1OKTA

X-ray structure of glutathione s-transferase from the malarial parasite plasmodium falciparum
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
211
structure length
211
Chain Sequence
b'MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title X-Ray Structure of Glutathione S-Transferase from the Malarial Parasite Plasmodium Falciparum
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 73
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1oktA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oktA01
2BJXA 5D96A 2CA8A 3RAZA 1AXDA 4NHWA 1Z3EA 4KCAA 3UAPA 4KA0A 1M2DA 1Y6EA 1ACVA 1FW1A 5JWOB 2LSTA 2WS2A 2H73A 1G7OA 1O6JA 2C3NA 1AQWA 3ZIVA 1XPVA 4TR1B 3WGEA 2EC4A 4FYUA 4PQIA 1EP8A 1XW6A 2HSMB 3W8JA 2PVQA 3RBTA 3NZNA 2FHEA 1XZOA 4L5LA 1HYUA 5COHA 4POLA 3IAM2 1LBKA 5DALB 1PMTA 3LG6A 3FHKA 4QL7A 4PQ1A 1XW5A 4ZILA 3GSTA 3WGXA 4IS0A 3DEXA 4OFMA 2I4AA 2RLIA 3D4MA 2CVDA 3MAKA 1ERUA 1TK8B 2OADA 1SL1B 1XVQA 1BEDA 3FR9A 4NHZA 1GH2A 2H74A 4HU9A 4YAPA 4AGSA 2YZHA 3KH7A 1NSWA 1PGTA 2HLSA 3DKSA 5HFGA 4HOJA 2L5OA 3HXSA 6GSVA 2H0GA 4K1FA 4MJBA 2H0HA 5IMVA 4MF7A 2WULA 2H6YA 4WXTA 3UL3A 3KD0A 4AJ8A 1OC9A 4RQXA 5AN1A 4JZQA 2YP6A 1SK0A 1AIUA 1Z6MA 5HR2A 5B6MA 2LV3A 1T3BA 3DYRA 3FW2A 2QSIA 3HYPA 4ZB9A 3DGQA 2VL2A 3E3EA 5EY6A 8GSSA 4TR3A 4MJAA 4IKHA 1OKDA 4XS1A 2PGTA 3LXTA 3IDVA 4ML1A 5GAND 1ZZYA 1GTUA 2PUKC 1TU7A 4CHSA 5CAXA 2H1BA 3EC3A 2MBTA 3ZMLA 2ES7A 2RIIA 1JZRA 5ECHB 4DSSB 1OE7A 3W8SA 2N5AA 6GSYA 3P7XA 1X9MB 2DJ2A 2FA8A 3QAWA 2NDOA 1QMVA 2MZCA 4BVYA 1F3BA 4KSMA 2KUCA 3C8EA 3TDGA 1Q4JA 1GUMA 5DBQA 1T4YA 4ZL8A 2L6CA 1C72A 5GSSA 3BCIA 4WF4A 3UARA 2CV4A 1XW9A 4K6XA 2M80A 5HQPA 3VURA 4IJIA 3H4KA 3RPPA 5FT3A 4DVCA 2NTOA 3WT1A 5CP1A 1THXA 3HZ8A 2VD0A 3UVHA 5D9TA 2OE3A 3D4TA 3GMFA 5DJLA 3TB2A 2E0QA 2E2GA 3LWAA 4XS4A 4TKYA 1GULA 1ST9A 3GV1A 2X99A 3D0ZA 1PA3A 4OD7A 3O3TA 2V6OA 2CAIA 4TXOA 6GSSA 2DIYA 3LJRA 4OO4A 2H0IA 3KP8A 1OKTA 1FB6A 2B5EA 2K8VA 1GUHA 2J9HA 3BBYA 3GA4A 2AAWA 3GTUB 3HKRA 2IIYA 3L78A 3DD3A 3KTLA 1DSBA 2GSRA 3QMXA 4F0CA 2VLTA 5C00A 2DMLA 1TOFA 3C1SA 3M9KA 3F63A 2DSAA 1YEPA 4IQAA 4BVXB 2C0DA 1ABAA 3UJ1A 1YEXA 4ECJA 2AHEA 3FZAA 5A4WA 1GSSA 1O8WA 3QAGA 2DC5A 4JR6A 1EGRA 3ZVJD 2DJJA 3GL3A 4HJ2A 1MDKA 2E2MA 2KOKA 3TOTA 3F4SA 1GP1A 1RK4A 4IW9A 1QK8A 2RUFA 2FNOA 4TOPA 1SJ6A 4HU7A 3GN3A 4PX1A 3GH6A 2FCHA 5CRWA 2R2JA 3PPUA 4HQSA 3E9JB 20GSA 3IA1A 6GSXA 1NHYA 1YY7A 1OVNA 1ZL9A 3I43A 4WR4A 2L4QA 1HD2A 2H66A 4FYCA 3ZFLA 4FYBA 3HJPA 2JZSA 1DUGA 2OJLA 4Q5FA 3SWLA 2VCQA 4QL9A 2K8SA 1N2AA 3O6TA 1F6MC 4GXZA 1SKRB 5KN3A 1TK0B 2L4CA 1PSQA 1YJ6A 1J9BA 4D73B 2DJ3A 1HQOA 2WB9A 2H75A 5J9BA 4WETA 4NPBA 1SYRA 1GTIA 1TXXA 2CVBA 5J41A 5A5KA 3TKRA 2OE1A 2IFQA 2YJHA 5D73A 2LQOA 3W6GA 1R5AA 5E59A 1URMA 4NWYA 3M0FA 4OCFA 1EWXA 4POKA 3GSSA 2RM6A 4EO3A 3QFAC 2F8FA 5G30A 4XTSA 2CZ2A 3IV4A 3TJFA 1FVKA 4YQMA 3IPZA 2B7JA 5JCUA 2FWHA 4L0WA 3BD2A 1FG4A 2C4JA 2HRKB 1QXHA 1B9YC 1XWAA 1TK5B 12GSA 4MABA 2O85A 2GVPA 4MA9A 3KGKA 4V1Ag 2LJAA 2V2GA 2TIRA 1U87A 1G0TA 2IWTA 4TN8A 5B8AA 1WJKA 2LNSA 1AQXA 2EIQA 1K0OA 5ENUA 3A2WA 1Z5YE 3TCOA 4IBPA 3G7JA 1WRYA 1WE0A 2VIMA 2FY6A 5HFKA 2M46A 2GTUA 1THOA 1M9AA 4TXVA 4I97A 4NMUA 4JE1A 2B3SA 4N0ZA 2PMTA 3L9VA 3IBHA 1V2AA 4GSTA 1SU9A 4KDYA 3R2QA 5HFIA 2C80A 5ID2A 2WDUA 2ON7A 5F06A 3EMPA 4IP6A 4ZBDA 4K0GA 2HYXA 4G10A 5LNKe 3LGCA 3J7Yk 2WJUA 3DWVA 1AUCA 3NIVA 4EVMA 1LU4A 2A2RA 5KN0A 1U88A 1K0CA 5EVOA 3GIXA 3PH9A 2IMDA 3LSZA 3P8WA 4KF9A 4WEYA 1TDIA 1R7HA 5EL8A 4JBBA 4NV5A 4J2FA 1EEMA 2XBQA 4BPYA 3C73A 3I6AA 1O8XA 2YJ7A 5BMUA 5CO3A 4BA7A 3I9V2 3D6IA 3VLNA 5DAKB 2GZPA 3IE3A 2HQTA 2HI7A 4ZL7A 1M99A 3F3RA 4K2DA 1M2BA 5HR1A 2FWFA 4G2EA 2CT6A 3PR8A 4WKWA 4EKZA 2P5RA 3D21A 2H72A 4PXOA 4JU5A 1PKZA 1WMJA 5LD0A 1FHEA 1KBNA 4PUFC 5H5QA 1O7UA 1T00A 1F37A 2HSYA 2DJKA 4EDYA 2HZEB 3ERGA 1K3YA 4EL1A 4O5RA 2C3QA 3OR5A 4GTUA 4KE3A 3VWVA 2CVKA 3E0UA 2HRNA 1SL2B 1ZOFA 4I8BA 3CRTA 3V1WA 1ERVA 3FK8A 1XXUA 1YKAA 18GSA 5J3RA 4N30A 3G7YA 1M7TA 1EEJA 2HRAA 2WCIA 1F3AA 3DVXA 4CDOA 1G6WA 1HNBA 3QOUA 1Z6NA 2H6ZA 4H86A 1J0FA 5D93A 1SK1A 3H93A 1IYHA 4ISDA 5B8BA 1A2LA 1X0RA 2H30A 1EGOA 1VRSD 3G9BA 4EDZA 5IOXA 1BAYA 3KZQA 4MF6A 2H76A 2HSHA 2OBIA 3ZVJA 2WFCA 2VD1A 1ZGNA 4YQUA 4FO5A 2CQ9A 1B8XA 3TUEA 2YWOA 5KN2A 4XIHA 2LJKA 2O89A 4BL7A 2YWNA 3CRUA 2A2SA 4ECCA 1A0RP 2CAQA 2WZ9A 2XPEA 2M72A 4MJCA 4KDXA 1VF4A 4MZBA 2VL3A 3QAVA 2Z9SA 13GSA 1XBSA 2H71A 2NBSA 5IO0A 1SD9A 1F2EA 3BJ5A 2MYGA 5AIXA 4ILFA 1TKDB 1M0UA 2MMZA 2VLUA 2VCTA 3F4RA 2LKUA 4MH3A 3DIEA 4XHMA 5FHIA 5JCGA 1ON4A 2G2QA 4HS1A 4TR1A 5ELGA 2HSMA 1FAAA 3FEUA 1H75A 2FWEA 10GSA 1JLVA 2KP1A 2QGVA 2GQKA 5JCWA 1IYIA 5DALA 2OA7A 3GKNA 4L5OA 1XWCA 2HFDA 2K6VA 1VF2A 4KW6A 4G0LA 5ECSA 3TOUA 2V41A 1TI1A 5DCGA 5HR3A 2GT6A 3IHQA 5IPHA 1ZYEA 2C0GA 4IN0A 5ECLB 3HY2A 4XRDA 3VK9A 4XRAA 4O32A 5JWQB 5CRDA 3TKSA 4PNFA 1X5CA 4HZ2A 2HRFA 3GUSA 2GQMA 4PNGA 1V58A 4TVEA 2N5BA 3F6FA 5HR0A 1SENA 4DSRA 3CTFA 2EIOA 3Q19A 1GWCA 1SL0B 2H1GA 3H79A 5IMDA 2MMNA 5GSTA 2C0FA 1PKWA 2IMKA 5IMCA 3EURA 22GSA 2WRTA 1SJZA 3JCML 4IELA 3L9SA 1OC8A 2FD3A 1Q98A 3GURA 1PN9A 2DBCA 5AIVA 3RDWA 4EUYA 1CQGA 4ZBBA 4YH2A 3APQA 1TRUA 1QUWA 4G0KA 5DJMA 3KTBA 1RQMA 3VWUA 3LYPA 1XFLA 5ECRB 3WD6A 2VAFA 5A4UA 2B6MA 2PVOC 4EC0A 4K7IA 4WF5A 1EP7A 2DLXA 3KH9A 3KXOA 11GSA 1A0FA 1OE8A 4LA1A 4ZBAA 4KUNA 2HE3A 3MWHA 5G31A 2CX3A 2YOIA 2IL3A 4WR5A 2LS5A 5DQYA 1B9XC 3C7MA 1QQ2A 4DSSA 5J5NA 3VI7A 4ACSA 3BOAA 4V2NA 1DBYA 3ZREA 3A2XA 1MEKA 1OC3A 1HNCA 1K0AA 1PX6A 5ID2B 4F0BA 4PTSA 1A2MA 1YQ1A 4IP1A 4ZXGA 4WBRD 14GSA 3GKXA 1R4WA 4ID0A 2VCZA 3ZL5A 1W4VA 4N10A 1MD4A 2PERA 3HZ4A 2PPTA 4X1UA 4F82A 3TRPA 2B7KA 3G7IA 3WGDA 2JADA 1PRXA 3ZZXA 2GQLA 1UC7A 2LRCA 2R3XA 1GNEA 1SKWB 1HNAA 1NW2A 3IC8A 2YANA 1EV9A 5H5RA 2I1UA 4HUAA 4KX4A 4EXJA 3WYWA 1UN2A 2O8VB 3GFKA 3EINA 1ML6A 3KP9A 2YV9A 2ZNMA 1GTAA 2X64A 2LJRA 4DEJA 1K0NA 5KEJA 2O7KA 3MNGA 1NHOA 3GTUA 5IOWA 4EF0A 1A8LA 2IMIA 1A23A 4AJ7A 3IRAA 4MCUA 5F8BA 2VL2C 1ZYQB 2QC7A 2DJ1A 5J9CA 4MH2A 4LL4B 5DVBA 4LMWA 2ALBA 1SK2A 4K7NA 3TRXA 1PX7A 2DMMA 4BVXA 1BYEA 6GSWA 1JHBA 3KM6A 1ILOA 1J08A 1VF3A 4WBJA 5D9XA 3VWWA 4HQZA 1OAZA 4KH7A 5IMAA 3EE2A 4E8EA 1Z7PA 3VPQA 5H5SA 4V1Ap 1GLPA 2P31A 4LL1B 1WOUA 4XS6A 2H8LA 4TRXA 3WT2A 1FOVA 2AV4A 4GCIA 1B4PA 4ZB8A 1V40A 3C1RA 3O76A 1JZDA 2LRTA 1BJXA 4BWQA 4K0NA 5CYYA 2IN3A 3QDNA 5ECMB 5B6NA 5JWRB 3F0IA 3TRQA 2R5GA 5F05A 1Z7RA 5L71A 3Q6OA 1V9WA 4OCEA 3Q18A 1ZMAA 3ISOA 3GNJA 3ZLPA 3N9JA 4USSA 2X8HA 1JFUA 4IVFA 5G5FA 1JLWA 2JACA 5IO2A 2PU9C 1Z9HA 3AY8A 3DMLA 1VGLA 2LQQA 5IPGA 3D22A 3ZTLA 1W89A 3SBCA 4TW5A 2BMXA 1SKSB 2C1YA 1JZOA 2WGRA 2IMEA 4PQHA 5G2ZA 1XVWA 2B5XA 2CX4A 4GRFA 1S3CA 1G7EA 3HCZA 4BL7B 3EVIA 1OC9B 2HRKA 4N11A 5F0GA 4X43A 4EE0A 5IMFA 3J7Yb 1B48A 4HZ4A 5IQYA 4GF0A 1QGVA 4KAEA 3LXZA 4IHUA 4L8EA 1H4OA 1XOAA 1EOHA 4GSSA 3FR3A 2J23A 4MZWA 5IMZA 1ZCPA 3EWLA 3FZ9A 1K3OA 3HJOA 1WPIA 5KN1A 2L57A 4I5QA 4MDCA 4ZIJA 4ZB6A 2HNLA 3GYKA 3M8NA 2LUSA 1PD21 4TR0A 2VCVA 2H1DA 2OBKA 1MDIA 3ZMKA 2GGTA 3M9JA 5LCZA 2OE0A 4TR4A 2LRNA 5B7CA 3MSZA 4BVYB 4QQ7A 2B1LA 1TRWA 1S3DA 3FY7A 3IK9A 2RM5A 2GSTA 2VL9A 3EYTA 1KTEA 5G1LA 1EV4A 2ZCTA 2I81A 2H6XA 1K0MA 3GH9A 4RI7A 3HJMA 1FVJA 4YQVA 3FZ5A 4P3YB 6GSTA 1JZWA 3DXBA 5IIZA 3RHBA 2VM1A 2GT5A 1R26A 1GSUA 2ZUPA 4KDUA 1M9BA 4I2UA 2R6KA 4XS4B 5DAKA 6GSUA 3FR6A 2AUVA 2N5FA 4XCSA 3F4TA 2F3MA 3IXRA 4KB3A 1Y25A 3VPTA 3QR6A 3TJJA 4LMVA 3TJKA 4TXOB 3TJGA 2XC2A 2LNTA 3ZYWA 4J56E 2IJYA 2JZRA 4G9HA 2YNXA 5J4UA 2C8UA 3FZ4A 5D9WA 2CZ3A 3KMNA 4IJ3A 3HHVA 2H70A 3CSIA 1GLQA 3A2VA 2PN8A 1E2YA 3I69A 3GKKA 2YZUA 5CREA 2VOCA 1X9SB 3H1NA 3QD9A 1A8YA 1WIKA 1WP0A 1XWGA 1V98A 2HZEA 4I2TA 3D5JA 2K9FA 2HXKA 4GQFA 2TRCP 2JSZA 2JSYA 2EIRA 3APSA 2E7PA 3IR4A 4HDEA 4Q5QA 3CSHA 4ULXA 2YPMA 3TJBA 4JEDA 3DRNA 4Q5RA 4O7HA 2X8CA 4HI7A 3IAS2 3LQ7A 3C71A 5G5EA 1CQHA 1XCCA 2LTKA 1U3AA 2I3YA 1XWBA 2FA4A 4FQUA 2V32A 2GSQA 1YDKA 3QFBC 1DE2A 5D8IA 4Z7XA 4AF2A 1FB0A 3NOFA 1SYXA 1YZXA 4RQRA 2GLRA 2H1AA 3KEBA 2FWGA 4ECIA 1GSQA 3Q74A 1U6TA 2OKAA 3UBKA 4OFNA 3A5WA 2DIZA 4OO5A 4FH8A 1GSEA 3ME8A 5GZZB 3BCKA 3UOMA 4MP4A 4F2IA 4MF5A 5AGYA 1K3LA 1ERWA 3M1GA 1GSDA 3U5RE 1O73A 2YV7A 3RHCA 1TJDA 1WWJA 4ECBA 4IGJA 4G0IA 3F8UA 4OMVA 2F9SA 1G6YA 2HZFA 2NVLA 3HVVA 4E8HA 1SD8A 1PL2A 1K0DA 16GSA 5FWGA 4MLYA 1OYJA 4MK3A 1TP9A 5IM9A 5DDLA 2IFQB 1GSFA 4CW9A 2MBSA 1KNGA 4YAVA 4NAXA 2P5QA 1QFNA 1VF1A 5E4WA 2DJ0A 3P90A 1AW9A 4HJMA 1X5DA 1N8JA 2MMOA 4X0XA 4F9ZA 1U3IA 4AJ6A 2AB6A 2VO4A 2GDRA 2REMA 1BG5A 2GZYA 5INYA 1F9MA 1MTCA 3K8NA 3MDKA 2D2ZA 4HEA2 3CXGA 2YWMA 4POBA 4GWRA 1GRXA 1BQ7A 5CNWA 2I9HA 2QKEA 2B5YA 2JU5A 4I6XA 1FO5A 3IOSA 5C04A 1DE1A 1GNWA 1UA5A 2VCWA 2GS3A 2AJQB 3HA9A 2A4VA 3GRXA 2PWJA 3LORA 5DCHA 3PGTA 3EMXA 3ZRDA 19GSA 4PGTA 1SJIA 2OACA 2YCDA 3M3MA 1BX9A 2HSNB 2AYTA 2ON5A 3HD5A 3VFIA 1T8EB 1A2JA 3ZFBA 4DSQA 1XWKA 3KCMA 3GL5A 3LFLA 1O85A 2KLXA 4NV2A 2VM2A 2L6DA 2JL4A 2VUPA 1T4ZA 1NM3A 1X9WB 5ECNB 1I9DA 3CMIA 1EZKA 4K9ZA 2VLVA 4MJEA 5F07A 3A3TA 4MMMA 4L0UA 2V1MA 4MZCA 2R37A 4IQ1A 1K0BA 3UIWA 5ABRA 3FKFA 4N0VA 3CTGA 3L0HA 3H8QA 1T7PB 2XPDA 3P2AA 3ZITA 4OFTA 2V6KA 4K8MA 2FUG2 3QCPA 4G19A 3EU3A 3FRCA 2XHFA 2UZ8A 2B1KA 3US3A 3APOA 1TRVA 4RUVA 1X5EA 2IMFA 1S3AA 1YKCA 3GHAA 2C3TA 2P0GA 3U6VA 3ERWA 3TGZA 1ERTA 4KNDA 1T1VA 2JZTA 3KMOA 2F51A 3KJYA 2KP2A 2X8GA 3DVWA 1R5PA 4JR4A 5ECKB 3RPNA 3L9UA 1KEBA 3QPMA 4ZL9A 4O92A 3N5OA 3IC4A 5DQSA 1TTZA 2FLSA 4GQCA 3UVTA 5ELAA 1E6BA 4POMA 3HDCA 2RUEA 5EPFA 1M2AA 4V2LA 1MDJA 3ZIJA 4K7OA 4LLRA 1B4QA 2R4VA 5G1KA 4BWSA 1GSYA 1O81A 4F03A 5D9VA 3FYGA 4MPFA 3IK7A 3TKSE 1GL8A 3HVSA 3LYKA 4MPGA 4OWYA 1V57A 9GSSA 4PUAA 4KSOA 2H01A 4GSNA 7GSSA 4FIWA 2F8AA 2PBJA 4KGIA 1GUKA 2XBIA 2G0FA 3F9UA 3GX0A 17GSA 3TKSC 3EU4A 3F6DA 2HT9A 3ME7A 1XIYA 3VI5A 1XOBA 5ECQB 2NPBA 4D73A 1AC1A 3HVXA 3CSJA 2GZZA 1EOGA 3UEMA 3VWXA 1RW1A 2H19A 3S9FA 4ML6A 3ERFA 2BTOT 2L5LA 3TKQA 5CRGA 1PQNA 1TRSA 3ED3A 1UVZA 2K18A 4RI6A 2MMAA 3KIJA 3F3QA 3TKPA 2C0EA 1MD3A 2TRXA 1AQVA 1YF1A 4V2MA 1AAZA 3UMAA 3CBUA 3GX8A 5GAPD 5ECIB 1LJRA 2YN1A 1YF0A 4Q5NA 3GKMA 2O87A 4JRRA 1A24A 1TW9A 5ECPB 1I5GA 3UBLA 3L4NA 3R3EA 4PURA 2KHPA 2IPAA 2LEGA 2L59A 4NXIA 5CRHA 2FGXA 4J57E 1PL1A 3LEFA 1GTBA 4KCEA 5ECOB 5AISA 1TU8A 4GLTA 3PINA 5A4VA 2YWIA 1USBA 2VCXA 2GSSA 3CYNA 1TI3A
