1OKSA

Crystal structure of the measles virus phosphoprotein xd domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
ASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLVKIIMKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA POLYMERASE ALPHA SUBUNIT
publication title Crystal Structure of the Measles Virus Phosphoprotein Domain Responsible for the Induced Folding of the C-Terminal Domain of the Nucleoprotein
pubmed doi rcsb
source organism Measles virus
molecule tags Transferase
total genus 15
structure length 53
sequence length 53
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1oksA00
1VEKA 2MR9A 2JZ0A 1ZMWA 2JUJA 3K9OA 2HAKA 1JR3E 2LVAA 4GEWA 1C7YA 2DENA 1HJPA 1DV0A 2MGWA 2KHHA 2JZ1A 1G4AE 1VDLA 1G41A 2O25A 4F2LA 1OTRA 1QZEA 2QNJA 1DO2A 1T6OA 2MROB 2LVQD 2L4FA 1E94E 2EKFA 2K0BX 2CP8A 1DO0A 2JY8A 1HQYE 1ZMVA 3IHPA 3F92A 2QHOB 1GO5A 2KNAA 4WP2A 5DFLA 4R71A 1SG9A 4HEOA 2JNHA 2ZTDA 2KNZA 3LCVB 3FRHA 1NV8A 1KYIA 1WR1B 2JY7A 1VQ1A 3IECA 2H5XA 2OO9A 3H4JA 1ZV1A 1NV9A 2LVNC 3MMPA 1WGNA 3GLIE 3FRIA 1IFYA 1Q02A 1OAIA 3GLGE 2JP7A 2LVPC 1WHCA 2QSFX 1MN3A 1WJ7A 3E21A 4F1IA 2OOAA 3T6PA 5JI2E 1T43A 1XXHE 2MJ5B 2DAMA 3BBZA 2DAGA 2B3TA 2DKLA 2BWEA 2BWBA 2DAKA 2KNVA 3LCUA 4UN2B 1Y8GA 1OQYA 2DZLA 2EJSA 3GLHE 2WZJA 2L4EA 3E46A 2JY5A 1R4GA 2LBCA 3K9PA 1P3QQ 2CWBA 1BVSA 2R0IA 1TR8A 2ZTCA 2DHYA 2OOBA 2L2DA 1CUKA 4G3OA 1F4IA 1A5TA 1AIPC 3FE3A 2LVOC 2DNAA 1HT2E 1XB2B 2LTUA 1IM2A 1IXSA 2HWJA 4DBGB 1HT1E 1PGYA 1ZMUA 1OKSA 3GLFE 2RRUA 1UFZA 2DI0A 1EFUB 2EKKA 4Q7JA 1VG5A 1VEJA 1V92A 1WGLA 2JY6B 1G3IA 2K9DA 2DAIA 1VEGA 1WIVA 1YLAA 1TTEA 2G3QA 2DAEA 3B89A
chains in the Genus database with same CATH superfamily
4AQYM 2N35A 4M9XA 3HHXA 4MH0E 2LH0A 5EP4A 2L6OA 4JI0M 1IN6A 2KHHA 1G4AE 4L4UA 2DZOB 3TL4X 5BPVA 3GLFB 3QAUA 2HKJA 2J5YA 4LGMA 1VDLA 1K3WA 5EQTA 4LFCM 1G71A 3M0EA 3FUXA 3IG5A 3GP1A 4JI3M 1NHWC 4OU7A 1E94E 2Z8YM 2ERCA 5L8RF 2Y0TA 3A42A 3GRVA 5EXTA 2GNOA 2CP8A 1DO0A 2RGHA 2CEAA 3CF6E 2CFOA 3KXEC 4Y28F 2QHOB 4DV1M 2I7PA 2X4AA 4CISA 1I94M 1GO5A 4WP2A 3NWLA 5C1BA 2GQFA 3SAVA 4R71A 1GL7A 4QNMA 3J2PB 5DYGA 4LRSA 4LZJA 4DV6M 2Z4SA 2R65A 2L09A 4NSOB 2LNHC 4I81A 3RE8A 2H5XA 4DUYM 3U61B 4FVMA 4GC9A 3GLIE 1SXJB 2VF7A 4IJFA 2KEBA 3IG8A 4G6ZA 4DV4M 4IBJA 1QYRA 3VK7A 2R4JA 1Q39A 3KDSE 2JP7A 3FYDA 4L16A 1WHCA 2QSFX 2CHGA 3KP0E 3WHKA 5H37D 4GHLA 1TGUA 4LGYA 4PDGA 1N75A 2VF8A 4GIPA 4FD2A 2WSEF 2C9CA 3U6MA 2OOAA 2V1CA 1L2CA 1XXHE 4B3SM 2K47A 2LHGA 4YY3M 3LVWA 3BBZA 3GLIA 2KZUA 3PVSA 3HU2A 5GKNA 2DKLA 2Q2EB 4UN2B 5EJCA 2ZM6M 1LTMA 4OW0A 1OIPA 5JI3E 1FJGM 2HCBA 4NSRA 3J7BA 4DV5M 3GLHE 3T1HM 4IJEA 3FUVA 4M0WA 4L15A 3ZH9B 4B3TM 2V6ZM 2JY5A 4KO8A 4W5WA 3GRYA 3ZC7B 