1OKSA

Crystal structure of the measles virus phosphoprotein xd domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
b'ASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLVKIIMKHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA POLYMERASE ALPHA SUBUNIT
publication title Crystal Structure of the Measles Virus Phosphoprotein Domain Responsible for the Induced Folding of the C-Terminal Domain of the Nucleoprotein
pubmed doi rcsb
source organism Measles virus
molecule tags Transferase
total genus 15
structure length 53
sequence length 53
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1oksA00
2L2DA 1XB2B 3E21A 4F1IA 1AIPC 1HQYE 1VQ1A 1T6OA 5DFLA 1IFYA 2L4FA 3F92A 1XXHE 2CP8A 4DBGB 1DO0A 2DNAA 1GO5A 1HT2E 1WIVA 5JI2E 3B89A 2KNZA 1WGLA 2QSFX 1G41A 2B3TA 2LVPC 2JZ1A 2CWBA 2R0IA 2JP7A 1ZMVA 1TTEA 1VDLA 2LTUA 4Q7JA 2KNAA 1E94E 1R4GA 2HWJA 2K9DA 1G3IA 1EFUB 3LCVB 1DO2A 2DENA 2JY8A 2DAGA 2DI0A 2LBCA 3GLIE 1ZMUA 3GLGE 2JNHA 1T43A 1PGYA 1UFZA 2JZ0A 2MGWA 2DKLA 1P3QQ 1WHCA 3BBZA 3H4JA 1VG5A 3GLFE 1VEGA 1CUKA 2H5XA 1NV9A 1A5TA 1OKSA 4R71A 1Q02A 2ZTDA 1HT1E 1OAIA 1F4IA 2DAMA 3FRHA 2DAKA 2JUJA 3IHPA 3MMPA 2KHHA 1MN3A 2BWBA 2JY5A 2LVNC 2LVQD 2EJSA 4G3OA 2QNJA 3T6PA 2JY7A 3K9PA 2DAIA 2QHOB 2MR9A 1SG9A 2DAEA 2OOAA 2O25A 4HEOA 2JY6B 4GEWA 2K0BX 1TR8A 3FE3A 1KYIA 3IECA 1JR3E 3E46A 1OTRA 1G4AE 1Y8GA 2G3QA 2HAKA 3K9OA 1VEKA 2WZJA 1C7YA 2MROB 2DZLA 3GLHE 1NV8A 1WGNA 4WP2A 4F2LA 2KNVA 2OOBA 1VEJA 1HJPA 2LVAA 1V92A 2LVOC 1WJ7A 3LCUA 2RRUA 1ZMWA 1OQYA 2OO9A 1BVSA 1ZV1A 2MJ5B 1WR1B 1YLAA 2ZTCA 1DV0A 2DHYA 2EKFA 2BWEA 2EKKA 4UN2B 1IXSA 1IM2A 1QZEA 2L4EA 3FRIA
chains in the Genus database with same CATH superfamily
1QANA 2L2DA 1SXJB 1IY1A 3LQQA 3LVVA 4W5WA 4F1IA 5ITUA 1AIPC 1HQYE 2QP9X 2Y21A 1E32A 3IG8A 4AQYM 1T6OA 4OX9M 2L4FA 4L6V6 4NSRA 2YR0A 3QWLA 3A98B 4JI8M 3F92A 1XXHE 2CP8A 1IXSB 2EA0A 1X37A 1Z5CA 4LY6A 4Y28F 2DWZB 4MGHA 2CFOA 1IN5A 2QQ8A 4L78A 4LF5M 1N33M 2NQ8C 2GNOA 5IWAM 3KS8A 1JB0F 1GLNA 2DVWB 4QNRA 3SYLA 2KNZA 2F5PA 1QDTA 3U61A 4PCZA 3VDPA 3B7NA 3AJIB 2JP7A 2XGNA 3SATA 4FD2A 1N32M 1VDLA 3BOSA 3FD9A 4LZZA 4RF1A 3U60B 3K92A 1J5EM 5C1BA 2KNAA 4KT0F 3ZH9B 1EFUB 3A42A 3D8BA 1UM8A 1D0LA 4FWDA 5FTMA 3RGSA 4G4NA 3DZDA 5KPRA 5IREB 4I8OA 3FUVA 2WSCF 4KO8A 3PFIA 3UGJA 3GLGE 1GVNA 4MGYE 2JNHA 1UFZA 2JZ0A 1NJGA 2DKLA 3H4JA 3GLFE 2L7HA 2KXEA 4WW0A 4NRWA 1QDRA 1VDDA 1NV9A 4GC5A 4X64M 2Z3XA 1L2DA 3UZUA 1Q02A 2F5OA 1MX0A 4R7GA 2LNHC 3W0LB 4L16A 1YSYA 3GQ3A 3SAVA 2DAMA 4OVZB 2LXEA 1IN7A 2DAKA 3CF2A 3QAUA 4CHTB 2RGHA 2XZFA 3L25A 4HL4A 3TWKA 3FTFA 2MH8A 3B74A 4I81A 2R65A 2LVNC 2KZUA 1E9RA 3GPPA 1JR3D 1Q39A 4IBGA 3SYKA 3NBXX 3SAUA 3C58A 3FTEA 1Z6TA 2DWLA 