chains in the Genus database with same CATH superfamily
2BJXA 5D96A 2CA8A 3RAZA 1AXDA 4NHWA 1Z3EA 4KCAA 3UAPA 4KA0A 1M2DA 1Y6EA 4CY6A 4FXYP 1ACVA 5J4VA 1FW1A 5JWOB 2LSTA 2WS2A 2H73A 1G7OA 1O6JA 2C3NA 1AQWA 3ZIVA 1XPVA 4TR1B 3WGEA 2EC4A 4FYUA 4PQIA 1EP8A 1XW6A 2HSMB 3W8JA 2PVQA 3RBTA 3NZNA 2FHEA 1XZOA 4L5LA 1HYUA 5COHA 4POLA 3IAM2 1LBKA 5DALB 1PMTA 3LG6A 3FHKA 4QL7A 4PQ1A 1XW5A 4ZILA 3GSTA 3WGXA 4IS0A 3DEXA 4X4JA 4OFMA 2I4AA 2RLIA 3D4MA 2CVDA 3MAKA 1ERUA 1TK8B 2OADA 1SL1B 1SVLA 1XVQA 1BEDA 3FR9A 4NHZA 1GH2A 2H74A 4HU9A 4YAPA 5A1NA 4AGSA 2YZHA 3KH7A 1NSWA 1PGTA 2HLSA 3DKSA 5HFGA 2QA1A 4HOJA 2L5OA 1M3JA 3HXSA 6GSVA 2H0GA 4K1FA 4MJBA 4PI2C 2H0HA 5IMVA 4MF7A 2WULA 2H6YA 4WXTA 3UL3A 3KD0A 4AJ8A 1OC9A 4RQXA 5AN1A 4JZQA 2YP6A 1SK0A 1AIUA 1Z6MA 5HR2A 5B6MA 2LV3A 1T3BA 3DYRA 3FW2A 2QSIA 3HYPA 4AKGA 4ZB9A 3DGQA 2VL2A 3E3EA 5EY6A 8GSSA 4TR3A 4MJAA 4IKHA 1OKDA 4XS1A 2PGTA 3LXTA 3IDVA 4ML1A 5GAND 1ZZYA 1GTUA 2PUKC 1TU7A 4CHSA 5CAXA 2H1BA 3EC3A 2MBTA 3ZMLA 2ES7A 2RIIA 1JZRA 5ECHB 4DSSB 1OE7A 3W8SA 2N5AA 6GSYA 2WVYA 3P7XA 1X9MB 2DJ2A 2FA8A 3QAWA 2NDOA 1QMVA 5A34A 2MZCA 4BVYA 1F3BA 4KSMA 2KUCA 3C8EA 3TDGA 1Q4JA 1GUMA 5DBQA 1T4YA 4ZL8A 1ZYPA 2L6CA 1C72A 5GSSA 3BCIA 4WF4A 3UARA 2CV4A 1XW9A 4K6XA 2R0CA 2M80A 5HQPA 3VURA 4IJIA 3H4KA 3RPPA 4O5QA 5FT3A 4DVCA 2NTOA 3WT1A 5CP1A 3HMJG 1THXA 3HZ8A 2VD0A 3UVHA 5D9TA 2OE3A 3D4TA 3GMFA 5DJLA 3TB2A 2E0QA 2E2GA 3LWAA 4XS4A 4TKYA 1GULA 1ST9A 3GV1A 2X99A 3D0ZA 1PA3A 4OD7A 3O3TA 2V6OA 2CAIA 4TXOA 6GSSA 2DIYA 3LJRA 4OO4A 2H0IA 3KP8A 1OKTA 1FB6A 2B5EA 2K8VA 1GUHA 2J9HA 5J47A 3BBYA 3GA4A 2AAWA 3GTUB 3HKRA 2IIYA 3L78A 3DD3A 3KTLA 1DSBA 2GSRA 3QMXA 4F0CA 2VLTA 5C00A 3MYDA 2DMLA 1TOFA 3C1SA 3M9KA 3F63A 2DSAA 1YEPA 2EFEA 4IQAA 4BVXB 2C0DA 1ABAA 3UJ1A 1YEXA 4ECJA 2AHEA 3FZAA 5A4WA 4K5RA 1GSSA 1O8WA 3QAGA 2DC5A 4JR6A 1EGRA 3ZVJD 2DJJA 3GL3A 4HJ2A 1MDKA 2E2MA 2KOKA 3TOTA 3F4SA 1GP1A 1RK4A 4IW9A 1QK8A 2RUFA 2FNOA 4TOPA 1SJ6A 4HU7A 3GN3A 4PX1A 3GH6A 2FCHA 5CRWA 2WW3A 2R2JA 3PPUA 4HQSA 3E9JB 20GSA 3IA1A 6GSXA 1NHYA 1YY7A 1OVNA 4EIQA 1ZL9A 3I43A 4WR4A 2L4QA 1HD2A 2H66A 4FYCA 3ZFLA 4FYBA 3HJPA 2JZSA 1DUGA 2OJLA 4Q5FA 3SWLA 2VCQA 4QL9A 2K8SA 1N2AA 3O6TA 1F6MC 4GXZA 1SKRB 5KN3A 5KOWA 1TK0B 2L4CA 1PSQA 1YJ6A 1J9BA 4D73B 2DJ3A 1HQOA 2WB9A 2H75A 5J9BA 4WETA 4NPBA 1SYRA 1GTIA 1TXXA 2CVBA 5J41A 5A5KA 3TKRA 2OE1A 2IFQA 4AKIA 2YJHA 5D73A 2LQOA 3W6GA 1R5AA 5E59A 1URMA 4NWYA 3M0FA 4OCFA 1EWXA 4POKA 3GSSA 2RM6A 4EO3A 3QFAC 2F8FA 5G30A 4XTSA 2CZ2A 3IV4A 3TJFA 1FVKA 4YQMA 3IPZA 2B7JA 5JCUA 2FWHA 4L0WA 3BD2A 1FG4A 2C4JA 2HRKB 1QXHA 1B9YC 1XWAA 1TK5B 12GSA 4MABA 2O85A 2GVPA 4MA9A 3KGKA 4V1Ag 2LJAA 2V2GA 2TIRA 3RFRC 1U87A 1G0TA 2IWTA 4TN8A 5B8AA 1WJKA 2LNSA 1AQXA 1S3RA 2EIQA 1K0OA 5ENUA 3A2WA 1Z5YE 3TCOA 4IBPA 3G7JA 1WRYA 1WE0A 2VIMA 2FY6A 5HFKA 2M46A 2GTUA 1THOA 1M9AA 4TXVA 4I97A 4NMUA 4JE1A 2B3SA 4N0ZA 2PMTA 4Z2UA 3L9VA 3IBHA 1V2AA 4GSTA 1SU9A 4KDYA 3R2QA 5HFIA 2HSNA 2C80A 5ID2A 2WDUA 2ON7A 5F06A 3EMPA 4IP6A 4ZBDA 4HSCX 4K0GA 2HYXA 4G10A 5LNKe 2H1LA 3LGCA 3J7Yk 2WJUA 3DWVA 1AUCA 3NIVA 4EVMA 1LU4A 2A2RA 5KN0A 1U88A 1K0CA 5EVOA 3GIXA 3PH9A 2IMDA 3LSZA 3P8WA 4KF9A 4WEYA 1TDIA 1R7HA 5EL8A 4JBBA 4NV5A 2WZSA 4J2FA 1EEMA 2O3EA 2XBQA 4BPYA 3C73A 3I6AA 1O8XA 2YJ7A 5BMUA 5CO3A 4BA7A 3I9V2 3D6IA 3VLNA 5DAKB 2GZPA 3HVNA 3IE3A 2HQTA 2HI7A 4ZL7A 1M99A 3F3RA 1TXUA 4K2DA 1M2BA 5HR1A 2FWFA 4G2EA 2CT6A 2WVZA 3PR8A 4WKWA 4EKZA 2P5RA 3D21A 2H72A 4PXOA 4JU5A 1PKZA 1WMJA 5LD0A 1FHEA 1KBNA 4PUFC 5H5QA 1O7UA 1T00A 1F37A 2HSYA 2DJKA 4EDYA 2HZEB 3ERGA 1K3YA 4EL1A 1BG1A 2WVXA 4O5RA 2C3QA 3OR5A 4GTUA 4KE3A 3VWVA 2CVKA 3E0UA 2HRNA 1SL2B 1ZOFA 4I8BA 3CRTA 3V1WA 1ERVA 3FK8A 1XXUA 1YKAA 18GSA 5J3RA 4N30A 3G7YA 3CHXC 1M7TA 1EEJA 2HRAA 2WCIA 1F3AA 3DVXA 4CDOA 1G6WA 1HNBA 3QOUA 1Z6NA 2H6ZA 4H86A 1J0FA 5D93A 1SK1A 3H93A 1IYHA 4ISDA 5B8BA 1A2LA 1X0RA 2H30A 1EGOA 1VRSD 3G9BA 4EDZA 5IOXA 1BAYA 3KZQA 4MF6A 2H76A 2HSHA 2OBIA 3ZVJA 4AKXB 2WFCA 2VD1A 1ZGNA 4YQUA 4FO5A 2CQ9A 1B8XA 3TUEA 2YWOA 5KN2A 4XIHA 2LJKA 2O89A 4BL7A 2YWNA 3CRUA 2A2SA 4ECCA 1A0RP 2CAQA 2WZ9A 2XPEA 2M72A 4MJCA 4KDXA 1VF4A 4MZBA 1PFOA 2VL3A 3QAVA 2Z9SA 5A5HA 13GSA 1XBSA 2H71A 2NBSA 5IO0A 1SD9A 1F2EA 3BJ5A 1M3IA 2MYGA 5AIXA 4ILFA 1TKDB 1M0UA 2MMZA 2VLUA 2VCTA 3F4RA 2LKUA 4MH3A 3DIEA 4XHMA 5FHIA 5JCGA 1ON4A 2G2QA 4HS1A 2R0PA 4TR1A 5ELGA 2HSMA 1FAAA 3FEUA 1H75A 2FWEA 10GSA 1JLVA 2KP1A 2QGVA 2GQKA 5JCWA 1IYIA 5DALA 2OA7A 3GKNA 4L5OA 1XWCA 2HFDA 2K6VA 1VF2A 4KW6A 4G0LA 5ECSA 3TOUA 2V41A 1TI1A 5DCGA 5HR3A 2GT6A 3IHQA 5IPHA 1ZYEA 2C0GA 4IN0A 5ECLB 3HY2A 4XRDA 3VK9A 4XRAA 4O32A 5JWQB 5CRDA 3TKSA 4PNFA 1X5CA 4HZ2A 2HRFA 3GUSA 2GQMA 4PNGA 1V58A 4TVEA 2N5BA 3F6FA 5HR0A 1SENA 4DSRA 3CTFA 2EIOA 3Q19A 1GWCA 1SL0B 2H1GA 3H79A 5IMDA 2MMNA 5GSTA 2C0FA 1PKWA 2IMKA 5IMCA 3EURA 22GSA 2WRTA 1SJZA 3JCML 4IELA 3L9SA 4E68A 1OC8A 2FD3A 1Q98A 3GURA 1PN9A 2DBCA 5AIVA 3RDWA 4EUYA 1CQGA 3LW9A 4ZBBA 4YH2A 3APQA 1TRUA 1QUWA 4G0KA 5DJMA 3KTBA 1RQMA 3VWUA 3LYPA 1XFLA 5ECRB 3WD6A 2VAFA 5A4UA 2B6MA 4W66A 2PVOC 4EC0A 4K7IA 4WF5A 1EP7A 2DLXA 3KH9A 2WW2A 3KXOA 11GSA 1A0FA 1OE8A 4LA1A 4ZBAA 4KUNA 2HE3A 3MWHA 2EFCA 5G31A 2CX3A 2YOIA 2IL3A 4WR5A 2LS5A 5DQYA 1B9XC 3FMWA 3C7MA 1QQ2A 4DSSA 1Y1UA 5J5NA 3VI7A 4ACSA 3BOAA 4V2NA 1DBYA 3ZREA 3A2XA 1MEKA 1OC3A 1HNCA 1K0AA 1PX6A 5ID2B 4F0BA 4PTSA 1A2MA 1YQ1A 4IP1A 4EIPA 4ZXGA 4WBRD 14GSA 3GKXA 1R4WA 4ID0A 2VCZA 3ZL5A 1W4VA 4N10A 1MD4A 2PERA 3HZ4A 2PPTA 4X1UA 4F82A 2EFDA 3TRPA 2B7KA 3G7IA 3WGDA 2JADA 1PRXA 3ZZXA 2GQLA 1UC7A 2LRCA 2R3XA 1GNEA 1SKWB 1HNAA 1NW2A 3IC8A 2YANA 1EV9A 5H5RA 2I1UA 4HUAA 4KX4A 4EXJA 3WYWA 1UN2A 2O8VB 3GFKA 3EINA 4K5SA 1ML6A 3KP9A 2YV9A 2ZNMA 4K2XA 1GTAA 2X64A 2LJRA 4DEJA 1K0NA 5KEJA 2OT3A 5J40A 2O7KA 3MNGA 2EFHA 1NHOA 3GTUA 5IOWA 4EF0A 1A8LA 2IMIA 1A23A 4AJ7A 3IRAA 4MCUA 5F8BA 2VL2C 1ZYQB 2QC7A 2DJ1A 5J9CA 4MH2A 4LL4B 3TU3B 5DVBA 4LMWA 2ALBA 2X4AA 1SK2A 4K7NA 3TRXA 1PX7A 2DMMA 4BVXA 1BYEA 6GSWA 4CY8A 1JHBA 3KM6A 1ILOA 1J08A 1VF3A 4YKFA 4WBJA 4Z2RA 5D9XA 3VWWA 1OAZA 4HQZA 4KH7A 5IMAA 3EE2A 4E8EA 1Z7PA 3VPQA 5H5SA 4V1Ap 4BIKA 1GLPA 3A5IA 2P31A 3CWGA 4LL1B 1WOUA 4XS6A 2H8LA 4TRXA 3WT2A 1FOVA 1N25A 2AV4A 4GCIA 1B4PA 4ZB8A 1V40A 2VKZG 2A2PA 3C1RA 3O76A 1JZDA 2LRTA 1BJXA 4BWQA 4K0NA 5CYYA 2IN3A 3QDNA 5ECMB 5B6NA 5JWRB 3F0IA 3TRQA 2R5GA 5F05A 1Z7RA 4YKGA 5L71A 3Q6OA 1V9WA 4OCEA 3Q18A 1ZMAA 3ISOA 3GNJA 3ZLPA 3N9JA 4USSA 1I1IP 2X8HA 1JFUA 4IVFA 5G5FA 1JLWA 2JACA 5IO2A 2PU9C 1Z9HA 3AY8A 3DMLA 1VGLA 2LQQA 5IPGA 3D22A 3ZTLA 1W89A 3SBCA 5A1NB 4TW5A 2BMXA 1SKSB 2C1YA 1JZOA 2WGRA 2IMEA 2UV8G 4PQHA 5G2ZA 1XVWA 2B5XA 2CX4A 4GRFA 1S3CA 1G7EA 3HCZA 4BL7B 3EVIA 1OC9B 2HRKA 4N11A 5F0GA 4X43A 4A5PA 4EE0A 5IMFA 1SVOA 3J7Yb 1B48A 4HZ4A 5IQYA 3CQFA 1ZYNA 4GF0A 1QGVA 4KAEA 3LXZA 4IHUA 4L8EA 1H4OA 1XOAA 1EOHA 4Z2TA 4GSSA 3FR3A 2J23A 4MZWA 5IMZA 1ZCPA 3EPTA 3EWLA 3FZ9A 1K3OA 3HJOA 1WPIA 5KN1A 2L57A 4I5QA 4MDCA 4ZIJA 4ZB6A 2HNLA 3GYKA 3M8NA 2LUSA 1PD21 4TR0A 2VCVA 2H1DA 2OBKA 1MDIA 3ZMKA 2GGTA 3M9JA 5LCZA 2OE0A 4TR4A 5A34B 2LRNA 5B7CA 4BVYB 3MSZA 4N3ZA 4QQ7A 2B1LA 1TRWA 1S3DA 3FY7A 3IK9A 2RM5A 2GSTA 2VL9A 1XG8A 3EYTA 1PN0A 1YEWC 1YVLA 1KTEA 5G1LA 1EV4A 5KOXA 2ZCTA 2I81A 2H6XA 1K0MA 3GH9A 4RI7A 3HJMA 1FVJA 4YQVA 3FZ5A 4P3YB 6GSTA 1JZWA 3DXBA 5IIZA 3RHBA 2VM1A 2GT5A 1R26A 1GSUA 2ZUPA 4KDUA 1M9BA 4I2UA 2R6KA 4XS4B 5DAKA 6GSUA 3FR6A 2AUVA 2N5FA 4XCSA 3F4TA 2F3MA 3IXRA 4KB3A 1Y25A 3VPTA 3QR6A 3TJJA 4LMVA 3TJKA 4TXOB 3TJGA 2XC2A 2LNTA 3ZYWA 2IJYA 4J56E 2JZRA 4G9HA 2YNXA 5J4UA 2C8UA 3FZ4A 5D9WA 2CZ3A 3KMNA 4IJ3A 3HHVA 2H70A 3CSIA 1GLQA 3A2VA 2PN8A 1E2YA 3I69A 3GKKA 2YZUA 5CREA 2VOCA 1X9SB 3H1NA 3QD9A 1A8YA 1WIKA 1WP0A 1XWGA 1V98A 2HZEA 4I2TA 2DKHA 3D5JA 5BRTA 2K9FA 2HXKA 4GQFA 2TRCP 2JSZA 2JSYA 2EIRA 1FOHA 3APSA 2E7PA 2R0GA 3IR4A 4HDEA 4Q5QA 3CSHA 4ULXA 2YPMA 3MIXA 3TJBA 4JEDA 3DRNA 2O36A 4Q5RA 4O7HA 2X8CA 4HI7A 3IAS2 3LQ7A 3C71A 5G5EA 1CQHA 1XCCA 2LTKA 1U3AA 2I3YA 1XWBA 2FA4A 4FQUA 2V32A 2GSQA 1YDKA 3QFBC 1DE2A 5D8IA 4Z7XA 4AF2A 1FB0A 3NOFA 1SYXA 1YZXA 4RQRA 2GLRA 2H1AA 3KEBA 2FWGA 4ECIA 1GSQA 3Q74A 1U6TA 2OKAA 3UBKA 4OFNA 3A5WA 2DIZA 4OO5A 4FH8A 1GSEA 3ME8A 5GZZB 3BCKA 3UOMA 4MP4A 4F2IA 4MF5A 5AGYA 1K3LA 1ERWA 3M1GA 1GSDA 3U5RE 1O73A 2YV7A 3RHCA 1TJDA 1WWJA 2A4HA 4ECBA 4IGJA 4G0IA 3F8UA 4OMVA 2F9SA 1G6YA 2HZFA 2NVLA 3HVVA 4E8HA 1SD8A 1PL2A 1K0DA 16GSA 5FWGA 4MLYA 1OYJA 4MK3A 1TP9A 5IM9A 5DDLA 2IFQB 1GSFA 4CW9A 2MBSA 1KNGA 4YAVA 4NAXA 2P5QA 1QFNA 1VF1A 5E4WA 4AKHA 2DJ0A 3P90A 1AW9A 4HJMA 1X5DA 1N8JA 2MMOA 4X0XA 4F9ZA 1U3IA 4AJ6A 2AB6A 2VO4A 2GDRA 2REMA 1BG5A 2GZYA 1SVMA 5INYA 1F9MA 1MTCA 3K8NA 3MDKA 2D2ZA 4HEA2 3CXGA 2YWMA 4POBA 4GWRA 1GRXA 1BQ7A 5CNWA 2O5VA 2I9HA 2QKEA 2B5YA 2JU5A 4I6XA 1FO5A 3IOSA 5C04A 1DE1A 1GNWA 1UA5A 2VCWA 2GS3A 2AJQB 3HA9A 2A4VA 3GRXA 2PWJA 3LORA 5DCHA 3PGTA 3EMXA 3ZRDA 19GSA 4PGTA 1SJIA 2OACA 2YCDA 3M3MA 4O5UA 4AI6A 1BX9A 2HSNB 2AYTA 2ON5A 3HD5A 3VFIA 1T8EB 1A2JA 3ZFBA 4DSQA 1XWKA 3KCMA 3GL5A 3LFLA 1O85A 