1OKSA

Crystal structure of the measles virus phosphoprotein xd domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
ASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLVKIIMKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Measles Virus Phosphoprotein Domain Responsible for the Induced Folding of the C-Terminal Domain of the Nucleoprotein
pubmed doi rcsb
source organism Measles virus
molecule tags Transferase
molecule keywords RNA POLYMERASE ALPHA SUBUNIT
total genus 15
structure length 53
sequence length 53
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1oksA00
4G3OA 1VDLA 2EKKA 1MN3A 2G3QA 2JY5A 2DAIA 2WZJA 2EJSA 1TTEA 2BWEA 1ZV1A 2HAKA 1BVSA 2LTUA 2ZTDA 3F92A 3H4JA 2L2DA 4UN2B 1IFYA 1NV9A 2R0IA 3FRHA 1ZMVA 1DO2A 5DFLA 4R71A 2JZ0A 2KNZA 1DV0A 1EFUB 3GLHE 2LVPC 2EKFA 1R4GA 2CWBA 2HWJA 1VEGA 4DBGB 3GLIE 1WR1B 1SG9A 3GLGE 2CP8A 2DAKA 1HT1E 1Y8GA 2JZ1A 2L4EA 1OQYA 2LBCA 2MJ5B 2L4FA 3GLFE 1PGYA 1IXSA 1A5TA 2ZTCA 1JR3E 2DHYA 3K9OA 2QSFX 2JP7A 1KYIA 1CUKA 2QNJA 2JY7A 1WJ7A 1DO0A 1G4AE 1NV8A 2JUJA 2LVOC 1ZMUA 3LCUA 3T6PA 4F1IA 1P3QQ 2DZLA 2MROB 3BBZA 1VEJA 1OKSA 2BWBA 1UFZA 2DAGA 2K0BX 4Q7JA 1XB2B 2DAEA 3FE3A 1WGLA 3E46A 1V92A 2DENA 2DKLA 2RRUA 3MMPA 2DAMA 1TR8A 1VEKA 2OOAA 3LCVB 1E94E 2H5XA 2KNVA 1VQ1A 2QHOB 3IECA 2LVNC 1OTRA 1F4IA 1QZEA 1WHCA 2K9DA 1T6OA 1VG5A 1WGNA 1YLAA 3E21A 3B89A 2JY6B 2O25A 1Q02A 1HJPA 2DNAA 1WIVA 2LVAA 1AIPC 2JNHA 4HEOA 1C7YA 2OO9A 2KHHA 2OOBA 2MGWA 1GO5A 2JY8A 2DI0A 1T43A 2B3TA 3FRIA 3K9PA 4F2LA 5JI2E 1HT2E 2LVQD 2KNAA 3IHPA 1OAIA 4GEWA 1G3IA 1XXHE 2MR9A 1HQYE 1IM2A 4WP2A 1ZMWA 1G41A
chains in the Genus database with same CATH superfamily
3D8BA 1MN3A 5KQ8A 3B7ZA 1FNNA 1OIPA 2DAIA 3GPXA 1I94M 2XSZA 4DUZM 1IN6A 4GC9A 2UXBM 3AKZA 1XC8A 3J80S 2F5NA 4MGYE 4NSOB 1BVSA 2ZTDA 1J09A 3SYKA 5EJCA 2L2DA 3THGA 3MJ5A 2N35A 2VDBB 2D7EA 1NV9A 2CUZA 3NBXX 5IREB 2R45A 4KLNA 4DV1M 3KOXE 3KP0E 5DFLA 1DGBA 3I01M 3VDUA 4D80A 2RGOA 3TWLA 1J7KA 1HNXM 2I7PA 2LVPC 2CV0A 1YE9A 2HWJA 4DBGB 3GLIE 4IBCA 3KOWE 1WR1B 1ZAEA 2RGHA 3WHLA 3SMPA 4B7GA 4I8OA 1HR0M 1V34A 1QAQA 5FLXS 3LW5F 1Y8GA 4Z6YA 4L16A 4DV7M 2Q2EB 4MGIE 1ZQ9A 3KSJA 2MH8A 3B9PA 4MB7A 2XZFA 3HWSA 3GPUA 2XLJA 2LXEA 3PFIA 1N34M 4LGMA 2QP9X 4NXNM 2C9CA 5FTNA 3SYLA 1PM5A 4AI6A 3LQQA 2QNJA 3UJNA 3SATA 4TUWA 3HGIA 3RE8A 4MM3B 3R9XB 1JR3D 4GKJM 1XNQM 1DO0A 5LMUM 2YNMD 1YUBA 2JUJA 4MGZE 3I51A 4JI0M 4B3TM 2J7NA 2EO2A 3TQSA 2XSZD 3HZJA 4DV0M 1P3QQ 2DZLA 1NHWC 3HJ8A 3VLFB 3PNVA 4DR3M 2M5ZA 1OKSA 3GLIB 3R8FA 2BWBA 2DAGA 4Q7JA 3MHVC 3KP1E 4R3DA 4G4OA 2DENA 2DAMA 1TR8A 2DWZB 2OOAA 1IN5A 3FD9A 5H37D 2D7HA 1NY5A 1WXQA 1E94E 4M0WA 4B3RM 1D2NA 3PVSA 3JR5A 4DV4M 3EIHA 2OPFA 3I4VA 