3GLIA 4JI7M 1SXJE 3U6PA 2XSZD 3DOAA 2Y0TA 1IBLM 4JXJA 4JYAM 3ZQJA 1ZAEA 2BNKA 2VF8A 2HHHM 2DAEA 2OOAA 2I7PA 3CGWA 2QBYA 5A2QS 2JY6B 4IBBA 4NXNM 4KODA 3LW5F 2VQFM 1L1TA 1IBMM 1WXQA 3FE3A 3LMMA 4PDIA 3AL0C 3HX3A 1C1KA 2J5YA 3T1YM 1Z59A 2UXCM 2ZM6M 1G4AE 1MJGM 3TL4X 5EXTA 3GP1A 2RGOA 4DUYM 1DGFA 1SXJC 2KA6B 3MK6A 3LQRA 3B7QA 1OFHA 1VEKA 2BJVA 2DZLA 3H4MA 3GLHE 7CATA 1WGNA 3GPUA 3HHYA 2KRUA 4LFAM 1PJTA 1IXZA 2OOBA 2ZBKB 3SHGB 1QYRA 2D7HA 2APLA 5KQDA 2UUAM 2VIIA 2KRKA 2HCBA 1ZMWA 4FWGA 1ZV1A 4DV6M 2MJ5B 1NHWC 1WR1B 2ZTCA 4DR1M 4LG2A 2FH0A 3AV0A 4P17A 5LMNM 1PJSA 2F5NA 3HHWA 4DR2M 3IG5A 3KOYE 2YQZA 3TQSA 3HJSA 4CISA 1RU3A 3K1JA 1S3SA 2Z4RA 3UK6A 4ITQA 3GLGB 3WHKA 1V33A 1YUBA 1IFYA 3SARA 3B7ZA 3EIHA 4GITA 4GKKM 4I4LA 5H37D 3MJ5A 2V1CA 1NSFA 1JQJC 5FTJA 1R2ZA 1WIVA 4QHTA 1K3XA 3WHLA 4JV5M 5LMUM 3B89A 1PJJA 2QSFX 3TPZA 2YFQA 2LVPC 2R46A 3L28A 2V1UA 5C18A 4G4OA 2EO2A 1QAMA 3QYBA 5E6JA 4AG6A 1NNJA 4AKGA 3GRYA 4IBEA 4MGIE 1ORYB 2LHGA 4Q7JA 4OU7A 3LVWA 1Q3CA 4IIWA 1HNWM 1E94E 1R4GA 3HHXA 1D0MA 1OIZA 1AUAA 3LCVB 3J2PB 4LGMA 1DO2A 2DENA 1IN4A 4LJ9A 4PT5A 4LF8M 4AI6A 2R4EA 4DR6M 3KDSE 4NXMM 4DV7M 1XXHA 3I51A 3GPYA 2R18A 3M0EA 1R7RA 3BBZA 1P3QQ 1R6BX 1VG5A 4LJ6A 5EP3A 2UXDM 4A3VB 3FUXA 2R44A 2ZTDA 3AFHA 1HT1E 1OAIA 3GLHB 3HU3A 3ILKA 2J7OA 4FCWA 3GQ5A 2UXBM 4BB9A 2C96A 3T15A 3IHPA 4M9XA 1TH2A 5EXXA 4KHPM 2CHVA 2C9OA 3NBIA 3GPXA 2KHHA 2JY5A 2VDBB 2VF7A 4MB7A 1NNUC 3U6MA 2RKOA 2XLJA 2QCUA 2EJSA 1TH3A 3U6QA 4AG5A 2X49A 3SC3A 2MR9A 4B08A 2Y0QA 2M5ZA 3J27B 1NJFA 2XFSA 3GLFA 3U6SA 2QENA 1GKIA 4P16A 4JI3M 2YNMD 3E4RA 1NVMA 4QOZC 2K0BX 1TR8A 2OQ4A 5EP4A 2KDLA 3KOZE 1JR3E 4LFBM 2FFJA 3CF0A 1OTRA 3L29A 4FWHA 4G6ZA 4LJ7A 1XC8A 1Y8GA 3SAWA 3U5ZA 1XMQM 5FLXS 1HQCA 2CV1A 5GKNA 3RFWA 3K2LA 1TH4A 4DR5M 4LJAA 3U6LA 3Q8XA 1K3WA 3W0FA 1C7YA 1NV8A 4WP2A 3I04M 2A5YB 4F2LA 3GQ4A 2KNVA 1VEJA 3PXGA 2Z8YM 2C9CA 4QHSA 2LVAA 2X4AA 1IN8A 2W82A 4IBIA 3C9PA 4Z6YA 4NC6A 1SXJA 1OQYA 1I4WA 1GABA 1G71A 1R2YA 1GL6A 4GMQA 3VLFB 1EIJA 2DHYA 1NHGC 3MHVC 3UJNA 4NOOB 2FNAA 2E5LM 4ZPXA 1IXRC 2LHCA 3EIEA 1IXSA 2HL7A 4LRSA 1IM2A 4M9SA 4RKUF 1QZEA 3R9XB 2L4EA 2JXNA 1GJTA 3FRIA 5EXPA 3KVWA 1XB2B 3KP0E 2Z4SA 4B7HA 3I01M 4MH0E 2X8AA 2ZAOA 3E9SA 3RE8A 4AW4A 1Q3BA 3THGA 4JI1M 3I4YA 2XFTA 4JI2M 4CJ6A 1QVRA 4IJFA 5EJCA 1MU5A 5ITXE 4DR3M 3CTWB 4L8RC 1DO0A 1J7KA 2DNAA 1DGHB 3U60A 4EIWA 2L09A 3SMPA 4GHAA 5L8RF 2OPFA 3HGIA 3GRVA 3HY5A 2L7IA 1WGLA 5EXSA 3DA1A 3DFZA 3J80S 5BR8M 2CV0A 2JZ1A 3SASA 3SHFA 4B3RM 2CWBA 1OIPA 3FTCA 4LF6M 3VK7A 5FTNA 3U6CA 4MM3B 1ZQ9A 2CEAA 8CATA 4LCBA 4B7FA 1IY0A 4MGZE 3GO8A 1N36M 2N35A 1TDZA 4AKIA 1QUSA 2JY8A 1Z5BA 2DI0A 3U61B 1PJQA 3K8ZA 2O01F 1W5TA 5BPVA 4LF7M 1ZMUA 2R62A 4RF0A 