1OKSA

Crystal structure of the measles virus phosphoprotein xd domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
ASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLVKIIMKHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Measles Virus Phosphoprotein Domain Responsible for the Induced Folding of the C-Terminal Domain of the Nucleoprotein
pubmed doi rcsb
source organism Measles virus
molecule tags Transferase
molecule keywords RNA POLYMERASE ALPHA SUBUNIT
total genus 15
structure length 53
sequence length 53
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1oksA00
1WHCA 2R0IA 1IM2A 1P3QQ 2DNAA 3IHPA 1V92A 3LCUA 1NV9A 1WJ7A 1VEKA 2JNHA 3MMPA 2MROB 2ZTCA 4HEOA 1OAIA 2DHYA 1ZV1A 3K9OA 2EJSA 2G3QA 2MGWA 2MR9A 1DO0A 1CUKA 3E21A 2DI0A 3F92A 4F1IA 1WR1B 4UN2B 2JY8A 1WGNA 2KNVA 1E94E 2O25A 4F2LA 1VEGA 2WZJA 2DAKA 2LVAA 2KHHA 1IFYA 2OOBA 1HT2E 1XXHE 1NV8A 1DO2A 3IECA 1ZMUA 1VEJA 2JP7A 2OO9A 1T6OA 1HJPA 3T6PA 2QNJA 4DBGB 1WIVA 2L2DA 3FRHA 2DAMA 2LVQD 1Y8GA 1YLAA 1IXSA 2OOAA 2HAKA 2LTUA 2LBCA 1F4IA 3GLHE 2CWBA 1HT1E 3LCVB 1A5TA 1OQYA 3FRIA 2EKKA 2KNZA 1XB2B 1PGYA 1VQ1A 4Q7JA 1AIPC 2DAGA 2BWBA 2JY7A 1C7YA 1G3IA 4R71A 1TTEA 2BWEA 2QHOB 2DAIA 2DKLA 1VDLA 1G41A 3FE3A 2JZ0A 1HQYE 1BVSA 1OTRA 2KNAA 3K9PA 4G3OA 1G4AE 1KYIA 2DENA 5JI2E 2K9DA 2DAEA 2K0BX 2LVNC 1R4GA 1Q02A 3BBZA 1ZMVA 2L4FA 2DZLA 2L4EA 5DFLA 2ZTDA 1WGLA 1QZEA 1OKSA 1MN3A 2RRUA 2H5XA 1TR8A 3GLFE 1ZMWA 3E46A 4GEWA 3GLIE 1EFUB 2JY5A 1JR3E 1VG5A 2JZ1A 1GO5A 4WP2A 2CP8A 2LVPC 2QSFX 3GLGE 1DV0A 2B3TA 2HWJA 1T43A 1UFZA 3H4JA 2EKFA 2JY6B 2LVOC 1SG9A 2JUJA 3B89A 2MJ5B
chains in the Genus database with same CATH superfamily
1KFVA 2KRUA 1XHBA 5C18A 4LF4M 3U6EA 2DNAA 2YQZA 3KW6A 1OFHA 1IQPA 2GQFA 4FW9A 1VEKA 4PDIA 2JNHA 3KOWE 4DV6M 2QBYB 2MROB 3CF0A 4G4QA 4DR6M 3HJQA 1YSYA 3U6SA 4M0WA 3B7ZA 3FD9A 3W0LB 3QWLA 3B74A 4XK8F 7CATA 2MGWA 2MR9A 1DO0A 3DA1A 3HX3A 4KLNA 3F92A 4F1IA 2VQFM 4EIWA 4LJ7A 1QDRA 5IREB 3ZH9B 1NY6A 5LMUM 2R65A 1E94E 2CEAA 2O5RA 2O25A 2UXCM 5EP3A 1VEGA 4NOOB 4TUWA 5FTMA 3BOSA 2F5QA 3GLFA 2DAKA 1ZQ9A 2KHHA 3HJ8A 1N75A 1IXZA 8CATA 2CV1A 5ITTA 2KXEA 2XLJA 2K6BA 3GLHA 1L8QA 1NHWC 3HZJA 4KT0F 3U6QA 4M9ZA 2UUAM 3IECA 3GQ5A 4DUYM 4S12A 3KOXE 1TH3A 4Z8XA 1T6OA 1DGHA 4M9XA 1X37A 3W68A 2QBYA 5EP1A 4K0KM 4LZJA 4HLQA 2K47A 2Y0QA 2DHRA 3HU1A 1N78A 4REZA 4IBDA 2Y21A 1Y8GA 2XEPA 4L78A 2L7HA 1N36M 4GKKM 1YUBA 3E4RA 1WXQA 2Q2EB 3GLIA 2HAKA 2OQ4A 3SYKA 4DV4M 2LBCA 2EO2A 1F4IA 4QNRA 2CWBA 4IBKA 4DR4M 2ZBKB 1NSFA 3C3DA 3UGJA 4KHPM 3SC3A 1R5LA 3V76A 1NY5A 1SXJA 4Q7JA 3AL0C 1AIPC 5DYIA 2DZNB 2X8AA 3CF6E 1IN6A 2FH0A 3SASA 1J5EM 3THGA 2KZUA 3U61B 1TTEA 2C9OA 2LXEA 1N33M 2BWEA 2QHOB 2DAIA 