1OKTA

X-ray structure of glutathione s-transferase from the malarial parasite plasmodium falciparum
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
211
structure length
211
Chain Sequence
MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title X-Ray Structure of Glutathione S-Transferase from the Malarial Parasite Plasmodium Falciparum
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 73
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1oktA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oktA01
2J9HA 5CYYA 1F6MC 2VL3A 2RM5A 2M80A 3EVIA 3ZIVA 2WDUA 5ECQB 3LGCA 1LJRA 3HCZA 1ACVA 3DEXA 3KH9A 1TTZA 2V6KA 1SJZA 2IL3A 1QUWA 3VWXA 3SBCA 5F06A 2YJ7A 5CREA 2H66A 1TK5B 2JU5A 1U87A 5D9XA 3RPNA 5E4WA 2C0EA 1SKWB 4ACSA 1TU8A 2AYTA 3ED3A 3PINA 1E2YA 3S9FA 1XW5A 5E59A 4G2EA 4ML6A 4JEDA 1XWBA 3GKKA 4TR4A 3KM6A 3VFIA 2VCXA 4WR5A 4RUVA 3FZ5A 2X8GA 1TDIA 1NW2A 5IMAA 4EXJA 4PX1A 5AGYA 2CT6A 1JZRA 2R6KA 4HEA2 4WF5A 3MWHA 4ZBDA 4EE0A 3F9UA 1G7EA 5DAKB 1TKDB 5HR0A 2H01A 2PMTA 1XWCA 1K0OA 4FH8A 5J4UA 2C8UA 3NIVA 4MABA 2WFCA 5IIZA 2LJKA 4F9ZA 3TKPA 2N5BA 3HZ4A 3I43A 3IDVA 2VLTA 5D8IA 11GSA 1FO5A 4HU7A 3WD6A 1TXXA 3EC3A 3BD2A 1JLWA 3NOFA 2GZYA 2RIIA 4BL7B 5C00A 2IJYA 3IRAA 1BYEA 5IMZA 3P90A 4IQAA 4MZCA 4MJBA 2G0FA 3TRXA 3D5JA 4TR0A 3EE2A 2RLIA 4YAVA 5HFIA 4Q5FA 5IQYA 1O8WA 3GL5A 6GSYA 3M8NA 5DDLA 3BJ5A 2HT9A 2ON7A 2L5OA 4ECIA 2H70A 2V6OA 2VUPA 1G0TA 4KW6A 4ZB6A 3IK7A 1B48A 1TJDA 4DSQA 1TK8B 3ZTLA 1N8JA 2VLVA 4GSNA 4XTSA 2OE3A 5KN3A 2GTUA 1NHOA 2AB6A 4L0UA 3FEUA 1K0CA 4KX4A 6GSVA 5H5SA 2HSHA 4G0KA 4NV5A 4G0LA 4G0IA 1OKDA 5CRHA 1ZZYA 5CNWA 4RI7A 1XZOA 2CVDA 1SYRA 1WWJA 3EURA 2L4CA 3GTUA 2IMEA 2YZUA 3KTBA 4WXTA 4EUYA 2VIMA 3ZIJA 2VD0A 4POKA 5HR2A 2H19A 4XS4A 1A2JA 1X5DA 3HJPA 3FZAA 1GNEA 3TGZA 1KEBA 3IBHA 1VF1A 2GSQA 3M3MA 2NPBA 4I8BA 2CA8A 3LYKA 3ZMLA 1GP1A 3CRTA 4Q5NA 3TDGA 2TRXA 2KP1A 4BVYA 2DJJA 2LJRA 1FAAA 3GL3A 2L6DA 4FYBA 3P2AA 3VLNA 3FY7A 2F3MA 3EMPA 4KA0A 1YF1A 1GTIA 1YKAA 1ZOFA 3UMAA 3BOAA 2H71A 2I4AA 2JZSA 2PN8A 3TB2A 3WGXA 3FRCA 4HQSA 2YWOA 5G30A 1KNGA 2HFDA 5ID2A 1XOBA 1ABAA 2FD3A 2TRCP 1GH2A 3WYWA 3G7YA 1GSYA 3LG6A 4IN0A 4ZBAA 4KCEA 3FR6A 1MD4A 4NV2A 4AJ6A 2GZZA 4WBJA 5ECRB 1AXDA 4KDYA 3HVXA 2C0GA 2H1GA 2L59A 1PX6A 1PKZA 3DRNA 1EEMA 1PKWA 5DQSA 3F4TA 2MYGA 1X9MB 2HRKB 4ECCA 2H6YA 2IWTA 2UZ8A 1XFLA 1ERVA 2HE3A 4TXOA 1X9WB 1GULA 8GSSA 1SL1B 3UBLA 2KP2A 2VCVA 3IK9A 4MZWA 1PL1A 2C3NA 2VL9A 5HR3A 3FR3A 3GA4A 5CRDA 2GDRA 5DQYA 1GTBA 4EDYA 2YJHA 5IOXA 2HXKA 2AJQB 2B7JA 5L71A 4OD7A 3HVVA 3SWLA 3TKSA 3F3RA 4HQZA 3L9UA 4EC0A 1M99A 3QMXA 3H93A 2O89A 1Z9HA 22GSA 1WOUA 1R7HA 3HXSA 4JRRA 3GYKA 4WEYA 1V2AA 3LXZA 4K6XA 1SK0A 3ZLPA 3BCIA 1GTUA 1MD3A 1OE7A 4O5RA 3C73A 1MTCA 3WGDA 3D4TA 3DMLA 2LV3A 1FB6A 2KUCA 2VLUA 2O87A 1PRXA 4TRXA 4MMMA 4ZL7A 3AY8A 3FK8A 4EO3A 5DALA 3D21A 5IPHA 1A2MA 4BA7A 1HNBA 2AAWA 1XWAA 4ZILA 3KCMA 3TJFA 1FG4A 2F8AA 1C72A 1QQ2A 3A5WA 4FIWA 3L9SA 2LRTA 1O8XA 4HZ2A 1GUHA 4PXOA 4YQMA 2LS5A 2H75A 3CSIA 4DSSB 1UN2A 4QL7A 3ERFA 3QAWA 4V1Ag 4D73A 1XW6A 2C1YA 1TOFA 4YH2A 1SK2A 5JCGA 3IC4A 5AIVA 5D9VA 4MZBA 3APSA 4KCAA 3G7IA 4IP6A 2DIZA 3GFKA 4YAPA 5GZZB 1JHBA 1TP9A 2FWFA 4KB3A 5AISA 4KH7A 2GS3A 2HRNA 3D6IA 5F0GA 5HQPA 16GSA 2H1DA 5G2ZA 3HJMA 1F3AA 2WULA 1RW1A 3UBKA 4PQ1A 5A4VA 1GNWA 4HZ4A 1PX7A 3HKRA 4IGJA 3UVHA 5LNKe 3U5RE 4HUAA 3CTGA 1GLQA 3ISOA 2EIOA 4HS1A 5ECLB 1SL2B 3ZRDA 2AUVA 2R37A 4JR4A 2E7PA 1TRUA 5C04A 1B8XA 3DD3A 5FT3A 2CX4A 3WT1A 3ZFBA 4G19A 1O7UA 4GCIA 2HLSA 4Q5RA 3PPUA 1TRVA 4EKZA 3OR5A 2KHPA 1VGLA 2O7KA 3O6TA 1E6BA 1DE1A 2GSSA 2BTOT 3HYPA 3L78A 4HDEA 1T00A 4ZL9A 2LNTA 3ZYWA 1CQGA 5GSSA 4PQHA 3TUEA 1JZOA 3D4MA 2IMIA 1Z7RA 5D9TA 2CX3A 1ZYEA 3GH9A 2K8SA 2YWMA 4RI6A 3F0IA 5ECSA 4MDCA 2JADA 5ABRA 2NVLA 4ULXA 3F8UA 1N2AA 2GSRA 2IN3A 3WT2A 4PNFA 1F2EA 5IMDA 1XVQA 2DJ1A 3KD0A 3HJOA 3H79A 4JR6A 3CYNA 2AV4A 4OFTA 3IC8A 17GSA 4USSA 2C3QA 1GUKA 4ML1A 3GUSA 2FCHA 1V57A 3GKXA 3UL3A 1CQHA 5JWQB 4LLRA 5DCHA 1K0AA 1YEXA 4DVCA 1GUMA 3RAZA 1R4WA 1T4ZA 4OWYA 2C0FA 2MMOA 4XRAA 4GLTA 2DMLA 2HSMA 1VF3A 2IMDA 3QR6A 4QL9A 4LL1B 4GF0A 4KUNA 3APOA 1PA3A 2NTOA 2WS2A 2OKAA 3KMNA 3LFLA 2H1AA 2KLXA 3TKRA 2CAQA 2VAFA 3M9KA 1QGVA 5A4UA 4WBRD 2FHEA 1EWXA 1MEKA 1URMA 5LD0A 1JZDA 3GX8A 3MSZA 2R4VA 4KF9A 5ECKB 3FHKA 1SD8A 1M2DA 4AJ8A 4WR4A 5ELAA 1GWCA 1M7TA 2CAIA 2DJKA 5A5KA 3LJRA 2QGVA 5IMVA 4ZXGA 2HZEB 1WPIA 3DKSA 2YN1A 5JCUA 2IIYA 1SYXA 3TKQA 3L0HA 1R5PA 4K7NA 2M46A 2ZUPA 1F9MA 1YF0A 4NAXA 1R5AA 1QXHA 2XBQA 2PBJA 1TRSA 4O7HA 2GZPA 3CSJA 2P31A 4CDOA 2GGTA 3G7JA 3IOSA 3F63A 4IJIA 2HQTA 4MF7A 3CRUA 3VWWA 3QDNA 1GSDA 1YY7A 3KP8A 4ISDA 2CZ3A 4N0VA 1HD2A 5DBQA 1MDJA 1OC9B 1M9BA 1A8YA 4I2UA 5GAND 1PSQA 4G10A 4KGIA 2C3TA 3H4KA 4L0WA 4K7IA 2GT5A 5J9CA 2LSTA 3M1GA 3IA1A 3TKSE 2H0GA 1DUGA 5B8AA 4MPFA 2DJ2A 3GV1A 1TRWA 3DVWA 2V32A 3RHBA 4N30A 1FOVA 1A8LA 2FNOA 5G5EA 4ZL8A 2LNSA 3DWVA 4L5OA 1Z6NA 1FW1A 2P0GA 14GSA 5IO0A 4CHSA 2YV9A 2YV7A 4F0CA 3A2WA 1X5EA 2FA8A 2G2QA 2GQKA 2YZHA 3UIWA 4N0ZA 2DSAA 2X64A 4GTUA 2CZ2A 2EC4A 4PTSA 5INYA 1GSEA 3QFAC 3BBYA 3H8QA 4KAEA 3HVSA 1TW9A 1K3LA 5LCZA 2JZTA 3TRPA 2R3XA 1TU7A 3QAGA 5FHIA 4F2IA 1Z7PA 1K0NA 1V40A 2HNLA 1G6WA 3GX0A 2R2JA 1PD21 4G9HA 1OYJA 1TK0B 2D2ZA 3VI7A 3ZVJD 1TI1A 5J9BA 5COHA 2ES7A 2I1UA 3EU4A 5KN0A 1A0RP 3KMOA 5KN2A 1BJXA 3TJKA 3KP9A 2FWHA 1SKSB 4IHUA 4TR1A 2B7KA 4F03A 2VCTA 2LKUA 3RHCA 5EVOA 2F9SA 3Q6OA 5ELGA 2MMZA 5CO3A 4I6XA 5J3RA 3I69A 5EY6A 1AQVA 4KNDA 4J56E 2V2GA 3N5OA 1FVJA 1AAZA 1JLVA 3ZZXA 5FWGA 2JL4A 2IFQA 2PU9C 3HY2A 4GSSA 1PGTA 1T8EB 3GKMA 1HQOA 2PPTA 2H74A 4IP1A 3TOUA 2GQMA 2C4JA 3C1RA 1EP8A 5D73A 4KDUA 4XIHA 5JWRB 1UC7A 3R3EA 5F8BA 1YJ6A 2JSYA 1AIUA 2PVQA 3TJBA 3CMIA 4PQIA 2L6CA 1K0BA 3TJJA 1XCCA 1SJ6A 6GSSA 1PMTA 5H5QA 3TJGA 2L5LA 5ENUA 1JFUA 1S3DA 2YPMA 1A2LA 2E2GA 3GURA 2MBSA 2VL2C 5KEJA 1PN9A 4JZQA 2C0DA 4GRFA 2K6VA 3QFBC 4P3YB 3IV4A 4L8EA 1NHYA 2OBKA 4JE1A 3J7Yb 3KZQA 2IPAA 4HI7A 2YWNA 4IBPA 2K18A 2NDOA 4WETA 3KGKA 1EV9A 2H73A 2HYXA 3LSZA 3C7MA 3LQ7A 3G9BA 3KEBA 2FUG2 4QQ7A 1G6YA 3IHQA 2OADA 3US3A 1H4OA 3KH7A 2YNXA 1GL8A 2FWGA 3ERGA 4KDXA 2B5EA 1K3YA 1WP0A 2PERA 4NXIA 1HNCA 3P7XA 1BG5A 1VF2A 1K3OA 1EOGA 1USBA 1WRYA 3PH9A 4J2FA 2X8CA 5DVBA 1YEPA 1W4VA 2HRAA 2V41A 1YQ1A 2R5GA 3UJ1A 5DJLA 1XPVA 5DAKA 3EU3A 4LMWA 5ECNB 1THOA 4AGSA 2QKEA 3HHVA 3APQA 1BAYA 3GTUB 2P5RA 4NPBA 2H72A 2DC5A 5AIXA 2OACA 18GSA 5HFKA 2VCWA 1AC1A 2B5YA 4XS4B 3KTLA 4MF5A 2QC7A 4OO5A 4MLYA 3PR8A 4EL1A 2MBTA 1X9SB 3FR9A 6GSTA 5F07A 2LQOA 2EIQA 5J5NA 1EGRA 4NHWA 2EIRA 4BL7A 2Z9SA 4BVYB 3J7Yk 5B7CA 4H86A 4OCFA 3VK9A 3ERWA 5D93A 3D0ZA 2OE0A 4KSOA 1A23A 2XBIA 4ID0A 5JWOB 3FW2A 2LUSA 1F3BA 2GT6A 1EZKA 2WRTA 4TOPA 2NBSA 3F3QA 1EV4A 1WE0A 4GWRA 4TXVA 2E0QA 3DYRA 3LEFA 2LJAA 3A2VA 1ZGNA 2J23A 1GSFA 5ID2B 3R2QA 1EP7A 1UA5A 5F05A 1I9DA 4MF6A 2HRFA 2RUEA 1SJIA 2ZCTA 1F37A 1B9YC 4IS0A 4OFNA 5G1KA 1Y6EA 3GNJA 4HJMA 5EPFA 2AHEA 2BJXA 2IMFA 3ME8A 3GRXA 5D9WA 5D96A 4RQXA 3UARA 2X8HA 2GVPA 6GSWA 3QD9A 4ZIJA 3LXTA 3CXGA 3HDCA 3C1SA 3DVXA 13GSA 4MJCA 4MH3A 7GSSA 3KXOA 4TXOB 1OAZA 5IOWA 3UOMA 2VCZA 4HOJA 1ZCPA 4N10A 1T4YA 3W6GA 2HZFA 4MJAA 1OVNA 3GMFA 1YKCA 1ML6A 3CSHA 4LA1A 3Q18A 4MK3A 1XXUA 2XPEA 5AN1A 2QSIA 3D22A 3GH6A 1BQ7A 4OCEA 1V98A 1Q98A 4GXZA 3QPMA 5IM9A 2LEGA 5ECHB 4K1FA 2HI7A 2MMAA 2DIYA 1XW9A 5CRWA 1QK8A 4O32A 5JCWA 1IYHA 3U6VA 4HU9A 1RQMA 5G5FA 2N5FA 3GKNA 3RBTA 5B8BA 3CTFA 4JBBA 2VO4A 2A2RA 5DCGA 3MNGA 3JCML 3FKFA 2IMKA 4ZBBA 4LL4B 2BMXA 2RM6A 3E3EA 5DALB 1WIKA 1GLPA 2H6XA 4KE3A 3VWUA 1J9BA 4TW5A 3TRQA 2OBIA 2OJLA 1HNAA 3EYTA 1ZYQB 2H6ZA 4O92A 2HRKA 2I9HA 4EDZA 1H75A 2M72A 2PGTA 1M0UA 2O85A 4WKWA 1SKRB 2LTKA 20GSA 4I2TA 3CBUA 1JZWA 4MCUA 4XS6A 3F6FA 1PL2A 4D73B 2PUKC 1Z3EA 6GSUA 4MH2A 1J0FA 2GLRA 2B6MA 3GHAA 4ZB9A 4ECJA 3TOTA 1OKTA 1T7PB 2ZNMA 4BPYA 6GSXA 4Z7XA 1A24A 3P8WA 1ST9A 1K0DA 2I3YA 1GTAA 4N11A 3O76A 3ZREA 1OC8A 4I97A 1AQWA 3A2XA 3QCPA 4E8HA 2H0IA 3ZFLA 4FYCA 1SENA 4X1UA 4MJEA 3IPZA 12GSA 1VRSD 5HFGA 1XBSA 3M0FA 3VURA 3HZ8A 2DLXA 1GSQA 3E0UA 1G7OA 1U3AA 5DJMA 4MPGA 5J41A 2WB9A 3TCOA 3MAKA 1QMVA 4OFMA 4AF2A 4IQ1A 2L4QA 1ZL9A 1LU4A 2FLSA 2I81A 3RDWA 1K0MA 1UVZA 2JACA 4ECBA 1ERWA 1EOHA 3GN3A 3I9V2 4POMA 