 A;  5IJR A;  2XJP A;  2ZGK A;  4QDS A;  1RUH 1;  1QJU 3;  4JKM A;  1QH7 A;  4KQ7 A;  2DCJ A;  4FXG B;  2EAA A;  2HEV F;  4LO7 A;  1JI6 A;  4Y22 B;  1VMH A;  1OH3 A;  2BNO A;  2D3R A;  2OUH A;  4LKF A;  3VBH C;  3W58 A;  5CIR A;  5JPM B;  1OMI A;  1AR9 3;  1BBT 3;  3BVC A;  4PQ9 A;  2VTF A;  3NJX A;  4P9X A;  3V65 A;  4FBF A;  4XFH A;  3N3H A;  1V6M A;  1XNT A;  2DCZ A;  3ZYR A;  4CCJ A;  2FCV A;  1W6N B;  4N90 A;  3AKP A;  5C9A C;  1NLS A;  4WVW A;  3LA7 A;  5FKC A;  5GZG A;  5JOX A;  5FZG A;  2BBV A;  2VZQ A;  1O5L A;  5FZH A;  4FI9 A;  3RJ2 X;  5GJ6 A;  1FPN 2;  3KCC A;  2VQ0 A;  1H30 A;  3I59 A;  3HOB A;  2W52 A;  1STM A;  3WNM A;  4CCE A;  3TEZ A;  4B4R A;  3MLL A;  4FP2 A;  1FI2 A;  4DRV A;  3GNE A;  4OUM A;  4XJ9 A;  4NPR A;  1JBC A;  5E6H A;  1WWY A;  4XUN A;  4CEY C;  4ZZ8 A;  5FO8 B;  2QVS B;  3RZG A;  3MF9 A;  3RWK X;  2CYF A;  3B9C A;  4I0B A;  1AX2 A;  3VBH A;  3WF0 A;  3VDB A;  1QXR A;  1GR3 A;  1TME 1;  2OPK A;  4Q2F A;  1DYO A;  3NVC A;  4J6G A;  4UFH A;  4DEQ A;  2JDH A;  2YC4 A;  4K8R B;  5D8A A;  1TMF 2;  4G9S B;  2TBV A;  3BIW E;  3BGA A;  3FJS A;  3R4U A;  2RR1 2;  3AMM A;  3O1V A;  1G86 A;  1TG7 A;  1RUJ 2;  3VBF B;  2BDR A;  3ELN A;  4P02 B;  1GSL A;  5F37 A;  4L8Q A;  2DTW A;  2VCA A;  4HMZ A;  4LUM A;  1UZW A;  5EWS A;  1Y9M A;  1NLR A;  1FMD 2;  1HIX A;  3AKR A;  2DVA A;  3AMH A;  4K3U A;  5F5I A;  1B09 A;  3URF A;  1Q8P A;  1RIT A;  1ZZ6 A;  3WNO A;  2WL1 A;  1HW5 A;  1CZV A;  5DUX A;  3VHO A;  4H2A A;  3ON7 A;  1D7P M;  1KS4 A;  5FYM A;  2BNN A;  2LM3 A;  1NZI A;  3VZM A;  1OT5 A;  1TNR A;  3ZDS A;  1S0D A;  4UI9 L;  2KXL A;  1OC1 A;  1GAN A;  4UBG A;  3WXP A;  3BKZ A;  2XWB B;  2X5I B;  4YVS A;  4AVT A;  1JYT A;  3VHN A;  3AJZ A;  3A7Q A;  1UYY A;  1BEV 3;  2A73 B;  2RMU 2;  2RR1 3;  3ZSM A;  5C71 A;  3DEC A;  2YMZ A;  1NCR B;  4Q4W 3;  3MIF A;  4IEV A;  4CEW A;  5EHD A;  2MHF A;  4AR2 A;  4F7Z A;  2RS3 3;  4LHK A;  4HKL A;  4QD2 A;  5BNP B;  2VZS A;  4IER A;  5EYX A;  5FZE A;  1LGN A;  4YLZ A;  2JE8 A;  2Y6H A;  3JB8 A;  2C4X A;  3CZJ A;  5ABJ B;  