1IBLM 5EQTA 2R4JA 4RF1A 3U6CA 4LF7M 4R7GA 3KOZE 2JZ0A 4G3OA 5IT9S 4LZZA 1QDTA 3I4VA 3K9PA 3PNYA 4DV7M 1XXHB 2VDBB 3E9SA 3KXEC 1D0KA 4X65M 5JI2E 1IN4A 1TDHA 3J2PB 1J7KA 2K9DA 3I04M 4G6ZA 4OVZB 1C1KA 3J81S 1N77A 5ITXE 4DR1M 4LF9M 4LJ5A 4JI2M 4JI5M 2L4FA 2BNKA 2DWLA 3NWLA 2VQEM 1WGLA 4DV5M 1V34A 4RKUF 1Z5CA 3HY5A 3GPXA 3J27B 2N35A 4IBIA 2R62A 4I81A 3C58A 4G4RA 2F5SA 3NBXX 2LHGA 4LRTA 4P17A 4DR7M 1NJGA 3LQQA 4AKGA 2JY5A 4NXNM 3K92A 1T3TA 4KO8A 5EJCA 2ZM6M 4AZFA 4JI1M 2CFOA 3GO8A 5BPVA 2B3TA 2HWJA 5A2QS 3VKGA 2YNMD 4G4OA 1IY2A 3TWKA 4JI4M 2C5RA 1L1ZA 1AUAA 3FKEA 3SHFA 2MJ5B 4MGKE 3GQ4A 4LFAM 4AQYM 2Z7JA 3L27A 3GRUA 2UXDM 3HU3A 2R46A 3L28A 1P3QQ 5EP4A 3IHPA 3M6AA 1HNXM 1IN7A 1SXJD 2APLA 4FCWA 2EA0A 2D7EA 2KEBA 2F5NA 3AFHA 2DHYA 1HNZM 2C96A 1ZV1A 4FVMA 3K9OA 1E9SA 4NSOB 4JI8M 3LQRA 5FTNA 2FNAA 2DI0A 1EIJA 1TH2A 1HR0M 3TWLA 4MGYE 2M60A 3KP0E 1Q3BA 1TH4A 4LY6A 3TQSA 2P5TA 2JY8A 4L15A 1XNRM 4M0DA 3FYCA 4PDGA 3U6MA 1R2YA 1TF0B 1JB0F 4B7FA 1QZMA 4F2LA 1HQCA 2WSEF 2WZJA 4NRWA 3SBJA 3GP1A 4QHTA 2ZAMA 2OOBA 4DV3M 1HT2E 5KO3A 2KDLA 2X49A 1MX0A 1NV8A 3AOEA 2F5PA 5IWAM 2H1RA 4IBBA 2JP7A 5ITXA 5E26A 3HHZA 3SAUA 1DGHB 2QNJA 2YR0A 4IBEA 1FNNA 2ZAOA 5EXPA 5FTJA 2MH8A 1D0MA 3GPYA 1WIVA 2L2DA 4NSRA 4M9SA 4MB7A 3PXGA 2DWMA 3AOEC 1IXSA 1G71A 4FD2A 2OOAA 3GLGB 1L2CA 4ANRA 1XNQM 3JAMS 2R4EA 1MJGM 4LJ8A 1PRBA 4I4LA 3GLHE 3KS4A 5KQDA 1OQYA 2FFJA 2EKKA 3B7NA 1XB2B 3KVWA 1VQ1A 3K1JA 3R8FA 2L6OA 3HWSA 4LRSA 2C99A 3T38A 5F3WA 2BWBA 2JY7A 3SHGB 2YFQA 4ZPXA 3A98B 3M7GA 3WHKA 4R71A 3AKZA 3RGSA 1QANA 3HHYA 3GLIB 5ITUA 1VDLA 4OW0A 1QQWA 2OPFA 1R7RA 3FE3A 4NRVA 1OTRA 4ITQA 2Z8YM 1GJSA 4D80A 4CISA 2L7IA 3U60A 4Y28F 1KYIA 2DENA 1XXHA 4LF8M 3GLGA 2GNOA 4I5SA 2K0BX 1IBMM 1PM5A 1Q02A 4GC9A 1Q39A 1OAOC 2ZTDA 1Q3CA 3EIEA 3U61A 2F5OA 2Y20A 1OKSA 1MN3A 1TDZA 1NNJA 2H5XA 4DV1M 3FTEA 2DXIA 2XZFA 2ZANA 2NQ8C 3GLFE 1QUSA 5DNYA 4LJ9A 1NNUC 1R2ZA 3VKHA 5E6JA 4JI3M 1OFIA 4FWDA 5EXSA 1XC8A 4MH0E 4BB9A 2JWSA 2UUCM 1VG5A 1DGBA 1GO5A 4GITA 4WP2A 2QZ4A 2CP8A 4FCVA 3GLGE 2C98A 2HKJA 1PJTA 3QYBA 1T43A 2XFSA 2FOIC 4B08A 2JY6B 3KSJA 3TPZA 1XMQM 3U60B 2LVOC 2G5GX 4DUZM 3T1YM 4DV0M 1I94M 4B7HA 1PJJA 1IN8A 1HNWM 2DVWB 3D8LA 1QUTA 1UM8A 1GJTA 2XFTA 3C9PA 2VF8A 2WSCF 4FCTA 3ZQJA 1IM2A 2LHCA 3QYEA 3AOGA 5ITRA 3VLFB 1V92A 1K3WA 1NV9A 4GKJM 1WJ7A 3A45A 2UUBM 3U5ZB 3MMPA 4LF5M 3L26A 2ZTCA 1OAIA 3GLFB 4IJEA 3SAVA 2EJSA 3SAWA 4PT5A 3E21A 2HL7A 3T1HM 1NO1A 1SXJE 1WR1B 3LMMA 4IIWA 2C9CA 4UN2B 3WHLA 2V1UA 3GPUA 2X4AA 4YY3M 1GLNA 2KW0A 4MGHA 3UJNA 2XZUA 1NVMA 4LGYA 3GPPA 2DZOB 1LTMA 3VDPA 1IN5A 3J7AS 2XGNA 2QCUA 2JXNA 3FYDA 3HHWA 4MGIE 2UU9M 3UMMA 3ZCBB 1ZMUA 3LW5F 4W5WA 1NJFA 1Z5BA 2OO9A 4II7A 1D0LA 4BLCA 