3SBJA 2V1CA 4FWDA 3DA1A 5DYIA 1QZEA 1F4IA 1K3XA 4IJFA 2R44A 3E21A 4OVZA 3CF0A 4DUYM 4JN6A 2JY6B 4I4LA 3W0FA 4PDGA 3HX3A 4DV5M 5FTMA 3TPZA 1Z5BA 4OW0A 3KFUG 1WIVA 2XZUA 2UU9M 1IY0A 4GMQA 3GQ3A 1GL7A 5KPRA 1GL6A 2KHHA 4G6ZA 4JV5M 1GO5A 1TH4A 1DGHA 1T43A 2Y21A 3JAMS 1PJJA 1UM8A 2DHRA 4KHPM 2CRUA 2YFQA 4F2LA 1XMQM 4CGYB 1Z5CA 3FUUA 4S12A 2KNAA 4ANRA 3RGSA 1OAIA 4GEWA 1MU5A 4AG6A 2DVWB 2UUBM 1N33M 2NQ8C 2CEAA 2APLA 4NOOB 4LJ6A 4G4RA 4WP2A 1ZMWA 2ZM6M 3CGWA 3ZCBB 1G41A 1IXRC 3V76A 4G3OA 3LVWA 4KT0F 4Y28F 1S3SA 3TWKA 2G3QA 4BLCA 3KSXA 2JY5A 2WZJA 3TL4X 2ERCA 1L1ZA 4M9ZA 3SAUA 3VK7A 1Q39A 1R5LA 1TTEA 4IBBA 1ZV1A 4QNRA 2VQFM 3SMSA 4LF6M 4QOZC 5LMNM 1OFIA 3F92A 4LGYA 2BJWA 2DZNB 3FTCA 1NNUC 4UN2B 1Z6TA 2L09A 4YY3M 5ITYA 1DO2A 4L78A 3WHKA 4GHLA 2JZ0A 1XXHB 4GRIA 3UGJA 1SXJA 3B74A 1EFUB 3A42A 1E9SA 4DR6M 3U60A 3GQ4A 1DGHB 3C9PA 3KOZE 5ITTA 3NBIA 2CP8A 1H6UA 2DAKA 3GRRA 1NY6A 4Z8XA 2JZ1A 2LWXA 3OTOM 3IG8A 1KFVA 2WSEF 4LRSA 1D0MA 2LBCA 5KQDA 3AOEC 3SHFA 1GJTA 1QANA 2A5YB 4NRVA 4WURA 2KA6B 4MH0E 3UMMA 3GLFE 1PJIA 2F5PA 1IXSA 4RF1A 4X65M 2E5LM 4IBJA 3FKEA 5ITUA 1PJQA 5EQTA 2HL7A 2OQ4A 2M60A 3GQ5A 1WJ7A 4JXJA 3U5ZB 3BXWA 4FVMA 4JYAM 2LVOC 4IIWA 2BNKA 3AOEA 3QAUA 2DXIA 4I5SA 4LFAM 4F1IA 5FTLA 2HKJA 3GP1A 2MROB 1IN7A 1TH2A 3W0LB 5GKNA 3AL0C 4EIWA 1R2ZA 1QDTA 3FYDA 1UFZA 3GLHA 1GJSA 4GC5A 3U6QA 1QDRA 1QAMA 4PT5A 3B7NA 4M9SA 3LCVB 2FS1A 3FTFA 1V33A 1N78A 1QUSA 2CV2A 3PXGA 1JQJC 1OTRA 5BR8M 3U60B 4NL4H 1PRBA 1YLAA 2Y20A 3B89A 4LF4M 4LFCM 1SXJB 5IT9S 3C3EA 2O25A 2HCBA 1IBMM 2WSFF 1HJPA 4DR5M 2DNAA 5BPVA 3GLHB 3CTWB 3DFZA 4B3SM 1SXJD 4PCZA 1XHBA 1YSYA 4XK8F 1MJGM 4FCTA 1AIPC 3HKPA 1C7YA 2CE7A 2QBYB 2OO9A 4OX9M 1LV7A 4HL4A 1KSFX 2LHCA 4II7A 2MGWA 5EXXA 1R2YA 2YR0A 3K9PA 2C9OA 5C1BA 2QCUA 4GHAA 4RF0A 2Y0TA 1Z59A 2K47A 4LJ5A 2LVQD 3LMMA 3T1YM 1NJGA 1AUAA 3GPYA 1QZMA 3IG5A 2K6BA 3KXEC 1XWIA 1L2BA 2C98A 2QENA 8CATA 4DV3M 1HQYE 3UK6A 2RKOA 3VKGA 3T1HM 3L2AA 5ITXA 5EP1A 2AHMA 4MGKE 4QOSA 4K0KM 2XEPA 2Z8YM 3J81S 4JI4M 1VDLA 2EKKA 3T38A 3FYCA 4I81A 4HLQA 1NO1A 4LJAA 2J7OA 5FTKA 3C3DA 4FWGA 4JI3M 5FSWA 4OU7A 2BWEA 5A2QS 1L2CA 3KVWA 3Q8GA 2KDLA 2KXEA 4ZPXA 3W68A 5KPZA 4LG2A 2R0IA 1NJFA 3L25A 2O5RA 1OIZA 5DYGA 2KZUA 1NHGC 4L6V6 4R71A 3U6SA 3SASA 1DGFA 1IY1A 1DV0A 4DV2M 3VKHA 3GLHE 2X49A 4GITA 3UZUA 1OFHA 3FUTA 3JR4A 1G71A 1R4GA 2CWBA 2EKFA 2R65A 2R4JA 5EP4A 3U6DA 4DR7M 1EIJA 4D82A 1SG9A 3GLGE 3GLGB 3HJSA 2L4EA 1W5TA 4LZJA 1OQYA 5JI3E 1G59A 4LJ4A 1RU3A 2JWSA 2L4FA 2CFOA 4D81A 1GLNA 1NSFA 2Z4SA 2Z4RA 5DNYA 1J5EM 1JR3E 1IN4A 2DHYA 2GQFA 5IWAM 3K9OA 1GKIA 2WSCF 4CJ6A 2P5TA 4IBKA 3NWLA 4IBGA 1KYIA 2XF3A 1CUKA 2O01F 3FUVA 5KO3A 2I7NA 2G8LA 2CHVA 1G4AE 1NV8A 3J27B 3HU3A 