4ILFA 2DJ3A 2OE1A 2REMA 4PURA 2N5AA 1KTEA 1XWGA 2MMNA 4F82A 2KOKA 3UAPA 4K7OA 3A3TA 4IW9A 3IR4A 2ON5A 3FYGA 2V1MA 4IELA 2B1KA 4IJ3A 2B5XA 2XHFA 3LYPA 5GSTA 4DSSA 2P5QA 5B6NA 4YQVA 3VPTA 5KN1A 2JZRA 4MA9A 5BMUA 3KJYA 2WZ9A 1FHEA 3IE3A 1QFNA 1WMJA 1Z6MA 3L4NA 2PWJA 4FYUA 1YDKA 4GQFA 4FO5A 1T1VA 4X43A 1SK1A 3QOUA 2TIRA 2B3SA 1U3IA 1DBYA 1R26A 2H1BA 5EL8A 1SU9A 4V2NA 3HA9A 1GSUA 4DEJA 5A4WA 4HJ2A 2H0HA 5G31A 3E9JB 1M2AA 3F4RA 4L5LA 5CP1A 5IO2A 1XOAA 1O6JA 2VM2A 1ON4A 2HSMB 1OE8A 3LWAA 2H30A 2YOIA 5G1LA 4BWSA 1Q4JA 1B4QA 1V9WA 1X5CA 3DIEA 3EMXA 4V2MA 2C80A 3C71A 2L57A 3V1WA 2LRCA 1ZMAA 4BVXA 1WJKA 3GSSA 4FQUA 1BX9A 2A2SA 1DE2A 1GRXA 4PNGA 3KIJA 3H1NA 2VD1A 2VL2A 4IVFA 1ILOA 3UVTA 2VM1A 1O73A 1S3CA 2PVOC 2VOCA 1NSWA 1Z5YE 1X0RA 4TKYA 3IAM2 4I5QA 1XIYA 2DBCA 1ERUA 3NZNA 1DSBA 2K8VA 3F6DA 4Q5QA 3EINA 2YANA 2YCDA 3IXRA 3F4SA 1AW9A 2X99A 3ZITA 3M9JA 3BCKA 2XPDA 2A4VA 4PGTA 4TN8A 1XWKA 4MP4A 4ZB8A 5IPGA 4GSTA 1Y25A 4XS1A 2WGRA 4POLA 3UEMA 5IMCA 5HR1A 2FWEA 2F51A 1AQXA 1M9AA 3VPQA 4NHZA 4K2DA 3QAVA 2B1LA 4TR3A 1M2BA 1NM3A 3RPPA 3K8NA 1AUCA 1ERTA 4GQCA 4YQUA 4J57E 2H8LA 9GSSA 2CQ9A 2H76A 1U88A 3O3TA 1THXA 2DMMA 3GIXA 1LBKA 3PGTA 4K0GA 2YP6A 2GQLA 4K8MA 3TKSC 4PUAA 3I6AA 1T3BA 2OA7A 3IAS2 4OO4A 5ECMB 2LRNA 2WCIA 4BWQA 5CRGA 4LMVA 1SL0B 4JU5A 5CAXA 1EEJA 3Q74A 1GSSA 1O85A 4EVMA 4K9ZA 1B9XC 1VF4A 2YWIA 3W8SA 1EGOA 1FB0A 2O8VB 3FZ9A 4POBA 1I5GA 2HZEA 3ZVJA 4DSRA 2FY6A 3W8JA 3ZMKA 2ALBA 4F0BA 4X0XA 1XVWA 3VI5A 3ZL5A 1HYUA 2GSTA 2JSZA 3EWLA 1RK4A 3N9JA 2FA4A 1SD9A 4OMVA 1A0FA 1W89A 2WJUA 2K9FA 4E8EA 4AJ7A 1OC9A 1S3AA 2CV4A 3LORA 4TR1B 2DJ0A 3WGEA 5B6MA 4V2LA 2HSYA 4KSMA 1KBNA 5GAPD 3ME7A 3DXBA 4RQRA 2LQQA 3HD5A 4EF0A 4NMUA 19GSA 4XRDA 2FGXA 3GSTA 2HSNB 5IMFA 3C8EA 4V1Ap 2CVKA 2F8FA 2IFQB 3Q19A 10GSA 5ECOB 5ECPB 1O81A 3VWVA 3FZ4A 4XHMA 2E2MA 4XCSA 1IYIA 1OC3A 1V58A 1B4PA 4IKHA 4BVXB 1FVKA 4TVEA 1J08A 2MZCA 4CW9A 1YZXA 3L9VA 5ECIB 2XC2A 1U6TA 4K0NA 1BEDA 1MDKA 1TI3A 2RUFA 1PQNA 4PUFC 3DGQA 4NWYA 2VCQA 3MDKA 1MDIA 4WF4A 2CVBA 5H5RA
chains in the Genus database with same CATH superfamily
2J9HA 4O5UA 5CYYA 1F6MC 2VL3A 2RM5A 2M80A 3EVIA 3ZIVA 2WDUA 5ECQB 3LGCA 1LJRA 3HCZA 1ACVA 3DEXA 3KH9A 1TTZA 2V6KA 1SJZA 2IL3A 1QUWA 3VWXA 3SBCA 5F06A 2YJ7A 5CREA 2H66A 1TK5B 2JU5A 1U87A 5D9XA 3RPNA 5E4WA 2C0EA 1SKWB 4ACSA 1TU8A 2AYTA 3ED3A 3PINA 1E2YA 3S9FA 1XW5A 5E59A 4G2EA 4ML6A 4JEDA 1XWBA 3GKKA 4TR4A 3KM6A 3VFIA 2VCXA 4WR5A 4RUVA 3FZ5A 4AKGA 2X8GA 1TDIA 1NW2A 5IMAA 4EXJA 4PX1A 5AGYA 2CT6A 1XG8A 1JZRA 2R6KA 4AKIA 4E68A 4HEA2 4WF5A 3MWHA 4ZBDA 4EE0A 3F9UA 1G7EA 5DAKB 1TKDB 5HR0A 2H01A 2PMTA 1XWCA 1K0OA 4FH8A 5J4UA 2C8UA 3NIVA 4MABA 3HVNA 2VKZG 2WFCA 5IIZA 2LJKA 4F9ZA 2EFCA 3TKPA 2N5BA 3HZ4A 3I43A 3IDVA 2VLTA 5D8IA 5A5HB 11GSA 2WVXB 1FO5A 4HU7A 3WD6A 1TXXA 3EC3A 3BD2A 1JLWA 3NOFA 2GZYA 2RIIA 4BL7B 5C00A 2IJYA 3IRAA 1BYEA 5IMZA 3P90A 4IQAA 4MZCA 4MJBA 2EFHA 2G0FA 3TRXA 2R0CA 3D5JA 4TR0A 3EE2A 2RLIA 3CWGA 1BG1A 4YAVA 5HFIA 1ZYPA 4Q5FA 5IQYA 1O8WA 3GL5A 6GSYA 2WW0A 3M8NA 5DDLA 3BJ5A 2HT9A 2ON7A 2L5OA 4ECIA 2H70A 2V6OA 2VUPA 1G0TA 4KW6A 4ZB6A 3IK7A 1B48A 1TJDA 4DSQA 1TK8B 3ZTLA 1N8JA 2VLVA 4GSNA 4XTSA 2OE3A 5KN3A 4PI2C 2GTUA 1NHOA 2AB6A 4L0UA 3FEUA 1K0CA 4KX4A 6GSVA 5H5SA 2HSHA 4G0KA 4NV5A 4G0LA 4G0IA 1OKDA 5CRHA 1ZZYA 5CNWA 4RI7A 1XZOA 2CVDA 1SYRA 1WWJA 3EURA 2L4CA 3GTUA 2IMEA 2YZUA 3KTBA 4WXTA 4EUYA 2VIMA 3ZIJA 2VD0A 4POKA 5HR2A 1I1IP 2H19A 4XS4A 1A2JA 1X5DA 3HJPA 3FZAA 1GNEA 3TGZA 1KEBA 3IBHA 1VF1A 2GSQA 3M3MA 2NPBA 4I8BA 2CA8A 2WVYA 3LYKA 3ZMLA 1GP1A 3CRTA 4Q5NA 3TDGA 2TRXA 2KP1A 4BVYA 2DJJA 2LJRA 1FAAA 3GL3A 1M3IA 2L6DA 4FYBA 3P2AA 4X4JA 3VLNA 3FY7A 2F3MA 3EMPA 4KA0A 1YF1A 1GTIA 1YKAA 1ZOFA 3UMAA 3BOAA 2H71A 2I4AA 2JZSA 2PN8A 3TB2A 3WGXA 3FRCA 4HQSA 2YWOA 5G30A 1KNGA 2HFDA 5ID2A 1XOBA 1SVLA 1ABAA 2FD3A 2TRCP 1GH2A 2R0PA 3WYWA 3G7YA 1GSYA 3LG6A 4IN0A 4ZBAA 1S4BP 4KCEA 3FR6A 1MD4A 4NV2A 4AJ6A 2GZZA 4WBJA 5ECRB 1AXDA 4KDYA 3HVXA 2C0GA 2H1GA 2L59A 1PX6A 5A34A 1PKZA 3DRNA 1EEMA 1PKWA 5DQSA 3F4TA 2MYGA 1X9MB 2HRKB 4ECCA 2H6YA 2IWTA 2UZ8A 1XFLA 1ERVA 2HE3A 4TXOA 1X9WB 1GULA 8GSSA 1SL1B 3UBLA 2KP2A 2VCVA 3IK9A 4MZWA 1PL1A 2C3NA 2VL9A 2R0GA 5HR3A 3FR3A 4AKHA 3GA4A 5CRDA 2GDRA 5DQYA 1GTBA 4EDYA 2YJHA 5IOXA 2HXKA 2AJQB 2B7JA 5L71A 4OD7A 3HVVA 3SWLA 3TKSA 3F3RA 4HQZA 3L9UA 4EC0A 1M99A 3QMXA 3H93A 2O89A 1Z9HA 22GSA 1WOUA 1R7HA 3HXSA 4JRRA 3GYKA 4WEYA 1V2AA 3LXZA 4K6XA 1SK0A 3ZLPA 3BCIA 1GTUA 1MD3A 1OE7A 4O5RA 3C73A 1MTCA 3WGDA 3D4TA 3DMLA 2LV3A 1FB6A 2KUCA 2VLUA 2O87A 1PRXA 4TRXA 4MMMA 4ZL7A 3AY8A 3FK8A 4EO3A 5DALA 3D21A 5IPHA 1A2MA 5J4VA 4BA7A 5KOXA 1HNBA 2AAWA 1XWAA 2UV8G 4ZILA 3KCMA 1ZYNA 3TJFA 1FG4A 2F8AA 4EIPA 1C72A 1QQ2A 3A5WA 4AI6A 4FIWA 3L9SA 2LRTA 1O8XA 4HZ2A 1GUHA 4PXOA 4YQMA 2LS5A 2H75A 3CSIA 4DSSB 1UN2A 4QL7A 3ERFA 2DKHA 3QAWA 4FXYP 4V1Ag 4D73A 1XW6A 5BMUB 2C1YA 1TOFA 4YH2A 1SK2A 5A1NA 5KOWA 5JCGA 3IC4A 5AIVA 5D9VA 4MZBA 3A5IA 3APSA 3FMWA 4KCAA 3G7IA 4IP6A 2DIZA 3GFKA 4YAPA 5GZZB 1JHBA 1TP9A 2FWFA 4KB3A 5AISA 4KH7A 2GS3A 2HRNA 3D6IA 5F0GA 5HQPA 16GSA 2H1DA 5G2ZA 3HJMA 3MIXA 1F3AA 2WULA 4K2XA 1RW1A 3UBKA 4PQ1A 5A4VA 1GNWA 4HZ4A 4W66A 1PX7A 3HKRA 4IGJA 3UVHA 4A5PA 5LNKe 3U5RE 4HUAA 3CTGA 1GLQA 3ISOA 2EIOA 4HS1A 5ECLB 1SL2B 2A4HA 3ZRDA 2AUVA 2R37A 4JR4A 2E7PA 1TRUA 5C04A 1B8XA 3DD3A 5FT3A 2CX4A 3WT1A 3MYDA 3ZFBA 4G19A 1O7UA 4GCIA 3RGBC 2HLSA 4Q5RA 3PPUA 4Z2TA 1TRVA 4EKZA 3OR5A 2KHPA 1VGLA 2EFEA 2O7KA 3O6TA 1E6BA 1DE1A 2GSSA 2BTOT 3HYPA 3L78A 4HDEA 1T00A 4K5RA 4ZL9A 4ZB7A 2LNTA 3ZYWA 1CQGA 5GSSA 4PQHA 3TUEA 1JZOA 3D4MA 2IMIA 1Z7RA 5D9TA 2CX3A 1ZYEA 3GH9A 2K8SA 2YWMA 4RI6A 3F0IA 5ECSA 4MDCA 2JADA 5ABRA 2NVLA 4ULXA 3F8UA 1N2AA 2GSRA 2IN3A 3WT2A 4PNFA 1F2EA 5IMDA 1XVQA 2DJ1A 3KD0A 2O3EA 3HJOA 3H79A 4JR6A 3CYNA 2AV4A 4OFTA 3IC8A 17GSA 4USSA 2C3QA 1GUKA 4ML1A 3GUSA 2FCHA 1V57A 3GKXA 3UL3A 1CQHA 5JWQB 4LLRA 5DCHA 1K0AA 1YEXA 4DVCA 1GUMA 3RAZA 1R4WA 1T4ZA 4OWYA 2C0FA 2MMOA 4XRAA 4GLTA 2DMLA 2HSMA 1VF3A 2IMDA 3QR6A 4QL9A 4LL1B 4GF0A 4KUNA 3APOA 1PA3A 2NTOA 2WS2A 2OKAA 3KMNA 3LFLA 2H1AA 2KLXA 3TKRA 2CAQA 2VAFA 3M9KA 1QGVA 5A4UA 4WBRD 2FHEA 1EWXA 1MEKA 1URMA 5LD0A 1JZDA 3GX8A 3MSZA 2R4VA 4KF9A 5ECKB 3FHKA 1S3RA 1SD8A 1M2DA 4AJ8A 4WR4A 5ELAA 1YEWC 1GWCA 1M7TA 2CAIA 2DJKA 5A5KA 3LJRA 2QGVA 5IMVA 4ZXGA 2HZEB 1WPIA 3DKSA 2YN1A 5JCUA 2IIYA 1SYXA 3TKQA 3L0HA 1R5PA 4K7NA 2M46A 2ZUPA 1F9MA 1YF0A 4NAXA 1PFOA 1R5AA 1QXHA 2XBQA 2PBJA 1TRSA 4O7HA 2GZPA 3CSJA 2P31A 4CDOA 2GGTA 3G7JA 3IOSA 3F63A 4IJIA 2HQTA 4MNNA 4MF7A 3CRUA 3VWWA 3QDNA 1GSDA 1YY7A 3KP8A 4ISDA 2CZ3A 4N0VA 1HD2A 5DBQA 1MDJA 1OC9B 1M9BA 1A8YA 4I2UA 5GAND 1PSQA 4G10A 4KGIA 2WVZA 2C3TA 3H4KA 4L0WA 4K7IA 2GT5A 5J9CA 2LSTA 3M1GA 3IA1A 3TKSE 2H0GA 1DUGA 5B8AA 4MPFA 2DJ2A 3GV1A 1TRWA 3DVWA 2V32A 3RHBA 4N30A 1FOVA 1A8LA 2FNOA 5G5EA 4ZL8A 2LNSA 3DWVA 4L5OA 1Z6NA 1FW1A 2P0GA 14GSA 5IO0A 4CHSA 2YV9A 2YV7A 4F0CA 3A2WA 1X5EA 2FA8A 2G2QA 2GQKA 2YZHA 3UIWA 4N0ZA 2DSAA 2X64A 4GTUA 2CZ2A 2EC4A 4PTSA 5INYA 1GSEA 3QFAC 3BBYA 3H8QA 4KAEA 3HVSA 1TW9A 1K3LA 5LCZA 2JZTA 3TRPA 2R3XA 1TU7A 3QAGA 5FHIA 4F2IA 1Z7PA 1K0NA 1V40A 2HNLA 1G6WA 3GX0A 2R2JA 1PD21 4G9HA 1OYJA 1TK0B 2D2ZA 3VI7A 3ZVJD 1TI1A 5J9BA 5COHA 4PI0C 2ES7A 2I1UA 3EU4A 5KN0A 1A0RP 3KMOA 5KN2A 1BJXA 3TJKA 3KP9A 2FWHA 1SKSB 4IHUA 4TR1A 2B7KA 4F03A 2VCTA 2LKUA 3RHCA 5EVOA 2F9SA 3Q6OA 5ELGA 2MMZA 5CO3A 4I6XA 2EFDA 5J3RA 3CQFA 3I69A 5EY6A 1AQVA 4KNDA 4J56E 2V2GA 3N5OA 1FVJA 1AAZA 1JLVA 3ZZXA 5FWGA 2JL4A 2IFQA 2PU9C 3HY2A 4GSSA 5J40A 1PGTA 1T8EB 3GKMA 1HQOA 2PPTA 2OT3A 2H74A 4IP1A 3TOUA 2X49A 2GQMA 2C4JA 3C1RA 1EP8A 5D73A 4KDUA 4XIHA 5JWRB 1UC7A 3R3EA 5F8BA 1YJ6A 2JSYA 1AIUA 2PVQA 3TJBA 3CMIA 2WW3A 4PQIA 2L6CA 1K0BA 3TJJA 1XCCA 1SJ6A 6GSSA 1PMTA 5H5QA 3TJGA 2L5LA 5ENUA 1JFUA 1S3DA 2YPMA 1A2LA 2E2GA 3GURA 2MBSA 2VL2C 5KEJA 3CHXC 1PN9A 4JZQA 2C0DA 4GRFA 2K6VA 3QFBC 4P3YB 3IV4A 4L8EA 1NHYA 4N3ZA 2OBKA 4JE1A 3J7Yb 3KZQA 2IPAA 4HI7A 2YWNA 4IBPA 2K18A 2NDOA 4WETA 3KGKA 1EV9A 2H73A 2HYXA 3LSZA 3C7MA 3LQ7A 3G9BA 3KEBA 2FUG2 4QQ7A 1G6YA 3IHQA 2OADA 3US3A 2X4AA 1H4OA 3KH7A 2YNXA 1GL8A 2FWGA 3ERGA 4KDXA 2B5EA 4PHZC 1K3YA 1WP0A 2PERA 4NXIA 1HNCA 3P7XA 1SVMA 1BG5A 1VF2A 1K3OA 1EOGA 1USBA 1WRYA 