2QQ8A 1HJPA 3U5ZA 3H4MA 4BBAA 3T6PA 4CIZA 3SYLA 1E32A 3FUXA 3DOAA 2Y0TA 4XGIA 2ERCA 2HCBA 4D81A 3FRHA 2O01F 3UK6A 1Z59A 3LVWA 3SMSA 3L2AA 2LTUA 3K2LA 4CHTB 5JI3E 4X62M 4DV2M 4X64M 5BR8M 4IBCA 4CGYB 1HT1E 3ILKA 3LCVB 4GC5A 1A5TA 4B3MM 3KSXA 3FRIA 5KPRA 4AKIA 2KNZA 3JR5A 3C3EA 3Q8GA 4NXMM 3W0FA 1E9RA 4AKHA 1GL6A 1PGYA 3I51A 3HJSA 3RGPA 1QAMA 3SFZA 3VK8A 3I4YA 3FTDA 1PJIA 3KP1E 4LJ4A 4RF0A 4LJ6A 4B3SM 2RKOA 4LFCM 4MGZE 1IXSB 2LNHC 3RFWA 4AG5A 1RU3A 5L8RF 2J7NA 4P16A 1S3SA 3TWMA 2DKLA 4OU7A 1G41A 3GQ3A 4IBGA 2KNAA 1BVSA 3MHVC 4QOSA 2J5YA 2Z3XA 2FS1A 2Z4RA 3U6PA 4LGMA 4NC6A 4GH9A 3J80S 3CTWB 1ZAEA 2A5YB 1FJGM 4L8RC 2LVNC 2VIIA 1OIZA 4QNMA 3BBZA 5LMNM 3D8BA 1DGGA 2RRUA 2WSFF 4JI0M 1K82A 2R6FA 5DYGA 1TR8A 4GMQA 4B7GA 4LF6M 4GEWA 1W5SA 3GLIE 3U6OA 3FTCA 3DFZA 1KSFX 3M0EA 1JR3E 4JN6A 1IY1A 3R9XB 2CV0A 2KRKA 2JZ1A 3GRVA 2RGOA 1DV0A 2QSFX 2LVPC 1IY0A 5H37D 4GHAA 1G59A 3HGIA 3FUTA 4JYAM 4AW4A 3U6DA 1LV7A 5FLXS 2EKFA 3MK6A 1IBKM 4DR3M 2JUJA 3SARA 2G8LA 4XBOA 3T15A 3CGWA 1WHCA 4HL4A 3KS8A 5KQ8A 1OIPA 5EXXA 2R0IA 2KA6B 3FTFA 5KPTA 2Z4SA 4Z6YA 3Q8XA 1YE9A 1V33A 3LCUA 3L29A 1MU5A 1I4WA 5ITQA 3RE8A 1PJSA 4NL4H 5ITYA 2DWNA 4HEOA 4B3TM 4L4UA 2QENA 2G3QA 3SATA 2QPAA 1CUKA 4LCBA 3PNVA 3PFIA 2CUZA 4A3VB 3FUWA 1TGUA 4LG2A 4AI6A 2AHMA 3I01M 4D82A 4WW0A 1NHGC 1WGNA 4GRIA 2KNVA 3HHXA 4IBJA 1QAQA 4PD2A 4PCZA 1GKIA 2R45A 3DZDA 3J7BA 1QAOA 3K8ZA 2LVAA 4G4NA 2R18A 1JR3D 3VDUA 4JV5M 1IFYA 3GLHB 5FTKA 5C1BA 1L2DA 3SMPA 4MM3B 3AV0A 4IBFA 1XXHE 1DO2A 1OJLA 4AG6A 2BJWA 2XSZD 1K3XA 1VEJA 3KOYE 1L2BA 2KZSA 4YHHM 1R6BX 1N34M 2XH9A 4GIPA 1D2NA 4DBGB 3FUUA 3U6LA 2XSZA 4LJAA 1DGFA 2DAMA 2LVQD 3CF2A 1YLAA 5KPZA 1XMOM 4WURA 2CHQA 2I7NA 3GRYA 2F4VM 3UZUA 1J09A 5FTLA 4OX9M 2E5LM 2QP9X 1L1TA 1JR3A 2XF3A 3NBIA 5GKNA 4B3RM 3HKPA 3B7QA 2VF7A 3EIHA 4JI6M 1W5TA 2FE8A 1QYRA 1SXJB 4GHLA 4OVZA 3KFUG 2LH0A 2V1CA 2DAGA 3KDSE 1GVNA 3LVVA 1C7YA 2CRUA 3IG8A 1G3IA 1Z5AA 3VFDA 2L09A 3A42A 4FWGA 4JI7M 2LWXA 3GRRA 2JA2A 2D7HA 5FSWA 3ZC7B 4CJ6A 2RGHA 1HQYE 2J7OA 3BXWA 1G4AE 2CV2A 1ORYB 1PJQA 2DAEA 4QOZC 4L6V6 4RNAA 3JR4A 1R4GA 4IJFA 1EE8A 1ZMVA 2W82A 3IG5A 2DZLA 2L4EA 1IXRC 5DFLA 4R3DA 3A46A 5IZ7D 3FUVA 4I8OA 1QZEA 1SXJC 3QAUA 2HHHM 2BJVA 2V6ZM 3OTOM 5EXTA 4DR2M 1N32M 2CHGA 4LFBM 1ZMWA 2D7GA 4FWHA 5EP2A 1GL7A 3E46A 4JXJA 3W67A 3MJ5A 1EFUB 2DWZB 4QHSA 1JQJC 2UXBM 2CHVA 1H6UA 1VDDA 4DR5M 2I7PA 3PVSA 1Z6TA 3TE6A 1UFZA 3H4JA 3TL4X 2EUCA 3L25A 2CE7A 3VK7A 4KODA 3HU2A 1GABA 1G8PA 1XWIA 1QVRA 1SG9A 2R44A 3AJIB 3B89A 3B9PA 2M5ZA 4L16A 4X66M
chains in the Genus database with same CATH topology