1QVRA 3M7GA 1ZMUA 2FE8A 1QQWA 3QYEA 1I4WA 4IBIA 3LCUA 1L1TA 4DR4M 3EIEA 4QHTA 2G5GX 3T15A 1L8QA 3VDPA 4WW0A 3U6LA 2UXCM 3J2PB 1VEJA 3KOYE 1QYRA 2C5RA 4M9XA 1XB2B 3SARA 4P16A 2KW0A 3VFDA 4ITQA 2Z7JA 3E46A 1V92A 2RRUA 4DR1M 1VEKA 4RKUF 3HHWA 3K2LA 1EE8A 3LQRA 4M0DA 1VQ1A 3TE6A 2R46A 2QHOB 4AQYM 4AZFA 3ZQJA 4B08A 2GNOA 2ZANA 5EP2A 4PD2A 1GABA 1WHCA 2K9DA 1T6OA 1VG5A 3FTDA 3A46A 2R6FA 3C58A 4A3VB 5KPTA 4L8RC 4DR2M 3SAWA 2KZSA 4JI6M 3A98B 4LF9M 1IXSB 1DGGA 2LVAA 2UUAM 3ZH9B 4FCVA 4JI2M 1N32M 2X4AA 4L15A 1TGUA 2W82A 4HEOA 3L28A 1Q3CA 4X64M 3K8ZA 4MGHA 3HHXA 3SFZA 3HU2A 2B3TA 2H1RA 2R4EA 1NVMA 1OJLA 2R62A 1HT2E 3DZDA 3FUXA 4FCWA 2F5SA 5EP3A 1QAOA 1SXJE 3IHPA 3DOAA 4REZA 3SAVA 2UXDM 3BOSA 4KO8A 1JB0F 2MR9A 2VF8A 4X66M 3AJIB 4LFBM 4FWHA 2FH0A 2KRKA 3U6MA 3HHYA 4QNMA 1R7RA 4IBDA 4GKKM 3J7AS 4LY6A 3LVVA 4R7GA 1T3TA 2EJSA 2FOIC 2KRUA 1HNWM 4LF5M 3Q8XA 4IBEA 1G8PA 1HQCA 2HAKA 4XGIA 2QBYA 4P17A 2LTUA 2DWNA 2JXNA 3GRVA 4W5WA 3H4JA 1N75A 2EUCA 2ZAOA 3PNYA 1IFYA 2LHGA 4LJ9A 3U6PA 4NXMM 1MX0A 3FRHA 7CATA 3K92A 3L27A 1ZMVA 2CHGA 2KNZA 4JI8M 2XGNA 1IBKM 4NSRA 3RGPA 3U6OA 2VQEM 3KDSE 4LJ7A 3U6EA 3AOGA 3E4RA 4KODA 3GRYA 1VEGA 2C99A 5EXPA 2X8AA 3KS4A 1JR3A 3GO8A 3M0EA 2CV1A 1D0LA 1HT1E 4JI1M 4NRWA 2V1UA 4QHSA 1Q3BA 1IBLM 2L7IA 3ILKA 3CF2A 2MJ5B 1W5SA 2EA0A 2LH0A 1PGYA 3A45A 1A5TA 3E9SA 3ZC7B 4BB9A 2ZBKB 2ZTCA 4OVZB 3SC3A 3GLGA 4B7FA 2QSFX 2L6OA 1SXJC 2JP7A 1D0KA 3HHZA 1E9RA 2DWMA 2JA2A 2JY7A 2F5OA 5E26A 3AFHA 3U5ZA 1FJGM 1N77A 3L26A 3KS8A 3K1JA 1IY2A 3VK8A 2D7GA 1Z5AA 4AG5A 3T6PA 1GVNA 3BBZA 3CF6E 3I4YA 4FD2A 4AKIA 3GLIA 5E6JA 2L7HA 3RFWA 3M6AA 2K0BX 5EXSA 3FTEA 2DAEA 3KW6A 1XNRM 4LF8M 3HJQA 3B7QA 1XMOM 3L29A 3FE3A 1WGLA 3I04M 3MMPA 1OAOC 2DKLA 4NC6A 4AW4A 1K3WA 3MK6A 2F4VM 2Y0QA 2XFTA 2R18A 2H5XA 2ZAMA 2KNVA 5EXTA 2QZ4A 3HU1A 3IECA 1QUTA 2LVNC 5ITXE 1IQPA 3GPPA 3QWLA 4BBAA 4CIZA 2VF7A 2QPAA 3J7BA 1NNJA 2UUCM 1WGNA 4G4QA 3SHGB 1VDDA 5ITQA 4XBOA 4AKHA 2XFSA 1Q02A 2FNAA 4YHHM 2J5YA 2V6ZM 3H4MA 2QQ8A 2Z3XA 3GRUA 4G4NA 5FTJA 1E32A 4IBFA 1TDHA 4LZZA 4CISA 3FUWA 2DWLA 3U61A 1IXZA 2VIIA 1ORYB 4LF7M 4GIPA 1XXHA 4JI5M 4X62M 1X37A 2JNHA 4GH9A 1TDZA 1LTMA 3GLFB 4AKGA 5L8RF 1PJSA 3QYBA 4LJ8A 2OOBA 4B7HA 2XH9A 2DZOB 4DV6M 2JY8A 2DI0A 1K82A 1TF0B 3FRIA 1L2DA 1HNZM 2YQZA 5F3WA 5IZ7D 1IN8A 4LCBA 5C18A 5JI2E 3D8LA 1PJTA 4L4UA 2LNHC 3GLFA 2BJVA 1TH3A 2KEBA 3AV0A 3W67A 3TWMA 4RNAA 2F5QA 4JI7M 3HY5A 2CHQA 1N36M 4CHTB 4IJEA 4PDIA 3U6CA 4B3MM 1G3IA 1XXHE 3U61B 2FFJA 1IM2A 1C1KA 1R6BX 2HHHM 5ITRA 4FW9A 4LRTA 2C96A
chains in the Genus database with same CATH topology