3PH9A 4J2FA 2X8CA 5DVBA 1YEPA 1W4VA 2HRAA 2V41A 1YQ1A 2R5GA 2WZSA 3UJ1A 5DJLA 1XPVA 5DAKA 3EU3A 4LMWA 5ECNB 1THOA 4AGSA 4Z2RA 2QKEA 3HHVA 3APQA 1BAYA 3GTUB 2P5RA 4NPBA 2H72A 2DC5A 5AIXA 2OACA 18GSA 5HFKA 2VCWA 1AC1A 3HMJG 2B5YA 4XS4B 3KTLA 4MF5A 2QC7A 4OO5A 5A5HA 4MLYA 3PR8A 4EL1A 2MBTA 1X9SB 3FR9A 2WVXA 6GSTA 5F07A 2LQOA 2EIQA 5J5NA 1EGRA 4NHWA 2EIRA 4BL7A 2Z9SA 4BVYB 3J7Yk 5B7CA 4H86A 4OCFA 3LW9A 3VK9A 3ERWA 5D93A 3D0ZA 2OE0A 4KSOA 1A23A 2XBIA 4ID0A 5JWOB 3FW2A 2LUSA 1F3BA 2GT6A 1EZKA 2WRTA 4TOPA 2NBSA 3F3QA 1EV4A 1WE0A 4GWRA 2O36A 4TXVA 2E0QA 3DYRA 3LEFA 2LJAA 3A2VA 1Y1UA 1ZGNA 2J23A 1GSFA 5ID2B 3R2QA 1EP7A 1UA5A 5F05A 1I9DA 4MF6A 2HRFA 2RUEA 1SJIA 2ZCTA 1F37A 1B9YC 4IS0A 4OFNA 5G1KA 1Y6EA 4YKFA 3GNJA 4HJMA 5EPFA 2AHEA 2BJXA 5A34B 2IMFA 4CY8A 3ME8A 3GRXA 5D9WA 5D96A 4RQXA 3UARA 2X8HA 2GVPA 6GSWA 2QA2A 3QD9A 4BIKA 4ZIJA 3LXTA 3CXGA 3HDCA 3C1SA 3DVXA 13GSA 4MJCA 4MH3A 7GSSA 3KXOA 4TXOB 1OAZA 5IOWA 3UOMA 2VCZA 4HOJA 1ZCPA 4N10A 4Z2UA 1T4YA 3W6GA 2HZFA 4MJAA 5J47A 1OVNA 3GMFA 1YKCA 1ML6A 3CSHA 4LA1A 3Q18A 4MK3A 1XXUA 2XPEA 5AN1A 2QSIA 3D22A 3GH6A 1BQ7A 4OCEA 1V98A 1Q98A 3EPTA 4GXZA 3QPMA 5IM9A 2LEGA 5ECHB 4K1FA 2HI7A 1FOHA 2MMAA 5BRTA 3RFRC 2DIYA 1XW9A 5CRWA 1QK8A 4O32A 5JCWA 1TXUA 1IYHA 3U6VA 4HU9A 1RQMA 5G5FA 2N5FA 3GKNA 3RBTA 5B8BA 3CTFA 4JBBA 2VO4A 2A2RA 5DCGA 3MNGA 3JCML 3FKFA 2WW1A 2IMKA 4ZBBA 4LL4B 2BMXA 2RM6A 3E3EA 5DALB 1WIKA 1GLPA 2H6XA 4KE3A 3VWUA 1J9BA 4TW5A 3TRQA 2OBIA 2OJLA 1HNAA 3EYTA 1ZYQB 2H6ZA 4O92A 2HRKA 2I9HA 4EDZA 1H75A 2M72A 2PGTA 1M0UA 2O85A 4WKWA 1SKRB 2LTKA 20GSA 4I2TA 3CBUA 1JZWA 2DKIA 4MCUA 4XS6A 3F6FA 1PL2A 4D73B 2PUKC 1Z3EA 6GSUA 4MH2A 1J0FA 1M3JA 4QMKA 2GLRA 5A1NB 2B6MA 4ZB9A 3GHAA 4ECJA 3TOTA 1OKTA 2A2PA 1T7PB 2ZNMA 4BPYA 6GSXA 4Z7XA 1A24A 3P8WA 1ST9A 1K0DA 2I3YA 1GTAA 4N11A 3O76A 3ZREA 1OC8A 4EIQA 4I97A 1AQWA 3A2XA 3QCPA 4E8HA 2H0IA 3ZFLA 4FYCA 1SENA 4X1UA 4MJEA 3IPZA 12GSA 1VRSD 5HFGA 1XBSA 3M0FA 3VURA 3HZ8A 2DLXA 1GSQA 3E0UA 1G7OA 1U3AA 5DJMA 4MPGA 5J41A 2WB9A 3TCOA 3MAKA 1QMVA 4OFMA 4AF2A 4CY6A 4IQ1A 2L4QA 1ZL9A 1LU4A 2FLSA 2I81A 3RDWA 1K0MA 1UVZA 2JACA 4ECBA 1ERWA 1EOHA 3GN3A 3I9V2 4POMA 4ILFA 2DJ3A 2OE1A 2REMA 4PURA 2N5AA 1KTEA 1XWGA 2MMNA 4F82A 2KOKA 2O5VA 3UAPA 4K7OA 3A3TA 4IW9A 3IR4A 2ON5A 3FYGA 2V1MA 4IELA 4HSCX 2B1KA 4IJ3A 2B5XA 2XHFA 3LYPA 5GSTA 4DSSA 2P5QA 5B6NA 4YQVA 3VPTA 5KN1A 2JZRA 4MA9A 5BMUA 3KJYA 2WZ9A 1FHEA 3IE3A 1QFNA 1WMJA 1Z6MA 3L4NA 2PWJA 4FYUA 1YDKA 4GQFA 4FO5A 1T1VA 4X43A 1SK1A 3QOUA 2TIRA 2WW2A 2B3SA 1U3IA 1DBYA 1R26A 2H1BA 5EL8A 1SU9A 4V2NA 3HA9A 1GSUA 4DEJA 5A4WA 4HJ2A 2H0HA 5G31A 3E9JB 1M2AA 3F4RA 4L5LA 5CP1A 5IO2A 3TU3B 1XOAA 1O6JA 2VM2A 1ON4A 2HSNA 2HSMB 1OE8A 3LWAA 2H30A 1PN0A 1N25A 2YOIA 5G1LA 4BWSA 1Q4JA 1B4QA 1V9WA 1X5CA 3DIEA 3EMXA 4V2MA 2C80A 3C71A 2L57A 3V1WA 2LRCA 1ZMAA 4BVXA 1WJKA 3GSSA 4AKXB 4FQUA 1BX9A 2A2SA 1DE2A 1GRXA 4PNGA 3KIJA 3H1NA 2VD1A 2VL2A 4IVFA 1ILOA 3UVTA 2VM1A 1O73A 1S3CA 2PVOC 2VOCA 1NSWA 1Z5YE 1X0RA 4TKYA 3IAM2 4I5QA 1XIYA 2DBCA 1ERUA 3NZNA 1DSBA 2K8VA 3F6DA 4Q5QA 3EINA 2YANA 2YCDA 3IXRA 3F4SA 1AW9A 2X99A 3ZITA 3M9JA 3BCKA 2XPDA 2A4VA 3IHGA 4PGTA 4TN8A 1XWKA 4MP4A 4ZB8A 4ICYA 5IPGA 4GSTA 1Y25A 4XS1A 2WGRA 4POLA 3UEMA 5IMCA 5HR1A 2FWEA 2F51A 1AQXA 1M9AA 3VPQA 4NHZA 4K2DA 3QAVA 2B1LA 4TR3A 1M2BA 1NM3A 3RPPA 3K8NA 1AUCA 1ERTA 4GQCA 4YQUA 4J57E 2H8LA 9GSSA 2CQ9A 2H76A 1U88A 1SVOA 3O3TA 1THXA 2DMMA 3GIXA 1LBKA 3PGTA 4K0GA 2YP6A 2GQLA 4K8MA 3TKSC 4PUAA 3I6AA 1T3BA 2OA7A 3IAS2 4OO4A 5ECMB 2LRNA 2WCIA 4BWQA 5CRGA 4LMVA 1SL0B 4JU5A 5CAXA 1EEJA 3Q74A 1GSSA 1O85A 4EVMA 4K9ZA 1B9XC 1VF4A 2YWIA 3W8SA 1EGOA 1FB0A 2O8VB 3FZ9A 4POBA 1BF5A 1I5GA 4O5QA 2HZEA 3ZVJA 4DSRA 2FY6A 3W8JA 3ZMKA 2ALBA 4F0BA 4X0XA 1XVWA 4G01A 3VI5A 3ZL5A 1HYUA 2GSTA 2H1LA 2JSZA 3EWLA 4K5SA 1RK4A 3N9JA 2FA4A 1SD9A 4OMVA 1A0FA 1W89A 2WJUA 2K9FA 4E8EA 4AJ7A 1OC9A 1YVLA 1S3AA 2CV4A 3LORA 4TR1B 2DJ0A 3WGEA 5B6MA 4V2LA 2HSYA 4KSMA 1KBNA 5GAPD 3ME7A 3DXBA 4RQRA 2LQQA 3HD5A 4EF0A 2QA1A 4NMUA 19GSA 4XRDA 2FGXA 3GSTA 2HSNB 5IMFA 3C8EA 4V1Ap 2CVKA 2F8FA 2IFQB 3Q19A 10GSA 5ECOB 5ECPB 1O81A 3VWVA 3FZ4A 4XHMA 2E2MA 4XCSA 1IYIA 1OC3A 1V58A 4YKGA 1B4PA 4IKHA 4BVXB 1FVKA 4TVEA 1J08A 4GDFA 2MZCA 4CW9A 1YZXA 3L9VA 5ECIB 2XC2A 1U6TA 4K0NA 1BEDA 1MDKA 5J4YA 1TI3A 2RUFA 1PQNA 4PUFC 3DGQA 4NWYA 2VCQA 3MDKA 1MDIA 4WF4A 2CVBA 5H5RA
chains in the Genus database with same CATH topology
2J9HA 4O5UA 5CYYA 1F6MC 2VL3A 2RM5A 2M80A 3EVIA 3ZIVA 2WDUA 5ECQB 3LGCA 1LJRA 3HCZA 1ACVA 3DEXA 3KH9A 1TTZA 2V6KA 1SJZA 2IL3A 1QUWA 3VWXA 3SBCA 5F06A 2YJ7A 5CREA 2H66A 1TK5B 2JU5A 1U87A 5D9XA 3RPNA 5E4WA 2C0EA 1SKWB 4ACSA 1TU8A 2AYTA 3ED3A 3PINA 1E2YA 3S9FA 1XW5A 5E59A 4G2EA 4ML6A 4JEDA 1XWBA 3GKKA 4TR4A 3KM6A 3VFIA 2VCXA 4WR5A 4RUVA 3FZ5A 4AKGA 2X8GA 1TDIA 1NW2A 5IMAA 4EXJA 4PX1A 5AGYA 2CT6A 1JZRA 2R6KA 4AKIA 4E68A 4HEA2 4WF5A 3MWHA 4ZBDA 4EE0A 3F9UA 1G7EA 5DAKB 1TKDB 5HR0A 2H01A 2PMTA 1XWCA 1K0OA 4FH8A 5J4UA 2C8UA 3NIVA 4MABA 2VKZG 2WFCA 5IIZA 2LJKA 4F9ZA 2EFCA 3TKPA 2N5BA 3HZ4A 3I43A 3IDVA 2VLTA 5D8IA 5A5HB 11GSA 1FO5A 4HU7A 3WD6A 1TXXA 3EC3A 3BD2A 1JLWA 3NOFA 2GZYA 2RIIA 4BL7B 5C00A 2IJYA 3IRAA 1BYEA 5IMZA 3P90A 4IQAA 4MZCA 4MJBA 2EFHA 2G0FA 3TRXA 2R0CA 3D5JA 4TR0A 3EE2A 2RLIA 3CWGA 1BG1A 4YAVA 5HFIA 1ZYPA 4Q5FA 5IQYA 1O8WA 3GL5A 6GSYA 3M8NA 5DDLA 3BJ5A 2HT9A 2ON7A 2L5OA 4ECIA 2H70A 2V6OA 2VUPA 1G0TA 4KW6A 4ZB6A 3IK7A 1B48A 1TJDA 4DSQA 1TK8B 3ZTLA 1N8JA 2VLVA 4GSNA 4XTSA 2OE3A 5KN3A 2GTUA 1NHOA 2AB6A 4L0UA 3FEUA 1K0CA 4KX4A 6GSVA 5H5SA 2HSHA 4G0KA 4NV5A 4G0LA 4G0IA 1OKDA 5CRHA 1ZZYA 5CNWA 4RI7A 1XZOA 2CVDA 1SYRA 1WWJA 3EURA 2L4CA 3GTUA 2IMEA 2YZUA 3KTBA 4WXTA 4EUYA 2VIMA 3ZIJA 2VD0A 4POKA 5HR2A 2H19A 4XS4A 1A2JA 1X5DA 3HJPA 3FZAA 1GNEA 3TGZA 1KEBA 3IBHA 1VF1A 2GSQA 3M3MA 2NPBA 4I8BA 2CA8A 3LYKA 3ZMLA 1GP1A 3CRTA 4Q5NA 3TDGA 2TRXA 2KP1A 4BVYA 2DJJA 2LJRA 1FAAA 3GL3A 2L6DA 4FYBA 3P2AA 4X4JA 3VLNA 3FY7A 2F3MA 3EMPA 4KA0A 1YF1A 1GTIA 1YKAA 1ZOFA 3UMAA 3BOAA 2H71A 2I4AA 2JZSA 2PN8A 3TB2A 3WGXA 3FRCA 4HQSA 2YWOA 5G30A 1KNGA 2HFDA 5ID2A 1XOBA 1SVLA 1ABAA 2FD3A 2TRCP 1GH2A 2R0PA 3WYWA 3G7YA 1GSYA 3LG6A 4IN0A 4ZBAA 4KCEA 3FR6A 1MD4A 4NV2A 4AJ6A 2GZZA 4WBJA 5ECRB 1AXDA 4KDYA 3HVXA 2C0GA 2H1GA 2L59A 1PX6A 5A34A 1PKZA 3DRNA 1EEMA 1PKWA 5DQSA 3F4TA 2MYGA 1X9MB 2HRKB 4ECCA 2H6YA 2IWTA 2UZ8A 1XFLA 1ERVA 2HE3A 4TXOA 1X9WB 1GULA 8GSSA 1SL1B 3UBLA 2KP2A 2VCVA 3IK9A 4MZWA 1PL1A 2C3NA 2VL9A 2R0GA 5HR3A 3FR3A 4AKHA 3GA4A 5CRDA 2GDRA 5DQYA 1GTBA 4EDYA 2YJHA 5IOXA 2HXKA 2AJQB 2B7JA 5L71A 4OD7A 3HVVA 3SWLA 3TKSA 3F3RA 4HQZA 3L9UA 4EC0A 1M99A 3QMXA 3H93A 2O89A 1Z9HA 22GSA 1WOUA 1R7HA 3HXSA 4JRRA 3GYKA 4WEYA 1V2AA 3LXZA 4K6XA 1SK0A 3ZLPA 3BCIA 1GTUA 1MD3A 1OE7A 4O5RA 3C73A 1MTCA 3WGDA 3D4TA 3DMLA 2LV3A 1FB6A 2KUCA 2VLUA 2O87A 1PRXA 4TRXA 4MMMA 4ZL7A 3AY8A 3FK8A 4EO3A 5DALA 3D21A 5IPHA 1A2MA 5J4VA 4BA7A 5KOXA 1HNBA 2AAWA 1XWAA 2UV8G 4ZILA 3KCMA 1ZYNA 3TJFA 1FG4A 2F8AA 4EIPA 1C72A 1QQ2A 3A5WA 4AI6A 4FIWA 3L9SA 2LRTA 1O8XA 4HZ2A 1GUHA 4PXOA 4YQMA 2LS5A 2H75A 3CSIA 4DSSB 1UN2A 4QL7A 3ERFA 2DKHA 3QAWA 4V1Ag 4D73A 1XW6A 5BMUB 2C1YA 1TOFA 4YH2A 1SK2A 5A1NA 5KOWA 5JCGA 3IC4A 5AIVA 5D9VA 4MZBA 3A5IA 3APSA 3FMWA 4KCAA 3G7IA 4IP6A 2DIZA 3GFKA 4YAPA 5GZZB 1JHBA 1TP9A 2FWFA 4KB3A 5AISA 4KH7A 2GS3A 2HRNA 3D6IA 5F0GA 5HQPA 16GSA 2H1DA 5G2ZA 3HJMA 3MIXA 1F3AA 2WULA 4K2XA 1RW1A 3UBKA 4PQ1A 5A4VA 1GNWA 4HZ4A 4W66A 1PX7A 3HKRA 4IGJA 3UVHA 4A5PA 5LNKe 3U5RE 4HUAA 3CTGA 1GLQA 3ISOA 2EIOA 4HS1A 5ECLB 1SL2B 2A4HA 3ZRDA 2AUVA 2R37A 4JR4A 2E7PA 1TRUA 5C04A 1B8XA 3DD3A 5FT3A 2CX4A 3WT1A 3MYDA 3ZFBA 4G19A 1O7UA 4GCIA 2HLSA 4Q5RA 3PPUA 4Z2TA 1TRVA 4EKZA 3OR5A 2KHPA 1VGLA 2EFEA 2O7KA 3O6TA 1E6BA 1DE1A 2GSSA 2BTOT 3HYPA 3L78A 4HDEA 1T00A 4K5RA 4ZL9A 4ZB7A 2LNTA 3ZYWA 1CQGA 5GSSA 4PQHA 3TUEA 1JZOA 3D4MA 2IMIA 1Z7RA 5D9TA 2CX3A 1ZYEA 3GH9A 2K8SA 2YWMA 4RI6A 3F0IA 5ECSA 4MDCA 2JADA 5ABRA 2NVLA 4ULXA 3F8UA 1N2AA 2GSRA 2IN3A 3WT2A 4PNFA 1F2EA 5IMDA 1XVQA 2DJ1A 3KD0A 3HJOA 3H79A 4JR6A 3CYNA 2AV4A 4OFTA 3IC8A 17GSA 4USSA 2C3QA 1GUKA 4ML1A 3GUSA 2FCHA 1V57A 3GKXA 3UL3A 1CQHA 5JWQB 4LLRA 5DCHA 1K0AA 1YEXA 4DVCA 1GUMA 3RAZA 1R4WA 1T4ZA 4OWYA 2C0FA 2MMOA 4XRAA 4GLTA 2DMLA 2HSMA 