2VQEM 4OVZA 1T3TA 4REZA 3U6EA 4LJ4A 1T43A 1PGYA 2CUZA 2F5QA 2C99A 1QAOA 2KW0A 1VEGA 1CUKA 2H5XA 3BXWA 1NY5A 1A5TA 2J7NA 2BJWA 3B9PA 1DGBA 3PNYA 4FW9A 4D80A 4GH9A 2XEPA 3FRHA 3V76A 1NY6A 2L6OA 5EP1A 3M7GA 3MMPA 2LWXA 4FCVA 4NRVA 4XK8F 1MN3A 4M0WA 3FYDA 1N77A 3ZCBB 4X65M 5ITTA 3KSJA 2QNJA 4YY3M 4LF9M 2LH0A 3K9PA 2DAIA 1IQPA 4CIZA 1PJIA 2F5SA 2KZSA 3FUUA 2R6FA 1SG9A 2CE7A 2HKJA 3PVSA 5EQTA 1QQWA 1G59A 4DR4M 1K82A 3UMMA 4TUWA 1KFVA 1I94M 4B7GA 2UU9M 5KPZA 5KO3A 1KYIA 3IECA 3CF6E 5F3WA 3KW6A 3E46A 4YHHM 3AKZA 3GLIB 1LV7A 4DV0M 4D82A 2DXIA 4JI5M 2G3QA 2R45A 1Z5AA 2M60A 4LJ5A 1TDHA 3T1HM 4OW0A 4QNMA 2QBYB 4AKHA 4DV1M 2KEBA 4IBCA 4LJ8A 3VKHA 2QPAA 3AOEC 1XMOM 1J09A 4L15A 2UUBM 3LCUA 1OFIA 4K0KM 1L2CA 3GLGA 4LRTA 3JAMS 1XWIA 3GRUA 3HKPA 1D0KA 4L4UA 2K47A 1L2BA 3KXEC 1OAOC 2FE8A 4UN2B 3FKEA 3L2AA 3TWLA 1OJLA 1LTMA 2LTUA 1JR3A 5DFLA 3KOWE 3U6DA 2DHRA 3E21A 3ZC7B 3A46A 5IT9S 2D7GA 1GL7A 4MGKE 1HNZM 1VQ1A 2XSZA 3HU1A 5DYIA 4G4RA 3KOXE 4B3TM 3C3EA 4FCTA 2V6ZM 2CRUA 4DBGB 3T38A 4DV5M 2Q2EB 2C5RA 2CHGA 2I7NA 1GO5A 4DV2M 1HT2E 2G5GX 4HLQA 4IBDA 1PRBA 3FYCA 4DUZM 5ITRA 2DWNA 4RNAA 3SFZA 5JI2E 1XNRM 4WURA 2F4VM 2K6BA 2QZ4A 2EUCA 1G41A 2B3TA 4IJEA 4M9ZA 2JWSA 1PM5A 2CHQA 4GHLA 3I4VA 4G4QA 2R0IA 5ITQA 3FUTA 5E26A 1TTEA 1ZMVA 3W67A 3JR5A 2ZANA 2DZNB 2K9DA 2HWJA 2XZUA 1G3IA 4NL4H 5DNYA 4ANRA 1KSFX 2XH9A 3VK8A 4DR7M 2DWMA 2WSFF 3GLHA 2DAGA 1FJGM 4IBJA 4IBFA 4LGYA 4IBKA 1G8PA 2FOIC 2LBCA 5ITXA 3GLIE 4JI0M 3SBJA 2ERCA 2MGWA 1N34M 2AHMA 1WHCA 1QUTA 3FTDA 3PNVA 4D81A 3J81S 1NO1A 2FS1A 2ZAMA 4I5SA 3RGPA 4CGYB 4JI6M 4Z8XA 1R5LA 1FNNA 1SXJD 2R4JA 1EE8A 2WSEF 3SMSA 1OKSA 3HU2A 4R71A 1E9SA 1QAQA 3HWSA 1HR0M 4LF4M 3HHZA 3M6AA 4DV3M 1YE9A 1XXHB 3A45A 2P5TA 1F4IA 4XGIA 2JUJA 4FVMA 4GRIA 4BBAA 4BLCA 3KSXA 2BWBA 2LVQD 3U6OA 2O5RA 5FSWA 1L8QA 4S12A 2H1RA 3VKGA 2Z7JA 4PD2A 4G3OA 5FTLA 3J7BA 4GC9A 4M0DA 3T6PA 1D2NA 2JY7A 1IN6A 3NWLA 3QYEA 3VFDA 3VDUA 2QHOB 3L27A 4B3SM 3W68A 1XNQM 3KS4A 1N78A 4X66M 2O25A 4JN6A 4QOSA 3L26A 3HZJA 4HEOA 5KQ8A 1HNXM 4DV4M 3HJQA 2C98A 4GEWA 2Y20A 1H6UA 3C3DA 4AZFA 2CV2A 2D7EA 4GIPA 1IBKM 3R8FA 1XHBA 2HAKA 3K9OA 1GJSA 4X62M 5JI3E 4XBOA 3GLFB 1L1ZA 2WZJA 2MROB 2GQFA 4NSOB 4B3MM 4LZJA 4LFCM 3KFUG 1HJPA 1V92A 5FTKA 4JI4M 5ITYA 3D8LA 3J7AS 2LVOC 1V34A 1WJ7A 2G8LA 2RRUA 5DYGA 1DGGA 5KPTA 1TF0B 2OO9A 1BVSA 1IY2A 3HJ8A 1N75A 3KP1E 4PDGA 3GRRA 3OTOM 1YLAA 3TE6A 3U5ZB 1DV0A 2JA2A 3Q8GA 1W5SA 1TGUA 2EKFA 3AOGA 2BWEA 3AOEA 4II7A 3TWMA 3FUWA 5EP2A 2EKKA 3JR4A 2UUCM 4R3DA 2XF3A 4KLNA 5IZ7D 2DZOB 1DGHA 4GKJM 1QZMA
chains in the Genus database with same CATH topology