4G3OA 1VDLA 2EKKA 1MN3A 2G3QA 2JY5A 2DAIA 2WZJA 2EJSA 1TTEA 2BWEA 1ZV1A 2HAKA 1BVSA 2LTUA 2ZTDA 3F92A 3H4JA 2L2DA 4UN2B 1IFYA 1NV9A 2R0IA 3FRHA 1ZMVA 1DO2A 5DFLA 4R71A 2JZ0A 2KNZA 1DV0A 1EFUB 3GLHE 2LVPC 2EKFA 1R4GA 2CWBA 2HWJA 1VEGA 4DBGB 3GLIE 1WR1B 1SG9A 3GLGE 2CP8A 2DAKA 1HT1E 1Y8GA 2JZ1A 2L4EA 1OQYA 2LBCA 2MJ5B 2L4FA 3GLFE 1PGYA 1IXSA 1A5TA 2ZTCA 1JR3E 2DHYA 3K9OA 2QSFX 2JP7A 1KYIA 1CUKA 2QNJA 2JY7A 1WJ7A 1DO0A 1G4AE 1NV8A 2JUJA 2LVOC 1ZMUA 3LCUA 3T6PA 4F1IA 1P3QQ 2DZLA 2MROB 3BBZA 1VEJA 1OKSA 2BWBA 1UFZA 2DAGA 2K0BX 4Q7JA 1XB2B 2DAEA 3FE3A 1WGLA 3E46A 1V92A 2DENA 2DKLA 2RRUA 3MMPA 2DAMA 1TR8A 1VEKA 2OOAA 3LCVB 1E94E 2H5XA 2KNVA 1VQ1A 2QHOB 3IECA 2LVNC 1OTRA 1F4IA 1QZEA 1WHCA 2K9DA 1T6OA 1VG5A 1WGNA 1YLAA 3E21A 3B89A 2JY6B 2O25A 1Q02A 1HJPA 2DNAA 1WIVA 2LVAA 1AIPC 2JNHA 4HEOA 1C7YA 2OO9A 2KHHA 2OOBA 2MGWA 1GO5A 2JY8A 2DI0A 1T43A 2B3TA 3FRIA 3K9PA 4F2LA 5JI2E 1HT2E 2LVQD 2KNAA 3IHPA 1OAIA 4GEWA 1G3IA 1XXHE 2MR9A 1HQYE 1IM2A 4WP2A 1ZMWA 1G41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G3O A;  1VDL A;  2EKK A;  1MN3 A;  2G3Q A;  2JY5 A;  2DAI A;  2WZJ A;  2EJS A;  1TTE A;  2BWE A;  1ZV1 A;  2HAK A;  1BVS A;  2LTU A;  2ZTD A;  3F92 A;  3H4J A;  2L2D A;  4UN2 B;  1IFY A;  1NV9 A;  2R0I A;  3FRH A;  1ZMV A;  1DO2 A;  5DFL A;  4R71 A;  2JZ0 A;  2KNZ A;  1DV0 A;  1EFU B;  3GLH E;  2LVP C;  2EKF A;  1R4G A;  2CWB A;  2HWJ A;  1VEG A;  4DBG B;  3GLI E;  1WR1 B;  1SG9 A;  3GLG E;  2CP8 A;  2DAK A;  1HT1 E;  1Y8G A;  2JZ1 A;  2L4E A;  1OQY A;  2LBC A;  2MJ5 B;  2L4F A;  3GLF E;  1PGY A;  1IXS A;  1A5T A;  2ZTC A;  1JR3 E;  2DHY A;  3K9O A;  2QSF X;  2JP7 A;  1KYI A;  1CUK A;  2QNJ A;  2JY7 A;  1WJ7 A;  1DO0 A;  1G4A E;  1NV8 A;  2JUJ A;  2LVO C;  1ZMU A;  3LCU A;  3T6P A;  4F1I A;  1P3Q Q;  2DZL A;  2MRO B;  3BBZ A;  1VEJ A;  1OKS A;  2BWB A;  1UFZ A;  2DAG A;  2K0B X;  4Q7J A;  1XB2 B;  2DAE A;  3FE3 A;  1WGL A;  3E46 A;  1V92 A;  2DEN A;  2DKL A;  2RRU A;  3MMP A;  2DAM A;  1TR8 A;  1VEK A;  2OOA A;  3LCV B;  1E94 E;  2H5X A;  2KNV A;  1VQ1 A;  2QHO B;  3IEC A;  2LVN C;  1OTR A;  1F4I A;  1QZE A;  1WHC A;  2K9D A;  1T6O A;  1VG5 A;  1WGN A;  1YLA A;  3E21 A;  3B89 A;  2JY6 B;  2O25 A;  1Q02 A;  1HJP A;  2DNA A;  1WIV A;  2LVA A;  1AIP C;  2JNH A;  4HEO A;  1C7Y A;  2OO9 A;  2KHH A;  2OOB A;  2MGW A;  1GO5 A;  2JY8 A;  2DI0 A;  1T43 A;  2B3T A;  3FRI A;  3K9P A;  4F2L A;  5JI2 E;  1HT2 E;  2LVQ D;  2KNA A;  3IHP A;  1OAI A;  4GEW A;  1G3I A;  1XXH E;  2MR9 A;  1HQY E;  1IM2 A;  4WP2 A;  1ZMW A;  1G41 A; 
#chains in the Genus database with same CATH topology