1WHCA 2R0IA 1IM2A 1P3QQ 2DNAA 3IHPA 1V92A 3LCUA 1NV9A 1WJ7A 1VEKA 2JNHA 3MMPA 2MROB 2ZTCA 4HEOA 1OAIA 2DHYA 1ZV1A 3K9OA 2EJSA 2G3QA 2MGWA 2MR9A 1DO0A 1CUKA 3E21A 2DI0A 3F92A 4F1IA 1WR1B 4UN2B 2JY8A 1WGNA 2KNVA 1E94E 2O25A 4F2LA 1VEGA 2WZJA 2DAKA 2LVAA 2KHHA 1IFYA 2OOBA 1HT2E 1XXHE 1NV8A 1DO2A 3IECA 1ZMUA 1VEJA 2JP7A 2OO9A 1T6OA 1HJPA 3T6PA 2QNJA 4DBGB 1WIVA 2L2DA 3FRHA 2DAMA 2LVQD 1Y8GA 1YLAA 1IXSA 2OOAA 2HAKA 2LTUA 2LBCA 1F4IA 3GLHE 2CWBA 1HT1E 3LCVB 1A5TA 1OQYA 3FRIA 2EKKA 2KNZA 1XB2B 1PGYA 1VQ1A 4Q7JA 1AIPC 2DAGA 2BWBA 2JY7A 1C7YA 1G3IA 4R71A 1TTEA 2BWEA 2QHOB 2DAIA 2DKLA 1VDLA 1G41A 3FE3A 2JZ0A 1HQYE 1BVSA 1OTRA 2KNAA 3K9PA 4G3OA 1G4AE 1KYIA 2DENA 5JI2E 2K9DA 2DAEA 2K0BX 2LVNC 1R4GA 1Q02A 3BBZA 1ZMVA 2L4FA 2DZLA 2L4EA 5DFLA 2ZTDA 1WGLA 1QZEA 1OKSA 1MN3A 2RRUA 2H5XA 1TR8A 3GLFE 1ZMWA 3E46A 4GEWA 3GLIE 1EFUB 2JY5A 1JR3E 1VG5A 2JZ1A 1GO5A 4WP2A 2CP8A 2LVPC 2QSFX 3GLGE 1DV0A 2B3TA 2HWJA 1T43A 1UFZA 3H4JA 2EKFA 2JY6B 2LVOC 1SG9A 2JUJA 3B89A 2MJ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHC A;  2R0I A;  1IM2 A;  1P3Q Q;  2DNA A;  3IHP A;  1V92 A;  3LCU A;  1NV9 A;  1WJ7 A;  1VEK A;  2JNH A;  3MMP A;  2MRO B;  2ZTC A;  4HEO A;  1OAI A;  2DHY A;  1ZV1 A;  3K9O A;  2EJS A;  2G3Q A;  2MGW A;  2MR9 A;  1DO0 A;  1CUK A;  3E21 A;  2DI0 A;  3F92 A;  4F1I A;  1WR1 B;  4UN2 B;  2JY8 A;  1WGN A;  2KNV A;  1E94 E;  2O25 A;  4F2L A;  1VEG A;  2WZJ A;  2DAK A;  2LVA A;  2KHH A;  1IFY A;  2OOB A;  1HT2 E;  1XXH E;  1NV8 A;  1DO2 A;  3IEC A;  1ZMU A;  1VEJ A;  2JP7 A;  2OO9 A;  1T6O A;  1HJP A;  3T6P A;  2QNJ A;  4DBG B;  1WIV A;  2L2D A;  3FRH A;  2DAM A;  2LVQ D;  1Y8G A;  1YLA A;  1IXS A;  2OOA A;  2HAK A;  2LTU A;  2LBC A;  1F4I A;  3GLH E;  2CWB A;  1HT1 E;  3LCV B;  1A5T A;  1OQY A;  3FRI A;  2EKK A;  2KNZ A;  1XB2 B;  1PGY A;  1VQ1 A;  4Q7J A;  1AIP C;  2DAG A;  2BWB A;  2JY7 A;  1C7Y A;  1G3I A;  4R71 A;  1TTE A;  2BWE A;  2QHO B;  2DAI A;  2DKL A;  1VDL A;  1G41 A;  3FE3 A;  2JZ0 A;  1HQY E;  1BVS A;  1OTR A;  2KNA A;  3K9P A;  4G3O A;  1G4A E;  1KYI A;  2DEN A;  5JI2 E;  2K9D A;  2DAE A;  2K0B X;  2LVN C;  1R4G A;  1Q02 A;  3BBZ A;  1ZMV A;  2L4F A;  2DZL A;  2L4E A;  5DFL A;  2ZTD A;  1WGL A;  1QZE A;  1OKS A;  1MN3 A;  2RRU A;  2H5X A;  1TR8 A;  3GLF E;  1ZMW A;  3E46 A;  4GEW A;  3GLI E;  1EFU B;  2JY5 A;  1JR3 E;  1VG5 A;  2JZ1 A;  1GO5 A;  4WP2 A;  2CP8 A;  2LVP C;  2QSF X;  3GLG E;  1DV0 A;  2B3T A;  2HWJ A;  1T43 A;  1UFZ A;  3H4J A;  2EKF A;  2JY6 B;  2LVO C;  1SG9 A;  2JUJ A;  3B89 A;  2MJ5 B; 
#chains in the Genus database with same CATH topology