2L2DA 1XB2B 3E21A 4F1IA 1AIPC 1HQYE 1VQ1A 1T6OA 5DFLA 1IFYA 2L4FA 3F92A 1XXHE 2CP8A 4DBGB 1DO0A 2DNAA 1GO5A 1HT2E 1WIVA 5JI2E 3B89A 2KNZA 1WGLA 2QSFX 1G41A 2B3TA 2LVPC 2JZ1A 2CWBA 2R0IA 2JP7A 1ZMVA 1TTEA 1VDLA 2LTUA 4Q7JA 2KNAA 1E94E 1R4GA 2HWJA 2K9DA 1G3IA 1EFUB 3LCVB 1DO2A 2DENA 2JY8A 2DAGA 2DI0A 2LBCA 3GLIE 1ZMUA 3GLGE 2JNHA 1T43A 1PGYA 1UFZA 2JZ0A 2MGWA 2DKLA 1P3QQ 1WHCA 3BBZA 3H4JA 1VG5A 3GLFE 1VEGA 1CUKA 2H5XA 1NV9A 1A5TA 1OKSA 4R71A 1Q02A 2ZTDA 1HT1E 1OAIA 1F4IA 2DAMA 3FRHA 2DAKA 2JUJA 3IHPA 3MMPA 2KHHA 1MN3A 2BWBA 2JY5A 2LVNC 2LVQD 2EJSA 4G3OA 2QNJA 3T6PA 2JY7A 3K9PA 2DAIA 2QHOB 2MR9A 1SG9A 2DAEA 2OOAA 2O25A 4HEOA 2JY6B 4GEWA 2K0BX 1TR8A 3FE3A 1KYIA 3IECA 1JR3E 3E46A 1OTRA 1G4AE 1Y8GA 2G3QA 2HAKA 3K9OA 1VEKA 2WZJA 1C7YA 2MROB 2DZLA 3GLHE 1NV8A 1WGNA 4WP2A 4F2LA 2KNVA 2OOBA 1VEJA 1HJPA 2LVAA 1V92A 2LVOC 1WJ7A 3LCUA 2RRUA 1ZMWA 1OQYA 2OO9A 1BVSA 1ZV1A 2MJ5B 1WR1B 1YLAA 2ZTCA 1DV0A 2DHYA 2EKFA 2BWEA 2EKKA 4UN2B 1IXSA 1IM2A 1QZEA 2L4EA 3FRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2D A;  1XB2 B;  3E21 A;  4F1I A;  1AIP C;  1HQY E;  1VQ1 A;  1T6O A;  5DFL A;  1IFY A;  2L4F A;  3F92 A;  1XXH E;  2CP8 A;  4DBG B;  1DO0 A;  2DNA A;  1GO5 A;  1HT2 E;  1WIV A;  5JI2 E;  3B89 A;  2KNZ A;  1WGL A;  2QSF X;  1G41 A;  2B3T A;  2LVP C;  2JZ1 A;  2CWB A;  2R0I A;  2JP7 A;  1ZMV A;  1TTE A;  1VDL A;  2LTU A;  4Q7J A;  2KNA A;  1E94 E;  1R4G A;  2HWJ A;  2K9D A;  1G3I A;  1EFU B;  3LCV B;  1DO2 A;  2DEN A;  2JY8 A;  2DAG A;  2DI0 A;  2LBC A;  3GLI E;  1ZMU A;  3GLG E;  2JNH A;  1T43 A;  1PGY A;  1UFZ A;  2JZ0 A;  2MGW A;  2DKL A;  1P3Q Q;  1WHC A;  3BBZ A;  3H4J A;  1VG5 A;  3GLF E;  1VEG A;  1CUK A;  2H5X A;  1NV9 A;  1A5T A;  1OKS A;  4R71 A;  1Q02 A;  2ZTD A;  1HT1 E;  1OAI A;  1F4I A;  2DAM A;  3FRH A;  2DAK A;  2JUJ A;  3IHP A;  3MMP A;  2KHH A;  1MN3 A;  2BWB A;  2JY5 A;  2LVN C;  2LVQ D;  2EJS A;  4G3O A;  2QNJ A;  3T6P A;  2JY7 A;  3K9P A;  2DAI A;  2QHO B;  2MR9 A;  1SG9 A;  2DAE A;  2OOA A;  2O25 A;  4HEO A;  2JY6 B;  4GEW A;  2K0B X;  1TR8 A;  3FE3 A;  1KYI A;  3IEC A;  1JR3 E;  3E46 A;  1OTR A;  1G4A E;  1Y8G A;  2G3Q A;  2HAK A;  3K9O A;  1VEK A;  2WZJ A;  1C7Y A;  2MRO B;  2DZL A;  3GLH E;  1NV8 A;  1WGN A;  4WP2 A;  4F2L A;  2KNV A;  2OOB A;  1VEJ A;  1HJP A;  2LVA A;  1V92 A;  2LVO C;  1WJ7 A;  3LCU A;  2RRU A;  1ZMW A;  1OQY A;  2OO9 A;  1BVS A;  1ZV1 A;  2MJ5 B;  1WR1 B;  1YLA A;  2ZTC A;  1DV0 A;  2DHY A;  2EKF A;  2BWE A;  2EKK A;  4UN2 B;  1IXS A;  1IM2 A;  1QZE A;  2L4E A;  3FRI A; 
#chains in the Genus database with same CATH topology