 3D8B A;  1MN3 A;  5KQ8 A;  3B7Z A;  1FNN A;  1OIP A;  2DAI A;  3GPX A;  1I94 M;  2XSZ A;  4DUZ M;  1IN6 A;  4GC9 A;  2UXB M;  3AKZ A;  1XC8 A;  3J80 S;  2F5N A;  4MGY E;  4NSO B;  1BVS A;  2ZTD A;  1J09 A;  3SYK A;  5EJC A;  2L2D A;  3THG A;  3MJ5 A;  2N35 A;  2VDB B;  2D7E A;  1NV9 A;  2CUZ A;  3NBX X;  5IRE B;  2R45 A;  4KLN A;  4DV1 M;  3KOX E;  3KP0 E;  5DFL A;  1DGB A;  3I01 M;  3VDU A;  4D80 A;  2RGO A;  3TWL A;  1J7K A;  1HNX M;  2I7P A;  2LVP C;  2CV0 A;  1YE9 A;  2HWJ A;  4DBG B;  3GLI E;  4IBC A;  3KOW E;  1WR1 B;  1ZAE A;  2RGH A;  3WHL A;  3SMP A;  4B7G A;  4I8O A;  1HR0 M;  1V34 A;  1QAQ A;  5FLX S;  3LW5 F;  1Y8G A;  4Z6Y A;  4L16 A;  4DV7 M;  2Q2E B;  4MGI E;  1ZQ9 A;  3KSJ A;  2MH8 A;  3B9P A;  4MB7 A;  2XZF A;  3HWS A;  3GPU A;  2XLJ A;  2LXE A;  3PFI A;  1N34 M;  4LGM A;  2QP9 X;  4NXN M;  2C9C A;  5FTN A;  3SYL A;  1PM5 A;  4AI6 A;  3LQQ A;  2QNJ A;  3UJN A;  3SAT A;  4TUW A;  3HGI A;  3RE8 A;  4MM3 B;  3R9X B;  1JR3 D;  4GKJ M;  1XNQ M;  1DO0 A;  5LMU M;  2YNM D;  1YUB A;  2JUJ A;  4MGZ E;  3I51 A;  4JI0 M;  4B3T M;  2J7N A;  2EO2 A;  3TQS A;  2XSZ D;  3HZJ A;  4DV0 M;  1P3Q Q;  2DZL A;  1NHW C;  3HJ8 A;  3VLF B;  3PNV A;  4DR3 M;  2M5Z A;  1OKS A;  3GLI B;  3R8F A;  2BWB A;  2DAG A;  4Q7J A;  3MHV C;  3KP1 E;  4R3D A;  4G4O A;  2DEN A;  2DAM A;  1TR8 A;  2DWZ B;  2OOA A;  1IN5 A;  3FD9 A;  5H37 D;  2D7H A;  1NY5 A;  1WXQ A;  1E94 E;  4M0W A;  4B3R M;  1D2N A;  3PVS A;  3JR5 A;  4DV4 M;  3EIH A;  2OPF A;  3I4V A;  3SBJ A;  2V1C A;  4FWD A;  3DA1 A;  5DYI A;  1QZE A;  1F4I A;  1K3X A;  4IJF A;  2R44 A;  3E21 A;  4OVZ A;  3CF0 A;  4DUY M;  4JN6 A;  2JY6 B;  4I4L A;  3W0F A;  4PDG A;  3HX3 A;  4DV5 M;  5FTM A;  3TPZ A;  1Z5B A;  4OW0 A;  3KFU G;  1WIV A;  2XZU A;  2UU9 M;  1IY0 A;  4GMQ A;  3GQ3 A;  1GL7 A;  5KPR A;  1GL6 A;  2KHH A;  4G6Z A;  4JV5 M;  1GO5 A;  1TH4 A;  1DGH A;  1T43 A;  2Y21 A;  3JAM S;  1PJJ A;  1UM8 A;  2DHR A;  4KHP M;  2CRU A;  2YFQ A;  4F2L A;  1XMQ M;  4CGY B;  1Z5C A;  3FUU A;  4S12 A;  2KNA A;  4ANR A;  3RGS A;  1OAI A;  4GEW A;  1MU5 A;  4AG6 A;  2DVW B;  2UUB M;  1N33 M;  2NQ8 C;  2CEA A;  2APL A;  4NOO B;  4LJ6 A;  4G4R A;  4WP2 A;  1ZMW A;  2ZM6 M;  3CGW A;  3ZCB B;  1G41 A;  1IXR C;  3V76 A;  4G3O A;  3LVW A;  4KT0 F;  4Y28 F;  1S3S A;  3TWK A;  2G3Q A;  4BLC A;  3KSX A;  2JY5 A;  2WZJ A;  3TL4 X;  2ERC A;  1L1Z A;  4M9Z A;  3SAU A;  3VK7 A;  1Q39 A;  1R5L A;  1TTE A;  4IBB A;  1ZV1 A;  4QNR A;  2VQF M;  3SMS A;  4LF6 M;  4QOZ C;  5LMN M;  1OFI A;  3F92 A;  4LGY A;  2BJW A;  2DZN B;  3FTC A;  1NNU C;  4UN2 B;  1Z6T A;  2L09 A;  4YY3 M;  5ITY A;  1DO2 A;  4L78 A;  3WHK A;  4GHL A;  2JZ0 A;  1XXH B;  4GRI A;  3UGJ A;  1SXJ A;  3B74 A;  1EFU B;  3A42 A;  1E9S A;  4DR6 M;  3U60 A;  3GQ4 A;  1DGH B;  3C9P A;  3KOZ E;  5ITT A;  3NBI A;  2CP8 A;  1H6U A;  2DAK A;  3GRR