2KLXA 4NV2A 2VM2A 2L6DA 2JL4A 2VUPA 1T4ZA 2X49A 1NM3A 1X9WB 5ECNB 1I9DA 3CMIA 1EZKA 4K9ZA 2VLVA 4MJEA 5F07A 3A3TA 4MMMA 4L0UA 2V1MA 4MZCA 2R37A 4IQ1A 1K0BA 3UIWA 5ABRA 3FKFA 4N0VA 3CTGA 3L0HA 3H8QA 1T7PB 2XPDA 3P2AA 3ZITA 5BMUB 4OFTA 2V6KA 4K8MA 2FUG2 4ICYA 3QCPA 4G19A 3EU3A 3FRCA 2XHFA 3IHGA 2UZ8A 2B1KA 3US3A 3APOA 1TRVA 4RUVA 1X5EA 2IMFA 1S3AA 1YKCA 3GHAA 2C3TA 2P0GA 3U6VA 3ERWA 3TGZA 1ERTA 2WW1A 4KNDA 4QMKA 1T1VA 4MNNA 2JZTA 3KMOA 2F51A 3KJYA 2KP2A 2X8GA 3DVWA 4GDFA 1R5PA 4JR4A 5ECKB 3RPNA 3L9UA 1KEBA 3QPMA 4ZL9A 4O92A 3N5OA 3IC4A 5DQSA 1TTZA 2FLSA 4GQCA 3UVTA 5ELAA 1E6BA 4POMA 3HDCA 2RUEA 5EPFA 1M2AA 4V2LA 1MDJA 3ZIJA 2WVXB 2WW0A 4K7OA 4LLRA 1B4QA 2R4VA 5G1KA 4BWSA 1GSYA 1O81A 4F03A 5D9VA 3FYGA 4MPFA 3IK7A 3TKSE 1GL8A 3HVSA 3LYKA 4MPGA 4OWYA 3RGBC 1V57A 1S4BP 9GSSA 4PUAA 4KSOA 2H01A 4GSNA 7GSSA 4FIWA 2F8AA 2PBJA 4KGIA 1GUKA 2XBIA 2G0FA 3F9UA 3GX0A 17GSA 3TKSC 3EU4A 3F6DA 2HT9A 3ME7A 1XIYA 3VI5A 1XOBA 5ECQB 4PI0C 2NPBA 4D73A 1AC1A 3HVXA 3CSJA 2GZZA 5J4YA 1EOGA 3UEMA 3VWXA 1RW1A 2H19A 3S9FA 4ML6A 3ERFA 2BTOT 2L5LA 3TKQA 5CRGA 1PQNA 1TRSA 3ED3A 1UVZA 2DKIA 2K18A 4RI6A 2MMAA 3KIJA 3F3QA 3TKPA 2C0EA 1MD3A 2TRXA 1AQVA 1YF1A 4V2MA 1AAZA 3UMAA 3CBUA 3GX8A 5GAPD 5ECIB 1LJRA 2YN1A 1YF0A 4Q5NA 3GKMA 2O87A 4JRRA 1A24A 1TW9A 5ECPB 4G01A 1I5GA 3UBLA 3L4NA 3R3EA 4PURA 2KHPA 2QA2A 2IPAA 2LEGA 2L59A 4NXIA 5CRHA 2FGXA 4J57E 4PHZC 1PL1A 3LEFA 5A5HB 1GTBA 4KCEA 1BF5A 5ECOB 5AISA 4ZB7A 1TU8A 4GLTA 3PINA 5A4VA 2YWIA 1USBA 2VCXA 2GSSA 3CYNA 1TI3A
chains in the Genus database with same CATH topology
2BJXA 5D96A 2CA8A 3RAZA 1AXDA 4NHWA 1Z3EA 4KCAA 3UAPA 4KA0A 1M2DA 1Y6EA 4CY6A 1ACVA 5J4VA 1FW1A 5JWOB 2LSTA 2WS2A 2H73A 1G7OA 1O6JA 2C3NA 1AQWA 3ZIVA 1XPVA 4TR1B 3WGEA 2EC4A 4FYUA 4PQIA 1EP8A 1XW6A 2HSMB 3W8JA 2PVQA 3RBTA 3NZNA 2FHEA 1XZOA 4L5LA 1HYUA 5COHA 4POLA 3IAM2 1LBKA 5DALB 1PMTA 3LG6A 3FHKA 4QL7A 4PQ1A 1XW5A 4ZILA 3GSTA 3WGXA 4IS0A 3DEXA 4X4JA 4OFMA 2I4AA 2RLIA 3D4MA 2CVDA 3MAKA 1ERUA 1TK8B 2OADA 1SL1B 1SVLA 1XVQA 1BEDA 3FR9A 4NHZA 1GH2A 2H74A 4HU9A 4YAPA 5A1NA 4AGSA 2YZHA 3KH7A 1NSWA 1PGTA 2HLSA 3DKSA 5HFGA 2QA1A 4HOJA 2L5OA 3HXSA 6GSVA 2H0GA 4K1FA 4MJBA 2H0HA 5IMVA 4MF7A 2WULA 2H6YA 4WXTA 3UL3A 3KD0A 4AJ8A 1OC9A 4RQXA 5AN1A 4JZQA 2YP6A 1SK0A 1AIUA 1Z6MA 5HR2A 5B6MA 2LV3A 1T3BA 3DYRA 3FW2A 2QSIA 3HYPA 4AKGA 4ZB9A 3DGQA 2VL2A 3E3EA 5EY6A 8GSSA 4TR3A 4MJAA 4IKHA 1OKDA 4XS1A 2PGTA 3LXTA 3IDVA 4ML1A 5GAND 1ZZYA 1GTUA 2PUKC 1TU7A 4CHSA 5CAXA 2H1BA 3EC3A 2MBTA 3ZMLA 2ES7A 2RIIA 1JZRA 5ECHB 4DSSB 1OE7A 3W8SA 2N5AA 6GSYA 3P7XA 1X9MB 2DJ2A 2FA8A 3QAWA 2NDOA 1QMVA 5A34A 2MZCA 4BVYA 1F3BA 4KSMA 2KUCA 3C8EA 3TDGA 1Q4JA 1GUMA 5DBQA 1T4YA 4ZL8A 1ZYPA 2L6CA 1C72A 5GSSA 3BCIA 4WF4A 3UARA 2CV4A 1XW9A 4K6XA 2R0CA 2M80A 5HQPA 3VURA 4IJIA 3H4KA 3RPPA 4O5QA 5FT3A 4DVCA 2NTOA 3WT1A 5CP1A 3HMJG 1THXA 3HZ8A 2VD0A 3UVHA 5D9TA 2OE3A 3D4TA 3GMFA 5DJLA 3TB2A 2E0QA 2E2GA 3LWAA 4XS4A 4TKYA 1GULA 1ST9A 3GV1A 2X99A 3D0ZA 1PA3A 4OD7A 3O3TA 2V6OA 2CAIA 4TXOA 6GSSA 2DIYA 3LJRA 4OO4A 2H0IA 3KP8A 1OKTA 1FB6A 2B5EA 2K8VA 1GUHA 2J9HA 5J47A 3BBYA 3GA4A 2AAWA 3GTUB 3HKRA 2IIYA 3L78A 3DD3A 3KTLA 1DSBA 2GSRA 3QMXA 4F0CA 2VLTA 5C00A 3MYDA 2DMLA 1TOFA 3C1SA 3M9KA 3F63A 2DSAA 1YEPA 2EFEA 4IQAA 4BVXB 2C0DA 1ABAA 3UJ1A 1YEXA 4ECJA 2AHEA 3FZAA 5A4WA 4K5RA 1GSSA 1O8WA 3QAGA 2DC5A 4JR6A 1EGRA 3ZVJD 2DJJA 3GL3A 4HJ2A 1MDKA 2E2MA 2KOKA 3TOTA 3F4SA 1GP1A 1RK4A 4IW9A 1QK8A 2RUFA 2FNOA 4TOPA 1SJ6A 4HU7A 3GN3A 4PX1A 3GH6A 2FCHA 5CRWA 2R2JA 3PPUA 4HQSA 3E9JB 20GSA 3IA1A 6GSXA 1NHYA 1YY7A 1OVNA 4EIQA 1ZL9A 3I43A 4WR4A 2L4QA 1HD2A 2H66A 4FYCA 3ZFLA 4FYBA 3HJPA 2JZSA 1DUGA 2OJLA 4Q5FA 3SWLA 2VCQA 4QL9A 2K8SA 1N2AA 3O6TA 1F6MC 4GXZA 1SKRB 5KN3A 5KOWA 1TK0B 2L4CA 1PSQA 1YJ6A 1J9BA 4D73B 2DJ3A 1HQOA 2WB9A 2H75A 5J9BA 4WETA 4NPBA 1SYRA 1GTIA 1TXXA 2CVBA 5J41A 5A5KA 3TKRA 2OE1A 2IFQA 4AKIA 2YJHA 5D73A 2LQOA 3W6GA 1R5AA 5E59A 1URMA 4NWYA 3M0FA 4OCFA 1EWXA 4POKA 3GSSA 2RM6A 4EO3A 3QFAC 2F8FA 5G30A 4XTSA 2CZ2A 3IV4A 3TJFA 1FVKA 4YQMA 3IPZA 2B7JA 5JCUA 2FWHA 4L0WA 3BD2A 1FG4A 2C4JA 2HRKB 1QXHA 1B9YC 1XWAA 1TK5B 12GSA 4MABA 2O85A 2GVPA 4MA9A 3KGKA 4V1Ag 2LJAA 2V2GA 2TIRA 1U87A 1G0TA 2IWTA 4TN8A 5B8AA 1WJKA 2LNSA 1AQXA 2EIQA 1K0OA 5ENUA 3A2WA 1Z5YE 3TCOA 4IBPA 3G7JA 1WRYA 1WE0A 2VIMA 2FY6A 5HFKA 2M46A 2GTUA 1THOA 1M9AA 4TXVA 4I97A 4NMUA 4JE1A 2B3SA 4N0ZA 2PMTA 4Z2UA 3L9VA 3IBHA 1V2AA 4GSTA 1SU9A 4KDYA 3R2QA 5HFIA 2HSNA 2C80A 5ID2A 2WDUA 2ON7A 5F06A 3EMPA 4IP6A 4ZBDA 4K0GA 2HYXA 4G10A 5LNKe 2H1LA 3LGCA 3J7Yk 2WJUA 3DWVA 1AUCA 3NIVA 4EVMA 1LU4A 2A2RA 5KN0A 1U88A 1K0CA 5EVOA 3GIXA 3PH9A 2IMDA 3LSZA 3P8WA 4KF9A 4WEYA 1TDIA 1R7HA 5EL8A 4JBBA 4NV5A 4J2FA 1EEMA 2XBQA 4BPYA 3C73A 3I6AA 1O8XA 2YJ7A 5BMUA 5CO3A 4BA7A 3I9V2 3D6IA 3VLNA 5DAKB 2GZPA 3IE3A 2HQTA 2HI7A 4ZL7A 1M99A 3F3RA 1TXUA 4K2DA 1M2BA 5HR1A 2FWFA 4G2EA 2CT6A 3PR8A 4WKWA 4EKZA 2P5RA 3D21A 2H72A 4PXOA 4JU5A 1PKZA 1WMJA 5LD0A 1FHEA 1KBNA 4PUFC 5H5QA 1O7UA 1T00A 1F37A 2HSYA 2DJKA 4EDYA 2HZEB 3ERGA 1K3YA 4EL1A 1BG1A 4O5RA 2C3QA 3OR5A 4GTUA 4KE3A 3VWVA 2CVKA 3E0UA 2HRNA 1SL2B 1ZOFA 4I8BA 3CRTA 3V1WA 1ERVA 3FK8A 1XXUA 1YKAA 18GSA 5J3RA 4N30A 3G7YA 1M7TA 1EEJA 2HRAA 2WCIA 1F3AA 3DVXA 4CDOA 1G6WA 1HNBA 3QOUA 1Z6NA 2H6ZA 4H86A 1J0FA 5D93A 1SK1A 3H93A 1IYHA 4ISDA 5B8BA 1A2LA 1X0RA 2H30A 1EGOA 1VRSD 3G9BA 4EDZA 5IOXA 1BAYA 3KZQA 4MF6A 2H76A 2HSHA 2OBIA 3ZVJA 4AKXB 2WFCA 2VD1A 1ZGNA 4YQUA 4FO5A 2CQ9A 1B8XA 3TUEA 2YWOA 5KN2A 4XIHA 2LJKA 2O89A 4BL7A 2YWNA 3CRUA 2A2SA 4ECCA 1A0RP 2CAQA 2WZ9A 2XPEA 2M72A 4MJCA 4KDXA 1VF4A 4MZBA 2VL3A 3QAVA 2Z9SA 5A5HA 13GSA 1XBSA 2H71A 2NBSA 5IO0A 1SD9A 1F2EA 3BJ5A 2MYGA 5AIXA 4ILFA 1TKDB 1M0UA 2MMZA 2VLUA 2VCTA 3F4RA 2LKUA 4MH3A 3DIEA 4XHMA 5FHIA 5JCGA 1ON4A 2G2QA 4HS1A 2R0PA 4TR1A 5ELGA 2HSMA 1FAAA 3FEUA 1H75A 2FWEA 10GSA 1JLVA 2KP1A 2QGVA 2GQKA 5JCWA 1IYIA 5DALA 2OA7A 3GKNA 4L5OA 1XWCA 2HFDA 2K6VA 1VF2A 4KW6A 4G0LA 5ECSA 3TOUA 2V41A 1TI1A 5DCGA 5HR3A 2GT6A 3IHQA 5IPHA 1ZYEA 2C0GA 4IN0A 5ECLB 3HY2A 4XRDA 3VK9A 4XRAA 4O32A 5JWQB 5CRDA 3TKSA 4PNFA 1X5CA 4HZ2A 2HRFA 3GUSA 2GQMA 4PNGA 1V58A 4TVEA 2N5BA 3F6FA 5HR0A 1SENA 4DSRA 3CTFA 2EIOA 3Q19A 1GWCA 1SL0B 2H1GA 3H79A 5IMDA 2MMNA 5GSTA 2C0FA 1PKWA 2IMKA 5IMCA 3EURA 22GSA 2WRTA 1SJZA 3JCML 4IELA 3L9SA 4E68A 1OC8A 2FD3A 1Q98A 3GURA 1PN9A 2DBCA 5AIVA 3RDWA 4EUYA 1CQGA 3LW9A 4ZBBA 4YH2A 3APQA 1TRUA 1QUWA 4G0KA 5DJMA 3KTBA 1RQMA 3VWUA 3LYPA 1XFLA 5ECRB 3WD6A 2VAFA 5A4UA 2B6MA 4W66A 2PVOC 4EC0A 4K7IA 4WF5A 1EP7A 2DLXA 3KH9A 3KXOA 11GSA 1A0FA 1OE8A 4LA1A 4ZBAA 4KUNA 2HE3A 3MWHA 2EFCA 5G31A 2CX3A 2YOIA 2IL3A 4WR5A 2LS5A 5DQYA 1B9XC 3FMWA 3C7MA 1QQ2A 4DSSA 1Y1UA 5J5NA 3VI7A 4ACSA 3BOAA 4V2NA 1DBYA 3ZREA 3A2XA 1MEKA 1OC3A 1HNCA 1K0AA 1PX6A 5ID2B 4F0BA 4PTSA 1A2MA 1YQ1A 4IP1A 4EIPA 4ZXGA 4WBRD 14GSA 3GKXA 1R4WA 4ID0A 2VCZA 3ZL5A 1W4VA 4N10A 1MD4A 2PERA 3HZ4A 2PPTA 4X1UA 4F82A 2EFDA 3TRPA 2B7KA 3G7IA 3WGDA 2JADA 1PRXA 3ZZXA 2GQLA 1UC7A 2LRCA 2R3XA 1GNEA 1SKWB 1HNAA 1NW2A 3IC8A 2YANA 1EV9A 5H5RA 2I1UA 4HUAA 4KX4A 4EXJA 3WYWA 1UN2A 2O8VB 3GFKA 3EINA 4K5SA 1ML6A 3KP9A 2YV9A 2ZNMA 4K2XA 1GTAA 2X64A 2LJRA 4DEJA 1K0NA 5KEJA 2OT3A 5J40A 2O7KA 3MNGA 2EFHA 1NHOA 3GTUA 5IOWA 4EF0A 1A8LA 2IMIA 1A23A 4AJ7A 3IRAA 4MCUA 5F8BA 2VL2C 1ZYQB 2QC7A 2DJ1A 5J9CA 4MH2A 4LL4B 3TU3B 5DVBA 4LMWA 2ALBA 2X4AA 1SK2A 4K7NA 3TRXA 1PX7A 2DMMA 4BVXA 1BYEA 6GSWA 4CY8A 1JHBA 3KM6A 1ILOA 1J08A 1VF3A 4YKFA 4WBJA 4Z2RA 5D9XA 3VWWA 1OAZA 4HQZA 4KH7A 5IMAA 3EE2A 4E8EA 1Z7PA 3VPQA 5H5SA 4V1Ap 1GLPA 3A5IA 2P31A 3CWGA 4LL1B 1WOUA 4XS6A 2H8LA 4TRXA 3WT2A 1FOVA 1N25A 2AV4A 4GCIA 1B4PA 4ZB8A 1V40A 2VKZG 2A2PA 3C1RA 3O76A 1JZDA 2LRTA 1BJXA 4BWQA 4K0NA 5CYYA 2IN3A 3QDNA 5ECMB 5B6NA 5JWRB 3F0IA 3TRQA 2R5GA 5F05A 1Z7RA 4YKGA 5L71A 3Q6OA 1V9WA 4OCEA 3Q18A 1ZMAA 3ISOA 3GNJA 3ZLPA 3N9JA 4USSA 2X8HA 1JFUA 4IVFA 5G5FA 1JLWA 2JACA 5IO2A 2PU9C 1Z9HA 3AY8A 3DMLA 1VGLA 2LQQA 5IPGA 3D22A 3ZTLA 1W89A 3SBCA 5A1NB 4TW5A 2BMXA 1SKSB 2C1YA 1JZOA 2WGRA 2IMEA 2UV8G 4PQHA 5G2ZA 1XVWA 2B5XA 2CX4A 4GRFA 1S3CA 1G7EA 3HCZA 4BL7B 3EVIA 1OC9B 2HRKA 4N11A 5F0GA 4X43A 4A5PA 4EE0A 5IMFA 1SVOA 3J7Yb 1B48A 4HZ4A 5IQYA 1ZYNA 4GF0A 1QGVA 4KAEA 3LXZA 4IHUA 4L8EA 1H4OA 1XOAA 1EOHA 4Z2TA 4GSSA 3FR3A 2J23A 4MZWA 5IMZA 1ZCPA 3EPTA 3EWLA 3FZ9A 1K3OA 3HJOA 1WPIA 5KN1A 2L57A 4I5QA 4MDCA 4ZIJA 4ZB6A 2HNLA 3GYKA 3M8NA 2LUSA 1PD21 4TR0A 2VCVA 2H1DA 2OBKA 1MDIA 3ZMKA 2GGTA 3M9JA 5LCZA 2OE0A 4TR4A 5A34B 2LRNA 5B7CA 3MSZA 4BVYB 4N3ZA 4QQ7A 2B1LA 1TRWA 1S3DA 3FY7A 3IK9A 2RM5A 2GSTA 2VL9A 3EYTA 1PN0A 1YVLA 1KTEA 5G1LA 1EV4A 5KOXA 2ZCTA 2I81A 2H6XA 1K0MA 3GH9A 4RI7A 3HJMA 1FVJA 4YQVA 3FZ5A 4P3YB 6GSTA 1JZWA 3DXBA 5IIZA 3RHBA 2VM1A 2GT5A 1R26A 1GSUA 2ZUPA 4KDUA 1M9BA 4I2UA 2R6KA 4XS4B 5DAKA 6GSUA 3FR6A 2AUVA 2N5FA 4XCSA 3F4TA 2F3MA 3IXRA 4KB3A 1Y25A 3VPTA 3QR6A 3TJJA 4LMVA 3TJKA 4TXOB 3TJGA 2XC2A 2LNTA 3ZYWA 2IJYA 4J56E 2JZRA 4G9HA 2YNXA 5J4UA 2C8UA 3FZ4A 5D9WA 2CZ3A 3KMNA 4IJ3A 3HHVA 2H70A 3CSIA 1GLQA 3A2VA 2PN8A 1E2YA 3I69A 3GKKA 2YZUA 5CREA 2VOCA 1X9SB 3H1NA 3QD9A 1A8YA 1WIKA 1WP0A 1XWGA 1V98A 2HZEA 4I2TA 2DKHA 3D5JA 5BRTA 2K9FA 2HXKA 4GQFA 2TRCP 2JSZA 2JSYA 2EIRA 1FOHA 3APSA 2E7PA 2R0GA 3IR4A 4HDEA 4Q5QA 3CSHA 4ULXA 2YPMA 3MIXA 3TJBA 4JEDA 3DRNA 4Q5RA 4O7HA 2X8CA 4HI7A 3IAS2 3LQ7A 3C71A 5G5EA 1CQHA 1XCCA 2LTKA 1U3AA 2I3YA 1XWBA 2FA4A 4FQUA 2V32A 2GSQA 1YDKA 3QFBC 1DE2A 5D8IA 4Z7XA 4AF2A 1FB0A 3NOFA 1SYXA 1YZXA 4RQRA 2GLRA 2H1AA 3KEBA 2FWGA 4ECIA 1GSQA 3Q74A 1U6TA 2OKAA 3UBKA 4OFNA 3A5WA 2DIZA 4OO5A 4FH8A 1GSEA 3ME8A 5GZZB 3BCKA 3UOMA 4MP4A 4F2IA 4MF5A 5AGYA 1K3LA 1ERWA 3M1GA 1GSDA 3U5RE 1O73A 