 1QAN A;  2L2D A;  1SXJ B;  1IY1 A;  3LQQ A;  3LVV A;  4W5W A;  4F1I A;  5ITU A;  1AIP C;  1HQY E;  2QP9 X;  2Y21 A;  1E32 A;  3IG8 A;  4AQY M;  1T6O A;  4OX9 M;  2L4F A;  4L6V 6;  4NSR A;  2YR0 A;  3QWL A;  3A98 B;  4JI8 M;  3F92 A;  1XXH E;  2CP8 A;  1IXS B;  2EA0 A;  1X37 A;  1Z5C A;  4LY6 A;  4Y28 F;  2DWZ B;  4MGH A;  2CFO A;  1IN5 A;  2QQ8 A;  4L78 A;  4LF5 M;  1N33 M;  2NQ8 C;  2GNO A;  5IWA M;  3KS8 A;  1JB0 F;  1GLN A;  2DVW B;  4QNR A;  3SYL A;  2KNZ A;  2F5P A;  1QDT A;  3U61 A;  4PCZ A;  3VDP A;  3B7N A;  3AJI B;  2JP7 A;  2XGN A;  3SAT A;  4FD2 A;  1N32 M;  1VDL A;  3BOS A;  3FD9 A;  4LZZ A;  4RF1 A;  3U60 B;  3K92 A;  1J5E M;  5C1B A;  2KNA A;  4KT0 F;  3ZH9 B;  1EFU B;  3A42 A;  3D8B A;  1UM8 A;  1D0L A;  4FWD A;  5FTM A;  3RGS A;  4G4N A;  3DZD A;  5KPR A;  5IRE B;  4I8O A;  3FUV A;  2WSC F;  4KO8 A;  3PFI A;  3UGJ A;  3GLG E;  1GVN A;  4MGY E;  2JNH A;  1UFZ A;  2JZ0 A;  1NJG A;  2DKL A;  3H4J A;  3GLF E;  2L7H A;  2KXE A;  4WW0 A;  4NRW A;  1QDR A;  1VDD A;  1NV9 A;  4GC5 A;  4X64 M;  2Z3X A;  1L2D A;  3UZU A;  1Q02 A;  2F5O A;  1MX0 A;  4R7G A;  2LNH C;  3W0L B;  4L16 A;  1YSY A;  3GQ3 A;  3SAV A;  2DAM A;  4OVZ B;  2LXE A;  1IN7 A;  2DAK A;  3CF2 A;  3QAU A;  4CHT B;  2RGH A;  2XZF A;  3L25 A;  4HL4 A;  3TWK A;  3FTF A;  2MH8 A;  3B74 A;  4I81 A;  2R65 A;  2LVN C;  2KZU A;  1E9R A;  3GPP A;  1JR3 D;  1Q39 A;  4IBG A;  3SYK A;  3NBX X;  3SAU A;  3C58 A;  3FTE A;  1Z6T A;  2DWL A;  3GLI A;  4JI7 M;  1SXJ E;  3U6P A;  2XSZ D;  3DOA A;  2Y0T A;  1IBL M;  4JXJ A;  4JYA M;  3ZQJ A;  1ZAE A;  2BNK A;  2VF8 A;  2HHH M;  2DAE A;  2OOA A;  2I7P A;  3CGW A;  2QBY A;  5A2Q S;  2JY6 B;  4IBB A;  4NXN M;  4KOD A;  3LW5 F;  2VQF M;  1L1T A;  1IBM M;  1WXQ A;  3FE3 A;  3LMM A;  4PDI A;  3AL0 C;  3HX3 A;  1C1K A;  2J5Y A;  3T1Y M;  1Z59 A;  2UXC M;  2ZM6 M;  1G4A E;  1MJG M;  3TL4 X;  5EXT A;  3GP1 A;  2RGO A;  4DUY M;  1DGF A;  1SXJ C;  2KA6 B;  3MK6 A;  3LQR A;  3B7Q A;  1OFH A;  1VEK A;  2BJV A;  2DZL A;  3H4M A;  3GLH E;  7CAT A;  1WGN A;  3GPU A;  3HHY A;  2KRU A;  4LFA M;  1PJT A;  1IXZ A;  2OOB A;  2ZBK B;  3SHG B;  1QYR A;  2D7H A;  2APL A;  5KQD A;  2UUA M;  2VII A;  2KRK A;  2HCB A;  1ZMW A;  4FWG A;  1ZV1 A;  4DV6 M;  2MJ5 B;  1NHW C;  1WR1 B;  2ZTC A;  4DR1 M;  4LG2 A;  2FH0 A;  3AV0 A;  4P17 A;  5LMN M;  1PJS A;  2F5N A;  3HHW A;  4DR2 M;  3IG5 A;  3KOY E;  2YQZ A;  3TQS A;  3HJS A;  4CIS A;  1RU3 A;  3K1J A;  1S3S A;  2Z4R A;  3UK6 A;  4ITQ A;  3GLG B;  3WHK A;  1V33 A;  1YUB A;  1IFY A;  3SAR A;  3B7Z A;  3EIH A;  4GIT A;  4GKK M;  4I4L A;  5H37 D;  3MJ5 A;  2V1C A;  1NSF A;  1JQJ C;  5FTJ A;  1R2Z A;  1WIV A;  4QHT A;  1K3X A;  3WHL A;  4JV5 M;  5LMU M;  3B89 A;  1PJJ A;  2QSF X;  3TPZ A;  2YFQ A;  2LVP C;  2R46 A;  3L28 A;  2V1U A;  5C18 A;  4G4O A;  2EO2 A;  1QAM A;  3QYB A;  