1VF3A 2IMDA 3QR6A 4QL9A 4LL1B 4GF0A 4KUNA 3APOA 1PA3A 2NTOA 2WS2A 2OKAA 3KMNA 3LFLA 2H1AA 2KLXA 3TKRA 2CAQA 2VAFA 3M9KA 1QGVA 5A4UA 4WBRD 2FHEA 1EWXA 1MEKA 1URMA 5LD0A 1JZDA 3GX8A 3MSZA 2R4VA 4KF9A 5ECKB 3FHKA 1SD8A 1M2DA 4AJ8A 4WR4A 5ELAA 1GWCA 1M7TA 2CAIA 2DJKA 5A5KA 3LJRA 2QGVA 5IMVA 4ZXGA 2HZEB 1WPIA 3DKSA 2YN1A 5JCUA 2IIYA 1SYXA 3TKQA 3L0HA 1R5PA 4K7NA 2M46A 2ZUPA 1F9MA 1YF0A 4NAXA 1R5AA 1QXHA 2XBQA 2PBJA 1TRSA 4O7HA 2GZPA 3CSJA 2P31A 4CDOA 2GGTA 3G7JA 3IOSA 3F63A 4IJIA 2HQTA 4MNNA 4MF7A 3CRUA 3VWWA 3QDNA 1GSDA 1YY7A 3KP8A 4ISDA 2CZ3A 4N0VA 1HD2A 5DBQA 1MDJA 1OC9B 1M9BA 1A8YA 4I2UA 5GAND 1PSQA 4G10A 4KGIA 2C3TA 3H4KA 4L0WA 4K7IA 2GT5A 5J9CA 2LSTA 3M1GA 3IA1A 3TKSE 2H0GA 1DUGA 5B8AA 4MPFA 2DJ2A 3GV1A 1TRWA 3DVWA 2V32A 3RHBA 4N30A 1FOVA 1A8LA 2FNOA 5G5EA 4ZL8A 2LNSA 3DWVA 4L5OA 1Z6NA 1FW1A 2P0GA 14GSA 5IO0A 4CHSA 2YV9A 2YV7A 4F0CA 3A2WA 1X5EA 2FA8A 2G2QA 2GQKA 2YZHA 3UIWA 4N0ZA 2DSAA 2X64A 4GTUA 2CZ2A 2EC4A 4PTSA 5INYA 1GSEA 3QFAC 3BBYA 3H8QA 4KAEA 3HVSA 1TW9A 1K3LA 5LCZA 2JZTA 3TRPA 2R3XA 1TU7A 3QAGA 5FHIA 4F2IA 1Z7PA 1K0NA 1V40A 2HNLA 1G6WA 3GX0A 2R2JA 1PD21 4G9HA 1OYJA 1TK0B 2D2ZA 3VI7A 3ZVJD 1TI1A 5J9BA 5COHA 2ES7A 2I1UA 3EU4A 5KN0A 1A0RP 3KMOA 5KN2A 1BJXA 3TJKA 3KP9A 2FWHA 1SKSB 4IHUA 4TR1A 2B7KA 4F03A 2VCTA 2LKUA 3RHCA 5EVOA 2F9SA 3Q6OA 5ELGA 2MMZA 5CO3A 4I6XA 2EFDA 5J3RA 3I69A 5EY6A 1AQVA 4KNDA 4J56E 2V2GA 3N5OA 1FVJA 1AAZA 1JLVA 3ZZXA 5FWGA 2JL4A 2IFQA 2PU9C 3HY2A 4GSSA 5J40A 1PGTA 1T8EB 3GKMA 1HQOA 2PPTA 2OT3A 2H74A 4IP1A 3TOUA 2X49A 2GQMA 2C4JA 3C1RA 1EP8A 5D73A 4KDUA 4XIHA 5JWRB 1UC7A 3R3EA 5F8BA 1YJ6A 2JSYA 1AIUA 2PVQA 3TJBA 3CMIA 4PQIA 2L6CA 1K0BA 3TJJA 1XCCA 1SJ6A 6GSSA 1PMTA 5H5QA 3TJGA 2L5LA 5ENUA 1JFUA 1S3DA 2YPMA 1A2LA 2E2GA 3GURA 2MBSA 2VL2C 5KEJA 1PN9A 4JZQA 2C0DA 4GRFA 2K6VA 3QFBC 4P3YB 3IV4A 4L8EA 1NHYA 4N3ZA 2OBKA 4JE1A 3J7Yb 3KZQA 2IPAA 4HI7A 2YWNA 4IBPA 2K18A 2NDOA 4WETA 3KGKA 1EV9A 2H73A 2HYXA 3LSZA 3C7MA 3LQ7A 3G9BA 3KEBA 2FUG2 4QQ7A 1G6YA 3IHQA 2OADA 3US3A 2X4AA 1H4OA 3KH7A 2YNXA 1GL8A 2FWGA 3ERGA 4KDXA 2B5EA 1K3YA 1WP0A 2PERA 4NXIA 1HNCA 3P7XA 1SVMA 1BG5A 1VF2A 1K3OA 1EOGA 1USBA 1WRYA 3PH9A 4J2FA 2X8CA 5DVBA 1YEPA 1W4VA 2HRAA 2V41A 1YQ1A 2R5GA 3UJ1A 5DJLA 1XPVA 5DAKA 3EU3A 4LMWA 5ECNB 1THOA 4AGSA 4Z2RA 2QKEA 3HHVA 3APQA 1BAYA 3GTUB 2P5RA 4NPBA 2H72A 2DC5A 5AIXA 2OACA 18GSA 5HFKA 2VCWA 1AC1A 3HMJG 2B5YA 4XS4B 3KTLA 4MF5A 2QC7A 4OO5A 5A5HA 4MLYA 3PR8A 4EL1A 2MBTA 1X9SB 3FR9A 6GSTA 5F07A 2LQOA 2EIQA 5J5NA 1EGRA 4NHWA 2EIRA 4BL7A 2Z9SA 4BVYB 3J7Yk 5B7CA 4H86A 4OCFA 3LW9A 3VK9A 3ERWA 5D93A 3D0ZA 2OE0A 4KSOA 1A23A 2XBIA 4ID0A 5JWOB 3FW2A 2LUSA 1F3BA 2GT6A 1EZKA 2WRTA 4TOPA 2NBSA 3F3QA 1EV4A 1WE0A 4GWRA 4TXVA 2E0QA 3DYRA 3LEFA 2LJAA 3A2VA 1Y1UA 1ZGNA 2J23A 1GSFA 5ID2B 3R2QA 1EP7A 1UA5A 5F05A 1I9DA 4MF6A 2HRFA 2RUEA 1SJIA 2ZCTA 1F37A 1B9YC 4IS0A 4OFNA 5G1KA 1Y6EA 4YKFA 3GNJA 4HJMA 5EPFA 2AHEA 2BJXA 5A34B 2IMFA 4CY8A 3ME8A 3GRXA 5D9WA 5D96A 4RQXA 3UARA 2X8HA 2GVPA 6GSWA 2QA2A 3QD9A 4ZIJA 3LXTA 3CXGA 3HDCA 3C1SA 3DVXA 13GSA 4MJCA 4MH3A 7GSSA 3KXOA 4TXOB 1OAZA 5IOWA 3UOMA 2VCZA 4HOJA 1ZCPA 4N10A 4Z2UA 1T4YA 3W6GA 2HZFA 4MJAA 5J47A 1OVNA 3GMFA 1YKCA 1ML6A 3CSHA 4LA1A 3Q18A 4MK3A 1XXUA 2XPEA 5AN1A 2QSIA 3D22A 3GH6A 1BQ7A 4OCEA 1V98A 1Q98A 3EPTA 4GXZA 3QPMA 5IM9A 2LEGA 5ECHB 4K1FA 2HI7A 1FOHA 2MMAA 5BRTA 2DIYA 1XW9A 5CRWA 1QK8A 4O32A 5JCWA 1TXUA 1IYHA 3U6VA 4HU9A 1RQMA 5G5FA 2N5FA 3GKNA 3RBTA 5B8BA 3CTFA 4JBBA 2VO4A 2A2RA 5DCGA 3MNGA 3JCML 3FKFA 2IMKA 4ZBBA 4LL4B 2BMXA 2RM6A 3E3EA 5DALB 1WIKA 1GLPA 2H6XA 4KE3A 3VWUA 1J9BA 4TW5A 3TRQA 2OBIA 2OJLA 1HNAA 3EYTA 1ZYQB 2H6ZA 4O92A 2HRKA 2I9HA 4EDZA 1H75A 2M72A 2PGTA 1M0UA 2O85A 4WKWA 1SKRB 2LTKA 20GSA 4I2TA 3CBUA 1JZWA 2DKIA 4MCUA 4XS6A 3F6FA 1PL2A 4D73B 2PUKC 1Z3EA 6GSUA 4MH2A 1J0FA 4QMKA 2GLRA 5A1NB 2B6MA 4ZB9A 3GHAA 4ECJA 3TOTA 1OKTA 2A2PA 1T7PB 2ZNMA 4BPYA 6GSXA 4Z7XA 1A24A 3P8WA 1ST9A 1K0DA 2I3YA 1GTAA 4N11A 3O76A 3ZREA 1OC8A 4EIQA 4I97A 1AQWA 3A2XA 3QCPA 4E8HA 2H0IA 3ZFLA 4FYCA 1SENA 4X1UA 4MJEA 3IPZA 12GSA 1VRSD 5HFGA 1XBSA 3M0FA 3VURA 3HZ8A 2DLXA 1GSQA 3E0UA 1G7OA 1U3AA 5DJMA 4MPGA 5J41A 2WB9A 3TCOA 3MAKA 1QMVA 4OFMA 4AF2A 4CY6A 4IQ1A 2L4QA 1ZL9A 1LU4A 2FLSA 2I81A 3RDWA 1K0MA 1UVZA 2JACA 4ECBA 1ERWA 1EOHA 3GN3A 3I9V2 4POMA 4ILFA 2DJ3A 2OE1A 2REMA 4PURA 2N5AA 1KTEA 1XWGA 2MMNA 4F82A 2KOKA 2O5VA 3UAPA 4K7OA 3A3TA 4IW9A 3IR4A 2ON5A 3FYGA 2V1MA 4IELA 2B1KA 4IJ3A 2B5XA 2XHFA 3LYPA 5GSTA 4DSSA 2P5QA 5B6NA 4YQVA 3VPTA 5KN1A 2JZRA 4MA9A 5BMUA 3KJYA 2WZ9A 1FHEA 3IE3A 1QFNA 1WMJA 1Z6MA 3L4NA 2PWJA 4FYUA 1YDKA 4GQFA 4FO5A 1T1VA 4X43A 1SK1A 3QOUA 2TIRA 2B3SA 1U3IA 1DBYA 1R26A 2H1BA 5EL8A 1SU9A 4V2NA 3HA9A 1GSUA 4DEJA 5A4WA 4HJ2A 2H0HA 5G31A 3E9JB 1M2AA 3F4RA 4L5LA 5CP1A 5IO2A 3TU3B 1XOAA 1O6JA 2VM2A 1ON4A 2HSNA 2HSMB 1OE8A 3LWAA 2H30A 1PN0A 1N25A 2YOIA 5G1LA 4BWSA 1Q4JA 1B4QA 1V9WA 1X5CA 3DIEA 3EMXA 4V2MA 2C80A 3C71A 2L57A 3V1WA 2LRCA 1ZMAA 4BVXA 1WJKA 3GSSA 4AKXB 4FQUA 1BX9A 2A2SA 1DE2A 1GRXA 4PNGA 3KIJA 3H1NA 2VD1A 2VL2A 4IVFA 1ILOA 3UVTA 2VM1A 1O73A 1S3CA 2PVOC 2VOCA 1NSWA 1Z5YE 1X0RA 4TKYA 3IAM2 4I5QA 1XIYA 2DBCA 1ERUA 3NZNA 1DSBA 2K8VA 3F6DA 4Q5QA 3EINA 2YANA 2YCDA 3IXRA 3F4SA 1AW9A 2X99A 3ZITA 3M9JA 3BCKA 2XPDA 2A4VA 3IHGA 4PGTA 4TN8A 1XWKA 4MP4A 4ZB8A 4ICYA 5IPGA 4GSTA 1Y25A 4XS1A 2WGRA 4POLA 3UEMA 5IMCA 5HR1A 2FWEA 2F51A 1AQXA 1M9AA 3VPQA 4NHZA 4K2DA 3QAVA 2B1LA 4TR3A 1M2BA 1NM3A 3RPPA 3K8NA 1AUCA 1ERTA 4GQCA 4YQUA 4J57E 2H8LA 9GSSA 2CQ9A 2H76A 1U88A 1SVOA 3O3TA 1THXA 2DMMA 3GIXA 1LBKA 3PGTA 4K0GA 2YP6A 2GQLA 4K8MA 3TKSC 4PUAA 3I6AA 1T3BA 2OA7A 3IAS2 4OO4A 5ECMB 2LRNA 2WCIA 4BWQA 5CRGA 4LMVA 1SL0B 4JU5A 5CAXA 1EEJA 3Q74A 1GSSA 1O85A 4EVMA 4K9ZA 1B9XC 1VF4A 2YWIA 3W8SA 1EGOA 1FB0A 2O8VB 3FZ9A 4POBA 1BF5A 1I5GA 4O5QA 2HZEA 3ZVJA 4DSRA 2FY6A 3W8JA 3ZMKA 2ALBA 4F0BA 4X0XA 1XVWA 4G01A 3VI5A 3ZL5A 1HYUA 2GSTA 2H1LA 2JSZA 3EWLA 4K5SA 1RK4A 3N9JA 2FA4A 1SD9A 4OMVA 1A0FA 1W89A 2WJUA 2K9FA 4E8EA 4AJ7A 1OC9A 1YVLA 1S3AA 2CV4A 3LORA 4TR1B 2DJ0A 3WGEA 5B6MA 4V2LA 2HSYA 4KSMA 1KBNA 5GAPD 3ME7A 3DXBA 4RQRA 2LQQA 3HD5A 4EF0A 2QA1A 4NMUA 19GSA 4XRDA 2FGXA 3GSTA 2HSNB 5IMFA 3C8EA 4V1Ap 2CVKA 2F8FA 2IFQB 3Q19A 10GSA 5ECOB 5ECPB 1O81A 3VWVA 3FZ4A 4XHMA 2E2MA 4XCSA 1IYIA 1OC3A 1V58A 4YKGA 1B4PA 4IKHA 4BVXB 1FVKA 4TVEA 1J08A 4GDFA 2MZCA 4CW9A 1YZXA 3L9VA 5ECIB 2XC2A 1U6TA 4K0NA 1BEDA 1MDKA 5J4YA 1TI3A 2RUFA 1PQNA 4PUFC 3DGQA 4NWYA 2VCQA 3MDKA 1MDIA 4WF4A 2CVBA 5H5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9H A;  5CYY A;  1F6M C;  2VL3 A;  2RM5 A;  2M80 A;  3EVI A;  3ZIV A;  2WDU A;  5ECQ B;  3LGC A;  1LJR A;  3HCZ A;  1ACV A;  3DEX A;  3KH9 A;  1TTZ A;  2V6K A;  1SJZ A;  2IL3 A;  1QUW A;  3VWX A;  3SBC A;  5F06 A;  2YJ7 A;  5CRE A;  2H66 A;  1TK5 B;  2JU5 A;  1U87 A;  5D9X A;  3RPN A;  5E4W A;  2C0E A;  1SKW B;  4ACS A;  1TU8 A;  2AYT A;  3ED3 A;  3PIN A;  1E2Y A;  3S9F A;  1XW5 A;  5E59 A;  4G2E A;  4ML6 A;  4JED A;  1XWB A;  3GKK A;  4TR4 A;  3KM6 A;  3VFI A;  2VCX A;  4WR5 A;  4RUV A;  3FZ5 A;  2X8G A;  1TDI A;  1NW2 A;  5IMA A;  4EXJ A;  4PX1 A;  5AGY A;  2CT6 A;  1JZR A;  2R6K A;  4HEA 2;  4WF5 A;  3MWH A;  4ZBD A;  4EE0 A;  3F9U A;  1G7E A;  5DAK B;  1TKD B;  5HR0 A;  2H01 A;  2PMT A;  1XWC A;  1K0O A;  4FH8 A;  5J4U A;  2C8U A;  3NIV A;  4MAB A;  2WFC A;  5IIZ A;  2LJK A;  4F9Z A;  3TKP A;  2N5B A;  3HZ4 A;  3I43 A;  3IDV A;  2VLT A;  5D8I A;  11GS A;  1FO5 A;  4HU7 A;  3WD6 A;  1TXX A;  3EC3 A;  3BD2 A;  1JLW A;  3NOF A;  2GZY A;  2RII A;  4BL7 B;  5C00 A;  2IJY A;  3IRA A;  1BYE A;  5IMZ A;  3P90 A;  4IQA A;  4MZC A;  4MJB A;  2G0F A;  3TRX A;  3D5J A;  4TR0 A;  3EE2 A;  2RLI A;  4YAV A;  5HFI A;  4Q5F A;  5IQY A;  1O8W A;  3GL5 A;  6GSY A;  3M8N A;  5DDL A;  3BJ5 A;  2HT9 A;  2ON7 A;  2L5O A;  4ECI A;  2H70 A;  2V6O A;  2VUP A;  1G0T A;  4KW6 A;  4ZB6 A;  3IK7 A;  1B48 A;  1TJD A;  4DSQ A;  1TK8 B;  3ZTL A;  1N8J A;  2VLV A;  4GSN A;  4XTS A;  2OE3 A;  5KN3 A;  2GTU A;  1NHO A;  2AB6 A;  4L0U A;  3FEU A;  1K0C A;  4KX4 A;  6GSV A;  5H5S A;  2HSH A;  4G0K A;  4NV5 A;  4G0L A;  4G0I A;  1OKD A;  5CRH A;  1ZZY A;  5CNW A;  4RI7 A;  1XZO A;  2CVD A;  