2YV7A 3RHCA 1TJDA 1WWJA 2A4HA 4ECBA 4IGJA 4G0IA 3F8UA 4OMVA 2F9SA 1G6YA 2HZFA 2NVLA 3HVVA 4E8HA 1SD8A 1PL2A 1K0DA 16GSA 5FWGA 4MLYA 1OYJA 4MK3A 1TP9A 5IM9A 5DDLA 2IFQB 1GSFA 4CW9A 2MBSA 1KNGA 4YAVA 4NAXA 2P5QA 1QFNA 1VF1A 5E4WA 4AKHA 2DJ0A 3P90A 1AW9A 4HJMA 1X5DA 1N8JA 2MMOA 4X0XA 4F9ZA 1U3IA 4AJ6A 2AB6A 2VO4A 2GDRA 2REMA 1BG5A 2GZYA 1SVMA 5INYA 1F9MA 1MTCA 3K8NA 3MDKA 2D2ZA 4HEA2 3CXGA 2YWMA 4POBA 4GWRA 1GRXA 1BQ7A 5CNWA 2O5VA 2I9HA 2QKEA 2B5YA 2JU5A 4I6XA 1FO5A 3IOSA 5C04A 1DE1A 1GNWA 1UA5A 2VCWA 2GS3A 2AJQB 3HA9A 2A4VA 3GRXA 2PWJA 3LORA 5DCHA 3PGTA 3EMXA 3ZRDA 19GSA 4PGTA 1SJIA 2OACA 2YCDA 3M3MA 4O5UA 4AI6A 1BX9A 2HSNB 2AYTA 2ON5A 3HD5A 3VFIA 1T8EB 1A2JA 3ZFBA 4DSQA 1XWKA 3KCMA 3GL5A 3LFLA 1O85A 2KLXA 4NV2A 2VM2A 2L6DA 2JL4A 2VUPA 1T4ZA 2X49A 1NM3A 1X9WB 5ECNB 1I9DA 3CMIA 1EZKA 4K9ZA 2VLVA 4MJEA 5F07A 3A3TA 4MMMA 4L0UA 2V1MA 4MZCA 2R37A 4IQ1A 1K0BA 3UIWA 5ABRA 3FKFA 4N0VA 3CTGA 3L0HA 3H8QA 1T7PB 2XPDA 3P2AA 3ZITA 5BMUB 4OFTA 2V6KA 4K8MA 2FUG2 4ICYA 3QCPA 4G19A 3EU3A 3FRCA 2XHFA 3IHGA 2UZ8A 2B1KA 3US3A 3APOA 1TRVA 4RUVA 1X5EA 2IMFA 1S3AA 1YKCA 3GHAA 2C3TA 2P0GA 3U6VA 3ERWA 3TGZA 1ERTA 4KNDA 4QMKA 1T1VA 4MNNA 2JZTA 3KMOA 2F51A 3KJYA 2KP2A 2X8GA 3DVWA 4GDFA 1R5PA 4JR4A 5ECKB 3RPNA 3L9UA 1KEBA 3QPMA 4ZL9A 4O92A 3N5OA 3IC4A 5DQSA 1TTZA 2FLSA 4GQCA 3UVTA 5ELAA 1E6BA 4POMA 3HDCA 2RUEA 5EPFA 1M2AA 4V2LA 1MDJA 3ZIJA 4K7OA 4LLRA 1B4QA 2R4VA 5G1KA 4BWSA 1GSYA 1O81A 4F03A 5D9VA 3FYGA 4MPFA 3IK7A 3TKSE 1GL8A 3HVSA 3LYKA 4MPGA 4OWYA 1V57A 9GSSA 4PUAA 4KSOA 2H01A 4GSNA 7GSSA 4FIWA 2F8AA 2PBJA 4KGIA 1GUKA 2XBIA 2G0FA 3F9UA 3GX0A 17GSA 3TKSC 3EU4A 3F6DA 2HT9A 3ME7A 1XIYA 3VI5A 1XOBA 5ECQB 2NPBA 4D73A 1AC1A 3HVXA 3CSJA 2GZZA 5J4YA 1EOGA 3UEMA 3VWXA 1RW1A 2H19A 3S9FA 4ML6A 3ERFA 2BTOT 2L5LA 3TKQA 5CRGA 1PQNA 1TRSA 3ED3A 1UVZA 2DKIA 2K18A 4RI6A 2MMAA 3KIJA 3F3QA 3TKPA 2C0EA 1MD3A 2TRXA 1AQVA 1YF1A 4V2MA 1AAZA 3UMAA 3CBUA 3GX8A 5GAPD 5ECIB 1LJRA 2YN1A 1YF0A 4Q5NA 3GKMA 2O87A 4JRRA 1A24A 1TW9A 5ECPB 4G01A 1I5GA 3UBLA 3L4NA 3R3EA 4PURA 2KHPA 2QA2A 2IPAA 2LEGA 2L59A 4NXIA 5CRHA 2FGXA 4J57E 1PL1A 3LEFA 5A5HB 1GTBA 4KCEA 1BF5A 5ECOB 5AISA 4ZB7A 1TU8A 4GLTA 3PINA 5A4VA 2YWIA 1USBA 2VCXA 2GSSA 3CYNA 1TI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJX A;  5D96 A;  2CA8 A;  3RAZ A;  1AXD A;  4NHW A;  1Z3E A;  4KCA A;  3UAP A;  4KA0 A;  1M2D A;  1Y6E A;  1ACV A;  1FW1 A;  5JWO B;  2LST A;  2WS2 A;  2H73 A;  1G7O A;  1O6J A;  2C3N A;  1AQW A;  3ZIV A;  1XPV A;  4TR1 B;  3WGE A;  2EC4 A;  4FYU A;  4PQI A;  1EP8 A;  1XW6 A;  2HSM B;  3W8J A;  2PVQ A;  3RBT A;  3NZN A;  2FHE A;  1XZO A;  4L5L A;  1HYU A;  5COH A;  4POL A;  3IAM 2;  1LBK A;  5DAL B;  1PMT A;  3LG6 A;  3FHK A;  4QL7 A;  4PQ1 A;  1XW5 A;  4ZIL A;  3GST A;  3WGX A;  4IS0 A;  3DEX A;  4OFM A;  2I4A A;  2RLI A;  3D4M A;  2CVD A;  3MAK A;  1ERU A;  1TK8 B;  2OAD A;  1SL1 B;  1XVQ A;  1BED A;  3FR9 A;  4NHZ A;  1GH2 A;  2H74 A;  4HU9 A;  4YAP A;  4AGS A;  2YZH A;  3KH7 A;  1NSW A;  1PGT A;  2HLS A;  3DKS A;  5HFG A;  4HOJ A;  2L5O A;  3HXS A;  6GSV A;  2H0G A;  4K1F A;  4MJB A;  2H0H A;  5IMV A;  4MF7 A;  2WUL A;  2H6Y A;  4WXT A;  3UL3 A;  3KD0 A;  4AJ8 A;  1OC9 A;  4RQX A;  5AN1 A;  4JZQ A;  2YP6 A;  1SK0 A;  1AIU A;  1Z6M A;  5HR2 A;  5B6M A;  2LV3 A;  1T3B A;  3DYR A;  3FW2 A;  2QSI A;  3HYP A;  4ZB9 A;  3DGQ A;  2VL2 A;  3E3E A;  5EY6 A;  8GSS A;  4TR3 A;  4MJA A;  4IKH A;  1OKD A;  4XS1 A;  2PGT A;  3LXT A;  3IDV A;  4ML1 A;  5GAN D;  1ZZY A;  1GTU A;  2PUK C;  1TU7 A;  4CHS A;  5CAX A;  2H1B A;  3EC3 A;  2MBT A;  3ZML A;  2ES7 A;  2RII A;  1JZR A;  5ECH B;  4DSS B;  1OE7 A;  3W8S A;  2N5A A;  6GSY A;  3P7X A;  1X9M B;  2DJ2 A;  2FA8 A;  3QAW A;  2NDO A;  1QMV A;  2MZC A;  4BVY A;  1F3B A;  4KSM A;  2KUC A;  3C8E A;  3TDG A;  1Q4J A;  1GUM A;  5DBQ A;  1T4Y A;  4ZL8 A;  2L6C A;  1C72 A;  5GSS A;  3BCI A;  4WF4 A;  3UAR A;  2CV4 A;  1XW9 A;  4K6X A;  2M80 A;  5HQP A;  3VUR A;  4IJI A;  3H4K A;  3RPP A;  5FT3 A;  4DVC A;  2NTO A;  3WT1 A;  5CP1 A;  1THX A;  3HZ8 A;  2VD0 A;  3UVH A;  5D9T A;  2OE3 A;  3D4T A;  3GMF A;  5DJL A;  3TB2 A;  2E0Q A;  2E2G A;  3LWA A;  4XS4 A;  4TKY A;  1GUL A;  1ST9 A;  3GV1 A;  2X99 A;  3D0Z A;  1PA3 A;  4OD7 A;  3O3T A;  2V6O A;  2CAI A;  4TXO A;  6GSS A;  2DIY A;  3LJR A;  4OO4 A;  2H0I A;  3KP8 A;  1OKT A;  1FB6 A;  2B5E A;  2K8V A;  1GUH A;  2J9H A;  3BBY A;  3GA4 A;  2AAW A;  3GTU B;  3HKR A;  2IIY A;  3L78 A;  3DD3 A;  3KTL A;  1DSB A;  2GSR A;  3QMX A;  4F0C A;  2VLT A;  5C00 A;  2DML A;  1TOF A;  3C1S A;  3M9K A;  3F63 A;  2DSA A;  1YEP A;  4IQA A;  4BVX B;  2C0D A;  1ABA A;  3UJ1 A;  1YEX A;  4ECJ A;  2AHE A;  3FZA A;  5A4W A;  1GSS A;  1O8W A;  3QAG A;  2DC5 A;  4JR6 A;  1EGR A;  3ZVJ D;  2DJJ A;  3GL3 A;  4HJ2 A;  1MDK A;  2E2M A;  2KOK A;  3TOT A;  3F4S A;  1GP1 A;  1RK4 A;  4IW9 A;  1QK8 A;  2RUF A;  2FNO A;  4TOP A;  1SJ6 A;  4HU7 A;  3GN3 A;  4PX1 A;  3GH6 A;  2FCH A;  5CRW A;  2R2J A;  3PPU A;  4HQS A;  3E9J B;  20GS A;  3IA1 A;  6GSX A;  1NHY A;  1YY7 A;  1OVN A;  1ZL9 A;  3I43 A;  4WR4 A;  2L4Q A;  1HD2 A;  2H66 A;  4FYC A;  3ZFL A;  4FYB A;  3HJP A;  2JZS A;  1DUG A;  2OJL A;  4Q5F A;  3SWL A;  2VCQ A;  4QL9 A;  2K8S A;  1N2A A;  3O6T A;  1F6M C;  4GXZ A;  1SKR B;  5KN3 A;  1TK0 B;  2L4C A;  1PSQ A;  1YJ6 A;  1J9B A;  4D73 B;  2DJ3 A;  1HQO A;  2WB9 A;  2H75 A;  5J9B A;  4WET A;  4NPB A;  1SYR A;  1GTI A;  1TXX A;  2CVB A;  5J41 A;  5A5K A;  3TKR A;  2OE1 A;  2IFQ A;  2YJH A;  5D73 A;  2LQO A;  3W6G A;  1R5A A;  5E59 A;  1URM A;  4NWY A;  3M0F A;  4OCF A;  1EWX A;  4POK A;  3GSS A;  2RM6 A;  4EO3 A;  3QFA C;  2F8F A;  5G30 A;  4XTS A;  2CZ2 A;  3IV4 A;  3TJF A;  1FVK A;  4YQM A;  3IPZ A;  2B7J A;  5JCU A;  2FWH A;  4L0W A;  3BD2 A;  1FG4 A;  2C4J A;  2HRK B;  1QXH A;  1B9Y C;  1XWA A;  1TK5 B;  12GS A;  4MAB A;  2O85 A;  2GVP A;  4MA9 A;  3KGK A;  4V1A g;  2LJA A;  2V2G A;  2TIR A;  1U87 A;  1G0T A;  2IWT A;  4TN8 A;  5B8A A;  1WJK A;  2LNS A;  1AQX A;  2EIQ A;  1K0O A;  5ENU A;  3A2W A;  1Z5Y E;  3TCO A;  4IBP A;  3G7J A;  1WRY A;  1WE0 A;  2VIM A;  2FY6 A;  5HFK A;  2M46 A;  2GTU A;  1THO A;  1M9A A;  4TXV A;  4I97 A;  4NMU A;  4JE1 A;  2B3S A;  4N0Z A;  2PMT A;  3L9V A;  3IBH A;  1V2A A;  4GST A;  1SU9 A;  4KDY A;  3R2Q A;  5HFI A;  2C80 A;  5ID2 A;  2WDU A;  2ON7 A;  5F06 A;  3EMP A;  4IP6 A;  4ZBD A;  4K0G A;  2HYX A;  4G10 A;  5LNK e;  3LGC A;  3J7Y k;  2WJU A;  3DWV A;  1AUC A;  3NIV A;  4EVM A;  1LU4 A;  2A2R A;  5KN0 A;  1U88 A;  1K0C A;  5EVO A;  3GIX A;  3PH9 A;  2IMD A;  3LSZ A;  3P8W A;  4KF9 A;  4WEY A;  1TDI A;  1R7H A;  5EL8 A;  4JBB A;  4NV5 A;  4J2F A;  1EEM A;  2XBQ A;  4BPY A;  3C73 A;  3I6A A;  1O8X A;  2YJ7 A;  5BMU A;  5CO3 A;  4BA7 A;  3I9V 2;  3D6I A;  3VLN A;  5DAK B;  2GZP A;  3IE3 A;  2HQT A;  2HI7 A;  4ZL7 A;  1M99 A;  3F3R A;  4K2D A;  1M2B A;  5HR1 A;  2FWF A;  4G2E A;  2CT6 A;  3PR8 A;  4WKW A;  4EKZ A;  2P5R A;  3D21 A;  2H72 A;  4PXO A;  4JU5 A;  1PKZ A;  1WMJ A;  5LD0 A;  1FHE A;  1KBN A;  4PUF C;  5H5Q A;  1O7U A;  1T00 A;  1F37 A;  2HSY A;  2DJK A;  4EDY A;  2HZE B;  3ERG A;  1K3Y A;  4EL1 A;  4O5R A;  2C3Q A;  3OR5 A;  4GTU A;  4KE3 A;  3VWV A;  2CVK A;  3E0U A;  2HRN A;  1SL2 B;  1ZOF A;  4I8B A;  3CRT A;  3V1W A;  1ERV A;  3FK8 A;  1XXU A;  1YKA A;  18GS A;  5J3R A;  4N30 A;  3G7Y A;  1M7T A;  1EEJ A;  2HRA A;  2WCI A;  1F3A A;  3DVX A;  4CDO A;  1G6W A;  1HNB A;  3QOU A;  1Z6N A;  2H6Z A;  4H86 A;  1J0F A;  5D93 A;  1SK1 A;  3H93 A;  1IYH A;  4ISD A;  5B8B A;  1A2L A;  1X0R A;  2H30 A;  1EGO A;  1VRS D;  3G9B A;  4EDZ A;  5IOX A;  1BAY A;  3KZQ A;  4MF6 A;  2H76 A;  2HSH A;  2OBI A;  3ZVJ A;  2WFC A;  2VD1 A;  1ZGN A;  4YQU A;  4FO5 A;  2CQ9 A;  1B8X A;  3TUE A;  2YWO A;  5KN2 A;  4XIH A;  2LJK A;  2O89 A;  4BL7 A;  2YWN A;  3CRU A;  2A2S A;  4ECC A;  1A0R P;  2CAQ A;  2WZ9 A;  2XPE A;  2M72 A;  4MJC A;  4KDX A;  1VF4 A;  4MZB A;  2VL3 A;  3QAV A;  2Z9S A;  13GS A;  1XBS A;  2H71 A;  2NBS A;  5IO0 A;  1SD9 A;  1F2E A;  3BJ5 A;  2MYG A;  5AIX A;  4ILF A;  1TKD B;  1M0U A;  2MMZ A;  2VLU A;  2VCT A;  3F4R A;  2LKU A;  4MH3 A;  3DIE A;  4XHM A;  5FHI A;  5JCG A;  1ON4 A;  2G2Q A;  4HS1 A;  4TR1 A;  5ELG A;  2HSM A;  1FAA A;  3FEU A;  1H75 A;  2FWE A;  10GS A;  1JLV A;  2KP1 A;  2QGV A;  2GQK A;  5JCW A;  1IYI A;  5DAL A;  2OA7 A;  3GKN A;  4L5O A;  1XWC A;  2HFD A;  2K6V A;  1VF2 A;  4KW6 A;  4G0L A;  5ECS A;  3TOU A;  2V41 A;  1TI1 A;  5DCG A;  5HR3 A;  2GT6 A;  3IHQ A;  5IPH A;  1ZYE A;  2C0G A;  4IN0 A;  5ECL B;  3HY2 A;  4XRD A;  3VK9 A;  4XRA A;  4O32 A;  5JWQ B;  5CRD A;  3TKS A;  4PNF A;  1X5C A;  4HZ2 A;  2HRF A;  3GUS A;  2GQM A;  4PNG A;  1V58 A;  4TVE A;  2N5B A;  3F6F A;  5HR0 A;  1SEN A;  4DSR A;  3CTF A;  2EIO A;  3Q19 A;  1GWC A;  1SL0 B;  2H1G A;  3H79 A;  5IMD A;  2MMN A;  5GST A;  2C0F A;  1PKW A;  2IMK A;  5IMC A;  3EUR A;  22GS A;  2WRT A;  1SJZ A;  3JCM L;  4IEL A;  3L9S A;  1OC8 A;  2FD3 A;  1Q98 A;  3GUR A;  1PN9 A;  2DBC A;  5AIV A;  3RDW A;  4EUY A;  1CQG A;  4ZBB A;  4YH2 A;  3APQ A;  1TRU A;  1QUW A;  4G0K A;  5DJM A;  3KTB A;  1RQM A;  3VWU A;  3LYP A;  1XFL A;  5ECR B;  3WD6 A;  2VAF A;  5A4U A;  2B6M A;  2PVO C;  4EC0 A;  4K7I A;  4WF5 A;  1EP7 A;  2DLX A;  3KH9 A;  3KXO A;  11GS A;  1A0F A;  1OE8 A;  4LA1 A;  4ZBA A;  4KUN A;  2HE3 A;  3MWH A;  5G31 A;  2CX3 A;  2YOI A;  2IL3 A;  4WR5 A;  2LS5 A;  5DQY A;  1B9X C;  3C7M A;  1QQ2 A;  4DSS A;  5J5N A;  3VI7 A;  4ACS A;  3BOA A;  4V2N A;  1DBY A;  3ZRE A;  3A2X A;  1MEK A;  1OC3 A;  1HNC A;  1K0A A;  1PX6 A;  5ID2 B;  4F0B A;  4PTS A;  1A2M A;  1YQ1 A;  4IP1 A;  4ZXG A;  4WBR D;  14GS A;  3GKX A;  1R4W A;  4ID0 A;  2VCZ A;  3ZL5 A;  1W4V A;  4N10 A;  1MD4 A;  2PER A;  3HZ4 A;  2PPT A;  4X1U A;  4F82 A;  3TRP A;  2B7K A;  3G7I A;  3WGD A;  2JAD A;  1PRX A;  3ZZX A;  2GQL A;  1UC7 A;  2LRC A;  2R3X A;  1GNE A;  1SKW B;  1HNA A;  1NW2 A;  3IC8 A;  2YAN A;  1EV9 A;  5H5R A;  2I1U A;  4HUA A;  4KX4 A;  4EXJ A;  3WYW A;  1UN2 A;  2O8V B;  3GFK A;  3EIN A;  1ML6 A;  3KP9 A;  2YV9 A;  2ZNM A;  1GTA A;  2X64 A;  2LJR A;  4DEJ A;  1K0N A;  5KEJ A;  2O7K A;  3MNG A;  1NHO A;  3GTU A;  5IOW A;  4EF0 A;  1A8L A;  2IMI A;  1A23 A;  4AJ7 A;  3IRA A;  4MCU A;  5F8B A;  2VL2 C;  1ZYQ B;  2QC7 A;  2DJ1 A;  5J9C A;  4MH2 A;  4LL4 B;  5DVB A;  4LMW A;  2ALB A;  1SK2 A;  4K7N A;  3TRX A;  1PX7 A;  2DMM A;  4BVX A;  1BYE A;  6GSW A;  1JHB A;  3KM6 A;  1ILO A;  1J08 A;  1VF3 A;  4WBJ A;  5D9X A;  3VWW A;  4HQZ A;  1OAZ A;  4KH7 A;  5IMA A;  3EE2 A;  4E8E A;  1Z7P A;  3VPQ A;  5H5S A;  4V1A p;  1GLP A;  2P31 A;  4LL1 B;  1WOU A;  4XS6 A;  2H8L A;  4TRX A;  3WT2 A;  1FOV A;  2AV4 A;  4GCI A;  1B4P A;  4ZB8 A;  1V40 A;  3C1R A;  3O76 A;  1JZD A;  2LRT A;  1BJX A;  4BWQ A;  4K0N A;  5CYY A;  2IN3 A;  3QDN A;  5ECM B;  5B6N A;  5JWR B;  3F0I A;  3TRQ A;  2R5G A;  5F05 A;  1Z7R A;  5L71 A;  3Q6O A;  1V9W A;  4OCE A;  3Q18 A;  1ZMA A;  3ISO A;  3GNJ A;  3ZLP A;  3N9J A;  4USS A;  2X8H A;  1JFU A;  4IVF A;  5G5F A;  1JLW A;  2JAC A;  5IO2 A;  2PU9 C;  1Z9H A;  3AY8 A;  3DML A;  1VGL A;  2LQQ A;  5IPG A;  3D22 A;  3ZTL A;  1W89 A;  3SBC A;  4TW5 A;  2BMX A;  1SKS B;  2C1Y A;  1JZO A;  2WGR A;  2IME A;  4PQH A;  5G2Z A;  1XVW A;  2B5X A;  2CX4 A;  4GRF A;  1S3C A;  1G7E A;  3HCZ A;  4BL7 B;  3EVI A;  1OC9 B;  2HRK A;  4N11 A;  5F0G A;  4X43 A;  4EE0 A;  5IMF A;  3J7Y b;  1B48 A;  4HZ4 A;  5IQY A;  4GF0 A;  1QGV A;  4KAE A;  3LXZ A;  4IHU A;  4L8E A;  1H4O A;  1XOA A;  1EOH A;  4GSS A;  3FR3 A;  2J23 A;  4MZW A;  5IMZ A;  1ZCP A;  3EWL A;  3FZ9 A;  1K3O A;  3HJO A;  1WPI A;  5KN1 A;  2L57 A;  4I5Q A;  4MDC A;  4ZIJ A;  4ZB6 A;  2HNL A;  3GYK A;  3M8N A;  2LUS A;  1PD2 1;  4TR0 A;  2VCV A;  2H1D A;  2OBK A;  1MDI A;  3ZMK A;  2GGT A;  3M9J A;  5LCZ A;  2OE0 A;  4TR4 A;  2LRN A;  5B7C A;  3MSZ A;  4BVY B;  4QQ7 A;  2B1L A;  1TRW A;  1S3D A;  3FY7 A;  3IK9 A;  2RM5 A;  2GST A;  2VL9 A;  3EYT A;  1KTE A;  5G1L A;  1EV4 A;  2ZCT A;  2I81 A;  2H6X A;  1K0M A;  3GH9 A;  4RI7 A;  3HJM A;  1FVJ A;  4YQV A;  3FZ5 A;  4P3Y B;  6GST A;  1JZW A;  3DXB A;  5IIZ A;  3RHB A;  2VM1 A;  2GT5 A;  1R26 A;  1GSU A;  2ZUP A;  4KDU A;  1M9B A;  4I2U A;  2R6K A;  4XS4 B;  5DAK A;  6GSU A;  3FR6 A;  2AUV A;  2N5F A;  4XCS A;  3F4T A;  2F3M A;  3IXR A;  4KB3 A;  1Y25 A;  3VPT A;  3QR6 A;  3TJJ A;  4LMV A;  3TJK A;  4TXO B;  3TJG A;  2XC2 A;  2LNT A;  3ZYW A;  4J56 E;  2IJY A;  2JZR A;  4G9H A;  2YNX A;  5J4U A;  2C8U A;  3FZ4 A;  5D9W A;  2CZ3 A;  3KMN A;  4IJ3 A;  3HHV A;  2H70 A;  3CSI A;  1GLQ A;  3A2V A;  2PN8 A;  1E2Y A;  3I69 A;  3GKK A;  2YZU A;  5CRE A;  2VOC A;  1X9S B;  3H1N A;  3QD9 A;  1A8Y A;  1WIK A;  1WP0 A;  1XWG A;  1V98 A;  2HZE A;  4I2T A;  3D5J A;  2K9F A;  2HXK A;  4GQF A;  2TRC P;  2JSZ A;  2JSY A;  2EIR A;  3APS A;  2E7P A;  3IR4 A;  4HDE A;  4Q5Q A;  3CSH A;  4ULX A;  2YPM A;  3TJB A;  4JED A;  3DRN A;  4Q5R A;  4O7H A;  2X8C A;  4HI7 A;  3IAS 2;  3LQ7 A;  3C71 A;  5G5E A;  1CQH A;  1XCC A;  2LTK A;  1U3A A;  2I3Y A;  1XWB A;  2FA4 A;  4FQU A;  2V32 A;  2GSQ A;  1YDK A;  3QFB C;  1DE2 A;  5D8I A;  4Z7X A;  4AF2 A;  1FB0 A;  3NOF A;  1SYX A;  1YZX A;  4RQR A;  2GLR A;  2H1A A;  3KEB A;  2FWG A;  4ECI A;  1GSQ A;  3Q74 A;  1U6T A;  2OKA A;  3UBK A;  4OFN A;  3A5W A;  2DIZ A;  4OO5 A;  4FH8 A;  1GSE A;  3ME8 A;  5GZZ B;  3BCK A;  3UOM A;  4MP4 A;  4F2I A;  4MF5 A;  5AGY A;  1K3L A;  1ERW A;  3M1G A;  1GSD A;  3U5R E;  1O73 A;  2YV7 A;  3RHC A;  1TJD A;  1WWJ A;  4ECB A;  4IGJ A;  4G0I A;  3F8U A;  4OMV A;  2F9S A;  1G6Y A;  2HZF A;  2NVL A;  3HVV A;  4E8H A;  1SD8 A;  1PL2 A;  1K0D A;  16GS A;  5FWG A;  4MLY A;  1OYJ A;  4MK3 A;  1TP9 A;  5IM9 A;  5DDL A;  2IFQ B;  1GSF A;  4CW9 A;  2MBS A;  1KNG A;  4YAV A;  4NAX A;  2P5Q A;  1QFN A;  1VF1 A;  5E4W A;  2DJ0 A;  3P90 A;  1AW9 A;  4HJM A;  1X5D A;  1N8J A;  2MMO A;  4X0X A;  4F9Z A;  1U3I A;  4AJ6 A;  2AB6 A;  2VO4 A;  2GDR A;  2REM A;  1BG5 A;  2GZY A;  5INY A;  1F9M A;  1MTC A;  3K8N A;  3MDK A;  2D2Z A;  4HEA 2;  3CXG A;  2YWM A;  4POB A;  4GWR A;  1GRX A;  1BQ7 A;  5CNW A;  2I9H A;  2QKE A;  2B5Y A;  2JU5 A;  4I6X A;  1FO5 A;  3IOS A;  5C04 A;  1DE1 A;  1GNW A;  1UA5 A;  2VCW A;  2GS3 A;  2AJQ B;  3HA9 A;  2A4V A;  3GRX A;  2PWJ A;  3LOR A;  5DCH A;  3PGT A;  3EMX A;  3ZRD A;  19GS A;  4PGT A;  1SJI A;  2OAC A;  2YCD A;  3M3M A;  1BX9 A;  2HSN B;  2AYT A;  2ON5 A;  3HD5 A;  3VFI A;  1T8E B;  1A2J A;  3ZFB A;  4DSQ A;  1XWK A;  3KCM A;  3GL5 A;  3LFL A;  1O85 A;  2KLX A;  4NV2 A;  2VM2 A;  2L6D A;  2JL4 A;  2VUP A;  1T4Z A;  1NM3 A;  1X9W B;  5ECN B;  1I9D A;  3CMI A;  1EZK A;  4K9Z A;  2VLV A;  4MJE A;  5F07 A;  3A3T A;  4MMM A;  4L0U A;  2V1M A;  4MZC A;  2R37 A;  4IQ1 A;  1K0B A;  3UIW A;  5ABR A;  3FKF A;  4N0V A;  3CTG A;  3L0H A;  3H8Q A;  1T7P B;  2XPD A;  3P2A A;  3ZIT A;  4OFT A;  2V6K A;  4K8M A;  2FUG 2;  3QCP A;  4G19 A;  3EU3 A;  3FRC A;  2XHF A;  2UZ8 A;  2B1K A;  3US3 A;  3APO A;  1TRV A;  4RUV A;  1X5E A;  2IMF A;  1S3A A;  1YKC A;  3GHA A;  2C3T A;  2P0G A;  3U6V A;  3ERW A;  3TGZ A;  1ERT A;  4KND A;  1T1V A;  2JZT A;  3KMO A;  2F51 A;  3KJY A;  2KP2 A;  2X8G A;  3DVW A;  1R5P A;  4JR4 A;  5ECK B;  3RPN A;  3L9U A;  1KEB A;  3QPM A;  4ZL9 A;  4O92 A;  3N5O A;  3IC4 A;  5DQS A;  1TTZ A;  2FLS A;  4GQC A;  3UVT A;  5ELA A;  1E6B A;  4POM A;  3HDC A;  2RUE A;  5EPF A;  1M2A A;  4V2L A;  1MDJ A;  3ZIJ A;  4K7O A;  4LLR A;  1B4Q A;  2R4V A;  5G1K A;  4BWS A;  1GSY A;  1O81 A;  4F03 A;  5D9V A;  3FYG A;  4MPF A;  3IK7 A;  3TKS E;  1GL8 A;  3HVS A;  3LYK A;  4MPG A;  4OWY A;  1V57 A;  9GSS A;  4PUA A;  4KSO A;  2H01 A;  4GSN A;  7GSS A;  4FIW A;  2F8A A;  2PBJ A;  4KGI A;  1GUK A;  2XBI A;  2G0F A;  3F9U A;  3GX0 A;  17GS A;  3TKS C;  3EU4 A;  3F6D A;  2HT9 A;  3ME7 A;  1XIY A;  3VI5 A;  1XOB A;  5ECQ B;  2NPB A;  4D73 A;  1AC1 A;  3HVX A;  3CSJ A;  2GZZ A;  1EOG A;  3UEM A;  3VWX A;  1RW1 A;  2H19 A;  3S9F A;  4ML6 A;  3ERF A;  2BTO T;  2L5L A;  3TKQ A;  5CRG A;  1PQN A;  1TRS A;  3ED3 A;  1UVZ A;  2K18 A;  4RI6 A;  2MMA A;  3KIJ A;  3F3Q A;  3TKP A;  2C0E A;  1MD3 A;  2TRX A;  1AQV A;  1YF1 A;  4V2M A;  1AAZ A;  3UMA A;  3CBU A;  3GX8 A;  5GAP D;  5ECI B;  1LJR A;  2YN1 A;  1YF0 A;  4Q5N A;  3GKM A;  2O87 A;  4JRR A;  1A24 A;  1TW9 A;  5ECP B;  1I5G A;  3UBL A;  3L4N A;  3R3E A;  4PUR A;  2KHP A;  2IPA A;  2LEG A;  2L59 A;  4NXI A;  5CRH A;  2FGX A;  4J57 E;  1PL1 A;  3LEF A;  1GTB A;  4KCE A;  5ECO B;  5AIS A;  1TU8 A;  4GLT A;  3PIN A;  5A4V A;  2YWI A;  1USB A;  2VCX A;  2GSS A;  3CYN A;  1TI3 A; 
#chains in the Genus database with same CATH topology
 2BJX A;  5D96 A;  2CA8 A;  3RAZ A;  1AXD A;  4NHW A;  1Z3E A;  4KCA A;  3UAP A;  4KA0 A;  1M2D A;  1Y6E A;  4CY6 A;  4FXY P;  1ACV A;  5J4V A;  1FW1 A;  5JWO B;  2LST A;  2WS2 A;  2H73 A;  1G7O A;  1O6J A;  2C3N A;  1AQW A;  3ZIV A;  1XPV A;  4TR1 B;  3WGE A;  2EC4 A;  4FYU A;  4PQI A;  1EP8 A;  1XW6 A;  2HSM B;  3W8J A;  2PVQ A;  3RBT A;  3NZN A;  2FHE A;  1XZO A;  4L5L A;  1HYU A;  5COH A;  4POL A;  3IAM 2;  1LBK A;  5DAL B;  1PMT A;  3LG6 A;  3FHK A;  4QL7 A;  4PQ1 A;  1XW5 A;  4ZIL A;  3GST A;  3WGX A;  4IS0 A;  3DEX A;  4X4J A;  4OFM A;  2I4A A;  2RLI A;  3D4M A;  2CVD A;  3MAK A;  1ERU A;  1TK8 B;  2OAD A;  1SL1 B;  1SVL A;  1XVQ A;  1BED A;  3FR9 A;  4NHZ A;  1GH2 A;  2H74 A;  4HU9 A;  4YAP A;  5A1N A;  4AGS A;  2YZH A;  3KH7 A;  1NSW A;  1PGT A;  2HLS A;  3DKS A;  5HFG A;  2QA1 A;  4HOJ A;  2L5O A;  1M3J A;  3HXS A;  6GSV A;  2H0G A;  4K1F A;  4MJB A;  4PI2 C;  2H0H A;  5IMV A;  4MF7 A;  2WUL A;  2H6Y A;  4WXT A;  3UL3 A;  3KD0 A;  4AJ8 A;  1OC9 A;  4RQX A;  5AN1 A;  4JZQ A;  2YP6 A;  1SK0 A;  1AIU A;  1Z6M A;  5HR2 A;  5B6M A;  2LV3 A;  1T3B A;  3DYR A;  3FW2 A;  2QSI A;  3HYP A;  4AKG A;  4ZB9 A;  3DGQ A;  2VL2 A;  3E3E A;  5EY6 A;  8GSS A;  4TR3 A;  4MJA A;  4IKH A;  1OKD A;  4XS1 A;  2PGT A;  3LXT A;  3IDV A;  4ML1 A;  5GAN D;  1ZZY A;  1GTU A;  2PUK C;  1TU7 A;  4CHS A;  5CAX A;  2H1B A;  3EC3 A;  2MBT A;  3ZML A;  2ES7 A;  2RII A;  1JZR A;  5ECH B;  4DSS B;  1OE7 A;  3W8S A;  2N5A A;  6GSY A;  2WVY A;  3P7X A;  1X9M B;  2DJ2 A;  2FA8 A;  3QAW A;  2NDO A;  1QMV A;  5A34 A;  2MZC A;  4BVY A;  1F3B A;  4KSM A;  2KUC A;  3C8E A;  3TDG A;  1Q4J A;  1GUM A;  5DBQ A;  1T4Y A;  4ZL8 A;  1ZYP A;  2L6C A;  1C72 A;  5GSS A;  3BCI A;  4WF4 A;  3UAR A;  2CV4 A;  1XW9 A;  4K6X A;  2R0C A;  2M80 A;  5HQP A;  3VUR A;  4IJI A;  3H4K A;  3RPP A;  4O5Q A;  5FT3 A;  4DVC A;  2NTO A;  3WT1 A;  5CP1 A;  3HMJ G;  1THX A;  3HZ8 A;  2VD0 A;  3UVH A;  5D9T A;  2OE3 A;  3D4T A;  3GMF A;  5DJL A;  3TB2 A;  2E0Q A;  2E2G A;  3LWA A;  4XS4 A;  4TKY A;  1GUL A;  1ST9 A;  3GV1 A;  2X99 A;  3D0Z A;  1PA3 A;  4OD7 A;  3O3T A;  2V6O A;  2CAI A;  4TXO A;  6GSS A;  2DIY A;  3LJR A;  4OO4 A;  2H0I A;  3KP8 A;  1OKT A;  1FB6 A;  2B5E A;  2K8V A;  1GUH A;  2J9H A;  5J47 A;  3BBY A;  3GA4 A;  