 1KFV A;  2KRU A;  1XHB A;  5C18 A;  4LF4 M;  3U6E A;  2DNA A;  2YQZ A;  3KW6 A;  1OFH A;  1IQP A;  2GQF A;  4FW9 A;  1VEK A;  4PDI A;  2JNH A;  3KOW E;  4DV6 M;  2QBY B;  2MRO B;  3CF0 A;  4G4Q A;  4DR6 M;  3HJQ A;  1YSY A;  3U6S A;  4M0W A;  3B7Z A;  3FD9 A;  3W0L B;  3QWL A;  3B74 A;  4XK8 F;  7CAT A;  2MGW A;  2MR9 A;  1DO0 A;  3DA1 A;  3HX3 A;  4KLN A;  3F92 A;  4F1I A;  2VQF M;  4EIW A;  4LJ7 A;  1QDR A;  5IRE B;  3ZH9 B;  1NY6 A;  5LMU M;  2R65 A;  1E94 E;  2CEA A;  2O5R A;  2O25 A;  2UXC M;  5EP3 A;  1VEG A;  4NOO B;  4TUW A;  5FTM A;  3BOS A;  2F5Q A;  3GLF A;  2DAK A;  1ZQ9 A;  2KHH A;  3HJ8 A;  1N75 A;  1IXZ A;  8CAT A;  2CV1 A;  5ITT A;  2KXE A;  2XLJ A;  2K6B A;  3GLH A;  1L8Q A;  1NHW C;  3HZJ A;  4KT0 F;  3U6Q A;  4M9Z A;  2UUA M;  3IEC A;  3GQ5 A;  4DUY M;  4S12 A;  3KOX E;  1TH3 A;  4Z8X A;  1T6O A;  1DGH A;  4M9X A;  1X37 A;  3W68 A;  2QBY A;  5EP1 A;  4K0K M;  4LZJ A;  4HLQ A;  2K47 A;  2Y0Q A;  2DHR A;  3HU1 A;  1N78 A;  4REZ A;  4IBD A;  2Y21 A;  1Y8G A;  2XEP A;  4L78 A;  2L7H A;  1N36 M;  4GKK M;  1YUB A;  3E4R A;  1WXQ A;  2Q2E B;  3GLI A;  2HAK A;  2OQ4 A;  3SYK A;  4DV4 M;  2LBC A;  2EO2 A;  1F4I A;  4QNR A;  2CWB A;  4IBK A;  4DR4 M;  2ZBK B;  1NSF A;  3C3D A;  3UGJ A;  4KHP M;  3SC3 A;  1R5L A;  3V76 A;  1NY5 A;  1SXJ A;  4Q7J A;  3AL0 C;  1AIP C;  5DYI A;  2DZN B;  2X8A A;  3CF6 E;  1IN6 A;  2FH0 A;  3SAS A;  1J5E M;  3THG A;  2KZU A;  3U61 B;  1TTE A;  2C9O A;  2LXE A;  1N33 M;  2BWE A;  2QHO B;  2DAI A;  1IBL M;  5EQT A;  2R4J A;  4RF1 A;  3U6C A;  4LF7 M;  4R7G A;  3KOZ E;  2JZ0 A;  4G3O A;  5IT9 S;  4LZZ A;  1QDT A;  3I4V A;  3K9P A;  3PNY A;  4DV7 M;  1XXH B;  2VDB B;  3E9S A;  3KXE C;  1D0K A;  4X65 M;  5JI2 E;  1IN4 A;  1TDH A;  3J2P B;  1J7K A;  2K9D A;  3I04 M;  4G6Z A;  4OVZ B;  1C1K A;  3J81 S;  1N77 A;  5ITX E;  4DR1 M;  4LF9 M;  4LJ5 A;  4JI2 M;  4JI5 M;  2L4F A;  2BNK A;  2DWL A;  3NWL A;  2VQE M;  1WGL A;  4DV5 M;  1V34 A;  4RKU F;  1Z5C A;  3HY5 A;  3GPX A;  3J27 B;  2N35 A;  4IBI A;  2R62 A;  4I81 A;  3C58 A;  4G4R A;  2F5S A;  3NBX X;  2LHG A;  4LRT A;  4P17 A;  4DR7 M;  1NJG A;  3LQQ A;  4AKG A;  2JY5 A;  4NXN M;  3K92 A;  1T3T A;  4KO8 A;  5EJC A;  2ZM6 M;  4AZF A;  4JI1 M;  2CFO A;  3GO8 A;  5BPV A;  2B3T A;  2HWJ A;  5A2Q S;  3VKG A;  2YNM D;  4G4O A;  1IY2 A;  3TWK A;  4JI4 M;  2C5R A;  1L1Z A;  1AUA A;  3FKE A;  3SHF A;  2MJ5 B;  4MGK E;  3GQ4 A;  4LFA M;  4AQY M;  2Z7J A;  3L27 A;  3GRU A;  2UXD M;  3HU3 A;  2R46 A;  3L28 A;  1P3Q Q;  5EP4 A;  3IHP A;  3M6A A;  1HNX M;  1IN7 A;  1SXJ D;  2APL A;  4FCW A;  2EA0 A;  2D7E A;  2KEB A;  2F5N A;  3AFH A;  2DHY A;  1HNZ M;  2C96 A;  1ZV1 A;  4FVM A;  3K9O A;  1E9S A;  4NSO B;  4JI8 M;  3LQR A;  5FTN A;  2FNA A;  2DI0 A;  1EIJ A;  1TH2 A;  1HR0 M;  3TWL A;  4MGY E;  2M60 A;  3KP0 E;  1Q3B A;  1TH4 A;  4LY6 A;  3TQS