1SYR A;  1WWJ A;  3EUR A;  2L4C A;  3GTU A;  2IME A;  2YZU A;  3KTB A;  4WXT A;  4EUY A;  2VIM A;  3ZIJ A;  2VD0 A;  4POK A;  5HR2 A;  2H19 A;  4XS4 A;  1A2J A;  1X5D A;  3HJP A;  3FZA A;  1GNE A;  3TGZ A;  1KEB A;  3IBH A;  1VF1 A;  2GSQ A;  3M3M A;  2NPB A;  4I8B A;  2CA8 A;  3LYK A;  3ZML A;  1GP1 A;  3CRT A;  4Q5N A;  3TDG A;  2TRX A;  2KP1 A;  4BVY A;  2DJJ A;  2LJR A;  1FAA A;  3GL3 A;  2L6D A;  4FYB A;  3P2A A;  3VLN A;  3FY7 A;  2F3M A;  3EMP A;  4KA0 A;  1YF1 A;  1GTI A;  1YKA A;  1ZOF A;  3UMA A;  3BOA A;  2H71 A;  2I4A A;  2JZS A;  2PN8 A;  3TB2 A;  3WGX A;  3FRC A;  4HQS A;  2YWO A;  5G30 A;  1KNG A;  2HFD A;  5ID2 A;  1XOB A;  1ABA A;  2FD3 A;  2TRC P;  1GH2 A;  3WYW A;  3G7Y A;  1GSY A;  3LG6 A;  4IN0 A;  4ZBA A;  4KCE A;  3FR6 A;  1MD4 A;  4NV2 A;  4AJ6 A;  2GZZ A;  4WBJ A;  5ECR B;  1AXD A;  4KDY A;  3HVX A;  2C0G A;  2H1G A;  2L59 A;  1PX6 A;  1PKZ A;  3DRN A;  1EEM A;  1PKW A;  5DQS A;  3F4T A;  2MYG A;  1X9M B;  2HRK B;  4ECC A;  2H6Y A;  2IWT A;  2UZ8 A;  1XFL A;  1ERV A;  2HE3 A;  4TXO A;  1X9W B;  1GUL A;  8GSS A;  1SL1 B;  3UBL A;  2KP2 A;  2VCV A;  3IK9 A;  4MZW A;  1PL1 A;  2C3N A;  2VL9 A;  5HR3 A;  3FR3 A;  3GA4 A;  5CRD A;  2GDR A;  5DQY A;  1GTB A;  4EDY A;  2YJH A;  5IOX A;  2HXK A;  2AJQ B;  2B7J A;  5L71 A;  4OD7 A;  3HVV A;  3SWL A;  3TKS A;  3F3R A;  4HQZ A;  3L9U A;  4EC0 A;  1M99 A;  3QMX A;  3H93 A;  2O89 A;  1Z9H A;  22GS A;  1WOU A;  1R7H A;  3HXS A;  4JRR A;  3GYK A;  4WEY A;  1V2A A;  3LXZ A;  4K6X A;  1SK0 A;  3ZLP A;  3BCI A;  1GTU A;  1MD3 A;  1OE7 A;  4O5R A;  3C73 A;  1MTC A;  3WGD A;  3D4T A;  3DML A;  2LV3 A;  1FB6 A;  2KUC A;  2VLU A;  2O87 A;  1PRX A;  4TRX A;  4MMM A;  4ZL7 A;  3AY8 A;  3FK8 A;  4EO3 A;  5DAL A;  3D21 A;  5IPH A;  1A2M A;  4BA7 A;  1HNB A;  2AAW A;  1XWA A;  4ZIL A;  3KCM A;  3TJF A;  1FG4 A;  2F8A A;  1C72 A;  1QQ2 A;  3A5W A;  4FIW A;  3L9S A;  2LRT A;  1O8X A;  4HZ2 A;  1GUH A;  4PXO A;  4YQM A;  2LS5 A;  2H75 A;  3CSI A;  4DSS B;  1UN2 A;  4QL7 A;  3ERF A;  3QAW A;  4V1A g;  4D73 A;  1XW6 A;  2C1Y A;  1TOF A;  4YH2 A;  1SK2 A;  5JCG A;  3IC4 A;  5AIV A;  5D9V A;  4MZB A;  3APS A;  4KCA A;  3G7I A;  4IP6 A;  2DIZ A;  3GFK A;  4YAP A;  5GZZ B;  1JHB A;  1TP9 A;  2FWF A;  4KB3 A;  5AIS A;  4KH7 A;  2GS3 A;  2HRN A;  3D6I A;  5F0G A;  5HQP A;  16GS A;  2H1D A;  5G2Z A;  3HJM A;  1F3A A;  2WUL A;  1RW1 A;  3UBK A;  4PQ1 A;  5A4V A;  1GNW A;  4HZ4 A;  1PX7 A;  3HKR A;  4IGJ A;  3UVH A;  5LNK e;  3U5R E;  4HUA A;  3CTG A;  1GLQ A;  3ISO A;  2EIO A;  4HS1 A;  5ECL B;  1SL2 B;  3ZRD A;  2AUV A;  2R37 A;  4JR4 A;  2E7P A;  1TRU A;  5C04 A;  1B8X A;  3DD3 A;  5FT3 A;  2CX4 A;  3WT1 A;  3ZFB A;  4G19 A;  1O7U A;  4GCI A;  2HLS A;  4Q5R A;  3PPU A;  1TRV A;  4EKZ A;  3OR5 A;  2KHP A;  1VGL A;  2O7K A;  3O6T A;  1E6B A;  1DE1 A;  2GSS A;  2BTO T;  3HYP A;  3L78 A;  4HDE A;  1T00 A;  4ZL9 A;  2LNT A;  3ZYW A;  1CQG A;  5GSS A;  4PQH A;  3TUE A;  1JZO A;  3D4M A;  2IMI A;  1Z7R A;  5D9T A;  2CX3 A;  1ZYE A;  3GH9 A;  2K8S A;  2YWM A;  4RI6 A;  3F0I A;  5ECS A;  4MDC A;  2JAD A;  5ABR A;  2NVL A;  4ULX A;  3F8U A;  1N2A A;  2GSR A;  2IN3 A;  3WT2 A;  4PNF A;  1F2E A;  5IMD A;  1XVQ A;  2DJ1 A;  3KD0 A;  3HJO A;  3H79 A;  4JR6 A;  3CYN A;  2AV4 A;  4OFT A;  3IC8 A;  17GS A;  4USS A;  2C3Q A;  1GUK A;  4ML1 A;  3GUS A;  2FCH A;  1V57 A;  3GKX A;  3UL3 A;  1CQH A;  5JWQ B;  4LLR A;  5DCH A;  1K0A A;  1YEX A;  4DVC A;  1GUM A;  3RAZ A;  1R4W A;  1T4Z A;  4OWY A;  2C0F A;  2MMO A;  4XRA A;  4GLT A;  2DML A;  2HSM A;  1VF3 A;  2IMD A;  3QR6 A;  4QL9 A;  4LL1 B;  4GF0 A;  4KUN A;  3APO A;  1PA3 A;  2NTO A;  2WS2 A;  2OKA A;  3KMN A;  3LFL A;  2H1A A;  2KLX A;  3TKR A;  2CAQ A;  2VAF A;  3M9K A;  1QGV A;  5A4U A;  4WBR D;  2FHE A;  1EWX A;  1MEK A;  1URM A;  5LD0 A;  1JZD A;  3GX8 A;  3MSZ A;  2R4V A;  4KF9 A;  5ECK B;  3FHK A;  1SD8 A;  1M2D A;  4AJ8 A;  4WR4 A;  5ELA A;  1GWC A;  1M7T A;  2CAI A;  2DJK A;  5A5K A;  3LJR A;  2QGV A;  5IMV A;  4ZXG A;  2HZE B;  1WPI A;  3DKS A;  2YN1 A;  5JCU A;  2IIY A;  1SYX A;  3TKQ A;  3L0H A;  1R5P A;  4K7N A;  2M46 A;  2ZUP A;  1F9M A;  1YF0 A;  4NAX A;  1R5A A;  1QXH A;  2XBQ A;  2PBJ A;  1TRS A;  4O7H A;  2GZP A;  3CSJ A;  2P31 A;  4CDO A;  2GGT A;  3G7J A;  3IOS A;  3F63 A;  4IJI A;  2HQT A;  4MF7 A;  3CRU A;  3VWW A;  3QDN A;  1GSD A;  1YY7 A;  3KP8 A;  4ISD A;  2CZ3 A;  4N0V A;  1HD2 A;  5DBQ A;  1MDJ A;  1OC9 B;  1M9B A;  1A8Y A;  4I2U A;  5GAN D;  1PSQ A;  4G10 A;  4KGI A;  2C3T A;  3H4K A;  4L0W A;  4K7I A;  2GT5 A;  5J9C A;  2LST A;  3M1G A;  3IA1 A;  3TKS E;  2H0G A;  1DUG A;  5B8A A;  4MPF A;  2DJ2 A;  3GV1 A;  1TRW A;  3DVW A;  2V32 A;  3RHB A;  4N30 A;  1FOV A;  1A8L A;  2FNO A;  5G5E A;  4ZL8 A;  2LNS A;  3DWV A;  4L5O A;  1Z6N A;  1FW1 A;  2P0G A;  14GS A;  5IO0 A;  4CHS A;  2YV9 A;  2YV7 A;  4F0C A;  3A2W A;  1X5E A;  2FA8 A;  2G2Q A;  2GQK A;  2YZH A;  3UIW A;  4N0Z A;  2DSA A;  2X64 A;  4GTU A;  2CZ2 A;  2EC4 A;  4PTS A;  5INY A;  1GSE A;  3QFA C;  3BBY A;  3H8Q A;  4KAE A;  3HVS A;  1TW9 A;  1K3L A;  5LCZ A;  2JZT A;  3TRP A;  2R3X A;  1TU7 A;  3QAG A;  5FHI A;  4F2I A;  1Z7P A;  1K0N A;  1V40 A;  2HNL A;  1G6W A;  3GX0 A;  2R2J A;  1PD2 1;  4G9H A;  1OYJ A;  1TK0 B;  2D2Z A;  3VI7 A;  3ZVJ D;  1TI1 A;  5J9B A;  5COH A;  2ES7 A;  2I1U A;  3EU4 A;  5KN0 A;  1A0R P;  3KMO A;  5KN2 A;  1BJX A;  3TJK A;  3KP9 A;  2FWH A;  1SKS B;  4IHU A;  4TR1 A;  2B7K A;  4F03 A;  2VCT A;  2LKU A;  3RHC A;  5EVO A;  2F9S A;  3Q6O A;  5ELG A;  2MMZ A;  5CO3 A;  4I6X A;  5J3R A;  3I69 A;  5EY6 A;  1AQV A;  4KND A;  4J56 E;  2V2G A;  3N5O A;  1FVJ A;  1AAZ A;  1JLV A;  3ZZX A;  5FWG A;  2JL4 A;  2IFQ A;  2PU9 C;  3HY2 A;  4GSS A;  1PGT A;  1T8E B;  3GKM A;  1HQO A;  2PPT A;  2H74 A;  4IP1 A;  3TOU A;  2GQM A;  2C4J A;  3C1R A;  1EP8 A;  5D73 A;  4KDU A;  4XIH A;  5JWR B;  1UC7 A;  3R3E A;  5F8B A;  1YJ6 A;  2JSY A;  1AIU A;  2PVQ A;  3TJB A;  3CMI A;  4PQI A;  2L6C A;  1K0B A;  3TJJ A;  1XCC A;  1SJ6 A;  6GSS A;  1PMT A;  5H5Q A;  3TJG A;  2L5L A;  5ENU A;  1JFU A;  1S3D A;  2YPM A;  1A2L A;  2E2G A;  3GUR A;  2MBS A;  2VL2 C;  5KEJ A;  1PN9 A;  4JZQ A;  2C0D A;  4GRF A;  2K6V A;  3QFB C;  4P3Y B;  3IV4 A;  4L8E A;  1NHY A;  2OBK A;  4JE1 A;  3J7Y b;  3KZQ A;  2IPA A;  4HI7 A;  2YWN A;  4IBP A;  2K18 A;  2NDO A;  4WET A;  3KGK A;  1EV9 A;  2H73 A;  2HYX A;  3LSZ A;  3C7M A;  3LQ7 A;  3G9B A;  3KEB A;  2FUG 2;  4QQ7 A;  1G6Y A;  3IHQ A;  2OAD A;  3US3 A;  1H4O A;  3KH7 A;  2YNX A;  1GL8 A;  2FWG A;  3ERG A;  4KDX A;  2B5E A;  1K3Y A;  1WP0 A;  2PER A;  4NXI A;  1HNC A;  3P7X A;  1BG5 A;  1VF2 A;  1K3O A;  1EOG A;  1USB A;  1WRY A;  3PH9 A;  4J2F A;  2X8C A;  5DVB A;  1YEP A;  1W4V A;  2HRA A;  2V41 A;  1YQ1 A;  2R5G A;  3UJ1 A;  5DJL A;  1XPV A;  5DAK A;  3EU3 A;  4LMW A;  5ECN B;  1THO A;  4AGS A;  2QKE A;  3HHV A;  3APQ A;  1BAY A;  3GTU B;  2P5R A;  4NPB A;  2H72 A;  2DC5 A;  5AIX A;  2OAC A;  18GS A;  5HFK A;  2VCW A;  1AC1 A;  2B5Y A;  4XS4 B;  3KTL A;  4MF5 A;  2QC7 A;  4OO5 A;  4MLY A;  3PR8 A;  4EL1 A;  2MBT A;  1X9S B;  3FR9 A;  6GST A;  5F07 A;  2LQO A;  2EIQ A;  5J5N A;  1EGR A;  4NHW A;  2EIR A;  4BL7 A;  2Z9S A;  4BVY B;  3J7Y k;  5B7C A;  4H86 A;  4OCF A;  3VK9 A;  3ERW A;  5D93 A;  3D0Z A;  2OE0 A;  4KSO A;  1A23 A;  2XBI A;  4ID0 A;  5JWO B;  3FW2 A;  2LUS A;  1F3B A;  2GT6 A;  1EZK A;  2WRT A;  4TOP A;  2NBS A;  3F3Q A;  1EV4 A;  1WE0 A;  4GWR A;  4TXV A;  2E0Q A;  3DYR A;  3LEF A;  2LJA A;  3A2V A;  1ZGN A;  2J23 A;  1GSF A;  5ID2 B;  3R2Q A;  1EP7 A;  1UA5 A;  5F05 A;  1I9D A;  4MF6 A;  2HRF A;  2RUE A;  1SJI A;  2ZCT A;  1F37 A;  1B9Y C;  4IS0 A;  4OFN A;  5G1K A;  1Y6E A;  3GNJ A;  4HJM A;  5EPF A;  2AHE A;  2BJX A;  2IMF A;  3ME8 A;  3GRX A;  5D9W A;  5D96 A;  4RQX A;  3UAR A;  2X8H A;  2GVP A;  6GSW A;  3QD9 A;  4ZIJ A;  3LXT A;  3CXG A;  3HDC A;  3C1S A;  3DVX A;  13GS A;  4MJC A;  4MH3 A;  7GSS A;  3KXO A;  4TXO B;  1OAZ A;  5IOW A;  3UOM A;  2VCZ A;  4HOJ A;  1ZCP A;  4N10 A;  1T4Y A;  3W6G A;  2HZF A;  4MJA A;  1OVN A;  3GMF A;  1YKC A;  1ML6 A;  3CSH A;  4LA1 A;  3Q18 A;  4MK3 A;  1XXU A;  2XPE A;  5AN1 A;  2QSI A;  3D22 A;  3GH6 A;  1BQ7 A;  4OCE A;  1V98 A;  1Q98 A;  4GXZ A;  3QPM A;  5IM9 A;  2LEG A;  5ECH B;  4K1F A;  2HI7 A;  2MMA A;  2DIY A;  1XW9 A;  5CRW A;  1QK8 A;  4O32 A;  5JCW A;  1IYH A;  3U6V A;  4HU9 A;  1RQM A;  5G5F A;  2N5F A;  3GKN A;  3RBT A;  5B8B A;  3CTF A;  4JBB A;  2VO4 A;  2A2R A;  5DCG A;  3MNG A;  3JCM L;  3FKF A;  2IMK A;  4ZBB A;  4LL4 B;  2BMX A;  2RM6 A;  3E3E A;  5DAL B;  1WIK A;  1GLP A;  2H6X A;  4KE3 A;  3VWU A;  1J9B A;  4TW5 A;  3TRQ A;  2OBI A;  2OJL A;  1HNA A;  3EYT A;  1ZYQ B;  2H6Z A;  4O92 A;  2HRK A;  2I9H A;  4EDZ A;  1H75 A;  2M72 A;  2PGT A;  1M0U A;  2O85 A;  4WKW A;  1SKR B;  2LTK A;  20GS A;  4I2T A;  3CBU A;  1JZW A;  4MCU A;  4XS6 A;  3F6F A;  1PL2 A;  4D73 B;  2PUK C;  1Z3E A;  6GSU A;  4MH2 A;  1J0F A;  2GLR A;  2B6M A;  3GHA A;  4ZB9 A;  4ECJ A;  3TOT A;  1OKT A;  1T7P B;  2ZNM A;  4BPY A;  6GSX A;  4Z7X A;  1A24 A;  3P8W A;  1ST9 A;  1K0D A;  2I3Y A;  1GTA A;  4N11 A;  3O76 A;  3ZRE A;  1OC8 A;  4I97 A;  1AQW A;  3A2X A;  3QCP A;  4E8H A;  2H0I A;  3ZFL A;  4FYC A;  1SEN A;  4X1U A;  4MJE A;  3IPZ A;  12GS A;  1VRS D;  5HFG A;  1XBS A;  3M0F A;  3VUR A;  3HZ8 A;  2DLX A;  1GSQ A;  3E0U A;  1G7O A;  1U3A A;  5DJM A;  4MPG A;  5J41 A;  2WB9 A;  3TCO A;  3MAK A;  1QMV A;  4OFM A;  4AF2 A;  4IQ1 A;  2L4Q A;  1ZL9 A;  1LU4 A;  2FLS A;  2I81 A;  3RDW A;  1K0M A;  1UVZ A;  2JAC A;  4ECB A;  1ERW A;  1EOH A;  3GN3 A;  3I9V 2;  4POM A;  4ILF A;  2DJ3 A;  2OE1 A;  2REM A;  4PUR A;  2N5A A;  1KTE A;  1XWG A;  2MMN A;  4F82 A;  2KOK A;  3UAP A;  4K7O A;  3A3T A;  4IW9 A;  3IR4 A;  2ON5 A;  3FYG A;  2V1M A;  4IEL A;  2B1K A;  4IJ3 A;  2B5X A;  2XHF A;  3LYP A;  5GST A;  4DSS A;  2P5Q A;  5B6N A;  4YQV A;  3VPT A;  5KN1 A;  2JZR A;  4MA9 A;  5BMU A;  3KJY A;  2WZ9 A;  1FHE A;  3IE3 A;  1QFN A;  1WMJ A;  1Z6M A;  3L4N A;  2PWJ A;  4FYU A;  1YDK A;  4GQF A;  4FO5 A;  1T1V A;  4X43 A;  1SK1 A;  3QOU A;  2TIR A;  2B3S A;  1U3I A;  1DBY A;  1R26 A;  2H1B A;  5EL8 A;  1SU9 A;  4V2N A;  3HA9 A;  1GSU A;  4DEJ A;  5A4W A;  4HJ2 A;  2H0H A;  5G31 A;  3E9J B;  1M2A A;  3F4R A;  4L5L A;  5CP1 A;  5IO2 A;  1XOA A;  1O6J A;  2VM2 A;  1ON4 A;  2HSM B;  1OE8 A;  3LWA A;  2H30 A;  2YOI A;  5G1L A;  4BWS A;  1Q4J A;  1B4Q A;  1V9W A;  1X5C A;  3DIE A;  3EMX A;  4V2M A;  2C80 A;  3C71 A;  2L57 A;  3V1W A;  2LRC A;  1ZMA A;  4BVX A;  1WJK A;  3GSS A;  4FQU A;  1BX9 A;  2A2S A;  1DE2 A;  1GRX A;  4PNG A;  3KIJ A;  3H1N A;  2VD1 A;  2VL2 A;  4IVF A;  1ILO A;  3UVT A;  2VM1 A;  1O73 A;  1S3C A;  2PVO C;  2VOC A;  1NSW A;  1Z5Y E;  1X0R A;  4TKY A;  3IAM 2;  4I5Q A;  1XIY A;  2DBC A;  1ERU A;  3NZN A;  1DSB A;  2K8V A;  3F6D A;  4Q5Q A;  3EIN A;  2YAN A;  2YCD A;  3IXR A;  3F4S A;  1AW9 A;  2X99 A;  3ZIT A;  3M9J A;  3BCK A;  2XPD A;  2A4V A;  4PGT A;  4TN8 A;  1XWK A;  4MP4 A;  4ZB8 A;  5IPG A;  4GST A;  1Y25 A;  4XS1 A;  2WGR A;  4POL A;  3UEM A;  5IMC A;  5HR1 A;  2FWE A;  2F51 A;  1AQX A;  1M9A A;  3VPQ A;  4NHZ A;  4K2D A;  3QAV A;  2B1L A;  4TR3 A;  1M2B A;  1NM3 A;  3RPP A;  3K8N A;  1AUC A;  1ERT A;  4GQC A;  4YQU A;  4J57 E;  2H8L A;  9GSS A;  2CQ9 A;  2H76 A;  1U88 A;  3O3T A;  1THX A;  2DMM A;  3GIX A;  1LBK A;  3PGT A;  4K0G A;  2YP6 A;  2GQL A;  4K8M A;  3TKS C;  4PUA A;  3I6A A;  1T3B A;  2OA7 A;  3IAS 2;  4OO4 A;  5ECM B;  2LRN A;  2WCI A;  4BWQ A;  5CRG A;  4LMV A;  1SL0 B;  4JU5 A;  5CAX A;  1EEJ A;  3Q74 A;  1GSS A;  1O85 A;  4EVM A;  4K9Z A;  1B9X C;  1VF4 A;  2YWI A;  3W8S A;  1EGO A;  1FB0 A;  2O8V B;  3FZ9 A;  4POB A;  1I5G A;  2HZE A;  3ZVJ A;  4DSR A;  2FY6 A;  3W8J A;  3ZMK A;  2ALB A;  4F0B A;  4X0X A;  1XVW A;  3VI5 A;  3ZL5 A;  1HYU A;  2GST A;  2JSZ A;  3EWL A;  1RK4 A;  3N9J A;  2FA4 A;  1SD9 A;  4OMV A;  1A0F A;  1W89 A;  2WJU A;  2K9F A;  4E8E A;  4AJ7 A;  1OC9 A;  1S3A A;  2CV4 A;  3LOR A;  4TR1 B;  2DJ0 A;  3WGE A;  5B6M A;  4V2L A;  2HSY A;  4KSM A;  1KBN A;  5GAP D;  3ME7 A;  3DXB A;  4RQR A;  2LQQ A;  3HD5 A;  4EF0 A;  4NMU A;  19GS A;  4XRD A;  2FGX A;  3GST A;  2HSN B;  5IMF A;  3C8E A;  4V1A p;  2CVK A;  2F8F A;  2IFQ B;  3Q19 A;  10GS A;  5ECO B;  5ECP B;  1O81 A;  3VWV A;  3FZ4 A;  4XHM A;  2E2M A;  4XCS A;  1IYI A;  1OC3 A;  1V58 A;  1B4P A;  4IKH A;  4BVX B;  1FVK A;  4TVE A;  1J08 A;  2MZC A;  4CW9 A;  1YZX A;  3L9V A;  5ECI B;  2XC2 A;  1U6T A;  4K0N A;  1BED A;  1MDK A;  1TI3 A;  2RUF A;  1PQN A;  4PUF C;  3DGQ A;  4NWY A;  2VCQ A;  3MDK A;  1MDI A;  4WF4 A;  2CVB A;  5H5R A; 
#chains in the Genus database with same CATH topology
 2J9H A;  4O5U A;  5CYY A;  1F6M C;  2VL3 A;  2RM5 A;  2M80 A;  3EVI A;  3ZIV A;  2WDU A;  5ECQ B;  3LGC A;  1LJR A;  3HCZ A;  1ACV A;  3DEX A;  3KH9 A;  1TTZ A;  2V6K A;  1SJZ A;  2IL3 A;  1QUW A;  3VWX A;  3SBC A;  5F06 A;  2YJ7 A;  5CRE A;  2H66 A;  1TK5 B;  2JU5 A;  1U87 A;  5D9X A;  3RPN A;  5E4W A;  2C0E A;  1SKW B;  4ACS A;  1TU8 A;  2AYT A;  3ED3 A;  3PIN A;  1E2Y A;  3S9F A;  1XW5 A;  5E59 A;  4G2E A;  4ML6 A;  4JED A;  1XWB A;  3GKK A;  4TR4 A;  3KM6 A;  3VFI A;  2VCX A;  4WR5 A;  4RUV A;  3FZ5 A;  4AKG A;  2X8G A;  1TDI A;  1NW2 A;  5IMA A;  4EXJ A;  4PX1 A;  5AGY A;  2CT6 A;  1XG8 A;  1JZR A;  2R6K A;  4AKI A;  4E68 A;  4HEA 2;  4WF5 A;  3MWH A;  4ZBD A;  4EE0 A;  3F9U A;  1G7E A;  5DAK B;  1TKD B;  5HR0 A;  2H01 A;  2PMT A;  1XWC A;  1K0O A;  4FH8 A;  5J4U A;  2C8U A;  3NIV A;  4MAB A;  3HVN A;  2VKZ G;  2WFC A;  5IIZ A;  2LJK A;  4F9Z A;  2EFC A;  3TKP A;  2N5B A;  3HZ4 A;  3I43 A;  3IDV A;  2VLT A;  5D8I A;  5A5H B;  11GS A;  2WVX B;  1FO5 A;  4HU7 A;  3WD6 A;  1TXX A;  3EC3 A;  3BD2 A;  1JLW A;  3NOF A;  2GZY A;  2RII A;  4BL7 B;  5C00 A;  2IJY A;  3IRA A;  1BYE A;  5IMZ A;  3P90 A;  4IQA A;  4MZC A;  4MJB A;  2EFH A;  2G0F A;  3TRX A;  2R0C A;  3D5J A;  4TR0 A;  3EE2 A;  2RLI A;  3CWG A;  1BG1 A;  4YAV A;  5HFI A;  1ZYP A;  4Q5F A;  5IQY A;  1O8W A;  3GL5 A;  6GSY A;  2WW0 A;  3M8N A;  5DDL A;  3BJ5 A;  2HT9 A;  2ON7 A;  2L5O A;  4ECI A;  2H70 A;  2V6O A;  2VUP A;  1G0T A;  4KW6 A;  4ZB6 A;  3IK7 A;  1B48 A;  1TJD A;  4DSQ A;  1TK8 B;  3ZTL A;  1N8J A;  2VLV A;  4GSN A;  4XTS A;  2OE3 A;  5KN3 A;  4PI2 C;  2GTU A;  1NHO A;  2AB6 A;  4L0U A;  3FEU A;  1K0C A;  4KX4 A;  6GSV A;  5H5S A;  2HSH A;  4G0K A;  4NV5 A;  4G0L A;  4G0I A;  1OKD A;  5CRH A;  1ZZY A;  5CNW A;  4RI7 A;  1XZO A;  2CVD A;  1SYR A;  1WWJ A;  3EUR A;  2L4C A;  3GTU A;  2IME A;  2YZU A;  3KTB A;  4WXT A;  4EUY A;  2VIM A;  3ZIJ A;  2VD0 A;  4POK A;  5HR2 A;  1I1I P;  2H19 A;  4XS4 A;  1A2J A;  1X5D A;  3HJP A;  3FZA A;  1GNE A;  3TGZ A;  1KEB A;  3IBH A;  1VF1 A;  2GSQ A;  3M3M A;  2NPB A;  4I8B A;  2CA8 A;  2WVY A;  3LYK A;  3ZML A;  1GP1 A;  3CRT A;  4Q5N A;  3TDG A;  2TRX A;  2KP1 A;  4BVY A;  2DJJ A;  2LJR A;  1FAA A;  3GL3 A;  1M3I A;  2L6D A;  4FYB A;  3P2A A;  4X4J A;  3VLN A;  3FY7 A;  2F3M A;  3EMP A;  4KA0 A;  1YF1 A;  1GTI A;  1YKA A;  1ZOF A;  3UMA A;  3BOA A;  2H71 A;  2I4A A;  2JZS A;  2PN8 A;  3TB2 A;  3WGX A;  3FRC A;  4HQS A;  2YWO A;  5G30 A;  1KNG A;  2HFD A;  5ID2 A;  1XOB A;  1SVL A;  1ABA A;  2FD3 A;  2TRC P;  1GH2 A;  2R0P A;  3WYW A;  3G7Y A;  1GSY A;  3LG6 A;  4IN0 A;  4ZBA A;  1S4B P;  4KCE A;  3FR6 A;  1MD4 A;  4NV2 A;  4AJ6 A;  2GZZ A;  4WBJ A;  5ECR B;  1AXD A;  4KDY A;  3HVX A;  2C0G A;  2H1G A;  2L59 A;  1PX6 A;  5A34 A;  1PKZ A;  3DRN A;  1EEM A;  1PKW A;  5DQS A;  3F4T A;  2MYG A;  1X9M B;  2HRK B;  4ECC A;  2H6Y A;  2IWT A;  2UZ8 A;  1XFL A;  1ERV A;  2HE3 A;  4TXO A;  1X9W B;  1GUL A;  8GSS A;  1SL1 B;  3UBL A;  2KP2 A;  2VCV A;  3IK9 A;  4MZW A;  1PL1 A;  2C3N A;  2VL9 A;  2R0G A;  5HR3 A;  3FR3 A;  4AKH A;  3GA4 A;  5CRD A;  2GDR A;  5DQY A;  1GTB A;  4EDY A;  2YJH A;  5IOX A;  2HXK A;  2AJQ B;  2B7J A;  5L71 A;  4OD7 A;  3HVV A;  3SWL A;  3TKS A;  3F3R A;  4HQZ A;  3L9U A;  4EC0 A;  1M99 A;  3QMX A;  3H93 A;  2O89 A;  1Z9H A;  22GS A;  1WOU A;  1R7H A;  3HXS A;  4JRR A;  3GYK A;  4WEY A;  1V2A A;  3LXZ A;  4K6X A;  1SK0 A;  3ZLP A;  3BCI A;  1GTU A;  1MD3 A;  1OE7 A;  4O5R A;  3C73 A;  1MTC A;  3WGD A;  3D4T A;  3DML A;  2LV3 A;  1FB6 A;  2KUC A;  2VLU A;  2O87 A;  1PRX A;  4TRX A;  4MMM A;  4ZL7 A;  3AY8 A;  3FK8 A;  4EO3 A;  5DAL A;  3D21 A;  5IPH A;  1A2M A;  5J4V A;  4BA7 A;  5KOX A;  1HNB A;  2AAW A;  1XWA A;  2UV8 G;  4ZIL A;  3KCM A;  1ZYN A;  3TJF A;  1FG4 A;  2F8A A;  4EIP A;  1C72 A;  1QQ2 A;  3A5W A;  4AI6 A;  4FIW A;  3L9S A;  2LRT A;  1O8X A;  4HZ2 A;  1GUH A;  4PXO A;  4YQM A;  2LS5 A;  2H75 A;  3CSI A;  4DSS B;  1UN2 A;  4QL7 A;  3ERF A;  2DKH A;  3QAW A;  4FXY P;  4V1A g;  4D73 A;  1XW6 A;  5BMU B;  2C1Y A;  1TOF A;  4YH2 A;  1SK2 A;  5A1N A;  5KOW A;  5JCG A;  3IC4 A;  5AIV A;  5D9V A;  4MZB A;  3A5I A;  3APS A;  3FMW A;  4KCA A;  3G7I A;  4IP6 A;  2DIZ A;  3GFK A;  4YAP A;  5GZZ B;  1JHB A;  1TP9 A;  2FWF A;  4KB3 A;  5AIS A;  4KH7 A;  2GS3 A;  2HRN A;  3D6I A;  5F0G A;  5HQP A;  16GS A;  2H1D A;  5G2Z A;  3HJM A;  3MIX A;  1F3A A;  2WUL A;  4K2X A;  1RW1 A;  3UBK A;  4PQ1 A;  5A4V A;  1GNW A;  4HZ4 A;  4W66 A;  1PX7 A;  3HKR A;  4IGJ A;  3UVH A;  4A5P A;  5LNK e;  3U5R E;  4HUA A;  3CTG A;  1GLQ A;  3ISO A;  2EIO A;  4HS1 A;  5ECL B;  1SL2 B;  2A4H A;  3ZRD A;  2AUV A;  2R37 A;  4JR4 A;  2E7P A;  1TRU A;  5C04 A;  1B8X A;  3DD3 A;  5FT3 A;  2CX4 A;  3WT1 A;  3MYD A;  3ZFB A;  4G19 A;  1O7U A;  4GCI A;  3RGB C;  2HLS A;  4Q5R A;  3PPU A;  4Z2T A;  1TRV A;  4EKZ A;  3OR5 A;  2KHP A;  1VGL A;  2EFE A;  2O7K A;  3O6T A;  1E6B A;  1DE1 A;  2GSS A;  2BTO T;  3HYP A;  3L78 A;  4HDE A;  1T00 A;  4K5R A;  4ZL9 A;  4ZB7 A;  2LNT A;  3ZYW A;  1CQG A;  5GSS A;  4PQH A;  3TUE A;  1JZO A;  3D4M A;  2IMI A;  1Z7R A;  5D9T A;  2CX3 A;  1ZYE A;  3GH9 A;  2K8S A;  2YWM A;  4RI6 A;  3F0I A;  5ECS A;  4MDC A;  2JAD A;  5ABR A;  2NVL A;  4ULX A;  3F8U A;  1N2A A;  2GSR A;  2IN3 A;  3WT2 A;  4PNF A;  1F2E A;  5IMD A;  1XVQ A;  2DJ1 A;  3KD0 A;  2O3E A;  3HJO A;  3H79 A;  4JR6 A;  3CYN A;  2AV4 A;  4OFT A;  3IC8 A;  17GS A;  4USS A;  2C3Q A;  1GUK A;  4ML1 A;  3GUS A;  2FCH A;  1V57 A;  3GKX A;  3UL3 A;  1CQH A;  5JWQ B;  4LLR A;  5DCH A;  1K0A A;  1YEX A;  4DVC A;  1GUM A;  3RAZ A;  1R4W A;  1T4Z A;  4OWY A;  2C0F A;  2MMO A;  4XRA A;  4GLT A;  2DML A;  2HSM A;  1VF3 A;  2IMD A;  3QR6 A;  4QL9 A;  4LL1 B;  4GF0 A;  4KUN A;  3APO A;  1PA3 A;  2NTO A;  2WS2 A;  2OKA A;  3KMN A;  3LFL A;  2H1A A;  2KLX A;  3TKR A;  2CAQ A;  2VAF A;  3M9K A;  1QGV A;  5A4U A;  4WBR D;  2FHE A;  1EWX A;  1MEK A;  1URM A;  5LD0 A;  1JZD A;  3GX8 A;  3MSZ A;  2R4V A;  4KF9 A;  5ECK B;  3FHK A;  1S3R A;  1SD8 A;  1M2D A;  4AJ8 A;  4WR4 A;  5ELA A;  1YEW C;  1GWC A;  1M7T A;  2CAI A;  2DJK A;  5A5K A;  3LJR A;  2QGV A;  5IMV A;  4ZXG A;  2HZE B;  1WPI A;  3DKS A;  2YN1 A;  5JCU A;  2IIY A;  1SYX A;  3TKQ A;  3L0H A;  1R5P A;  4K7N A;  2M46 A;  2ZUP A;  1F9M A;  1YF0 A;  4NAX A;  1PFO A;  1R5A A;  1QXH A;  2XBQ A;  2PBJ A;  1TRS A;  4O7H A;  2GZP A;  3CSJ A;  2P31 A;  4CDO A;  2GGT A;  3G7J A;  3IOS A;  3F63 A;  4IJI A;  2HQT A;  4MNN A;  4MF7 A;  3CRU A;  3VWW A;  3QDN A;  1GSD A;  1YY7 A;  3KP8 A;  4ISD A;  2CZ3 A;  4N0V A;  1HD2 A;  5DBQ A;  1MDJ A;  1OC9 B;  1M9B A;  1A8Y A;  4I2U A;  5GAN D;  1PSQ A;  4G10 A;  4KGI A;  2WVZ A;  2C3T A;  3H4K A;  4L0W A;  4K7I A;  2GT5 A;  5J9C A;  2LST A;  3M1G A;  3IA1 A;  3TKS E;  2H0G A;  1DUG A;  5B8A A;  4MPF A;  2DJ2 A;  3GV1 A;  1TRW A;  3DVW A;  2V32 A;  3RHB A;  4N30 A;  1FOV A;  1A8L A;  2FNO A;  5G5E A;  4ZL8 A;  2LNS A;  3DWV A;  4L5O A;  1Z6N A;  1FW1 A;  2P0G A;  14GS A;  5IO0 A;  4CHS A;  2YV9 A;  2YV7 A;  4F0C A;  3A2W A;  1X5E A;  2FA8 A;  2G2Q A;  2GQK A;  2YZH A;  3UIW A;  4N0Z A;  2DSA A;  2X64 A;  4GTU A;  2CZ2 A;  2EC4 A;  4PTS A;  5INY A;  1GSE A;  3QFA C;  3BBY A;  3H8Q A;  4KAE A;  3HVS A;  1TW9 A;  1K3L A;  5LCZ A;  2JZT A;  3TRP A;  2R3X A;  1TU7 A;  3QAG A;  5FHI A;  4F2I A;  1Z7P A;  1K0N A;  1V40 A;  2HNL A;  1G6W A;  3GX0 A;  2R2J A;  1PD2 1;  4G9H A;  1OYJ A;  1TK0 B;  2D2Z A;  3VI7 A;  3ZVJ D;  1TI1 A;  5J9B A;  5COH A;  4PI0 C;  2ES7 A;  2I1U A;  3EU4 A;  5KN0 A;  1A0R P;  3KMO A;  5KN2 A;  1BJX A;  3TJK A;  3KP9 A;  2FWH A;  1SKS B;  4IHU A;  4TR1 A;  2B7K A;  4F03 A;  2VCT A;  2LKU A;  3RHC A;  5EVO A;  2F9S A;  3Q6O A;  5ELG A;  2MMZ A;  5CO3 A;  4I6X A;  2EFD A;  5J3R A;  3CQF A;  3I69 A;  5EY6 A;  1AQV A;  4KND A;  4J56 E;  2V2G A;  3N5O A;  1FVJ A;  1AAZ A;  1JLV A;  3ZZX A;  5FWG A;  2JL4 A;  2IFQ A;  2PU9 C;  3HY2 A;  4GSS A;  5J40 A;  1PGT A;  1T8E B;  3GKM A;  1HQO A;  2PPT A;  2OT3 A;  2H74 A;  4IP1 A;  3TOU A;  2X49 A;  2GQM A;  2C4J A;  3C1R A;  1EP8 A;  5D73 A;  4KDU A;  4XIH A;  5JWR B;  1UC7 A;  3R3E A;  5F8B A;  1YJ6 A;  2JSY A;  1AIU A;  2PVQ A;  3TJB A;  3CMI A;  2WW3 A;  4PQI A;  2L6C A;  1K0B A;  3TJJ A;  1XCC A;  1SJ6 A;  6GSS A;  1PMT A;  5H5Q A;  3TJG A;  2L5L A;  5ENU A;  1JFU A;  1S3D A;  2YPM A;  1A2L A;  2E2G A;  3GUR A;  2MBS A;  2VL2 C;  5KEJ A;  3CHX C;  1PN9 A;  4JZQ A;  2C0D A;  4GRF A;  2K6V A;  3QFB C;  4P3Y B;  3IV4 A;  4L8E A;  1NHY A;  4N3Z A;  2OBK A;  4JE1 A;  3J7Y b;  3KZQ A;  2IPA A;  4HI7 A;  2YWN A;  4IBP A;  2K18 A;  2NDO A;  4WET A;  3KGK A;  1EV9 A;  2H73 A;  2HYX A;  3LSZ A;  3C7M A;  3LQ7 A;  3G9B A;  3KEB A;  2FUG 2;  4QQ7 A;  1G6Y A;  3IHQ A;  2OAD A;  3US3 A;  2X4A A;  1H4O A;  3KH7 A;  2YNX A;  1GL8 A;  2FWG A;  3ERG A;  4KDX A;  2B5E A;  4PHZ C;  1K3Y A;  1WP0 A;  2PER A;  4NXI A;  1HNC A;  3P7X A;  1SVM A;  1BG5 A;  1VF2 A;  1K3O A;  1EOG A;  1USB A;  1WRY A;  3PH9 A;  4J2F A;  2X8C A;  5DVB A;  1YEP A;  1W4V A;  2HRA A;  2V41 A;  1YQ1 A;  2R5G A;  2WZS A;  3UJ1 A;  5DJL A;  1XPV A;  5DAK A;  3EU3 A;  4LMW A;  5ECN B;  1THO A;  4AGS A;  4Z2R A;  2QKE A;  3HHV A;  3APQ A;  1BAY A;  3GTU B;  2P5R A;  4NPB A;  2H72 A;  2DC5 A;  5AIX A;  2OAC A;  18GS A;  5HFK A;  2VCW A;  1AC1 A;  3HMJ G;  2B5Y A;  4XS4 B;  3KTL A;  4MF5 A;  2QC7 A;  4OO5 A;  5A5H A;  4MLY A;  3PR8 A;  4EL1 A;  2MBT A;  1X9S B;  3FR9 A;  2WVX A;  6GST A;  5F07 A;  2LQO A;  2EIQ A;  5J5N A;  1EGR A;  4NHW A;  2EIR A;  4BL7 A;  2Z9S A;  4BVY B;  3J7Y k;  5B7C A;  4H86 A;  4OCF A;  3LW9 A;  3VK9 A;  3ERW A;  5D93 A;  3D0Z A;  2OE0 A;  4KSO A;  1A23 A;  2XBI A;  4ID0 A;  5JWO B;  3FW2 A;  2LUS A;  1F3B A;  2GT6 A;  1EZK A;  2WRT A;  4TOP A;  2NBS A;  3F3Q A;  1EV4 A;  1WE0 A;  4GWR A;  2O36 A;  4TXV A;  2E0Q A;  3DYR A;  3LEF A;  2LJA A;  3A2V A;  1Y1U A;  1ZGN A;  2J23 A;  1GSF A;  5ID2 B;  3R2Q A;  1EP7 A;  1UA5 A;  5F05 A;  1I9D A;  4MF6 A;  2HRF A;  2RUE A;  1SJI A;  2ZCT A;  1F37 A;  1B9Y C;  4IS0 A;  4OFN A;  5G1K A;  1Y6E A;  4YKF A;  3GNJ A;  4HJM A;  5EPF A;  2AHE A;  2BJX A;  5A34 B;  2IMF A;  4CY8 A;  3ME8 A;  3GRX A;  5D9W A;  5D96 A;  4RQX A;  3UAR A;  2X8H A;  2GVP A;  6GSW A;  2QA2 A;  3QD9 A;  4BIK A;  4ZIJ A;  3LXT A;  3CXG A;  3HDC A;  3C1S A;  3DVX A;  13GS A;  4MJC A;  4MH3 A;  7GSS A;  3KXO A;  4TXO B;  1OAZ A;  5IOW A;  3UOM A;  2VCZ A;  4HOJ A;  1ZCP A;  4N10 A;  4Z2U A;  1T4Y A;  3W6G A;  2HZF A;  4MJA A;  5J47 A;  1OVN A;  3GMF A;  1YKC A;  1ML6 A;  3CSH A;  4LA1 A;  3Q18 A;  4MK3 A;  1XXU A;  2XPE A;  5AN1 A;  2QSI A;  3D22 A;  3GH6 A;  1BQ7 A;  4OCE A;  1V98 A;  1Q98 A;  3EPT A;  4GXZ A;  3QPM A;  5IM9 A;  2LEG A;  5ECH B;  4K1F A;  2HI7 A;  1FOH A;  2MMA A;  5BRT A;  3RFR C;  2DIY A;  1XW9 A;  5CRW A;  1QK8 A;  4O32 A;  5JCW A;  1TXU A;  1IYH A;  3U6V A;  4HU9 A;  1RQM A;  5G5F A;  2N5F A;  3GKN A;  3RBT A;  5B8B A;  3CTF A;  4JBB A;  2VO4 A;  2A2R A;  5DCG A;  3MNG A;  3JCM L;  3FKF A;  2WW1 A;  2IMK A;  4ZBB A;  4LL4 B;  2BMX A;  2RM6 A;  3E3E A;  5DAL B;  1WIK A;  1GLP A;  2H6X A;  4KE3 A;  3VWU A;  1J9B A;  4TW5 A;  3TRQ A;  2OBI A;  2OJL A;  1HNA A;  3EYT A;  1ZYQ B;  2H6Z A;  4O92 A;  2HRK A;  2I9H A;  4EDZ A;  1H75 A;  2M72 A;  2PGT A;  1M0U A;  2O85 A;  4WKW A;  1SKR B;  2LTK A;  20GS A;  4I2T A;  3CBU A;  1JZW A;  2DKI A;  4MCU A;  4XS6 A;  3F6F A;  1PL2 A;  4D73 B;  2PUK C;  1Z3E A;  6GSU A;  4MH2 A;  1J0F A;  1M3J