2QPAA 4REZA 3SAUA 1BVSA 3HU1A 5FTJA 1IXSB 3R9XB 2JWSA 2R44A 3TWKA 4II7A 2O5RA 3U5ZA 2OOBA 4IIWA 4TUWA 2QBYA 1OJLA 3A98B 3K1JA 3A45A 3PNVA 3A46A 4AW4A 4DV7M 4JI4M 1F4IA 4QHSA 4X62M 1PJQA 3FE3A 4LF6M 3SBJA 4LF7M 3SHFA 1I4WA 2KA6B 3CF2A 4AKGA 1NY5A 4MGZE 2R4EA 4QNRA 1E32A 2LTUA 1IM2A 3RFWA 3T15A 4DR1M 1J7KA 1HT1E 1PGYA 1ZMUA 2WSCF 4CJ6A 3SMSA 2C96A 2O01F 2F5PA 1R5LA 1UFZA 3HHYA 2EO2A 1Q3CA 3UJNA 2KDLA 4Q7JA 3VDUA 4AI6A 2C9OA 2UUBM 3AL0C 4GC5A 2CE7A 4M9ZA 2EA0A 1G3IA 5FTMA 3SFZA 2KRKA 2KZSA 4MGYE 1NO1A 2XFTA 1GL6A 1OAOC 5ITYA 1XMOM 4L8RC 1Z6TA 1TTEA 2JA2A 2ZAMA 4FCTA 4FCVA 2J7NA 4B3RM 2VQFM 4IBGA 4L78A 3LVVA 4RF0A 1NHGC 3K9OA 1Q3BA 1JR3E 2LVAA 3JAMS 1N32M 1HJPA 4LY6A 1Z59A 2JZ1A 4NC6A 1DGHA 3QWLA 4LCBA 1LV7A 1TF0B 3MJ5A 1N34M 1OIZA 4F2LA 1QZEA 2QNJA 1NNJA 5IZ7D 1T6OA 2VIIA 4ITQA 1QAOA 1XNQM 2R46A 2YNMD 2DWLA 2K0BX 1JR3A 4LJAA 3GQ3A 3C9PA 4KHPM 5EP1A 3C58A 3M6AA 2KNAA 2XZUA 5IWAM 4MGKE 5ITRA 2V1UA 1S3SA 5DFLA 4ANRA 5KO3A 2C98A 3SHGB 3KP1E 4DV0M 1PRBA 1L1TA 1IBMM 1NJFA 3KOZE 1WR1B 1L2DA 4AG5A 2ZBKB 3IECA 4OX9M 3H4JA 1ZV1A 3GPPA 4MB7A 3TWLA 4AKIA 3GPXA 2EUCA 2J7OA 1WGNA 3SAWA 3D8BA 5ITXE 4YHHM 3HGIA 3T1YM 1W5SA 2BJVA 3V76A 4BLCA 3GLGE 2LVPC 2OQ4A 1QUSA 4MGIE 3VK8A 4LFBM 2D7GA 4XGIA 3T6PA 5EP2A 5JI2E 3L26A 4JI2M 1NSFA 4RNAA 3B7NA 5FTNA 2UXBM 4LJ7A 1GJTA 2UXCM 1V33A 5ITXA 5KPRA 3VKHA 3SYLA 2BWEA 4XBOA 2DAKA 3HWSA 4L6V6 4LJ8A 2QBYB 1Y8GA 4DR6M 2Z4RA 4B7FA 2EJSA 2R62A 4M0DA 2F5NA 3RGPA 4FWGA 3U60B 1HNXM 4PD2A 1PJSA 2XLJA 1R4GA 1YUBA 2VDBB 1TDZA 3TPZA 1Z5CA 4DR5M 4G4QA 1Z5AA 3I4YA 4NXNM 3LQRA 7CATA 1TH4A 2CRUA 4NRVA 1TR8A 4LJ5A 4DR7M 3BXWA 2DHYA 4HL4A 2OPFA 1IN8A 1WXQA 4R3DA 4LFAM 2L2DA 2QQ8A 3ZQJA 1CUKA 1DGBA 2DWZB 1VDDA 3I04M 3FTFA 1A5TA 3L25A 2Y0QA 3GPYA 2CV2A 1PJJA 1HT2E 3KS4A 1XB2B 1IBKM 1XWIA 5E6JA 5EXSA 4HLQA 2QCUA 4B7HA 4DBGB 4G4NA 5KQDA 1XC8A 1R2YA 3HJSA 4QHTA 2M5ZA 1D2NA 2XH9A 3HX3A 4OVZA 1OKSA 4Z8XA 3GLFE 1XXHA 4JI7M 2RRUA 2DI0A 4GKKM 3ZCBB 3FTEA 2EKKA 4IBCA 2CHQA 3HY5A 2FE8A 2JXNA 1V92A 3J80S 4IBBA 1WGLA 2Z3XA 3U6SA 2XZFA 2F4VM 2K9DA 5EXPA 1VEGA 3GLHA 3KOXE 1GLNA 2W82A 4JN6A 2F5OA 1GVNA 3K2LA 1X37A 1K3XA 1VEKA 2MR9A 3VFDA 3FTDA 4M9SA 1DGGA 1ZMWA 4RF1A 2DWNA 2JUJA 4I8OA 5DNYA 1C7YA 2LXEA 4GEWA 3D8LA 2UXDM 1IY0A 2DENA 1XNRM 1DV0A 2MGWA 3J81S 3DOAA 3FUTA 4MGHA 3LMMA 1E9RA 4KLNA 1SXJE 3K92A 1D0KA 1DO2A 2FH0A 2MROB 2R18A 3FTCA 2L4FA 2FOIC 3SC3A 2EKFA 2G5GX 3L29A 2K6BA 3PFIA 2JY8A 2DWMA 4IBIA 5EXXA 1ZMVA 3IHPA 2CV1A 4KT0F 3W67A 3CTWB 3FYCA 3L2AA 5ITTA 2KXEA 3I4VA 4Z6YA 1E9SA 3LW5F 1SG9A 2X8AA 3E4RA 2ZTDA 3FRHA 2F5SA 1KYIA 2FS1A 4I5SA 3C3DA 2JY7A 4G4RA 1VQ1A 3FD9A 2R6FA 5E26A 3TQSA 1RU3A 2OO9A 5A2QS 2QENA 1NY6A 4FWHA 1NV9A 2LVNC 3B74A 