A;  1NY6 A;  4Z8X A;  2JZ1 A;  2LWX A;  3OTO M;  3IG8 A;  1KFV A;  2WSE F;  4LRS A;  1D0M A;  2LBC A;  5KQD A;  3AOE C;  3SHF A;  1GJT A;  1QAN A;  2A5Y B;  4NRV A;  4WUR A;  2KA6 B;  4MH0 E;  3UMM A;  3GLF E;  1PJI A;  2F5P A;  1IXS A;  4RF1 A;  4X65 M;  2E5L M;  4IBJ A;  3FKE A;  5ITU A;  1PJQ A;  5EQT A;  2HL7 A;  2OQ4 A;  2M60 A;  3GQ5 A;  1WJ7 A;  4JXJ A;  3U5Z B;  3BXW A;  4FVM A;  4JYA M;  2LVO C;  4IIW A;  2BNK A;  3AOE A;  3QAU A;  2DXI A;  4I5S A;  4LFA M;  4F1I A;  5FTL A;  2HKJ A;  3GP1 A;  2MRO B;  1IN7 A;  1TH2 A;  3W0L B;  5GKN A;  3AL0 C;  4EIW A;  1R2Z A;  1QDT A;  3FYD A;  1UFZ A;  3GLH A;  1GJS A;  4GC5 A;  3U6Q A;  1QDR A;  1QAM A;  4PT5 A;  3B7N A;  4M9S A;  3LCV B;  2FS1 A;  3FTF A;  1V33 A;  1N78 A;  1QUS A;  2CV2 A;  3PXG A;  1JQJ C;  1OTR A;  5BR8 M;  3U60 B;  4NL4 H;  1PRB A;  1YLA A;  2Y20 A;  3B89 A;  4LF4 M;  4LFC M;  1SXJ B;  5IT9 S;  3C3E A;  2O25 A;  2HCB A;  1IBM M;  2WSF F;  1HJP A;  4DR5 M;  2DNA A;  5BPV A;  3GLH B;  3CTW B;  3DFZ A;  4B3S M;  1SXJ D;  4PCZ A;  1XHB A;  1YSY A;  4XK8 F;  1MJG M;  4FCT A;  1AIP C;  3HKP A;  1C7Y A;  2CE7 A;  2QBY B;  2OO9 A;  4OX9 M;  1LV7 A;  4HL4 A;  1KSF X;  2LHC A;  4II7 A;  2MGW A;  5EXX A;  1R2Y A;  2YR0 A;  3K9P A;  2C9O A;  5C1B A;  2QCU A;  4GHA A;  4RF0 A;  2Y0T A;  1Z59 A;  2K47 A;  4LJ5 A;  2LVQ D;  3LMM A;  3T1Y M;  1NJG A;  1AUA A;  3GPY A;  1QZM A;  3IG5 A;  2K6B A;  3KXE C;  1XWI A;  1L2B A;  2C98 A;  2QEN A;  8CAT A;  4DV3 M;  1HQY E;  3UK6 A;  2RKO A;  3VKG A;  3T1H M;  3L2A A;  5ITX A;  5EP1 A;  2AHM A;  4MGK E;  4QOS A;  4K0K M;  2XEP A;  2Z8Y M;  3J81 S;  4JI4 M;  1VDL A;  2EKK A;  3T38 A;  3FYC A;  4I81 A;  4HLQ A;  1NO1 A;  4LJA A;  2J7O A;  5FTK A;  3C3D A;  4FWG A;  4JI3 M;  5FSW A;  4OU7 A;  2BWE A;  5A2Q S;  1L2C A;  3KVW A;  3Q8G A;  2KDL A;  2KXE A;  4ZPX A;  3W68 A;  5KPZ A;  4LG2 A;  2R0I A;  1NJF A;  3L25 A;  2O5R A;  1OIZ A;  5DYG A;  2KZU A;  1NHG C;  4L6V 6;  4R71 A;  3U6S A;  3SAS A;  1DGF A;  1IY1 A;  1DV0 A;  4DV2 M;  3VKH A;  3GLH E;  2X49 A;  4GIT A;  3UZU A;  1OFH A;  3FUT A;  3JR4 A;  1G71 A;  1R4G A;  2CWB A;  2EKF A;  2R65 A;  2R4J A;  5EP4 A;  3U6D A;  4DR7 M;  1EIJ A;  4D82 A;  1SG9 A;  3GLG E;  3GLG B;  3HJS A;  2L4E A;  1W5T A;  4LZJ A;  1OQY A;  5JI3 E;  1G59 A;  4LJ4 A;  1RU3 A;  2JWS A;  2L4F A;  2CFO A;  4D81 A;  1GLN A;  1NSF A;  2Z4S A;  2Z4R A;  5DNY A;  1J5E M;  1JR3 E;  1IN4 A;  2DHY A;  2GQF A;  5IWA M;  3K9O A;  1GKI A;  2WSC F;  4CJ6 A;  2P5T A;  4IBK A;  3NWL A;  4IBG A;  1KYI A;  2XF3 A;  1CUK A;  2O01 F;  3FUV A;  5KO3 A;  2I7N A;  2G8L A;  2CHV A;  1G4A E;  1NV8 A;  3J27 B;  3HU3 A;  1QVR A;  3M7G