5E6J A;  4AG6 A;  1NNJ A;  4AKG A;  3GRY A;  4IBE A;  4MGI E;  1ORY B;  2LHG A;  4Q7J A;  4OU7 A;  3LVW A;  1Q3C A;  4IIW A;  1HNW M;  1E94 E;  1R4G A;  3HHX A;  1D0M A;  1OIZ A;  1AUA A;  3LCV B;  3J2P B;  4LGM A;  1DO2 A;  2DEN A;  1IN4 A;  4LJ9 A;  4PT5 A;  4LF8 M;  4AI6 A;  2R4E A;  4DR6 M;  3KDS E;  4NXM M;  4DV7 M;  1XXH A;  3I51 A;  3GPY A;  2R18 A;  3M0E A;  1R7R A;  3BBZ A;  1P3Q Q;  1R6B X;  1VG5 A;  4LJ6 A;  5EP3 A;  2UXD M;  4A3V B;  3FUX A;  2R44 A;  2ZTD A;  3AFH A;  1HT1 E;  1OAI A;  3GLH B;  3HU3 A;  3ILK A;  2J7O A;  4FCW A;  3GQ5 A;  2UXB M;  4BB9 A;  2C96 A;  3T15 A;  3IHP A;  4M9X A;  1TH2 A;  5EXX A;  4KHP M;  2CHV A;  2C9O A;  3NBI A;  3GPX A;  2KHH A;  2JY5 A;  2VDB B;  2VF7 A;  4MB7 A;  1NNU C;  3U6M A;  2RKO A;  2XLJ A;  2QCU A;  2EJS A;  1TH3 A;  3U6Q A;  4AG5 A;  2X49 A;  3SC3 A;  2MR9 A;  4B08 A;  2Y0Q A;  2M5Z A;  3J27 B;  1NJF A;  2XFS A;  3GLF A;  3U6S A;  2QEN A;  1GKI A;  4P16 A;  4JI3 M;  2YNM D;  3E4R A;  1NVM A;  4QOZ C;  2K0B X;  1TR8 A;  2OQ4 A;  5EP4 A;  2KDL A;  3KOZ E;  1JR3 E;  4LFB M;  2FFJ A;  3CF0 A;  1OTR A;  3L29 A;  4FWH A;  4G6Z A;  4LJ7 A;  1XC8 A;  1Y8G A;  3SAW A;  3U5Z A;  1XMQ M;  5FLX S;  1HQC A;  2CV1 A;  5GKN A;  3RFW A;  3K2L A;  1TH4 A;  4DR5 M;  4LJA A;  3U6L A;  3Q8X A;  1K3W A;  3W0F A;  1C7Y A;  1NV8 A;  4WP2 A;  3I04 M;  2A5Y B;  4F2L A;  3GQ4 A;  2KNV A;  1VEJ A;  3PXG A;  2Z8Y M;  2C9C A;  4QHS A;  2LVA A;  2X4A A;  1IN8 A;  2W82 A;  4IBI A;  3C9P A;  4Z6Y A;  4NC6 A;  1SXJ A;  1OQY A;  1I4W A;  1GAB A;  1G71 A;  1R2Y A;  1GL6 A;  4GMQ A;  3VLF B;  1EIJ A;  2DHY A;  1NHG C;  3MHV C;  3UJN A;  4NOO B;  2FNA A;  2E5L M;  4ZPX A;  1IXR C;  2LHC A;  3EIE A;  1IXS A;  2HL7 A;  4LRS A;  1IM2 A;  4M9S A;  4RKU F;  1QZE A;  3R9X B;  2L4E A;  2JXN A;  1GJT A;  3FRI A;  5EXP A;  3KVW A;  1XB2 B;  3KP0 E;  2Z4S A;  4B7H A;  3I01 M;  4MH0 E;  2X8A A;  2ZAO A;  3E9S A;  3RE8 A;  4AW4 A;  1Q3B A;  3THG A;  4JI1 M;  3I4Y A;  2XFT A;  4JI2 M;  4CJ6 A;  1QVR A;  4IJF A;  5EJC A;  1MU5 A;  5ITX E;  4DR3 M;  3CTW B;  4L8R C;  1DO0 A;  1J7K A;  2DNA A;  1DGH B;  3U60 A;  4EIW A;  2L09 A;  3SMP A;  4GHA A;  5L8R F;  2OPF A;  3HGI A;  3GRV A;  3HY5 A;  2L7I A;  1WGL A;  5EXS A;  3DA1 A;  3DFZ A;  3J80 S;  5BR8 M;  2CV0 A;  2JZ1 A;  3SAS A;  3SHF A;  4B3R M;  2CWB A;  1OIP A;  3FTC A;  4LF6 M;  3VK7 A;  5FTN A;  3U6C A;  4MM3 B;  1ZQ9 A;  2CEA A;  8CAT A;  4LCB A;  4B7F A;  1IY0 A;  4MGZ E;  3GO8 A;  1N36 M;  2N35 A;  1TDZ A;  4AKI A;  1QUS A;  2JY8 A;  1Z5B A;  2DI0 A;  3U61 B;  1PJQ A;  3K8Z A;  2O01 F;  1W5T A;  5BPV A;  4LF7 M;  1ZMU A;  2R62 A;  4RF0 A;  2VQE M;  4OVZ A;  1T3T A;  4REZ A;  3U6E A;  4LJ4 A;  1T43 A;  1PGY A;  2CUZ A;  2F5Q A;  2C99 A;  1QAO A;  2KW0 A;  1VEG A;  1CUK A;  2H5X A;  3BXW A;  1NY5 A;  1A5T A;  2J7N A;  2BJW A;  3B9P A;  1DGB A;  3PNY A;  4FW9 A;  4D80 A;  4GH9 A;  2XEP A;  3FRH A;  3V76 A;  1NY6 A;  2L6O A;  5EP1 A;  3M7G A;  3MMP A;  2LWX A;  4FCV A;  4NRV A;  4XK8 F;  1MN3 A;  4M0W A;  3FYD A;  1N77 A;  3ZCB B;  4X65 M;  5ITT A;  3KSJ A;  2QNJ A;  4YY3 M;  4LF9 M;  2LH0 A;  3K9P A;  2DAI A;  1IQP A;  4CIZ A;  1PJI A;  2F5S A;  2KZS A;  3FUU A;  2R6F A;  1SG9 A;  2CE7 A;  2HKJ A;  3PVS A;  5EQT A;  1QQW A;  1G59 A;  4DR4 M;  1K82 A;  3UMM A;  4TUW A;  1KFV A;  1I94 M;  4B7G A;  2UU9 M;  5KPZ A;  5KO3 A;  1KYI A;  3IEC A;  3CF6 E;  5F3W A;  3KW6 A;  3E46 A;  4YHH M;  3AKZ A;  3GLI B;  1LV7 A;  4DV0 M;  4D82 A;  2DXI A;  4JI5 M;  2G3Q A;  2R45 A;  1Z5A A;  2M60 A;  4LJ5 A;  1TDH A;  3T1H M;  4OW0 A;  4QNM A;  2QBY B;  4AKH A;  4DV1 M;  2KEB A;  4IBC A;  4LJ8 A;  3VKH A;  2QPA A;  3AOE C;  1XMO M;  1J09 A;  4L15 A;  2UUB M;  3LCU A;  1OFI A;  4K0K M;  1L2C A;  3GLG A;  4LRT A;  3JAM S;  1XWI A;  3GRU A;  3HKP A;  1D0K A;  4L4U A;  2K47 A;  1L2B A;  3KXE C;  1OAO C;  2FE8 A;  4UN2 B;  3FKE A;  3L2A A;  3TWL A;  1OJL A;  1LTM A;  2LTU A;  1JR3 A;  5DFL A;  3KOW E;  3U6D A;  2DHR A;  3E21 A;  3ZC7 B;  3A46 A;  5IT9 S;  2D7G A;  1GL7 A;  4MGK E;  1HNZ M;  1VQ1 A;  2XSZ A;  3HU1 A;  5DYI A;  4G4R A;  3KOX E;  4B3T M;  3C3E A;  4FCT A;  2V6Z M;  2CRU A;  4DBG B;  3T38 A;  4DV5 M;  2Q2E B;  2C5R A;  2CHG A;  2I7N A;  1GO5 A;  4DV2 M;  1HT2 E;  2G5G X;  4HLQ A;  4IBD A;  1PRB A;  3FYC A;  4DUZ M;  5ITR A;  2DWN A;  4RNA A;  3SFZ A;  5JI2 E;  1XNR M;  4WUR A;  2F4V M;  2K6B A;  2QZ4 A;  2EUC A;  1G41 A;  2B3T A;  4IJE A;  4M9Z A;  2JWS A;  1PM5 A;  2CHQ A;  4GHL A;  3I4V A;  4G4Q A;  2R0I A;  5ITQ A;  3FUT A;  5E26 A;  1TTE A;  1ZMV A;  3W67 A;  3JR5 A;  2ZAN A;  2DZN B;  2K9D A;  2HWJ A;  2XZU A;  1G3I A;  4NL4 H;  5DNY A;  4ANR A;  1KSF X;  2XH9 A;  3VK8 A;  4DR7 M;  2DWM A;  2WSF F;  3GLH A;  2DAG A;  1FJG M;  4IBJ A;  4IBF A;  4LGY A;  4IBK A;  1G8P A;  2FOI C;  2LBC A;  5ITX A;  3GLI E;  4JI0 M;  3SBJ A;  2ERC A;  2MGW A;  1N34 M;  2AHM A;  1WHC A;  1QUT A;  3FTD A;  3PNV A;  4D81 A;  3J81 S;  1NO1 A;  2FS1 A;  2ZAM A;  4I5S A;  3RGP A;  4CGY B;  4JI6 M;  4Z8X A;  1R5L A;  1FNN A;  1SXJ D;  2R4J A;  1EE8 A;  2WSE F;  3SMS A;  1OKS A;  3HU2 A;  4R71 A;  1E9S A;  1QAQ A;  3HWS A;  1HR0 M;  4LF4 M;  3HHZ A;  3M6A A;  4DV3 M;  1YE9 A;  1XXH B;  3A45 A;  2P5T A;  1F4I A;  4XGI A;  2JUJ A;  4FVM A;  4GRI A;  4BBA A;  4BLC A;  3KSX A;  2BWB A;  2LVQ D;  3U6O A;  2O5R A;  5FSW A;  1L8Q A;  4S12 A;  