1N78A 2UUCM 3FRIA 1IFYA 1QAQA 1N77A 3GRRA 3U6DA 2A5YB 1Q02A 3MHVC 3U6PA 1OAIA 5FTLA 3HJ8A 1MJGM 1MX0A 2C99A 1ZQ9A 2L7HA 4CIZA 4JV5M 4F1IA 1N36M 1K82A 4RKUF 2MJ5B 1IXRC 4PCZA 5FSWA 2DAMA 4DR4M 3MK6A 2DAGA 2LHCA 1L8QA 1TH3A 2B3TA 1PJIA 3LCUA 2KNVA 4FCWA 1L1ZA 3HJQA 3EIHA 3KS8A 1OQYA 1TDHA 1QAMA 1QQWA 1YSYA 2DZLA 4BB9A 2E5LM 4B08A 4LJ4A 2L4EA 3HHWA 3E46A 2XSZA 2QZ4A 1JR3D 4IBKA 5BR8M 3GLIB 3KFUG 5IT9S 1NVMA 4GHAA 2CWBA 1JB0F 3C3EA 4EIWA 2CV0A 8CATA 3RGSA 4DV2M 3E9SA 4P16A 1G8PA 1XXHB 3U6CA 4JI5M 4G3OA 1HR0M 4PDIA 1EE8A 2XSZD 1AIPC 2DZNB 3HZJA 4DR3M 1GJSA 1YE9A 4D82A 2DNAA 4LJ6A 1ZAEA 4LRTA 4R7GA 4BBAA 3AKZA 3U5ZB 1DGFA 1MU5A 3UGJA 5LMUM 2YR0A 3SYKA 3U6QA 3GLHB 4QOZC 3AOEC 4X65M 3GLGA 2KRUA 3AOGA 4ZPXA 3SATA 4IBFA 4LF9M 4JYAM 2HL7A 1Z5BA 1R7RA 4NL4H 2L7IA 3FKEA 2VQEM 2Y21A 2D7EA 1EFUB 3B7ZA 3OTOM 2DXIA 4NRWA 2R45A 3KOWE 4LG2A 5DYIA 3U6EA 3I01M 4DV3M 2DVWB 3W0FA 3CGWA 5KQ8A 2DAIA 3GRUA 1WIVA 2YFQA 2FNAA 1QDRA 1NJGA 2WSFF 1N33M 1H6UA 4P17A 2C5RA 2G3QA 2G8LA 2Z7JA 3SMPA 1HNWM 3B89A 3F92A 2LWXA 2JZ0A 3K8ZA 4JI8M 1XMQM 2HAKA 3GO8A 1IN7A 1IN4A 3NBXX 3L28A 2F5QA 4QOSA 1IQPA 3T38A 5FTKA 2XGNA 5KPTA 1G41A 2O25A 1OTRA 3PNYA 5LMNM 4GRIA 3PXGA 2NQ8C 2LVQD 2AHMA 3SARA 1W5TA 2FFJA 1XHBA 3HKPA 3KSJA 5EP3A 3VKGA 4FWDA 1DGHB 3BOSA 1HQYE 2CHVA 2XF3A 2ZANA 3W68A 3Q8GA 1V34A 2Y20A 3DZDA 3VLFB 3JR5A 3M7GA 3JR4A 1KFVA 4JXJA 2BJWA 2P5TA 3B7QA 2HHHM 3LQQA 1T3TA 3DA1A 1IN5A 3GQ4A 4K0KM 4B7GA 3UZUA 3HU3A 4HEOA 3GLFA 1C1KA 2JNHA 1NNUC 2KNZA 3LCVB 4B3MM 3J7AS 5KPZA 1NV8A 5ITQA 3B9PA 3GPUA 3CF0A 1QUTA 4D80A 4LJ9A 2I7NA 1OFIA 3W0LB 3FUWA 3TE6A 4GKJM 3QYBA 1QZMA 4GH9A 3U6OA 1G59A 3L27A 2KW0A 2X49A 1MN3A 1WJ7A 2BNKA 3E21A 4IBDA 5ITUA 4S12A 2YQZA 3UK6A 1T43A 2M60A 5IREB 3WHLA 1QVRA 2H1RA 1JQJC 3U60A 3U61A 4LF4M 1EIJA 3FUUA 2BWBA 1SXJA 2UU9M 5C18A 3DFZA 1D0MA 1QDTA 2WZJA 4DR2M 4WW0A 4XK8F 2QP9X 1KSFX 1R2ZA 1PJTA 4A3VB 4LF5M 2DHRA 4NOOB 3AV0A 2LBCA 4GITA 3K9PA 1P3QQ 4X66M 4AG6A 4LF8M 4D81A 3GQ5A 3GLGB 2R0IA 5F3WA 4AZFA 1SXJC 2RKOA 2ZAOA 2ZTCA 1SXJD 4JI6M 1IXZA 3HHZA 3QYEA 3VDPA 3SASA 1J09A 1IBLM 1ORYB 3THGA 4CGYB 3U6LA 2LVOC 3J27B 4GMQA 4CHTB 1GABA 4NXMM 4X64M 2APLA 3KSXA 2HWJA 1IXSA 3UMMA 1QANA 5FLXS 3ILKA 3R8FA 1J5EM 1L2BA 1UM8A 1D0LA 4AKHA 1TH2A 2MH8A 3TWMA 3H4MA 2D7HA 3KVWA 4KODA 1HNZM 4JI1M 3EIEA 1IY1A 1IY2A 2UUAM 4FW9A 2CUZA 3AFHA 3KW6A 1R6BX 1VG5A 3Q8XA 2XFSA 4I4LA 1FNNA 1VEJA 4LZZA 4G4OA 1AUAA 1GKIA 2JY6B 1HQCA 2RGOA 3AOEA 4IBEA 4MM3B 4OVZB 1PM5A 4PT5A 3I51A 1YLAA 1OFHA 4WURA 3KOYE 4DUZM 3NBIA 3AJIB 2DAEA 3MMPA 2XEPA
chains in the Genus database with same CATH topology