A;  2P5T A;  2JY8 A;  4L15 A;  1XNR M;  4M0D A;  3FYC A;  4PDG A;  3U6M A;  1R2Y A;  1TF0 B;  1JB0 F;  4B7F A;  1QZM A;  4F2L A;  1HQC A;  2WSE F;  2WZJ A;  4NRW A;  3SBJ A;  3GP1 A;  4QHT A;  2ZAM A;  2OOB A;  4DV3 M;  1HT2 E;  5KO3 A;  2KDL A;  2X49 A;  1MX0 A;  1NV8 A;  3AOE A;  2F5P A;  5IWA M;  2H1R A;  4IBB A;  2JP7 A;  5ITX A;  5E26 A;  3HHZ A;  3SAU A;  1DGH B;  2QNJ A;  2YR0 A;  4IBE A;  1FNN A;  2ZAO A;  5EXP A;  5FTJ A;  2MH8 A;  1D0M A;  3GPY A;  1WIV A;  2L2D A;  4NSR A;  4M9S A;  4MB7 A;  3PXG A;  2DWM A;  3AOE C;  1IXS A;  1G71 A;  4FD2 A;  2OOA A;  3GLG B;  1L2C A;  4ANR A;  1XNQ M;  3JAM S;  2R4E A;  1MJG M;  4LJ8 A;  1PRB A;  4I4L A;  3GLH E;  3KS4 A;  5KQD A;  1OQY A;  2FFJ A;  2EKK A;  3B7N A;  1XB2 B;  3KVW A;  1VQ1 A;  3K1J A;  3R8F A;  2L6O A;  3HWS A;  4LRS A;  2C99 A;  3T38 A;  5F3W A;  2BWB A;  2JY7 A;  3SHG B;  2YFQ A;  4ZPX A;  3A98 B;  3M7G A;  3WHK A;  4R71 A;  3AKZ A;  3RGS A;  1QAN A;  3HHY A;  3GLI B;  5ITU A;  1VDL A;  4OW0 A;  1QQW A;  2OPF A;  1R7R A;  3FE3 A;  4NRV A;  1OTR A;  4ITQ A;  2Z8Y M;  1GJS A;  4D80 A;  4CIS A;  2L7I A;  3U60 A;  4Y28 F;  1KYI A;  2DEN A;  1XXH A;  4LF8 M;  3GLG A;  2GNO A;  4I5S A;  2K0B X;  1IBM M;  1PM5 A;  1Q02 A;  4GC9 A;  1Q39 A;  1OAO C;  2ZTD A;  1Q3C A;  3EIE A;  3U61 A;  2F5O A;  2Y20 A;  1OKS A;  1MN3 A;  1TDZ A;  1NNJ A;  2H5X A;  4DV1 M;  3FTE A;  2DXI A;  2XZF A;  2ZAN A;  2NQ8 C;  3GLF E;  1QUS A;  5DNY A;  4LJ9 A;  1NNU C;  1R2Z A;  3VKH A;  5E6J A;  4JI3 M;  1OFI A;  4FWD A;  5EXS A;  1XC8 A;  4MH0 E;  4BB9 A;  2JWS A;  2UUC M;  1VG5 A;  1DGB A;  1GO5 A;  4GIT A;  4WP2 A;  2QZ4 A;  2CP8 A;  4FCV A;  3GLG E;  2C98 A;  2HKJ A;  1PJT A;  3QYB A;  1T43 A;  2XFS A;  2FOI C;  4B08 A;  2JY6 B;  3KSJ A;  3TPZ A;  1XMQ M;  3U60 B;  2LVO C;  2G5G X;  4DUZ M;  3T1Y M;  4DV0 M;  1I94 M;  4B7H A;  1PJJ A;  1IN8 A;  1HNW M;  2DVW B;  3D8L A;  1QUT A;  1UM8 A;  1GJT A;  2XFT A;  3C9P A;  2VF8 A;  2WSC F;  4FCT A;  3ZQJ A;  1IM2 A;  2LHC A;  3QYE A;  3AOG A;  5ITR A;  3VLF B;  1V92 A;  1K3W A;  1NV9 A;  4GKJ M;  1WJ7 A;  3A45 A;  2UUB M;  3U5Z B;  3MMP A;  4LF5 M;  3L26 A;  2ZTC A;  1OAI A;  3GLF B;  4IJE A;  3SAV A;  2EJS A;  3SAW A;  4PT5 A;  3E21 A;  2HL7 A;  3T1H M;  1NO1 A;  1SXJ E;  1WR1 B;  3LMM A;  4IIW A;  2C9C A;  4UN2 B;  3WHL A;  2V1U A;  3GPU A;  2X4A A;  4YY3 M;  1GLN A;  2KW0 A;  4MGH A;  3UJN A;  2XZU A;  1NVM A;  4LGY A;  3GPP A;  2DZO B;  1LTM A;  3VDP A;  1IN5 A;  3J7A S;  2XGN A;  2QCU A;  2JXN A;  3FYD A;  3HHW A;  4MGI E;  2UU9 M;  3UMM A;  3ZCB B;  1ZMU A;  3LW5 F;  4W5W A;  1NJF A;  1Z5B A;  2OO9 A;  4II7 A;  1D0L A;  4BLC A;  2QQ8 A;  1HJP