2H1R A;  3VKG A;  2Z7J A;  4PD2 A;  4G3O A;  5FTL A;  3J7B A;  4GC9 A;  4M0D A;  3T6P A;  1D2N A;  2JY7 A;  1IN6 A;  3NWL A;  3QYE A;  3VFD A;  3VDU A;  2QHO B;  3L27 A;  4B3S M;  3W68 A;  1XNQ M;  3KS4 A;  1N78 A;  4X66 M;  2O25 A;  4JN6 A;  4QOS A;  3L26 A;  3HZJ A;  4HEO A;  5KQ8 A;  1HNX M;  4DV4 M;  3HJQ A;  2C98 A;  4GEW A;  2Y20 A;  1H6U A;  3C3D A;  4AZF A;  2CV2 A;  2D7E A;  4GIP A;  1IBK M;  3R8F A;  1XHB A;  2HAK A;  3K9O A;  1GJS A;  4X62 M;  5JI3 E;  4XBO A;  3GLF B;  1L1Z A;  2WZJ A;  2MRO B;  2GQF A;  4NSO B;  4B3M M;  4LZJ A;  4LFC M;  3KFU G;  1HJP A;  1V92 A;  5FTK A;  4JI4 M;  5ITY A;  3D8L A;  3J7A S;  2LVO C;  1V34 A;  1WJ7 A;  2G8L A;  2RRU A;  5DYG A;  1DGG A;  5KPT A;  1TF0 B;  2OO9 A;  1BVS A;  1IY2 A;  3HJ8 A;  1N75 A;  3KP1 E;  4PDG A;  3GRR A;  3OTO M;  1YLA A;  3TE6 A;  3U5Z B;  1DV0 A;  2JA2 A;  3Q8G A;  1W5S A;  1TGU A;  2EKF A;  3AOG A;  2BWE A;  3AOE A;  4II7 A;  3TWM A;  3FUW A;  5EP2 A;  2EKK A;  3JR4 A;  2UUC M;  4R3D A;  2XF3 A;  4KLN A;  5IZ7 D;  2DZO B;  1DGH A;  4GKJ M;  1QZM A; 
#chains in the Genus database with same CATH homology
 2L2D A;  1XB2 B;  3E21 A;  4F1I A;  1AIP C;  1HQY E;  1VQ1 A;  1T6O A;  5DFL A;  1IFY A;  2L4F A;  3F92 A;  1XXH E;  2CP8 A;  4DBG B;  1DO0 A;  2DNA A;  1GO5 A;  1HT2 E;  1WIV A;  5JI2 E;  3B89 A;  2KNZ A;  1WGL A;  2QSF X;  1G41 A;  2B3T A;  2LVP C;  2JZ1 A;  2CWB A;  2R0I A;  2JP7 A;  1ZMV A;  1TTE A;  1VDL A;  2LTU A;  4Q7J A;  2KNA A;  1E94 E;  1R4G A;  2HWJ A;  2K9D A;  1G3I A;  1EFU B;  3LCV B;  1DO2 A;  2DEN A;  2JY8 A;  2DAG A;  2DI0 A;  2LBC A;  3GLI E;  1ZMU A;  3GLG E;  2JNH A;  1T43 A;  1PGY A;  1UFZ A;  2JZ0 A;  2MGW A;  2DKL A;  1P3Q Q;  1WHC A;  3BBZ A;  3H4J A;  1VG5 A;  3GLF E;  1VEG A;  1CUK A;  2H5X A;  1NV9 A;  1A5T A;  1OKS A;  4R71 A;  1Q02 A;  2ZTD A;  1HT1 E;  1OAI A;  1F4I A;  2DAM A;  3FRH A;  2DAK A;  2JUJ A;  3IHP A;  3MMP A;  2KHH A;  1MN3 A;  2BWB A;  2JY5 A;  2LVN C;  2LVQ D;  2EJS A;  4G3O A;  2QNJ A;  3T6P A;  2JY7 A;  3K9P A;  2DAI A;  2QHO B;  2MR9 A;  1SG9 A;  2DAE A;  2OOA A;  2O25 A;  4HEO A;  2JY6 B;  4GEW A;  2K0B X;  1TR8 A;  3FE3 A;  1KYI A;  3IEC A;  1JR3 E;  3E46 A;  1OTR A;  1G4A E;  1Y8G A;  2G3Q A;  2HAK A;  3K9O A;  1VEK A;  2WZJ A;  1C7Y A;  2MRO B;  2DZL A;  3GLH E;  1NV8 A;  1WGN A;  4WP2 A;  4F2L A;  2KNV A;  2OOB A;  1VEJ A;  1HJP A;  2LVA A;  1V92 A;  2LVO C;  1WJ7 A;  3LCU A;  2RRU A;  1ZMW A;  1OQY A;  2OO9 A;  1BVS A;  1ZV1 A;  2MJ5 B;  1WR1 B;  1YLA A;  2ZTC A;  1DV0 A;  2DHY A;  2EKF A;  2BWE A;  2EKK A;  4UN2 B;  1IXS A;  1IM2 A;  1QZE A;  2L4E A;  3FRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...