1VEKA 2MR9A 2JZ0A 1ZMWA 2JUJA 3K9OA 2HAKA 1JR3E 2LVAA 4GEWA 1C7YA 2DENA 1HJPA 1DV0A 2MGWA 2KHHA 2JZ1A 1G4AE 1VDLA 1G41A 2O25A 4F2LA 1OTRA 1QZEA 2QNJA 1DO2A 1T6OA 2MROB 2LVQD 2L4FA 1E94E 2EKFA 2K0BX 2CP8A 1DO0A 2JY8A 1HQYE 1ZMVA 3IHPA 3F92A 2QHOB 1GO5A 2KNAA 4WP2A 5DFLA 4R71A 1SG9A 4HEOA 2JNHA 2ZTDA 2KNZA 3LCVB 3FRHA 1NV8A 1KYIA 1WR1B 2JY7A 1VQ1A 3IECA 2H5XA 2OO9A 3H4JA 1ZV1A 1NV9A 2LVNC 3MMPA 1WGNA 3GLIE 3FRIA 1IFYA 1Q02A 1OAIA 3GLGE 2JP7A 2LVPC 1WHCA 2QSFX 1MN3A 1WJ7A 3E21A 4F1IA 2OOAA 3T6PA 5JI2E 1T43A 1XXHE 2MJ5B 2DAMA 3BBZA 2DAGA 2B3TA 2DKLA 2BWEA 2BWBA 2DAKA 2KNVA 3LCUA 4UN2B 1Y8GA 1OQYA 2DZLA 2EJSA 3GLHE 2WZJA 2L4EA 3E46A 2JY5A 1R4GA 2LBCA 3K9PA 1P3QQ 2CWBA 1BVSA 2R0IA 1TR8A 2ZTCA 2DHYA 2OOBA 2L2DA 1CUKA 4G3OA 1F4IA 1A5TA 1AIPC 3FE3A 2LVOC 2DNAA 1HT2E 1XB2B 2LTUA 1IM2A 1IXSA 2HWJA 4DBGB 1HT1E 1PGYA 1ZMUA 1OKSA 3GLFE 2RRUA 1UFZA 2DI0A 1EFUB 2EKKA 4Q7JA 1VG5A 1VEJA 1V92A 1WGLA 2JY6B 1G3IA 2K9DA 2DAIA 1VEGA 1WIVA 1YLAA 1TTEA 2G3QA 2DAEA 3B89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEK A;  2MR9 A;  2JZ0 A;  1ZMW A;  2JUJ A;  3K9O A;  2HAK A;  1JR3 E;  2LVA A;  4GEW A;  1C7Y A;  2DEN A;  1HJP A;  1DV0 A;  2MGW A;  2KHH A;  2JZ1 A;  1G4A E;  1VDL A;  1G41 A;  2O25 A;  4F2L A;  1OTR A;  1QZE A;  2QNJ A;  1DO2 A;  1T6O A;  2MRO B;  2LVQ D;  2L4F A;  1E94 E;  2EKF A;  2K0B X;  2CP8 A;  1DO0 A;  2JY8 A;  1HQY E;  1ZMV A;  3IHP A;  3F92 A;  2QHO B;  1GO5 A;  2KNA A;  4WP2 A;  5DFL A;  4R71 A;  1SG9 A;  4HEO A;  2JNH A;  2ZTD A;  2KNZ A;  3LCV B;  3FRH A;  1NV8 A;  1KYI A;  1WR1 B;  2JY7 A;  1VQ1 A;  3IEC A;  2H5X A;  2OO9 A;  3H4J A;  1ZV1 A;  1NV9 A;  2LVN C;  3MMP A;  1WGN A;  3GLI E;  3FRI A;  1IFY A;  1Q02 A;  1OAI A;  3GLG E;  2JP7 A;  2LVP C;  1WHC A;  2QSF X;  1MN3 A;  1WJ7 A;  3E21 A;  4F1I A;  2OOA A;  3T6P A;  5JI2 E;  1T43 A;  1XXH E;  2MJ5 B;  2DAM A;  3BBZ A;  2DAG A;  2B3T A;  2DKL A;  2BWE A;  2BWB A;  2DAK A;  2KNV A;  3LCU A;  4UN2 B;  1Y8G A;  1OQY A;  2DZL A;  2EJS A;  3GLH E;  2WZJ A;  2L4E A;  3E46 A;  2JY5 A;  1R4G A;  2LBC A;  3K9P A;  1P3Q Q;  2CWB A;  1BVS A;  2R0I A;  1TR8 A;  2ZTC A;  2DHY A;  2OOB A;  2L2D A;  1CUK A;  4G3O A;  1F4I A;  1A5T A;  1AIP C;  3FE3 A;  2LVO C;  2DNA A;  1HT2 E;  1XB2 B;  2LTU A;  1IM2 A;  1IXS A;  2HWJ A;  4DBG B;  1HT1 E;  1PGY A;  1ZMU A;  1OKS A;  3GLF E;  2RRU A;  1UFZ A;  2DI0 A;  1EFU B;  2EKK A;  4Q7J A;  1VG5 A;  1VEJ A;  1V92 A;  1WGL A;  2JY6 B;  1G3I A;  2K9D A;  2DAI A;  1VEG A;  1WIV A;  1YLA A;  1TTE A;  2G3Q A;  2DAE A;  3B89 A; 
#chains in the Genus database with same CATH topology