A;  1ZMU A;  2FE8 A;  1QQW A;  3QYE A;  1I4W A;  4IBI A;  3LCU A;  1L1T A;  4DR4 M;  3EIE A;  4QHT A;  2G5G X;  3T15 A;  1L8Q A;  3VDP A;  4WW0 A;  3U6L A;  2UXC M;  3J2P B;  1VEJ A;  3KOY E;  1QYR A;  2C5R A;  4M9X A;  1XB2 B;  3SAR A;  4P16 A;  2KW0 A;  3VFD A;  4ITQ A;  2Z7J A;  3E46 A;  1V92 A;  2RRU A;  4DR1 M;  1VEK A;  4RKU F;  3HHW A;  3K2L A;  1EE8 A;  3LQR A;  4M0D A;  1VQ1 A;  3TE6 A;  2R46 A;  2QHO B;  4AQY M;  4AZF A;  3ZQJ A;  4B08 A;  2GNO A;  2ZAN A;  5EP2 A;  4PD2 A;  1GAB A;  1WHC A;  2K9D A;  1T6O A;  1VG5 A;  3FTD A;  3A46 A;  2R6F A;  3C58 A;  4A3V B;  5KPT A;  4L8R C;  4DR2 M;  3SAW A;  2KZS A;  4JI6 M;  3A98 B;  4LF9 M;  1IXS B;  1DGG A;  2LVA A;  2UUA M;  3ZH9 B;  4FCV A;  4JI2 M;  1N32 M;  2X4A A;  4L15 A;  1TGU A;  2W82 A;  4HEO A;  3L28 A;  1Q3C A;  4X64 M;  3K8Z A;  4MGH A;  3HHX A;  3SFZ A;  3HU2 A;  2B3T A;  2H1R A;  2R4E A;  1NVM A;  1OJL A;  2R62 A;  1HT2 E;  3DZD A;  3FUX A;  4FCW A;  2F5S A;  5EP3 A;  1QAO A;  1SXJ E;  3IHP A;  3DOA A;  4REZ A;  3SAV A;  2UXD M;  3BOS A;  4KO8 A;  1JB0 F;  2MR9 A;  2VF8 A;  4X66 M;  3AJI B;  4LFB M;  4FWH A;  2FH0 A;  2KRK A;  3U6M A;  3HHY A;  4QNM A;  1R7R A;  4IBD A;  4GKK M;  3J7A S;  4LY6 A;  3LVV A;  4R7G A;  1T3T A;  2EJS A;  2FOI C;  2KRU A;  1HNW M;  4LF5 M;  3Q8X A;  4IBE A;  1G8P A;  1HQC A;  2HAK A;  4XGI A;  2QBY A;  4P17 A;  2LTU A;  2DWN A;  2JXN A;  3GRV A;  4W5W A;  3H4J A;  1N75 A;  2EUC A;  2ZAO A;  3PNY A;  1IFY A;  2LHG A;  4LJ9 A;  3U6P A;  4NXM M;  1MX0 A;  3FRH A;  7CAT A;  3K92 A;  3L27 A;  1ZMV A;  2CHG A;  2KNZ A;  4JI8 M;  2XGN A;  1IBK M;  4NSR A;  3RGP A;  3U6O A;  2VQE M;  3KDS E;  4LJ7 A;  3U6E A;  3AOG A;  3E4R A;  4KOD A;  3GRY A;  1VEG A;  2C99 A;  5EXP A;  2X8A A;  3KS4 A;  1JR3 A;  3GO8 A;  3M0E A;  2CV1 A;  1D0L A;  1HT1 E;  4JI1 M;  4NRW A;  2V1U A;  4QHS A;  1Q3B A;  1IBL M;  2L7I A;  3ILK A;  3CF2 A;  2MJ5 B;  1W5S A;  2EA0 A;  2LH0 A;  1PGY A;  3A45 A;  1A5T A;  3E9S A;  3ZC7 B;  4BB9 A;  2ZBK B;  2ZTC A;  4OVZ B;  3SC3 A;  3GLG A;  4B7F A;  2QSF X;  2L6O A;  1SXJ C;  2JP7 A;  1D0K A;  3HHZ A;  1E9R A;  2DWM A;  2JA2 A;  2JY7 A;  2F5O A;  5E26 A;  3AFH A;  3U5Z A;  1FJG M;  1N77 A;  3L26 A;  3KS8 A;  3K1J A;  1IY2 A;  3VK8 A;  2D7G A;  1Z5A A;  4AG5 A;  3T6P A;  1GVN A;  3BBZ A;  3CF6 E;  3I4Y A;  4FD2 A;  4AKI A;  3GLI A;  5E6J A;  2L7H A;  3RFW A;  3M6A A;  2K0B X;  5EXS A;  3FTE A;  2DAE A;  3KW6 A;  1XNR M;  4LF8 M;  3HJQ A;  3B7Q A;  1XMO M;  3L29 A;  3FE3 A;  1WGL A;  3I04 M;  3MMP A;  1OAO C;  2DKL A;  4NC6 A;  4AW4 A;  1K3W A;  3MK6 A;  2F4V M;  2Y0Q A;  2XFT A;  2R18 A;  2H5X A;  2ZAM A;  2KNV A;  5EXT A;  2QZ4 