3UJQ A;  1W8O A;  4GB3 2;  3WF2 A;  1W05 A;  4BQ2 A;  3IDC B;  1F5J A;  1UIJ A;  4UW6 A;  1PO2 1;  2WO7 A;  1S0B A;  1ACC A;  1QJZ A;  2ZEW A;  2IC1 A;  3OTF A;  1AYN 2;  4HPK B;  1YFX A;  1C57 A;  4QQO A;  5A32 A;  3KV6 A;  4ZHN A;  1TMF 1;  3DCQ A;  4A6O A;  4CEY B;  2SLI A;  2VMG A;  4LUK A;  4QM9 A;  2CDP A;  3P6B A;  5LBC A;  1ZBA 1;  1LOC A;  2RS3 2;  1PO1 2;  4Q0U A;  4CXW A;  2WN2 A;  4MLO A;  5I0S A;  1ENS A;  4QDQ A;  3KF3 A;  3KT4 A;  5KC6 A;  3ZFG C;  3EO6 A;  1XB9 A;  2YC0 A;  4A45 A;  3T1M A;  2ADD A;  1NQJ A;  1PMJ X;  4QHZ A;  2ZTN A;  4Y1V A;  2BWC A;  3RMY A;  2R30 A;  1RUO A;  1OD3 A;  1OSG A;  1IOA A;  2VU9 A;  1PNG A;  3ZYG A;  2WA4 A;  4LK7 A;  3NNJ A;  4NAO A;  1EAH 3;  1URX A;  4QHO A;  5A33 A;  4OQ8 A;  2Y0O A;  1FX5 A;  4HT1 T;  1CPN A;  5FIX A;  3RGB A;  4YM3 A;  1WD4 A;  5HXM A;  4KMQ A;  4YW4 A;  1ND2 B;  1LUL A;  4D6Q A;  1PMH X;  5LA2 A;  2EA7 A;  1H6X A;  1YHF A;  2EIC A;  4L0P A;  4QU2 A;  2RMU 1;  1H8V A;  3WUC A;  2WAO A;  3H50 A;  1R64 A;  4IW3 A;  5FP4 A;  3D5O A;  2HWB 3;  4JTN A;  4PLM A;  4XFG A;  1OLM E;  4GWN A;  4OZO A;  1U5X A;  4XC9 A;  4XMA A;  5DZG A;  1POV 3;  5FZO A;  4LKE A;  1PIV 2;  4OYU A;  1UZZ A;  2XB6 C;  4I0A A;  1UXZ A;  1HQW A;  1UX6 A;  4OLL A;  3Q8F A;  1I1E A;  4J25 A;  1EPW A;  4WM8 A;  3PIJ A;  2FDK A;  2GNT A;  4GB3 1;  2MEV 1;  4ATF A;  5IAX A;  1X33 A;  4P08 A;  1MQT C;  1AL0 G;  2O14 A;  3GBG A;  2ZXQ A;  1MS5 A;  2EXK A;  1KDK A; 
#chains in the Genus database with same CATH homology
 1W8T A;  1OKO A;  4LJH A;  2Q1F A;  2C24 A;  1W8U A;  4YW7 A;  4CP9 A;  4AL9 A;  4YWA A;  2KR2 A;  3ZYF A;  1WZX A;  1W90 A;  4BQ3 A;  5D21 A;  1W8Z A;  1GWK A;  1WMX A;  4A6S A;  4BQ4 A;  2WYF A;  2VXJ A;  1UOJ A;  1GWL A;  4CPB D;  4LKE A;  1OH3 A;  1V0A A;  1W8W A;  2LRO A;  4LKF A;  4YW6 A;  3ZYH A;  1W9F A;  3UT0 A;  2LRP A;  4BQ2 A;  4BQ5 A;  3F95 A;  1WCU A;  4CPB A;  1L7L A;  1HN0 A;  1GWM A;  2K46 A;  4LK7 A;  4CP9 B;  4LK6 A;  3ORJ A;  2O14 A;  3ZYB A;  2JWP A;  4LKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...