 4AQY M;  2N35 A;  4M9X A;  3HHX A;  4MH0 E;  2LH0 A;  5EP4 A;  2L6O A;  4JI0 M;  1IN6 A;  2KHH A;  1G4A E;  4L4U A;  2DZO B;  3TL4 X;  5BPV A;  3GLF B;  3QAU A;  2HKJ A;  2J5Y A;  4LGM A;  1VDL A;  1K3W A;  5EQT A;  4LFC M;  1G71 A;  3M0E A;  3FUX A;  3IG5 A;  3GP1 A;  4JI3 M;  1NHW C;  4OU7 A;  1E94 E;  2Z8Y M;  2ERC A;  5L8R F;  2Y0T A;  3A42 A;  3GRV A;  5EXT A;  2GNO A;  2CP8 A;  1DO0 A;  2RGH A;  2CEA A;  3CF6 E;  2CFO A;  3KXE C;  4Y28 F;  2QHO B;  4DV1 M;  2I7P A;  2X4A A;  4CIS A;  1I94 M;  1GO5 A;  4WP2 A;  3NWL A;  5C1B A;  2GQF A;  3SAV A;  4R71 A;  1GL7 A;  4QNM A;  3J2P B;  5DYG A;  4LRS A;  4LZJ A;  4DV6 M;  2Z4S A;  2R65 A;  2L09 A;  4NSO B;  2LNH C;  4I81 A;  3RE8 A;  2H5X A;  4DUY M;  3U61 B;  4FVM A;  4GC9 A;  3GLI E;  1SXJ B;  2VF7 A;  4IJF A;  2KEB A;  3IG8 A;  4G6Z A;  4DV4 M;  4IBJ A;  1QYR A;  3VK7 A;  2R4J A;  1Q39 A;  3KDS E;  2JP7 A;  3FYD A;  4L16 A;  1WHC A;  2QSF X;  2CHG A;  3KP0 E;  3WHK A;  5H37 D;  4GHL A;  1TGU A;  4LGY A;  4PDG A;  1N75 A;  2VF8 A;  4GIP A;  4FD2 A;  2WSE F;  2C9C A;  3U6M A;  2OOA A;  2V1C A;  1L2C A;  1XXH E;  4B3S M;  2K47 A;  2LHG A;  4YY3 M;  3LVW A;  3BBZ A;  3GLI A;  2KZU A;  3PVS A;  3HU2 A;  5GKN A;  2DKL A;  2Q2E B;  4UN2 B;  5EJC A;  2ZM6 M;  1LTM A;  4OW0 A;  1OIP A;  5JI3 E;  1FJG M;  2HCB A;  4NSR A;  3J7B A;  4DV5 M;  3GLH E;  3T1H M;  4IJE A;  3FUV A;  4M0W A;  4L15 A;  3ZH9 B;  4B3T M;  2V6Z M;  2JY5 A;  4KO8 A;  4W5W A;  3GRY A;  3ZC7 B;  2QPA A;  4REZ A;  3SAU A;  1BVS A;  3HU1 A;  5FTJ A;  1IXS B;  3R9X B;  2JWS A;  2R44 A;  3TWK A;  4II7 A;  2O5R A;  3U5Z A;  2OOB A;  4IIW A;  4TUW A;  2QBY A;  1OJL A;  3A98 B;  3K1J A;  3A45 A;  3PNV A;  3A46 A;  4AW4 A;  4DV7 M;  4JI4 M;  1F4I A;  4QHS A;  4X62 M;  1PJQ A;  3FE3 A;  4LF6 M;  3SBJ A;  4LF7 M;  3SHF A;  1I4W A;  2KA6 B;  3CF2 A;  4AKG A;  1NY5 A;  4MGZ E;  2R4E A;  4QNR A;  1E32 A;  2LTU A;  1IM2 A;  3RFW A;  3T15 A;  4DR1 M;  1J7K A;  1HT1 E;  1PGY A;  1ZMU A;  2WSC F;  4CJ6 A;  3SMS A;  2C96 A;  2O01 F;  2F5P A;  1R5L A;  1UFZ A;  3HHY A;  2EO2 A;  1Q3C A;  3UJN A;  2KDL A;  4Q7J A;  3VDU A;  4AI6 A;  2C9O A;  2UUB M;  3AL0 C;  4GC5 A;  2CE7 A;  4M9Z A;  2EA0 A;  1G3I A;  5FTM A;  3SFZ A;  2KRK A;  2KZS A;  4MGY E;  1NO1 A;  2XFT A;  1GL6 A;  1OAO C;  5ITY A;  1XMO M;  4L8R C;  1Z6T A;  1TTE A;  2JA2 A;  2ZAM A;  4FCT A;  4FCV A;  2J7N A;  4B3R M;  2VQF M;  4IBG A;  4L78 A;  3LVV A;  4RF0 A;  1NHG C;  3K9O A;  1Q3B A;  1JR3 E;  2LVA A;  3JAM S;  1N32 M;  1HJP A;  4LY6 A;  1Z59 A;  2JZ1 A;  4NC6 A;  1DGH A;  3QWL A;  4LCB A;  1LV7 A;  1TF0 B;  3MJ5 A;  1N34 M;  1OIZ A;  4F2L A;  1QZE A;  2QNJ A;  1NNJ A;  5IZ7 D;  1T6O A;  2VII A;  4ITQ A;  1QAO A;  1XNQ M;  2R46 A;  2YNM D;  2DWL A;  2K0B X;  1JR3 A;  4LJA A;  3GQ3 A;  3C9P A;  4KHP M;  5EP1 A;  3C58 A;  3M6A A;  2KNA A;  2XZU