A;  3HU1 A;  3IEC A;  1QUT A;  2LVN C;  5ITX E;  1IQP A;  3GPP A;  3QWL A;  4BBA A;  4CIZ A;  2VF7 A;  2QPA A;  3J7B A;  1NNJ A;  2UUC M;  1WGN A;  4G4Q A;  3SHG B;  1VDD A;  5ITQ A;  4XBO A;  4AKH A;  2XFS A;  1Q02 A;  2FNA A;  4YHH M;  2J5Y A;  2V6Z M;  3H4M A;  2QQ8 A;  2Z3X A;  3GRU A;  4G4N A;  5FTJ A;  1E32 A;  4IBF A;  1TDH A;  4LZZ A;  4CIS A;  3FUW A;  2DWL A;  3U61 A;  1IXZ A;  2VII A;  1ORY B;  4LF7 M;  4GIP A;  1XXH A;  4JI5 M;  4X62 M;  1X37 A;  2JNH A;  4GH9 A;  1TDZ A;  1LTM A;  3GLF B;  4AKG A;  5L8R F;  1PJS A;  3QYB A;  4LJ8 A;  2OOB A;  4B7H A;  2XH9 A;  2DZO B;  4DV6 M;  2JY8 A;  2DI0 A;  1K82 A;  1TF0 B;  3FRI A;  1L2D A;  1HNZ M;  2YQZ A;  5F3W A;  5IZ7 D;  1IN8 A;  4LCB A;  5C18 A;  5JI2 E;  3D8L A;  1PJT A;  4L4U A;  2LNH C;  3GLF A;  2BJV A;  1TH3 A;  2KEB A;  3AV0 A;  3W67 A;  3TWM A;  4RNA A;  2F5Q A;  4JI7 M;  3HY5 A;  2CHQ A;  1N36 M;  4CHT B;  4IJE A;  4PDI A;  3U6C A;  4B3M M;  1G3I A;  1XXH E;  3U61 B;  2FFJ A;  1IM2 A;  1C1K A;  1R6B X;  2HHH M;  5ITR A;  4FW9 A;  4LRT A;  2C96 A; 
#chains in the Genus database with same CATH homology
 4G3O A;  1VDL A;  2EKK A;  1MN3 A;  2G3Q A;  2JY5 A;  2DAI A;  2WZJ A;  2EJS A;  1TTE A;  2BWE A;  1ZV1 A;  2HAK A;  1BVS A;  2LTU A;  2ZTD A;  3F92 A;  3H4J A;  2L2D A;  4UN2 B;  1IFY A;  1NV9 A;  2R0I A;  3FRH A;  1ZMV A;  1DO2 A;  5DFL A;  4R71 A;  2JZ0 A;  2KNZ A;  1DV0 A;  1EFU B;  3GLH E;  2LVP C;  2EKF A;  1R4G A;  2CWB A;  2HWJ A;  1VEG A;  4DBG B;  3GLI E;  1WR1 B;  1SG9 A;  3GLG E;  2CP8 A;  2DAK A;  1HT1 E;  1Y8G A;  2JZ1 A;  2L4E A;  1OQY A;  2LBC A;  2MJ5 B;  2L4F A;  3GLF E;  1PGY A;  1IXS A;  1A5T A;  2ZTC A;  1JR3 E;  2DHY A;  3K9O A;  2QSF X;  2JP7 A;  1KYI A;  1CUK A;  2QNJ A;  2JY7 A;  1WJ7 A;  1DO0 A;  1G4A E;  1NV8 A;  2JUJ A;  2LVO C;  1ZMU A;  3LCU A;  3T6P A;  4F1I A;  1P3Q Q;  2DZL A;  2MRO B;  3BBZ A;  1VEJ A;  1OKS A;  2BWB A;  1UFZ A;  2DAG A;  2K0B X;  4Q7J A;  1XB2 B;  2DAE A;  3FE3 A;  1WGL A;  3E46 A;  1V92 A;  2DEN A;  2DKL A;  2RRU A;  3MMP A;  2DAM A;  1TR8 A;  1VEK A;  2OOA A;  3LCV B;  1E94 E;  2H5X A;  2KNV A;  1VQ1 A;  2QHO B;  3IEC A;  2LVN C;  1OTR A;  1F4I A;  1QZE A;  1WHC A;  2K9D A;  1T6O A;  1VG5 A;  1WGN A;  1YLA A;  3E21 A;  3B89 A;  2JY6 B;  2O25 A;  1Q02 A;  1HJP A;  2DNA A;  1WIV A;  2LVA A;  1AIP C;  2JNH A;  4HEO A;  1C7Y A;  2OO9 A;  2KHH A;  2OOB A;  2MGW A;  1GO5 A;  2JY8 A;  2DI0 A;  1T43 A;  2B3T A;  3FRI A;  3K9P A;  4F2L A;  5JI2 E;  1HT2 E;  2LVQ D;  2KNA A;  3IHP A;  1OAI A;  4GEW A;  1G3I A;  1XXH E;  2MR9 A;  1HQY E;  1IM2 A;  4WP2 A;  1ZMW A;  1G41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...