2AAW A;  3GTU B;  3HKR A;  2IIY A;  3L78 A;  3DD3 A;  3KTL A;  1DSB A;  2GSR A;  3QMX A;  4F0C A;  2VLT A;  5C00 A;  3MYD A;  2DML A;  1TOF A;  3C1S A;  3M9K A;  3F63 A;  2DSA A;  1YEP A;  2EFE A;  4IQA A;  4BVX B;  2C0D A;  1ABA A;  3UJ1 A;  1YEX A;  4ECJ A;  2AHE A;  3FZA A;  5A4W A;  4K5R A;  1GSS A;  1O8W A;  3QAG A;  2DC5 A;  4JR6 A;  1EGR A;  3ZVJ D;  2DJJ A;  3GL3 A;  4HJ2 A;  1MDK A;  2E2M A;  2KOK A;  3TOT A;  3F4S A;  1GP1 A;  1RK4 A;  4IW9 A;  1QK8 A;  2RUF A;  2FNO A;  4TOP A;  1SJ6 A;  4HU7 A;  3GN3 A;  4PX1 A;  3GH6 A;  2FCH A;  5CRW A;  2WW3 A;  2R2J A;  3PPU A;  4HQS A;  3E9J B;  20GS A;  3IA1 A;  6GSX A;  1NHY A;  1YY7 A;  1OVN A;  4EIQ A;  1ZL9 A;  3I43 A;  4WR4 A;  2L4Q A;  1HD2 A;  2H66 A;  4FYC A;  3ZFL A;  4FYB A;  3HJP A;  2JZS A;  1DUG A;  2OJL A;  4Q5F A;  3SWL A;  2VCQ A;  4QL9 A;  2K8S A;  1N2A A;  3O6T A;  1F6M C;  4GXZ A;  1SKR B;  5KN3 A;  5KOW A;  1TK0 B;  2L4C A;  1PSQ A;  1YJ6 A;  1J9B A;  4D73 B;  2DJ3 A;  1HQO A;  2WB9 A;  2H75 A;  5J9B A;  4WET A;  4NPB A;  1SYR A;  1GTI A;  1TXX A;  2CVB A;  5J41 A;  5A5K A;  3TKR A;  2OE1 A;  2IFQ A;  4AKI A;  2YJH A;  5D73 A;  2LQO A;  3W6G A;  1R5A A;  5E59 A;  1URM A;  4NWY A;  3M0F A;  4OCF A;  1EWX A;  4POK A;  3GSS A;  2RM6 A;  4EO3 A;  3QFA C;  2F8F A;  5G30 A;  4XTS A;  2CZ2 A;  3IV4 A;  3TJF A;  1FVK A;  4YQM A;  3IPZ A;  2B7J A;  5JCU A;  2FWH A;  4L0W A;  3BD2 A;  1FG4 A;  2C4J A;  2HRK B;  1QXH A;  1B9Y C;  1XWA A;  1TK5 B;  12GS A;  4MAB A;  2O85 A;  2GVP A;  4MA9 A;  3KGK A;  4V1A g;  2LJA A;  2V2G A;  2TIR A;  3RFR C;  1U87 A;  1G0T A;  2IWT A;  4TN8 A;  5B8A A;  1WJK A;  2LNS A;  1AQX A;  1S3R A;  2EIQ A;  1K0O A;  5ENU A;  3A2W A;  1Z5Y E;  3TCO A;  4IBP A;  3G7J A;  1WRY A;  1WE0 A;  2VIM A;  2FY6 A;  5HFK A;  2M46 A;  2GTU A;  1THO A;  1M9A A;  4TXV A;  4I97 A;  4NMU A;  4JE1 A;  2B3S A;  4N0Z A;  2PMT A;  4Z2U A;  3L9V A;  3IBH A;  1V2A A;  4GST A;  1SU9 A;  4KDY A;  3R2Q A;  5HFI A;  2HSN A;  2C80 A;  5ID2 A;  2WDU A;  2ON7 A;  5F06 A;  3EMP A;  4IP6 A;  4ZBD A;  4HSC X;  4K0G A;  2HYX A;  4G10 A;  5LNK e;  2H1L A;  3LGC A;  3J7Y k;  2WJU A;  3DWV A;  1AUC A;  3NIV A;  4EVM A;  1LU4 A;  2A2R A;  5KN0 A;  1U88 A;  1K0C A;  5EVO A;  3GIX A;  3PH9 A;  2IMD A;  3LSZ A;  3P8W A;  4KF9 A;  4WEY A;  1TDI A;  1R7H A;  5EL8 A;  4JBB A;  4NV5 A;  2WZS A;  4J2F A;  1EEM A;  2O3E A;  2XBQ A;  4BPY A;  3C73 A;  3I6A A;  1O8X A;  2YJ7 A;  5BMU A;  5CO3 A;  4BA7 A;  3I9V 2;  3D6I A;  3VLN A;  5DAK B;  2GZP A;  3HVN A;  3IE3 A;  2HQT A;  2HI7 A;  4ZL7 A;  1M99 A;  3F3R A;  1TXU A;  4K2D A;  1M2B A;  5HR1 A;  2FWF A;  4G2E A;  2CT6 A;  2WVZ A;  3PR8 A;  4WKW A;  4EKZ A;  2P5R A;  3D21 A;  2H72 A;  4PXO A;  4JU5 A;  1PKZ A;  1WMJ A;  5LD0 A;  1FHE A;  1KBN A;  4PUF C;  5H5Q A;  1O7U A;  1T00 A;  1F37 A;  2HSY A;  2DJK A;  4EDY A;  2HZE B;  3ERG A;  1K3Y A;  4EL1 A;  1BG1 A;  2WVX A;  4O5R A;  2C3Q A;  3OR5 A;  4GTU A;  4KE3 A;  3VWV A;  2CVK A;  3E0U A;  2HRN A;  1SL2 B;  1ZOF A;  4I8B A;  3CRT A;  3V1W A;  1ERV A;  3FK8 A;  1XXU A;  1YKA A;  18GS A;  5J3R A;  4N30 A;  3G7Y A;  3CHX C;  1M7T A;  1EEJ A;  2HRA A;  2WCI A;  1F3A A;  3DVX A;  4CDO A;  1G6W A;  1HNB A;  3QOU A;  1Z6N A;  2H6Z A;  4H86 A;  1J0F A;  5D93 A;  1SK1 A;  3H93 A;  1IYH A;  4ISD A;  5B8B A;  1A2L A;  1X0R A;  2H30 A;  1EGO A;  1VRS D;  3G9B A;  4EDZ A;  5IOX A;  1BAY A;  3KZQ A;  4MF6 A;  2H76 A;  2HSH A;  2OBI A;  3ZVJ A;  4AKX B;  2WFC A;  2VD1 A;  1ZGN A;  4YQU A;  4FO5 A;  2CQ9 A;  1B8X A;  3TUE A;  2YWO A;  5KN2 A;  4XIH A;  2LJK A;  2O89 A;  4BL7 A;  2YWN A;  3CRU A;  2A2S A;  4ECC A;  1A0R P;  2CAQ A;  2WZ9 A;  2XPE A;  2M72 A;  4MJC A;  4KDX A;  1VF4 A;  4MZB A;  1PFO A;  2VL3 A;  3QAV A;  2Z9S A;  5A5H A;  13GS A;  1XBS A;  2H71 A;  2NBS A;  5IO0 A;  1SD9 A;  1F2E A;  3BJ5 A;  1M3I A;  2MYG A;  5AIX A;  4ILF A;  1TKD B;  1M0U A;  2MMZ A;  2VLU A;  2VCT A;  3F4R A;  2LKU A;  4MH3 A;  3DIE A;  4XHM A;  5FHI A;  5JCG A;  1ON4 A;  2G2Q A;  4HS1 A;  2R0P A;  4TR1 A;  5ELG A;  2HSM A;  1FAA A;  3FEU A;  1H75 A;  2FWE A;  10GS A;  1JLV A;  2KP1 A;  2QGV A;  2GQK A;  5JCW A;  1IYI A;  5DAL A;  2OA7 A;  3GKN A;  4L5O A;  1XWC A;  2HFD A;  2K6V A;  1VF2 A;  4KW6 A;  4G0L A;  5ECS A;  3TOU A;  2V41 A;  1TI1 A;  5DCG A;  5HR3 A;  2GT6 A;  3IHQ A;  5IPH A;  1ZYE A;  2C0G A;  4IN0 A;  5ECL B;  3HY2 A;  4XRD A;  3VK9 A;  4XRA A;  4O32 A;  5JWQ B;  5CRD A;  3TKS A;  4PNF A;  1X5C A;  4HZ2 A;  2HRF A;  3GUS A;  2GQM A;  4PNG A;  1V58 A;  4TVE A;  2N5B A;  3F6F A;  5HR0 A;  1SEN A;  4DSR A;  3CTF A;  2EIO A;  3Q19 A;  1GWC A;  1SL0 B;  2H1G A;  3H79 A;  5IMD A;  2MMN A;  5GST A;  2C0F A;  1PKW A;  2IMK A;  5IMC A;  3EUR A;  22GS A;  2WRT A;  1SJZ A;  3JCM L;  4IEL A;  3L9S A;  4E68 A;  1OC8 A;  2FD3 A;  1Q98 A;  3GUR A;  1PN9 A;  2DBC A;  5AIV A;  3RDW A;  4EUY A;  1CQG A;  3LW9 A;  4ZBB A;  4YH2 A;  3APQ A;  1TRU A;  1QUW A;  4G0K A;  5DJM A;  3KTB A;  1RQM A;  3VWU A;  3LYP A;  1XFL A;  5ECR B;  3WD6 A;  2VAF A;  5A4U A;  2B6M A;  4W66 A;  2PVO C;  4EC0 A;  4K7I A;  4WF5 A;  1EP7 A;  2DLX A;  3KH9 A;  2WW2 A;  3KXO A;  11GS A;  1A0F A;  1OE8 A;  4LA1 A;  4ZBA A;  4KUN A;  2HE3 A;  3MWH A;  2EFC A;  5G31 A;  2CX3 A;  2YOI A;  2IL3 A;  4WR5 A;  2LS5 A;  5DQY A;  1B9X C;  3FMW A;  3C7M A;  1QQ2 A;  4DSS A;  1Y1U A;  5J5N A;  3VI7 A;  4ACS A;  3BOA A;  4V2N A;  1DBY A;  3ZRE A;  3A2X A;  1MEK A;  1OC3 A;  1HNC A;  1K0A A;  1PX6 A;  5ID2 B;  4F0B A;  4PTS A;  1A2M A;  1YQ1 A;  4IP1 A;  4EIP A;  4ZXG A;  4WBR D;  14GS A;  3GKX A;  1R4W A;  4ID0 A;  2VCZ A;  3ZL5 A;  1W4V A;  4N10 A;  1MD4 A;  2PER A;  3HZ4 A;  2PPT A;  4X1U A;  4F82 A;  2EFD A;  3TRP A;  2B7K A;  3G7I A;  3WGD A;  2JAD A;  1PRX A;  3ZZX A;  2GQL A;  1UC7 A;  2LRC A;  2R3X A;  1GNE A;  1SKW B;  1HNA A;  1NW2 A;  3IC8 A;  2YAN A;  1EV9 A;  5H5R A;  2I1U A;  4HUA A;  4KX4 A;  4EXJ A;  3WYW A;  1UN2 A;  2O8V B;  3GFK A;  3EIN A;  4K5S A;  1ML6 A;  3KP9 A;  2YV9 A;  2ZNM A;  4K2X A;  1GTA A;  2X64 A;  2LJR A;  4DEJ A;  1K0N A;  5KEJ A;  2OT3 A;  5J40 A;  2O7K A;  3MNG A;  2EFH A;  1NHO A;  3GTU A;  5IOW A;  4EF0 A;  1A8L A;  2IMI A;  1A23 A;  4AJ7 A;  3IRA A;  4MCU A;  5F8B A;  2VL2 C;  1ZYQ B;  2QC7 A;  2DJ1 A;  5J9C A;  4MH2 A;  4LL4 B;  3TU3 B;  5DVB A;  4LMW A;  2ALB A;  2X4A A;  1SK2 A;  4K7N A;  3TRX A;  1PX7 A;  2DMM A;  4BVX A;  1BYE A;  6GSW A;  4CY8 A;  1JHB A;  3KM6 A;  1ILO A;  1J08 A;  1VF3 A;  4YKF A;  4WBJ A;  4Z2R A;  5D9X A;  3VWW A;  1OAZ A;  4HQZ A;  4KH7 A;  5IMA A;  3EE2 A;  4E8E A;  1Z7P A;  3VPQ A;  5H5S A;  4V1A p;  4BIK A;  1GLP A;  3A5I A;  2P31 A;  3CWG A;  4LL1 B;  1WOU A;  4XS6 A;  2H8L A;  4TRX A;  3WT2 A;  1FOV A;  1N25 A;  2AV4 A;  4GCI A;  1B4P A;  4ZB8 A;  1V40 A;  2VKZ G;  2A2P A;  3C1R A;  3O76 A;  1JZD A;  2LRT A;  1BJX A;  4BWQ A;  4K0N A;  5CYY A;  2IN3 A;  3QDN A;  5ECM B;  5B6N A;  5JWR B;  3F0I A;  3TRQ A;  2R5G A;  5F05 A;  1Z7R A;  4YKG A;  5L71 A;  3Q6O A;  1V9W A;  4OCE A;  3Q18 A;  1ZMA A;  3ISO A;  3GNJ A;  3ZLP A;  3N9J A;  4USS A;  1I1I P;  2X8H A;  1JFU A;  4IVF A;  5G5F A;  1JLW A;  2JAC A;  5IO2 A;  2PU9 C;  1Z9H A;  3AY8 A;  3DML A;  1VGL A;  2LQQ A;  5IPG A;  3D22 A;  3ZTL A;  1W89 A;  3SBC A;  5A1N B;  4TW5 A;  2BMX A;  1SKS B;  2C1Y A;  1JZO A;  2WGR A;  2IME A;  2UV8 G;  4PQH A;  5G2Z A;  1XVW A;  2B5X A;  2CX4 A;  4GRF A;  1S3C A;  1G7E A;  3HCZ A;  4BL7 B;  3EVI A;  1OC9 B;  2HRK A;  4N11 A;  5F0G A;  4X43 A;  4A5P A;  4EE0 A;  5IMF A;  1SVO A;  3J7Y b;  1B48 A;  4HZ4 A;  5IQY A;  3CQF A;  1ZYN A;  4GF0 A;  1QGV A;  4KAE A;  3LXZ A;  4IHU A;  4L8E A;  1H4O A;  1XOA A;  1EOH A;  4Z2T A;  4GSS A;  3FR3 A;  2J23 A;  4MZW A;  5IMZ A;  1ZCP A;  3EPT A;  3EWL A;  3FZ9 A;  1K3O A;  3HJO A;  1WPI A;  5KN1 A;  2L57 A;  4I5Q A;  4MDC A;  4ZIJ A;  4ZB6 A;  2HNL A;  3GYK A;  3M8N A;  2LUS A;  1PD2 1;  4TR0 A;  2VCV A;  2H1D A;  2OBK A;  1MDI A;  3ZMK A;  2GGT A;  3M9J A;  5LCZ A;  2OE0 A;  4TR4 A;  5A34 B;  2LRN A;  5B7C A;  4BVY B;  3MSZ A;  4N3Z A;  4QQ7 A;  2B1L A;  1TRW A;  1S3D A;  3FY7 A;  3IK9 A;  2RM5 A;  2GST A;  2VL9 A;  1XG8 A;  3EYT A;  1PN0 A;  1YEW C;  1YVL A;  1KTE A;  5G1L A;  1EV4 A;  5KOX A;  2ZCT A;  2I81 A;  2H6X A;  1K0M A;  3GH9 A;  4RI7 A;  3HJM A;  1FVJ A;  4YQV A;  3FZ5 A;  4P3Y B;  6GST A;  1JZW A;  3DXB A;  5IIZ A;  3RHB A;  2VM1 A;  2GT5 A;  1R26 A;  1GSU A;  2ZUP A;  4KDU A;  1M9B A;  4I2U A;  2R6K A;  4XS4 B;  5DAK A;  6GSU A;  3FR6 A;  2AUV A;  2N5F A;  4XCS A;  3F4T A;  2F3M A;  3IXR A;  4KB3 A;  1Y25 A;  3VPT A;  3QR6 A;  3TJJ A;  4LMV A;  3TJK A;  4TXO B;  3TJG A;  2XC2 A;  2LNT A;  3ZYW A;  2IJY A;  4J56 E;  2JZR A;  4G9H A;  2YNX A;  5J4U A;  2C8U A;  3FZ4 A;  5D9W A;  2CZ3 A;  3KMN A;  4IJ3 A;  3HHV A;  2H70 A;  3CSI A;  1GLQ A;  3A2V A;  2PN8 A;  1E2Y A;  3I69 A;  3GKK A;  2YZU A;  5CRE A;  2VOC A;  1X9S B;  3H1N A;  3QD9 A;  1A8Y A;  1WIK A;  1WP0 A;  1XWG A;  1V98 A;  2HZE A;  4I2T A;  2DKH A;  3D5J A;  5BRT A;  2K9F A;  2HXK A;  4GQF A;  2TRC P;  2JSZ A;  2JSY A;  2EIR A;  1FOH A;  3APS A;  2E7P A;  2R0G A;  3IR4 A;  4HDE A;  4Q5Q A;  3CSH A;  4ULX A;  2YPM A;  3MIX A;  3TJB A;  4JED A;  3DRN A;  2O36 A;  4Q5R A;  4O7H A;  2X8C A;  4HI7 A;  3IAS 2;  3LQ7 A;  3C71 A;  5G5E A;  1CQH A;  1XCC A;  2LTK A;  1U3A A;  2I3Y A;  1XWB A;  2FA4 A;  4FQU A;  2V32 A;  2GSQ A;  1YDK A;  3QFB C;  1DE2 A;  5D8I A;  4Z7X A;  4AF2 A;  1FB0 A;  3NOF A;  1SYX A;  