A;  3U5Z A;  3H4M A;  4BBA A;  3T6P A;  4CIZ A;  3SYL A;  1E32 A;  3FUX A;  3DOA A;  2Y0T A;  4XGI A;  2ERC A;  2HCB A;  4D81 A;  3FRH A;  2O01 F;  3UK6 A;  1Z59 A;  3LVW A;  3SMS A;  3L2A A;  2LTU A;  3K2L A;  4CHT B;  5JI3 E;  4X62 M;  4DV2 M;  4X64 M;  5BR8 M;  4IBC A;  4CGY B;  1HT1 E;  3ILK A;  3LCV B;  4GC5 A;  1A5T A;  4B3M M;  3KSX A;  3FRI A;  5KPR A;  4AKI A;  2KNZ A;  3JR5 A;  3C3E A;  3Q8G A;  4NXM M;  3W0F A;  1E9R A;  4AKH A;  1GL6 A;  1PGY A;  3I51 A;  3HJS A;  3RGP A;  1QAM A;  3SFZ A;  3VK8 A;  3I4Y A;  3FTD A;  1PJI A;  3KP1 E;  4LJ4 A;  4RF0 A;  4LJ6 A;  4B3S M;  2RKO A;  4LFC M;  4MGZ E;  1IXS B;  2LNH C;  3RFW A;  4AG5 A;  1RU3 A;  5L8R F;  2J7N A;  4P16 A;  1S3S A;  3TWM A;  2DKL A;  4OU7 A;  1G41 A;  3GQ3 A;  4IBG A;  2KNA A;  1BVS A;  3MHV C;  4QOS A;  2J5Y A;  2Z3X A;  2FS1 A;  2Z4R A;  3U6P A;  4LGM A;  4NC6 A;  4GH9 A;  3J80 S;  3CTW B;  1ZAE A;  2A5Y B;  1FJG M;  4L8R C;  2LVN C;  2VII A;  1OIZ A;  4QNM A;  3BBZ A;  5LMN M;  3D8B A;  1DGG A;  2RRU A;  2WSF F;  4JI0 M;  1K82 A;  2R6F A;  5DYG A;  1TR8 A;  4GMQ A;  4B7G A;  4LF6 M;  4GEW A;  1W5S A;  3GLI E;  3U6O A;  3FTC A;  3DFZ A;  1KSF X;  3M0E A;  1JR3 E;  4JN6 A;  1IY1 A;  3R9X B;  2CV0 A;  2KRK A;  2JZ1 A;  3GRV A;  2RGO A;  1DV0 A;  2QSF X;  2LVP C;  1IY0 A;  5H37 D;  4GHA A;  1G59 A;  3HGI A;  3FUT A;  4JYA M;  4AW4 A;  3U6D A;  1LV7 A;  5FLX S;  2EKF A;  3MK6 A;  1IBK M;  4DR3 M;  2JUJ A;  3SAR A;  2G8L A;  4XBO A;  3T15 A;  3CGW A;  1WHC A;  4HL4 A;  3KS8 A;  5KQ8 A;  1OIP A;  5EXX A;  2R0I A;  2KA6 B;  3FTF A;  5KPT A;  2Z4S A;  4Z6Y A;  3Q8X A;  1YE9 A;  1V33 A;  3LCU A;  3L29 A;  1MU5 A;  1I4W A;  5ITQ A;  3RE8 A;  1PJS A;  4NL4 H;  5ITY A;  2DWN A;  4HEO A;  4B3T M;  4L4U A;  2QEN A;  2G3Q A;  3SAT A;  2QPA A;  1CUK A;  4LCB A;  3PNV A;  3PFI A;  2CUZ A;  4A3V B;  3FUW A;  1TGU A;  4LG2 A;  4AI6 A;  2AHM A;  3I01 M;  4D82 A;  4WW0 A;  1NHG C;  1WGN A;  4GRI A;  2KNV A;  3HHX A;  4IBJ A;  1QAQ A;  4PD2 A;  4PCZ A;  1GKI A;  2R45 A;  3DZD A;  3J7B A;  1QAO A;  3K8Z A;  2LVA A;  4G4N A;  2R18 A;  1JR3 D;  3VDU A;  4JV5 M;  1IFY A;  3GLH B;  5FTK A;  5C1B A;  1L2D A;  3SMP A;  4MM3 B;  3AV0 A;  4IBF A;  1XXH E;  1DO2 A;  1OJL A;  4AG6 A;  2BJW A;  2XSZ D;  1K3X A;  1VEJ A;  3KOY E;  1L2B A;  2KZS A;  4YHH M;  1R6B X;  1N34 M;  2XH9 A;  4GIP A;  1D2N A;  4DBG B;  3FUU A;  3U6L A;  2XSZ A;  4LJA A;  1DGF A;  2DAM A;  2LVQ D;  3CF2 A;  1YLA A;  5KPZ A;  1XMO M;  4WUR A;  2CHQ A;  2I7N A;  3GRY A;  2F4V M;  3UZU A;  1J09 A;  5FTL A;  4OX9 M;  2E5L M;  2QP9 X;  1L1T A;  1JR3 A;  2XF3 A;  3NBI A;  5GKN A;  4B3R M;  3HKP A;  3B7Q A;  2VF7 A;  3EIH A;  4JI6 M;  1W5T A;  2FE8 A;  1QYR A;  1SXJ B;  4GHL A;  4OVZ A;  3KFU G;  2LH0 A;  2V1C A;  2DAG A;  3KDS E;  1GVN A;  3LVV A;  1C7Y A;  2CRU A;  3IG8 A;  1G3I A;  1Z5A A;  3VFD A;  2L09 A;  3A42 A;  4FWG A;  4JI7 M;  2LWX A;  3GRR A;  2JA2 A;  2D7H A;  5FSW A;  3ZC7 B;  4CJ6 A;  2RGH A;  1HQY E;  2J7O A;  3BXW A;  1G4A E;  2CV2 A;  1ORY B;  1PJQ A;  2DAE A;  4QOZ C;  4L6V 6;  4RNA A;  3JR4 A;  1R4G A;  4IJF A;  1EE8 A;  1ZMV A;  2W82 A;  3IG5 A;  2DZL A;  2L4E A;  1IXR C;  5DFL A;  4R3D A;  3A46 A;  5IZ7 D;  3FUV A;  4I8O A;  1QZE A;  1SXJ C;  3QAU A;  2HHH M;  2BJV A;  2V6Z M;  3OTO M;  5EXT A;  4DR2 M;  1N32 M;  2CHG A;  4LFB M;  1ZMW A;  2D7G A;  4FWH A;  5EP2 A;  1GL7 A;  3E46 A;  4JXJ A;  3W67 A;  3MJ5 A;  1EFU B;  2DWZ B;  4QHS A;  1JQJ C;  2UXB M;  2CHV A;  1H6U A;  1VDD A;  4DR5 M;  2I7P A;  3PVS A;  1Z6T A;  3TE6 A;  1UFZ A;  3H4J A;  3TL4 X;  2EUC A;  3L25 A;  2CE7 A;  3VK7 A;  4KOD A;  3HU2 A;  1GAB A;  1G8P A;  1XWI A;  1QVR A;  1SG9 A;  2R44 A;  3AJI B;  3B89 A;  3B9P A;  2M5Z A;  4L16 A;  4X66 M; 
#chains in the Genus database with same CATH homology
 1WHC A;  2R0I A;  1IM2 A;  1P3Q Q;  2DNA A;  3IHP A;  1V92 A;  3LCU A;  1NV9 A;  1WJ7 A;  1VEK A;  2JNH A;  3MMP A;  2MRO B;  2ZTC A;  4HEO A;  1OAI A;  2DHY A;  1ZV1 A;  3K9O A;  2EJS A;  2G3Q A;  2MGW A;  2MR9 A;  1DO0 A;  1CUK A;  3E21 A;  2DI0 A;  3F92 A;  4F1I A;  1WR1 B;  4UN2 B;  2JY8 A;  1WGN A;  2KNV A;  1E94 E;  2O25 A;  4F2L A;  1VEG A;  2WZJ A;  2DAK A;  2LVA A;  2KHH A;  1IFY A;  2OOB A;  1HT2 E;  1XXH E;  1NV8 A;  1DO2 A;  3IEC A;  1ZMU A;  1VEJ A;  2JP7 A;  2OO9 A;  1T6O A;  1HJP A;  3T6P A;  2QNJ A;  4DBG B;  1WIV A;  2L2D A;  3FRH A;  2DAM A;  2LVQ D;  1Y8G A;  1YLA A;  1IXS A;  2OOA A;  2HAK A;  2LTU A;  2LBC A;  1F4I A;  3GLH E;  2CWB A;  1HT1 E;  3LCV B;  1A5T A;  1OQY A;  3FRI A;  2EKK A;  2KNZ A;  1XB2 B;  1PGY A;  1VQ1 A;  4Q7J A;  1AIP C;  2DAG A;  2BWB A;  2JY7 A;  1C7Y A;  1G3I A;  4R71 A;  1TTE A;  2BWE A;  2QHO B;  2DAI A;  2DKL A;  1VDL A;  1G41 A;  3FE3 A;  2JZ0 A;  1HQY E;  1BVS A;  1OTR A;  2KNA A;  3K9P A;  4G3O A;  1G4A E;  1KYI A;  2DEN A;  5JI2 E;  2K9D A;  2DAE A;  2K0B X;  2LVN C;  1R4G A;  1Q02 A;  3BBZ A;  1ZMV A;  2L4F A;  2DZL A;  2L4E A;  5DFL A;  2ZTD A;  1WGL A;  1QZE A;  1OKS A;  1MN3 A;  2RRU A;  2H5X A;  1TR8 A;  3GLF E;  1ZMW A;  3E46 A;  4GEW A;  3GLI E;  1EFU B;  2JY5 A;  1JR3 E;  1VG5 A;  2JZ1 A;  1GO5 A;  4WP2 A;  2CP8 A;  2LVP C;  2QSF X;  3GLG E;  1DV0 A;  2B3T A;  2HWJ A;  1T43 A;  1UFZ A;  3H4J A;  2EKF A;  2JY6 B;  2LVO C;  1SG9 A;  2JUJ A;  3B89 A;  2MJ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...