A;  5IWA M;  4MGK E;  5ITR A;  2V1U A;  1S3S A;  5DFL A;  4ANR A;  5KO3 A;  2C98 A;  3SHG B;  3KP1 E;  4DV0 M;  1PRB A;  1L1T A;  1IBM M;  1NJF A;  3KOZ E;  1WR1 B;  1L2D A;  4AG5 A;  2ZBK B;  3IEC A;  4OX9 M;  3H4J A;  1ZV1 A;  3GPP A;  4MB7 A;  3TWL A;  4AKI A;  3GPX A;  2EUC A;  2J7O A;  1WGN A;  3SAW A;  3D8B A;  5ITX E;  4YHH M;  3HGI A;  3T1Y M;  1W5S A;  2BJV A;  3V76 A;  4BLC A;  3GLG E;  2LVP C;  2OQ4 A;  1QUS A;  4MGI E;  3VK8 A;  4LFB M;  2D7G A;  4XGI A;  3T6P A;  5EP2 A;  5JI2 E;  3L26 A;  4JI2 M;  1NSF A;  4RNA A;  3B7N A;  5FTN A;  2UXB M;  4LJ7 A;  1GJT A;  2UXC M;  1V33 A;  5ITX A;  5KPR A;  3VKH A;  3SYL A;  2BWE A;  4XBO A;  2DAK A;  3HWS A;  4L6V 6;  4LJ8 A;  2QBY B;  1Y8G A;  4DR6 M;  2Z4R A;  4B7F A;  2EJS A;  2R62 A;  4M0D A;  2F5N A;  3RGP A;  4FWG A;  3U60 B;  1HNX M;  4PD2 A;  1PJS A;  2XLJ A;  1R4G A;  1YUB A;  2VDB B;  1TDZ A;  3TPZ A;  1Z5C A;  4DR5 M;  4G4Q A;  1Z5A A;  3I4Y A;  4NXN M;  3LQR A;  7CAT A;  1TH4 A;  2CRU A;  4NRV A;  1TR8 A;  4LJ5 A;  4DR7 M;  3BXW A;  2DHY A;  4HL4 A;  2OPF A;  1IN8 A;  1WXQ A;  4R3D A;  4LFA M;  2L2D A;  2QQ8 A;  3ZQJ A;  1CUK A;  1DGB A;  2DWZ B;  1VDD A;  3I04 M;  3FTF A;  1A5T A;  3L25 A;  2Y0Q A;  3GPY A;  2CV2 A;  1PJJ A;  1HT2 E;  3KS4 A;  1XB2 B;  1IBK M;  1XWI A;  5E6J A;  5EXS A;  4HLQ A;  2QCU A;  4B7H A;  4DBG B;  4G4N A;  5KQD A;  1XC8 A;  1R2Y A;  3HJS A;  4QHT A;  2M5Z A;  1D2N A;  2XH9 A;  3HX3 A;  4OVZ A;  1OKS A;  4Z8X A;  3GLF E;  1XXH A;  4JI7 M;  2RRU A;  2DI0 A;  4GKK M;  3ZCB B;  3FTE A;  2EKK A;  4IBC A;  2CHQ A;  3HY5 A;  2FE8 A;  2JXN A;  1V92 A;  3J80 S;  4IBB A;  1WGL A;  2Z3X A;  3U6S A;  2XZF A;  2F4V M;  2K9D A;  5EXP A;  1VEG A;  3GLH A;  3KOX E;  1GLN A;  2W82 A;  4JN6 A;  2F5O A;  1GVN A;  3K2L A;  1X37 A;  1K3X A;  1VEK A;  2MR9 A;  3VFD A;  3FTD A;  4M9S A;  1DGG A;  1ZMW A;  4RF1 A;  2DWN A;  2JUJ A;  4I8O A;  5DNY A;  1C7Y A;  2LXE A;  4GEW A;  3D8L A;  2UXD M;  1IY0 A;  2DEN A;  1XNR M;  1DV0 A;  2MGW A;  3J81 S;  3DOA A;  3FUT A;  4MGH A;  3LMM A;  1E9R A;  4KLN A;  1SXJ E;  3K92 A;  1D0K A;  1DO2 A;  2FH0 A;  2MRO B;  2R18 A;  3FTC A;  2L4F A;  2FOI C;  3SC3 A;  2EKF A;  2G5G X;  3L29 A;  2K6B A;  3PFI A;  2JY8 A;  2DWM A;  4IBI A;  5EXX A;  1ZMV A;  3IHP A;  2CV1 A;  4KT0 F;  3W67 A;  3CTW B;  3FYC A;  3L2A A;  5ITT A;  2KXE A;  3I4V A;  4Z6Y A;  1E9S A;  3LW5 F;  1SG9 A;  2X8A A;  3E4R A;  2ZTD A;  3FRH A;  2F5S A;  1KYI A;  2FS1 A;  4I5S A;  3C3D A;  2JY7 A;  4G4R A;  1VQ1 A;  3FD9 A;  2R6F A;  5E26 A;  3TQS A;  1RU3 A;  2OO9 A;  5A2Q S;  2QEN A;  1NY6 A;  4FWH A;  1NV9 A;  2LVN C;  3B74 A;  1N78 A;  2UUC M;  3FRI A;  1IFY A;  