1YZX A;  4RQR A;  2GLR A;  2H1A A;  3KEB A;  2FWG A;  4ECI A;  1GSQ A;  3Q74 A;  1U6T A;  2OKA A;  3UBK A;  4OFN A;  3A5W A;  2DIZ A;  4OO5 A;  4FH8 A;  1GSE A;  3ME8 A;  5GZZ B;  3BCK A;  3UOM A;  4MP4 A;  4F2I A;  4MF5 A;  5AGY A;  1K3L A;  1ERW A;  3M1G A;  1GSD A;  3U5R E;  1O73 A;  2YV7 A;  3RHC A;  1TJD A;  1WWJ A;  2A4H A;  4ECB A;  4IGJ A;  4G0I A;  3F8U A;  4OMV A;  2F9S A;  1G6Y A;  2HZF A;  2NVL A;  3HVV A;  4E8H A;  1SD8 A;  1PL2 A;  1K0D A;  16GS A;  5FWG A;  4MLY A;  1OYJ A;  4MK3 A;  1TP9 A;  5IM9 A;  5DDL A;  2IFQ B;  1GSF A;  4CW9 A;  2MBS A;  1KNG A;  4YAV A;  4NAX A;  2P5Q A;  1QFN A;  1VF1 A;  5E4W A;  4AKH A;  2DJ0 A;  3P90 A;  1AW9 A;  4HJM A;  1X5D A;  1N8J A;  2MMO A;  4X0X A;  4F9Z A;  1U3I A;  4AJ6 A;  2AB6 A;  2VO4 A;  2GDR A;  2REM A;  1BG5 A;  2GZY A;  1SVM A;  5INY A;  1F9M A;  1MTC A;  3K8N A;  3MDK A;  2D2Z A;  4HEA 2;  3CXG A;  2YWM A;  4POB A;  4GWR A;  1GRX A;  1BQ7 A;  5CNW A;  2O5V A;  2I9H A;  2QKE A;  2B5Y A;  2JU5 A;  4I6X A;  1FO5 A;  3IOS A;  5C04 A;  1DE1 A;  1GNW A;  1UA5 A;  2VCW A;  2GS3 A;  2AJQ B;  3HA9 A;  2A4V A;  3GRX A;  2PWJ A;  3LOR A;  5DCH A;  3PGT A;  3EMX A;  3ZRD A;  19GS A;  4PGT A;  1SJI A;  2OAC A;  2YCD A;  3M3M A;  4O5U A;  4AI6 A;  1BX9 A;  2HSN B;  2AYT A;  2ON5 A;  3HD5 A;  3VFI A;  1T8E B;  1A2J A;  3ZFB A;  4DSQ A;  1XWK A;  3KCM A;  3GL5 A;  3LFL A;  1O85 A;  2KLX A;  4NV2 A;  2VM2 A;  2L6D A;  2JL4 A;  2VUP A;  1T4Z A;  2X49 A;  1NM3 A;  1X9W B;  5ECN B;  1I9D A;  3CMI A;  1EZK A;  4K9Z A;  2VLV A;  4MJE A;  5F07 A;  3A3T A;  4MMM A;  4L0U A;  2V1M A;  4MZC A;  2R37 A;  4IQ1 A;  1K0B A;  3UIW A;  5ABR A;  3FKF A;  4N0V A;  3CTG A;  3L0H A;  3H8Q A;  1T7P B;  2XPD A;  3P2A A;  3ZIT A;  5BMU B;  4OFT A;  2V6K A;  4K8M A;  2FUG 2;  4ICY A;  3QCP A;  4G19 A;  3EU3 A;  3FRC A;  2XHF A;  3IHG A;  2UZ8 A;  2B1K A;  3US3 A;  3APO A;  1TRV A;  4RUV A;  1X5E A;  2IMF A;  1S3A A;  1YKC A;  3GHA A;  2C3T A;  2P0G A;  3U6V A;  3ERW A;  3TGZ A;  1ERT A;  2WW1 A;  4KND A;  4QMK A;  1T1V A;  4MNN A;  2JZT A;  3KMO A;  2F51 A;  3KJY A;  2KP2 A;  2X8G A;  3DVW A;  4GDF A;  1R5P A;  4JR4 A;  5ECK B;  3RPN A;  3L9U A;  1KEB A;  3QPM A;  4ZL9 A;  4O92 A;  3N5O A;  3IC4 A;  5DQS A;  1TTZ A;  2FLS A;  4GQC A;  3UVT A;  5ELA A;  1E6B A;  4POM A;  3HDC A;  2RUE A;  5EPF A;  1M2A A;  4V2L A;  1MDJ A;  3ZIJ A;  2WVX B;  2WW0 A;  4K7O A;  4LLR A;  1B4Q A;  2R4V A;  5G1K A;  4BWS A;  1GSY A;  1O81 A;  4F03 A;  5D9V A;  3FYG A;  4MPF A;  3IK7 A;  3TKS E;  1GL8 A;  3HVS A;  3LYK A;  4MPG A;  4OWY A;  3RGB C;  1V57 A;  1S4B P;  9GSS A;  4PUA A;  4KSO A;  2H01 A;  4GSN A;  7GSS A;  4FIW A;  2F8A A;  2PBJ A;  4KGI A;  1GUK A;  2XBI A;  2G0F A;  3F9U A;  3GX0 A;  17GS A;  3TKS C;  3EU4 A;  3F6D A;  2HT9 A;  3ME7 A;  1XIY A;  3VI5 A;  1XOB A;  5ECQ B;  4PI0 C;  2NPB A;  4D73 A;  1AC1 A;  3HVX A;  3CSJ A;  2GZZ A;  5J4Y A;  1EOG A;  3UEM A;  3VWX A;  1RW1 A;  2H19 A;  3S9F A;  4ML6 A;  3ERF A;  2BTO T;  2L5L A;  3TKQ A;  5CRG A;  1PQN A;  1TRS A;  3ED3 A;  1UVZ A;  2DKI A;  2K18 A;  4RI6 A;  2MMA A;  3KIJ A;  3F3Q A;  3TKP A;  2C0E A;  1MD3 A;  2TRX A;  1AQV A;  1YF1 A;  4V2M A;  1AAZ A;  3UMA A;  3CBU A;  3GX8 A;  5GAP D;  5ECI B;  1LJR A;  2YN1 A;  1YF0 A;  4Q5N A;  3GKM A;  2O87 A;  4JRR A;  1A24 A;  1TW9 A;  5ECP B;  4G01 A;  1I5G A;  3UBL A;  3L4N A;  3R3E A;  4PUR A;  2KHP A;  2QA2 A;  2IPA A;  2LEG A;  2L59 A;  4NXI A;  5CRH A;  2FGX A;  4J57 E;  4PHZ C;  1PL1 A;  3LEF A;  5A5H B;  1GTB A;  4KCE A;  1BF5 A;  5ECO B;  5AIS A;  4ZB7 A;  1TU8 A;  4GLT A;  3PIN A;  5A4V A;  2YWI A;  1USB A;  2VCX A;  2GSS A;  3CYN A;  1TI3 A; 
#chains in the Genus database with same CATH homology
 2BJX A;  5D96 A;  2CA8 A;  3RAZ A;  1AXD A;  4NHW A;  1Z3E A;  4KCA A;  3UAP A;  4KA0 A;  1M2D A;  1Y6E A;  4CY6 A;  1ACV A;  5J4V A;  1FW1 A;  5JWO B;  2LST A;  2WS2 A;  2H73 A;  1G7O A;  1O6J A;  2C3N A;  1AQW A;  3ZIV A;  1XPV A;  4TR1 B;  3WGE A;  2EC4 A;  4FYU A;  4PQI A;  1EP8 A;  1XW6 A;  2HSM B;  3W8J A;  2PVQ A;  3RBT A;  3NZN A;  2FHE A;  1XZO A;  4L5L A;  1HYU A;  5COH A;  4POL A;  3IAM 2;  1LBK A;  5DAL B;  1PMT A;  3LG6 A;  3FHK A;  4QL7 A;  4PQ1 A;  1XW5 A;  4ZIL A;  3GST A;  3WGX A;  4IS0 A;  3DEX A;  4X4J A;  4OFM A;  2I4A A;  2RLI A;  3D4M A;  2CVD A;  3MAK A;  1ERU A;  1TK8 B;  2OAD A;  1SL1 B;  1SVL A;  1XVQ A;  1BED A;  3FR9 A;  4NHZ A;  1GH2 A;  2H74 A;  4HU9 A;  4YAP A;  5A1N A;  4AGS A;  2YZH A;  3KH7 A;  1NSW A;  1PGT A;  2HLS A;  3DKS A;  5HFG A;  2QA1 A;  4HOJ A;  2L5O A;  3HXS A;  6GSV A;  2H0G A;  4K1F A;  4MJB A;  2H0H A;  5IMV A;  4MF7 A;  2WUL A;  2H6Y A;  4WXT A;  3UL3 A;  3KD0 A;  4AJ8 A;  1OC9 A;  4RQX A;  5AN1 A;  4JZQ A;  2YP6 A;  1SK0 A;  1AIU A;  1Z6M A;  5HR2 A;  5B6M A;  2LV3 A;  1T3B A;  3DYR A;  3FW2 A;  2QSI A;  3HYP A;  4AKG A;  4ZB9 A;  3DGQ A;  2VL2 A;  3E3E A;  5EY6 A;  8GSS A;  4TR3 A;  4MJA A;  4IKH A;  1OKD A;  4XS1 A;  2PGT A;  3LXT A;  3IDV A;  4ML1 A;  5GAN D;  1ZZY A;  1GTU A;  2PUK C;  1TU7 A;  4CHS A;  5CAX A;  2H1B A;  3EC3 A;  2MBT A;  3ZML A;  2ES7 A;  2RII A;  1JZR A;  5ECH B;  4DSS B;  1OE7 A;  3W8S A;  2N5A A;  6GSY A;  3P7X A;  1X9M B;  2DJ2 A;  2FA8 A;  3QAW A;  2NDO A;  1QMV A;  5A34 A;  2MZC A;  4BVY A;  1F3B A;  4KSM A;  2KUC A;  3C8E A;  3TDG A;  1Q4J A;  1GUM A;  5DBQ A;  1T4Y A;  4ZL8 A;  1ZYP A;  2L6C A;  1C72 A;  5GSS A;  3BCI A;  4WF4 A;  3UAR A;  2CV4 A;  1XW9 A;  4K6X A;  2R0C A;  2M80 A;  5HQP A;  3VUR A;  4IJI A;  3H4K A;  3RPP A;  4O5Q A;  5FT3 A;  4DVC A;  2NTO A;  3WT1 A;  5CP1 A;  3HMJ G;  1THX A;  3HZ8 A;  2VD0 A;  3UVH A;  5D9T A;  2OE3 A;  3D4T A;  3GMF A;  5DJL A;  3TB2 A;  2E0Q A;  2E2G A;  3LWA A;  4XS4 A;  4TKY A;  1GUL A;  1ST9 A;  3GV1 A;  2X99 A;  3D0Z A;  1PA3 A;  4OD7 A;  3O3T A;  2V6O A;  2CAI A;  4TXO A;  6GSS A;  2DIY A;  3LJR A;  4OO4 A;  2H0I A;  3KP8 A;  1OKT A;  1FB6 A;  2B5E A;  2K8V A;  1GUH A;  2J9H A;  5J47 A;  3BBY A;  3GA4 A;  2AAW A;  3GTU B;  3HKR A;  2IIY A;  3L78 A;  3DD3 A;  3KTL A;  1DSB A;  2GSR A;  3QMX A;  4F0C A;  2VLT A;  5C00 A;  3MYD A;  2DML A;  1TOF A;  3C1S A;  3M9K A;  3F63 A;  2DSA A;  1YEP A;  2EFE A;  4IQA A;  4BVX B;  2C0D A;  1ABA A;  3UJ1 A;  1YEX A;  4ECJ A;  2AHE A;  3FZA A;  5A4W A;  4K5R A;  1GSS A;  1O8W A;  3QAG A;  2DC5 A;  4JR6 A;  1EGR A;  3ZVJ D;  2DJJ A;  3GL3 A;  4HJ2 A;  1MDK A;  2E2M A;  2KOK A;  3TOT A;  3F4S A;  1GP1 A;  1RK4 A;  4IW9 A;  1QK8 A;  2RUF A;  2FNO A;  4TOP A;  1SJ6 A;  4HU7 A;  3GN3 A;  4PX1 A;  3GH6 A;  2FCH A;  5CRW A;  2R2J A;  3PPU A;  4HQS A;  3E9J B;  20GS A;  3IA1 A;  6GSX A;  1NHY A;  1YY7 A;  1OVN A;  4EIQ A;  1ZL9 A;  3I43 A;  4WR4 A;  2L4Q A;  1HD2 A;  2H66 A;  4FYC A;  3ZFL A;  4FYB A;  3HJP A;  2JZS A;  1DUG A;  2OJL A;  4Q5F A;  3SWL A;  2VCQ A;  4QL9 A;  2K8S A;  1N2A A;  3O6T A;  1F6M C;  4GXZ A;  1SKR B;  5KN3 A;  5KOW A;  1TK0 B;  2L4C A;  1PSQ A;  1YJ6 A;  1J9B A;  4D73 B;  2DJ3 A;  1HQO A;  2WB9 A;  2H75 A;  5J9B A;  4WET A;  4NPB A;  1SYR A;  1GTI A;  1TXX A;  2CVB A;  5J41 A;  5A5K A;  3TKR A;  2OE1 A;  2IFQ A;  4AKI A;  2YJH A;  5D73 A;  2LQO A;  3W6G A;  1R5A A;  5E59 A;  1URM A;  4NWY A;  3M0F A;  4OCF A;  1EWX A;  4POK A;  3GSS A;  2RM6 A;  4EO3 A;  3QFA C;  2F8F A;  5G30 A;  4XTS A;  2CZ2 A;  3IV4 A;  3TJF A;  1FVK A;  4YQM A;  3IPZ A;  2B7J A;  5JCU A;  2FWH A;  4L0W A;  3BD2 A;  1FG4 A;  2C4J A;  2HRK B;  1QXH A;  1B9Y C;  1XWA A;  1TK5 B;  12GS A;  4MAB A;  2O85 A;  2GVP A;  4MA9 A;  3KGK A;  4V1A g;  2LJA A;  2V2G A;  2TIR A;  1U87 A;  1G0T A;  2IWT A;  4TN8 A;  5B8A A;  1WJK A;  2LNS A;  1AQX A;  2EIQ A;  1K0O A;  5ENU A;  3A2W A;  1Z5Y E;  3TCO A;  4IBP A;  3G7J A;  1WRY A;  1WE0 A;  2VIM A;  2FY6 A;  5HFK A;  2M46 A;  2GTU A;  1THO A;  1M9A A;  4TXV A;  4I97 A;  4NMU A;  4JE1 A;  2B3S A;  4N0Z A;  2PMT A;  4Z2U A;  3L9V A;  3IBH A;  1V2A A;  4GST A;  1SU9 A;  4KDY A;  3R2Q A;  5HFI A;  2HSN A;  2C80 A;  5ID2 A;  2WDU A;  2ON7 A;  5F06 A;  3EMP A;  4IP6 A;  4ZBD A;  4K0G A;  2HYX A;  4G10 A;  5LNK e;  2H1L A;  3LGC A;  3J7Y k;  2WJU A;  3DWV A;  1AUC A;  3NIV A;  4EVM A;  1LU4 A;  2A2R A;  5KN0 A;  1U88 A;  1K0C A;  5EVO A;  3GIX A;  3PH9 A;  2IMD A;  3LSZ A;  3P8W A;  4KF9 A;  4WEY A;  1TDI A;  1R7H A;  5EL8 A;  4JBB A;  4NV5 A;  4J2F A;  1EEM A;  2XBQ A;  4BPY A;  3C73 A;  3I6A A;  1O8X A;  2YJ7 A;  5BMU A;  5CO3 A;  4BA7 A;  3I9V 2;  3D6I A;  3VLN A;  5DAK B;  2GZP A;  3IE3 A;  2HQT A;  2HI7 A;  4ZL7 A;  1M99 A;  3F3R A;  1TXU A;  4K2D A;  1M2B A;  5HR1 A;  2FWF A;  4G2E A;  2CT6 A;  3PR8 A;  4WKW A;  4EKZ A;  2P5R A;  3D21 A;  2H72 A;  4PXO A;  4JU5 A;  1PKZ A;  1WMJ A;  5LD0 A;  1FHE A;  1KBN A;  4PUF C;  5H5Q A;  1O7U A;  1T00 A;  1F37 A;  2HSY A;  2DJK A;  4EDY A;  2HZE B;  3ERG A;  1K3Y A;  4EL1 A;  1BG1 A;  4O5R A;  2C3Q A;  3OR5 A;  4GTU A;  4KE3 A;  3VWV A;  2CVK A;  3E0U A;  2HRN A;  1SL2 B;  1ZOF A;  4I8B A;  3CRT A;  3V1W A;  1ERV A;  3FK8 A;  1XXU A;  1YKA A;  18GS A;  5J3R A;  4N30 A;  3G7Y A;  1M7T A;  1EEJ A;  2HRA A;  2WCI A;  1F3A A;  3DVX A;  4CDO A;  1G6W A;  1HNB A;  3QOU A;  1Z6N A;  2H6Z A;  4H86 A;  1J0F A;  5D93 A;  1SK1 A;  3H93 A;  1IYH A;  4ISD A;  5B8B A;  1A2L A;  1X0R A;  2H30 A;  1EGO A;  1VRS D;  3G9B A;  4EDZ A;  5IOX A;  1BAY A;  3KZQ A;  4MF6 A;  2H76 A;  2HSH A;  2OBI A;  3ZVJ A;  4AKX B;  2WFC A;  2VD1 A;  1ZGN A;  4YQU A;  4FO5 A;  2CQ9 A;  1B8X A;  3TUE A;  2YWO A;  5KN2 A;  4XIH