1QAQ A;  1N77 A;  3GRR A;  3U6D A;  2A5Y B;  1Q02 A;  3MHV C;  3U6P A;  1OAI A;  5FTL A;  3HJ8 A;  1MJG M;  1MX0 A;  2C99 A;  1ZQ9 A;  2L7H A;  4CIZ A;  4JV5 M;  4F1I A;  1N36 M;  1K82 A;  4RKU F;  2MJ5 B;  1IXR C;  4PCZ A;  5FSW A;  2DAM A;  4DR4 M;  3MK6 A;  2DAG A;  2LHC A;  1L8Q A;  1TH3 A;  2B3T A;  1PJI A;  3LCU A;  2KNV A;  4FCW A;  1L1Z A;  3HJQ A;  3EIH A;  3KS8 A;  1OQY A;  1TDH A;  1QAM A;  1QQW A;  1YSY A;  2DZL A;  4BB9 A;  2E5L M;  4B08 A;  4LJ4 A;  2L4E A;  3HHW A;  3E46 A;  2XSZ A;  2QZ4 A;  1JR3 D;  4IBK A;  5BR8 M;  3GLI B;  3KFU G;  5IT9 S;  1NVM A;  4GHA A;  2CWB A;  1JB0 F;  3C3E A;  4EIW A;  2CV0 A;  8CAT A;  3RGS A;  4DV2 M;  3E9S A;  4P16 A;  1G8P A;  1XXH B;  3U6C A;  4JI5 M;  4G3O A;  1HR0 M;  4PDI A;  1EE8 A;  2XSZ D;  1AIP C;  2DZN B;  3HZJ A;  4DR3 M;  1GJS A;  1YE9 A;  4D82 A;  2DNA A;  4LJ6 A;  1ZAE A;  4LRT A;  4R7G A;  4BBA A;  3AKZ A;  3U5Z B;  1DGF A;  1MU5 A;  3UGJ A;  5LMU M;  2YR0 A;  3SYK A;  3U6Q A;  3GLH B;  4QOZ C;  3AOE C;  4X65 M;  3GLG A;  2KRU A;  3AOG A;  4ZPX A;  3SAT A;  4IBF A;  4LF9 M;  4JYA M;  2HL7 A;  1Z5B A;  1R7R A;  4NL4 H;  2L7I A;  3FKE A;  2VQE M;  2Y21 A;  2D7E A;  1EFU B;  3B7Z A;  3OTO M;  2DXI A;  4NRW A;  2R45 A;  3KOW E;  4LG2 A;  5DYI A;  3U6E A;  3I01 M;  4DV3 M;  2DVW B;  3W0F A;  3CGW A;  5KQ8 A;  2DAI A;  3GRU A;  1WIV A;  2YFQ A;  2FNA A;  1QDR A;  1NJG A;  2WSF F;  1N33 M;  1H6U A;  4P17 A;  2C5R A;  2G3Q A;  2G8L A;  2Z7J A;  3SMP A;  1HNW M;  3B89 A;  3F92 A;  2LWX A;  2JZ0 A;  3K8Z A;  4JI8 M;  1XMQ M;  2HAK A;  3GO8 A;  1IN7 A;  1IN4 A;  3NBX X;  3L28 A;  2F5Q A;  4QOS A;  1IQP A;  3T38 A;  5FTK A;  2XGN A;  5KPT A;  1G41 A;  2O25 A;  1OTR A;  3PNY A;  5LMN M;  4GRI A;  3PXG A;  2NQ8 C;  2LVQ D;  2AHM A;  3SAR A;  1W5T A;  2FFJ A;  1XHB A;  3HKP A;  3KSJ A;  5EP3 A;  3VKG A;  4FWD A;  1DGH B;  3BOS A;  1HQY E;  2CHV A;  2XF3 A;  2ZAN A;  3W68 A;  3Q8G A;  1V34 A;  2Y20 A;  3DZD A;  3VLF B;  3JR5 A;  3M7G A;  3JR4 A;  1KFV A;  4JXJ A;  2BJW A;  2P5T A;  3B7Q A;  2HHH M;  3LQQ A;  1T3T A;  3DA1 A;  1IN5 A;  3GQ4 A;  4K0K M;  4B7G A;  3UZU A;  3HU3 A;  4HEO A;  3GLF A;  1C1K A;  2JNH A;  1NNU C;  2KNZ A;  3LCV B;  4B3M M;  3J7A S;  5KPZ A;  1NV8 A;  5ITQ A;  3B9P A;  3GPU A;  3CF0 A;  1QUT A;  4D80 A;  4LJ9 A;  2I7N A;  1OFI A;  3W0L B;  3FUW A;  3TE6 A;  4GKJ M;  3QYB A;  1QZM A;  4GH9 A;  3U6O A;  1G59 A;  3L27 A;  2KW0 A;  2X49 A;  1MN3 A;  1WJ7 A;  2BNK A;  3E21 A;  4IBD A;  5ITU A;  4S12 A;  2YQZ A;  3UK6 A;  1T43 A;  2M60 A;  5IRE B;  3WHL A;  1QVR A;  2H1R A;  1JQJ C;  3U60 A;  3U61 A;  4LF4 M;  1EIJ A;  3FUU A;  2BWB A;  1SXJ A;  2UU9 M;  5C18 A;  3DFZ A;  1D0M A;  1QDT A;  2WZJ A;  4DR2 M;  4WW0 A;  4XK8 F;  2QP9 X;  1KSF X;  1R2Z A;  1PJT A;  4A3V B;  4LF5 M;  2DHR A;  4NOO B;  3AV0 A;  2LBC A;  4GIT A;  3K9P A;  1P3Q Q;  4X66 M;  4AG6 A;  4LF8 M;  4D81 A;  3GQ5 A;  3GLG B;  2R0I A;  5F3W A;  4AZF A;  1SXJ C;  2RKO A;  2ZAO A;  2ZTC A;  1SXJ D;  4JI6 M;  1IXZ A;  3HHZ A;  3QYE A;  3VDP A;  3SAS A;  1J09 A;  1IBL M;  1ORY B;  3THG A;  4CGY B;  3U6L A;  2LVO C;  3J27 B;  4GMQ A;  4CHT B;  1GAB A;  4NXM M;  4X64 M;  2APL A;  3KSX A;  2HWJ A;  1IXS A;  3UMM A;  1QAN A;  5FLX S;  3ILK A;  3R8F A;  1J5E M;  1L2B A;  1UM8 A;  1D0L A;  4AKH A;  1TH2 A;  2MH8 A;  3TWM A;  3H4M A;  2D7H A;  3KVW A;  4KOD A;  1HNZ M;  4JI1 M;  3EIE A;  1IY1 A;  1IY2 A;  2UUA M;  4FW9 A;  2CUZ A;  3AFH A;  3KW6 A;  1R6B X;  1VG5 A;  3Q8X A;  2XFS A;  4I4L A;  1FNN A;  1VEJ A;  4LZZ A;  4G4O A;  1AUA A;  1GKI A;  2JY6 B;  1HQC A;  2RGO A;  3AOE A;  4IBE A;  4MM3 B;  4OVZ B;  1PM5 A;  4PT5 A;  3I51 A;  1YLA A;  1OFH A;  4WUR A;  3KOY E;  4DUZ M;  3NBI A;  3AJI B;  2DAE A;  3MMP A;  2XEP A; 
#chains in the Genus database with same CATH homology
 1VEK A;  2MR9 A;  2JZ0 A;  1ZMW A;  2JUJ A;  3K9O A;  2HAK A;  1JR3 E;  2LVA A;  4GEW A;  1C7Y A;  2DEN A;  1HJP A;  1DV0 A;  2MGW A;  2KHH A;  2JZ1 A;  1G4A E;  1VDL A;  1G41 A;  2O25 A;  4F2L A;  1OTR A;  1QZE A;  2QNJ A;  1DO2 A;  1T6O A;  2MRO B;  2LVQ D;  2L4F A;  1E94 E;  2EKF A;  2K0B X;  2CP8 A;  1DO0 A;  2JY8 A;  1HQY E;  1ZMV A;  3IHP A;  3F92 A;  2QHO B;  1GO5 A;  2KNA A;  4WP2 A;  5DFL A;  4R71 A;  1SG9 A;  4HEO A;  2JNH A;  2ZTD A;  2KNZ A;  3LCV B;  3FRH A;  1NV8 A;  1KYI A;  1WR1 B;  2JY7 A;  1VQ1 A;  3IEC A;  2H5X A;  2OO9 A;  3H4J A;  1ZV1 A;  1NV9 A;  2LVN C;  3MMP A;  1WGN A;  3GLI E;  3FRI A;  1IFY A;  1Q02 A;  1OAI A;  3GLG E;  2JP7 A;  2LVP C;  1WHC A;  2QSF X;  1MN3 A;  1WJ7 A;  3E21 A;  4F1I A;  2OOA A;  3T6P A;  5JI2 E;  1T43 A;  1XXH E;  2MJ5 B;  2DAM A;  3BBZ A;  2DAG A;  2B3T A;  2DKL A;  2BWE A;  2BWB A;  2DAK A;  2KNV A;  3LCU A;  4UN2 B;  1Y8G A;  1OQY A;  2DZL A;  2EJS A;  3GLH E;  2WZJ A;  2L4E A;  3E46 A;  2JY5 A;  1R4G A;  2LBC A;  3K9P A;  1P3Q Q;  2CWB A;  1BVS A;  2R0I A;  1TR8 A;  2ZTC A;  2DHY A;  2OOB A;  2L2D A;  1CUK A;  4G3O A;  1F4I A;  1A5T A;  1AIP C;  3FE3 A;  2LVO C;  2DNA A;  1HT2 E;  1XB2 B;  2LTU A;  1IM2 A;  1IXS A;  2HWJ A;  4DBG B;  1HT1 E;  1PGY A;  1ZMU A;  1OKS A;  3GLF E;  2RRU A;  1UFZ A;  2DI0 A;  1EFU B;  2EKK A;  4Q7J A;  1VG5 A;  1VEJ A;  1V92 A;  1WGL A;  2JY6 B;  1G3I A;  2K9D A;  2DAI A;  1VEG A;  1WIV A;  1YLA A;  1TTE A;  2G3Q A;  2DAE A;  3B89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...