A;  2LJK A;  2O89 A;  4BL7 A;  2YWN A;  3CRU A;  2A2S A;  4ECC A;  1A0R P;  2CAQ A;  2WZ9 A;  2XPE A;  2M72 A;  4MJC A;  4KDX A;  1VF4 A;  4MZB A;  2VL3 A;  3QAV A;  2Z9S A;  5A5H A;  13GS A;  1XBS A;  2H71 A;  2NBS A;  5IO0 A;  1SD9 A;  1F2E A;  3BJ5 A;  2MYG A;  5AIX A;  4ILF A;  1TKD B;  1M0U A;  2MMZ A;  2VLU A;  2VCT A;  3F4R A;  2LKU A;  4MH3 A;  3DIE A;  4XHM A;  5FHI A;  5JCG A;  1ON4 A;  2G2Q A;  4HS1 A;  2R0P A;  4TR1 A;  5ELG A;  2HSM A;  1FAA A;  3FEU A;  1H75 A;  2FWE A;  10GS A;  1JLV A;  2KP1 A;  2QGV A;  2GQK A;  5JCW A;  1IYI A;  5DAL A;  2OA7 A;  3GKN A;  4L5O A;  1XWC A;  2HFD A;  2K6V A;  1VF2 A;  4KW6 A;  4G0L A;  5ECS A;  3TOU A;  2V41 A;  1TI1 A;  5DCG A;  5HR3 A;  2GT6 A;  3IHQ A;  5IPH A;  1ZYE A;  2C0G A;  4IN0 A;  5ECL B;  3HY2 A;  4XRD A;  3VK9 A;  4XRA A;  4O32 A;  5JWQ B;  5CRD A;  3TKS A;  4PNF A;  1X5C A;  4HZ2 A;  2HRF A;  3GUS A;  2GQM A;  4PNG A;  1V58 A;  4TVE A;  2N5B A;  3F6F A;  5HR0 A;  1SEN A;  4DSR A;  3CTF A;  2EIO A;  3Q19 A;  1GWC A;  1SL0 B;  2H1G A;  3H79 A;  5IMD A;  2MMN A;  5GST A;  2C0F A;  1PKW A;  2IMK A;  5IMC A;  3EUR A;  22GS A;  2WRT A;  1SJZ A;  3JCM L;  4IEL A;  3L9S A;  4E68 A;  1OC8 A;  2FD3 A;  1Q98 A;  3GUR A;  1PN9 A;  2DBC A;  5AIV A;  3RDW A;  4EUY A;  1CQG A;  3LW9 A;  4ZBB A;  4YH2 A;  3APQ A;  1TRU A;  1QUW A;  4G0K A;  5DJM A;  3KTB A;  1RQM A;  3VWU A;  3LYP A;  1XFL A;  5ECR B;  3WD6 A;  2VAF A;  5A4U A;  2B6M A;  4W66 A;  2PVO C;  4EC0 A;  4K7I A;  4WF5 A;  1EP7 A;  2DLX A;  3KH9 A;  3KXO A;  11GS A;  1A0F A;  1OE8 A;  4LA1 A;  4ZBA A;  4KUN A;  2HE3 A;  3MWH A;  2EFC A;  5G31 A;  2CX3 A;  2YOI A;  2IL3 A;  4WR5 A;  2LS5 A;  5DQY A;  1B9X C;  3FMW A;  3C7M A;  1QQ2 A;  4DSS A;  1Y1U A;  5J5N A;  3VI7 A;  4ACS A;  3BOA A;  4V2N A;  1DBY A;  3ZRE A;  3A2X A;  1MEK A;  1OC3 A;  1HNC A;  1K0A A;  1PX6 A;  5ID2 B;  4F0B A;  4PTS A;  1A2M A;  1YQ1 A;  4IP1 A;  4EIP A;  4ZXG A;  4WBR D;  14GS A;  3GKX A;  1R4W A;  4ID0 A;  2VCZ A;  3ZL5 A;  1W4V A;  4N10 A;  1MD4 A;  2PER A;  3HZ4 A;  2PPT A;  4X1U A;  4F82 A;  2EFD A;  3TRP A;  2B7K A;  3G7I A;  3WGD A;  2JAD A;  1PRX A;  3ZZX A;  2GQL A;  1UC7 A;  2LRC A;  2R3X A;  1GNE A;  1SKW B;  1HNA A;  1NW2 A;  3IC8 A;  2YAN A;  1EV9 A;  5H5R A;  2I1U A;  4HUA A;  4KX4 A;  4EXJ A;  3WYW A;  1UN2 A;  2O8V B;  3GFK A;  3EIN A;  4K5S A;  1ML6 A;  3KP9 A;  2YV9 A;  2ZNM A;  4K2X A;  1GTA A;  2X64 A;  2LJR A;  4DEJ A;  1K0N A;  5KEJ A;  2OT3 A;  5J40 A;  2O7K A;  3MNG A;  2EFH A;  1NHO A;  3GTU A;  5IOW A;  4EF0 A;  1A8L A;  2IMI A;  1A23 A;  4AJ7 A;  3IRA A;  4MCU A;  5F8B A;  2VL2 C;  1ZYQ B;  2QC7 A;  2DJ1 A;  5J9C A;  4MH2 A;  4LL4 B;  3TU3 B;  5DVB A;  4LMW A;  2ALB A;  2X4A A;  1SK2 A;  4K7N A;  3TRX A;  1PX7 A;  2DMM A;  4BVX A;  1BYE A;  6GSW A;  4CY8 A;  1JHB A;  3KM6 A;  1ILO A;  1J08 A;  1VF3 A;  4YKF A;  4WBJ A;  4Z2R A;  5D9X A;  3VWW A;  1OAZ A;  4HQZ A;  4KH7 A;  5IMA A;  3EE2 A;  4E8E A;  1Z7P A;  3VPQ A;  5H5S A;  4V1A p;  1GLP A;  3A5I A;  2P31 A;  3CWG A;  4LL1 B;  1WOU A;  4XS6 A;  2H8L A;  4TRX A;  3WT2 A;  1FOV A;  1N25 A;  2AV4 A;  4GCI A;  1B4P A;  4ZB8 A;  1V40 A;  2VKZ G;  2A2P A;  3C1R A;  3O76 A;  1JZD A;  2LRT A;  1BJX A;  4BWQ A;  4K0N A;  5CYY A;  2IN3 A;  3QDN A;  5ECM B;  5B6N A;  5JWR B;  3F0I A;  3TRQ A;  2R5G A;  5F05 A;  1Z7R A;  4YKG A;  5L71 A;  3Q6O A;  1V9W A;  4OCE A;  3Q18 A;  1ZMA A;  3ISO A;  3GNJ A;  3ZLP A;  3N9J A;  4USS A;  2X8H A;  1JFU A;  4IVF A;  5G5F A;  1JLW A;  2JAC A;  5IO2 A;  2PU9 C;  1Z9H A;  3AY8 A;  3DML A;  1VGL A;  2LQQ A;  5IPG A;  3D22 A;  3ZTL A;  1W89 A;  3SBC A;  5A1N B;  4TW5 A;  2BMX A;  1SKS B;  2C1Y A;  1JZO A;  2WGR A;  2IME A;  2UV8 G;  4PQH A;  5G2Z A;  1XVW A;  2B5X A;  2CX4 A;  4GRF A;  1S3C A;  1G7E A;  3HCZ A;  4BL7 B;  3EVI A;  1OC9 B;  2HRK A;  4N11 A;  5F0G A;  4X43 A;  4A5P A;  4EE0 A;  5IMF A;  1SVO A;  3J7Y b;  1B48 A;  4HZ4 A;  5IQY A;  1ZYN A;  4GF0 A;  1QGV A;  4KAE A;  3LXZ A;  4IHU A;  4L8E A;  1H4O A;  1XOA A;  1EOH A;  4Z2T A;  4GSS A;  3FR3 A;  2J23 A;  4MZW A;  5IMZ A;  1ZCP A;  3EPT A;  3EWL A;  3FZ9 A;  1K3O A;  3HJO A;  1WPI A;  5KN1 A;  2L57 A;  4I5Q A;  4MDC A;  4ZIJ A;  4ZB6 A;  2HNL A;  3GYK A;  3M8N A;  2LUS A;  1PD2 1;  4TR0 A;  2VCV A;  2H1D A;  2OBK A;  1MDI A;  3ZMK A;  2GGT A;  3M9J A;  5LCZ A;  2OE0 A;  4TR4 A;  5A34 B;  2LRN A;  5B7C A;  3MSZ A;  4BVY B;  4N3Z A;  4QQ7 A;  2B1L A;  1TRW A;  1S3D A;  3FY7 A;  3IK9 A;  2RM5 A;  2GST A;  2VL9 A;  3EYT A;  1PN0 A;  1YVL A;  1KTE A;  5G1L A;  1EV4 A;  5KOX A;  2ZCT A;  2I81 A;  2H6X A;  1K0M A;  3GH9 A;  4RI7 A;  3HJM A;  1FVJ A;  4YQV A;  3FZ5 A;  4P3Y B;  6GST A;  1JZW A;  3DXB A;  5IIZ A;  3RHB A;  2VM1 A;  2GT5 A;  1R26 A;  1GSU A;  2ZUP A;  4KDU A;  1M9B A;  4I2U A;  2R6K A;  4XS4 B;  5DAK A;  6GSU A;  3FR6 A;  2AUV A;  2N5F A;  4XCS A;  3F4T A;  2F3M A;  3IXR A;  4KB3 A;  1Y25 A;  3VPT A;  3QR6 A;  3TJJ A;  4LMV A;  3TJK A;  4TXO B;  3TJG A;  2XC2 A;  2LNT A;  3ZYW A;  2IJY A;  4J56 E;  2JZR A;  4G9H A;  2YNX A;  5J4U A;  2C8U A;  3FZ4 A;  5D9W A;  2CZ3 A;  3KMN A;  4IJ3 A;  3HHV A;  2H70 A;  3CSI A;  1GLQ A;  3A2V A;  2PN8 A;  1E2Y A;  3I69 A;  3GKK A;  2YZU A;  5CRE A;  2VOC A;  1X9S B;  3H1N A;  3QD9 A;  1A8Y A;  1WIK A;  1WP0 A;  1XWG A;  1V98 A;  2HZE A;  4I2T A;  2DKH A;  3D5J A;  5BRT A;  2K9F A;  2HXK A;  4GQF A;  2TRC P;  2JSZ A;  2JSY A;  2EIR A;  1FOH A;  3APS A;  2E7P A;  2R0G A;  3IR4 A;  4HDE A;  4Q5Q A;  3CSH A;  4ULX A;  2YPM A;  3MIX A;  3TJB A;  4JED A;  3DRN A;  4Q5R A;  4O7H A;  2X8C A;  4HI7 A;  3IAS 2;  3LQ7 A;  3C71 A;  5G5E A;  1CQH A;  1XCC A;  2LTK A;  1U3A A;  2I3Y A;  1XWB A;  2FA4 A;  4FQU A;  2V32 A;  2GSQ A;  1YDK A;  3QFB C;  1DE2 A;  5D8I A;  4Z7X A;  4AF2 A;  1FB0 A;  3NOF A;  1SYX A;  1YZX A;  4RQR A;  2GLR A;  2H1A A;  3KEB A;  2FWG A;  4ECI A;  1GSQ A;  3Q74 A;  1U6T A;  2OKA A;  3UBK A;  4OFN A;  3A5W A;  2DIZ A;  4OO5 A;  4FH8 A;  1GSE A;  3ME8 A;  5GZZ B;  3BCK A;  3UOM A;  4MP4 A;  4F2I A;  4MF5 A;  5AGY A;  1K3L A;  1ERW A;  3M1G A;  1GSD A;  3U5R E;  1O73 A;  2YV7 A;  3RHC A;  1TJD A;  1WWJ A;  2A4H A;  4ECB A;  4IGJ A;  4G0I A;  3F8U A;  4OMV A;  2F9S A;  1G6Y A;  2HZF A;  2NVL A;  3HVV A;  4E8H A;  1SD8 A;  1PL2 A;  1K0D A;  16GS A;  5FWG A;  4MLY A;  1OYJ A;  4MK3 A;  1TP9 A;  5IM9 A;  5DDL A;  2IFQ B;  1GSF A;  4CW9 A;  2MBS A;  1KNG A;  4YAV A;  4NAX A;  2P5Q A;  1QFN A;  1VF1 A;  5E4W A;  4AKH A;  2DJ0 A;  3P90 A;  1AW9 A;  4HJM A;  1X5D A;  1N8J A;  2MMO A;  4X0X A;  4F9Z A;  1U3I A;  4AJ6 A;  2AB6 A;  2VO4 A;  2GDR A;  2REM A;  1BG5 A;  2GZY A;  1SVM A;  5INY A;  1F9M A;  1MTC A;  3K8N A;  3MDK A;  2D2Z A;  4HEA 2;  3CXG A;  2YWM A;  4POB A;  4GWR A;  1GRX A;  1BQ7 A;  5CNW A;  2O5V A;  2I9H A;  2QKE A;  2B5Y A;  2JU5 A;  4I6X A;  1FO5 A;  3IOS A;  5C04 A;  1DE1 A;  1GNW A;  1UA5 A;  2VCW A;  2GS3 A;  2AJQ B;  3HA9 A;  2A4V A;  3GRX A;  2PWJ A;  3LOR A;  5DCH A;  3PGT A;  3EMX A;  3ZRD A;  19GS A;  4PGT A;  1SJI A;  2OAC A;  2YCD A;  3M3M A;  4O5U A;  4AI6 A;  1BX9 A;  2HSN B;  2AYT A;  2ON5 A;  3HD5 A;  3VFI A;  1T8E B;  1A2J A;  3ZFB A;  4DSQ A;  1XWK A;  3KCM A;  3GL5 A;  3LFL A;  1O85 A;  2KLX A;  4NV2 A;  2VM2 A;  2L6D A;  2JL4 A;  2VUP A;  1T4Z A;  2X49 A;  1NM3 A;  1X9W B;  5ECN B;  1I9D A;  3CMI A;  1EZK A;  4K9Z A;  2VLV A;  4MJE A;  5F07 A;  3A3T A;  4MMM A;  4L0U A;  2V1M A;  4MZC A;  2R37 A;  4IQ1 A;  1K0B A;  3UIW A;  5ABR A;  3FKF A;  4N0V A;  3CTG A;  3L0H A;  3H8Q A;  1T7P B;  2XPD A;  3P2A A;  3ZIT A;  5BMU B;  4OFT A;  2V6K A;  4K8M A;  2FUG 2;  4ICY A;  3QCP A;  4G19 A;  3EU3 A;  3FRC A;  2XHF A;  3IHG A;  2UZ8 A;  2B1K A;  3US3 A;  3APO A;  1TRV A;  4RUV A;  1X5E A;  2IMF A;  1S3A A;  1YKC A;  3GHA A;  2C3T A;  2P0G A;  3U6V A;  3ERW A;  3TGZ A;  1ERT A;  4KND A;  4QMK A;  1T1V A;  4MNN A;  2JZT A;  3KMO A;  2F51 A;  3KJY A;  2KP2 A;  2X8G A;  3DVW A;  4GDF A;  1R5P A;  4JR4 A;  5ECK B;  3RPN A;  3L9U A;  1KEB A;  3QPM A;  4ZL9 A;  4O92 A;  3N5O A;  3IC4 A;  5DQS A;  1TTZ A;  2FLS A;  4GQC A;  3UVT A;  5ELA A;  1E6B A;  4POM A;  3HDC A;  2RUE A;  5EPF A;  1M2A A;  4V2L A;  1MDJ A;  3ZIJ A;  4K7O A;  4LLR A;  1B4Q A;  2R4V A;  5G1K A;  4BWS A;  1GSY A;  1O81 A;  4F03 A;  5D9V A;  3FYG A;  4MPF A;  3IK7 A;  3TKS E;  1GL8 A;  3HVS A;  3LYK A;  4MPG A;  4OWY A;  1V57 A;  9GSS A;  4PUA A;  4KSO A;  2H01 A;  4GSN A;  7GSS A;  4FIW A;  2F8A A;  2PBJ A;  4KGI A;  1GUK A;  2XBI A;  2G0F A;  3F9U A;  3GX0 A;  17GS A;  3TKS C;  3EU4 A;  3F6D A;  2HT9 A;  3ME7 A;  1XIY A;  3VI5 A;  1XOB A;  5ECQ B;  2NPB A;  4D73 A;  1AC1 A;  3HVX A;  3CSJ A;  2GZZ A;  5J4Y A;  1EOG A;  3UEM A;  3VWX A;  1RW1 A;  2H19 A;  3S9F A;  4ML6 A;  3ERF A;  2BTO T;  2L5L A;  3TKQ A;  5CRG A;  1PQN A;  1TRS A;  3ED3 A;  1UVZ A;  2DKI A;  2K18 A;  4RI6 A;  2MMA A;  3KIJ A;  3F3Q A;  3TKP A;  2C0E A;  1MD3 A;  2TRX A;  1AQV A;  1YF1 A;  4V2M A;  1AAZ A;  3UMA A;  3CBU A;  3GX8 A;  5GAP D;  5ECI B;  1LJR A;  2YN1 A;  1YF0 A;  4Q5N A;  3GKM A;  2O87 A;  4JRR A;  1A24 A;  1TW9 A;  5ECP B;  4G01 A;  1I5G A;  3UBL A;  3L4N A;  3R3E A;  4PUR A;  2KHP A;  2QA2 A;  2IPA A;  2LEG A;  2L59 A;  4NXI A;  5CRH A;  2FGX A;  4J57 E;  1PL1 A;  3LEF A;  5A5H B;  1GTB A;  4KCE A;  1BF5 A;  5ECO B;  5AIS A;  4ZB7 A;  1TU8 A;  4GLT A;  3PIN A;  5A4V A;  2YWI A;  1USB A;  2VCX A;  2GSS A;  3CYN A;  1TI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...