A;  4QMK A;  2GLR A;  5A1N B;  2B6M A;  4ZB9 A;  3GHA A;  4ECJ A;  3TOT A;  1OKT A;  2A2P A;  1T7P B;  2ZNM A;  4BPY A;  6GSX A;  4Z7X A;  1A24 A;  3P8W A;  1ST9 A;  1K0D A;  2I3Y A;  1GTA A;  4N11 A;  3O76 A;  3ZRE A;  1OC8 A;  4EIQ A;  4I97 A;  1AQW A;  3A2X A;  3QCP A;  4E8H A;  2H0I A;  3ZFL A;  4FYC A;  1SEN A;  4X1U A;  4MJE A;  3IPZ A;  12GS A;  1VRS D;  5HFG A;  1XBS A;  3M0F A;  3VUR A;  3HZ8 A;  2DLX A;  1GSQ A;  3E0U A;  1G7O A;  1U3A A;  5DJM A;  4MPG A;  5J41 A;  2WB9 A;  3TCO A;  3MAK A;  1QMV A;  4OFM A;  4AF2 A;  4CY6 A;  4IQ1 A;  2L4Q A;  1ZL9 A;  1LU4 A;  2FLS A;  2I81 A;  3RDW A;  1K0M A;  1UVZ A;  2JAC A;  4ECB A;  1ERW A;  1EOH A;  3GN3 A;  3I9V 2;  4POM A;  4ILF A;  2DJ3 A;  2OE1 A;  2REM A;  4PUR A;  2N5A A;  1KTE A;  1XWG A;  2MMN A;  4F82 A;  2KOK A;  2O5V A;  3UAP A;  4K7O A;  3A3T A;  4IW9 A;  3IR4 A;  2ON5 A;  3FYG A;  2V1M A;  4IEL A;  4HSC X;  2B1K A;  4IJ3 A;  2B5X A;  2XHF A;  3LYP A;  5GST A;  4DSS A;  2P5Q A;  5B6N A;  4YQV A;  3VPT A;  5KN1 A;  2JZR A;  4MA9 A;  5BMU A;  3KJY A;  2WZ9 A;  1FHE A;  3IE3 A;  1QFN A;  1WMJ A;  1Z6M A;  3L4N A;  2PWJ A;  4FYU A;  1YDK A;  4GQF A;  4FO5 A;  1T1V A;  4X43 A;  1SK1 A;  3QOU A;  2TIR A;  2WW2 A;  2B3S A;  1U3I A;  1DBY A;  1R26 A;  2H1B A;  5EL8 A;  1SU9 A;  4V2N A;  3HA9 A;  1GSU A;  4DEJ A;  5A4W A;  4HJ2 A;  2H0H A;  5G31 A;  3E9J B;  1M2A A;  3F4R A;  4L5L A;  5CP1 A;  5IO2 A;  3TU3 B;  1XOA A;  1O6J A;  2VM2 A;  1ON4 A;  2HSN A;  2HSM B;  1OE8 A;  3LWA A;  2H30 A;  1PN0 A;  1N25 A;  2YOI A;  5G1L A;  4BWS A;  1Q4J A;  1B4Q A;  1V9W A;  1X5C A;  3DIE A;  3EMX A;  4V2M A;  2C80 A;  3C71 A;  2L57 A;  3V1W A;  2LRC A;  1ZMA A;  4BVX A;  1WJK A;  3GSS A;  4AKX B;  4FQU A;  1BX9 A;  2A2S A;  1DE2 A;  1GRX A;  4PNG A;  3KIJ A;  3H1N A;  2VD1 A;  2VL2 A;  4IVF A;  1ILO A;  3UVT A;  2VM1 A;  1O73 A;  1S3C A;  2PVO C;  2VOC A;  1NSW A;  1Z5Y E;  1X0R A;  4TKY A;  3IAM 2;  4I5Q A;  1XIY A;  2DBC A;  1ERU A;  3NZN A;  1DSB A;  2K8V A;  3F6D A;  4Q5Q A;  3EIN A;  2YAN A;  2YCD A;  3IXR A;  3F4S A;  1AW9 A;  2X99 A;  3ZIT A;  3M9J A;  3BCK A;  2XPD A;  2A4V A;  3IHG A;  4PGT A;  4TN8 A;  1XWK A;  4MP4 A;  4ZB8 A;  4ICY A;  5IPG A;  4GST A;  1Y25 A;  4XS1 A;  2WGR A;  4POL A;  3UEM A;  5IMC A;  5HR1 A;  2FWE A;  2F51 A;  1AQX A;  1M9A A;  3VPQ A;  4NHZ A;  4K2D A;  3QAV A;  2B1L A;  4TR3 A;  1M2B A;  1NM3 A;  3RPP A;  3K8N A;  1AUC A;  1ERT A;  4GQC A;  4YQU A;  4J57 E;  2H8L A;  9GSS A;  2CQ9 A;  2H76 A;  1U88 A;  1SVO A;  3O3T A;  1THX A;  2DMM A;  3GIX A;  1LBK A;  3PGT A;  4K0G A;  2YP6 A;  2GQL A;  4K8M A;  3TKS C;  4PUA A;  3I6A A;  1T3B A;  2OA7 A;  3IAS 2;  4OO4 A;  5ECM B;  2LRN A;  2WCI A;  4BWQ A;  5CRG A;  4LMV A;  1SL0 B;  4JU5 A;  5CAX A;  1EEJ A;  3Q74 A;  1GSS A;  1O85 A;  4EVM A;  4K9Z A;  1B9X C;  1VF4 A;  2YWI A;  3W8S A;  1EGO A;  1FB0 A;  2O8V B;  3FZ9 A;  4POB A;  1BF5 A;  1I5G A;  4O5Q A;  2HZE A;  3ZVJ A;  4DSR A;  2FY6 A;  3W8J A;  3ZMK A;  2ALB A;  4F0B A;  4X0X A;  1XVW A;  4G01 A;  3VI5 A;  3ZL5 A;  1HYU A;  2GST A;  2H1L A;  2JSZ A;  3EWL A;  4K5S A;  1RK4 A;  3N9J A;  2FA4 A;  1SD9 A;  4OMV A;  1A0F A;  1W89 A;  2WJU A;  2K9F A;  4E8E A;  4AJ7 A;  1OC9 A;  1YVL A;  1S3A A;  2CV4 A;  3LOR A;  4TR1 B;  2DJ0 A;  3WGE A;  5B6M A;  4V2L A;  2HSY A;  4KSM A;  1KBN A;  5GAP D;  3ME7 A;  3DXB A;  4RQR A;  2LQQ A;  3HD5 A;  4EF0 A;  2QA1 A;  4NMU A;  19GS A;  4XRD A;  2FGX A;  3GST A;  2HSN B;  5IMF A;  3C8E A;  4V1A p;  2CVK A;  2F8F A;  2IFQ B;  3Q19 A;  10GS A;  5ECO B;  5ECP B;  1O81 A;  3VWV A;  3FZ4 A;  4XHM A;  2E2M A;  4XCS A;  1IYI A;  1OC3 A;  1V58 A;  4YKG A;  1B4P A;  4IKH A;  4BVX B;  1FVK A;  4TVE A;  1J08 A;  4GDF A;  2MZC A;  4CW9 A;  1YZX A;  3L9V A;  5ECI B;  2XC2 A;  1U6T A;  4K0N A;  1BED A;  1MDK A;  5J4Y A;  1TI3 A;  2RUF A;  1PQN A;  4PUF C;  3DGQ A;  4NWY A;  2VCQ A;  3MDK A;  1MDI A;  4WF4 A;  2CVB A;  5H5R A; 
#chains in the Genus database with same CATH homology
 2J9H A;  4O5U A;  5CYY A;  1F6M C;  2VL3 A;  2RM5 A;  2M80 A;  3EVI A;  3ZIV A;  2WDU A;  5ECQ B;  3LGC A;  1LJR A;  3HCZ A;  1ACV A;  3DEX A;  3KH9 A;  1TTZ A;  2V6K A;  1SJZ A;  2IL3 A;  1QUW A;  3VWX A;  3SBC A;  5F06 A;  2YJ7 A;  5CRE A;  2H66 A;  1TK5 B;  2JU5 A;  1U87 A;  5D9X A;  3RPN A;  5E4W A;  2C0E A;  1SKW B;  4ACS A;  1TU8 A;  2AYT A;  3ED3 A;  3PIN A;  1E2Y A;  3S9F A;  1XW5 A;  5E59 A;  4G2E A;  4ML6 A;  4JED A;  1XWB A;  3GKK A;  4TR4 A;  3KM6 A;  3VFI A;  2VCX A;  4WR5 A;  4RUV A;  3FZ5 A;  4AKG A;  2X8G A;  1TDI A;  1NW2 A;  5IMA A;  4EXJ A;  4PX1 A;  5AGY A;  2CT6 A;  1JZR A;  2R6K A;  4AKI A;  4E68 A;  4HEA 2;  4WF5 A;  3MWH A;  4ZBD A;  4EE0 A;  3F9U A;  1G7E A;  5DAK B;  1TKD B;  5HR0 A;  2H01 A;  2PMT A;  1XWC A;  1K0O A;  4FH8 A;  5J4U A;  2C8U A;  3NIV A;  4MAB A;  2VKZ G;  2WFC A;  5IIZ A;  2LJK A;  4F9Z A;  2EFC A;  3TKP A;  2N5B A;  3HZ4 A;  3I43 A;  3IDV A;  2VLT A;  5D8I A;  5A5H B;  11GS A;  1FO5 A;  4HU7 A;  3WD6 A;  1TXX A;  3EC3 A;  3BD2 A;  1JLW A;  3NOF A;  2GZY A;  2RII A;  4BL7 B;  5C00 A;  2IJY A;  3IRA A;  1BYE A;  5IMZ A;  3P90 A;  4IQA A;  4MZC A;  4MJB A;  2EFH A;  2G0F A;  3TRX A;  2R0C A;  3D5J A;  4TR0 A;  3EE2 A;  2RLI A;  3CWG A;  1BG1 A;  4YAV A;  5HFI A;  1ZYP A;  4Q5F A;  5IQY A;  1O8W A;  3GL5 A;  6GSY A;  3M8N A;  5DDL A;  3BJ5 A;  2HT9 A;  2ON7 A;  2L5O A;  4ECI A;  2H70 A;  2V6O A;  2VUP A;  1G0T A;  4KW6 A;  4ZB6 A;  3IK7 A;  1B48 A;  1TJD A;  4DSQ A;  1TK8 B;  3ZTL A;  1N8J A;  2VLV A;  4GSN A;  4XTS A;  2OE3 A;  5KN3 A;  2GTU A;  1NHO A;  2AB6 A;  4L0U A;  3FEU A;  1K0C A;  4KX4 A;  6GSV A;  5H5S A;  2HSH A;  4G0K A;  4NV5 A;  4G0L A;  4G0I A;  1OKD A;  5CRH A;  1ZZY A;  5CNW A;  4RI7 A;  1XZO A;  2CVD A;  1SYR A;  1WWJ A;  3EUR A;  2L4C A;  3GTU A;  2IME A;  2YZU A;  3KTB A;  4WXT A;  4EUY A;  2VIM A;  3ZIJ A;  2VD0 A;  4POK A;  5HR2 A;  2H19 A;  4XS4 A;  1A2J A;  1X5D A;  3HJP A;  3FZA A;  1GNE A;  3TGZ A;  1KEB A;  3IBH A;  1VF1 A;  2GSQ A;  3M3M A;  2NPB A;  4I8B A;  2CA8 A;  3LYK A;  3ZML A;  1GP1 A;  3CRT A;  4Q5N A;  3TDG A;  2TRX A;  2KP1 A;  4BVY A;  2DJJ A;  2LJR A;  1FAA A;  3GL3 A;  2L6D A;  4FYB A;  3P2A A;  4X4J A;  3VLN A;  3FY7 A;  2F3M A;  3EMP A;  4KA0 A;  1YF1 A;  1GTI A;  1YKA A;  1ZOF A;  3UMA A;  3BOA A;  2H71 A;  2I4A A;  2JZS A;  2PN8 A;  3TB2 A;  3WGX A;  3FRC A;  4HQS A;  2YWO A;  5G30 A;  1KNG A;  2HFD A;  5ID2 A;  1XOB A;  1SVL A;  1ABA A;  2FD3 A;  2TRC P;  1GH2 A;  2R0P A;  3WYW A;  3G7Y A;  1GSY A;  3LG6 A;  4IN0 A;  4ZBA A;  4KCE A;  3FR6 A;  1MD4 A;  4NV2 A;  4AJ6 A;  2GZZ A;  4WBJ A;  5ECR B;  1AXD A;  4KDY A;  3HVX A;  2C0G A;  2H1G A;  2L59 A;  1PX6 A;  5A34 A;  1PKZ A;  3DRN A;  1EEM A;  1PKW A;  5DQS A;  3F4T A;  2MYG A;  1X9M B;  2HRK B;  4ECC A;  2H6Y A;  2IWT A;  2UZ8 A;  1XFL A;  1ERV A;  2HE3 A;  4TXO A;  1X9W B;  1GUL A;  8GSS A;  1SL1 B;  3UBL A;  2KP2 A;  2VCV A;  3IK9 A;  4MZW A;  1PL1 A;  2C3N A;  2VL9 A;  2R0G A;  5HR3 A;  3FR3 A;  4AKH A;  3GA4 A;  5CRD A;  2GDR A;  5DQY A;  1GTB A;  4EDY A;  2YJH A;  5IOX A;  2HXK A;  2AJQ B;  2B7J A;  5L71 A;  4OD7 A;  3HVV A;  3SWL A;  3TKS A;  3F3R A;  4HQZ A;  3L9U A;  4EC0 A;  1M99 A;  3QMX A;  3H93 A;  2O89 A;  1Z9H A;  22GS A;  1WOU A;  1R7H A;  3HXS A;  4JRR A;  3GYK A;  4WEY A;  1V2A A;  3LXZ A;  4K6X A;  1SK0 A;  3ZLP A;  3BCI A;  1GTU A;  1MD3 A;  1OE7 A;  4O5R A;  3C73 A;  1MTC A;  3WGD A;  3D4T A;  3DML A;  2LV3 A;  1FB6 A;  2KUC A;  2VLU A;  2O87 A;  1PRX A;  4TRX A;  4MMM A;  4ZL7 A;  3AY8 A;  3FK8 A;  4EO3 A;  5DAL A;  3D21 A;  5IPH A;  1A2M A;  5J4V A;  4BA7 A;  5KOX A;  1HNB A;  2AAW A;  1XWA A;  2UV8 G;  4ZIL A;  3KCM A;  1ZYN A;  3TJF A;  1FG4 A;  2F8A A;  4EIP A;  1C72 A;  1QQ2 A;  3A5W A;  4AI6 A;  4FIW A;  3L9S A;  2LRT A;  1O8X A;  4HZ2 A;  1GUH A;  4PXO A;  4YQM A;  2LS5 A;  2H75 A;  3CSI A;  4DSS B;  1UN2 A;  4QL7 A;  3ERF A;  2DKH A;  3QAW A;  4V1A g;  4D73 A;  1XW6 A;  5BMU B;  2C1Y A;  1TOF A;  4YH2 A;  1SK2 A;  5A1N A;  5KOW A;  5JCG A;  3IC4 A;  5AIV A;  5D9V A;  4MZB A;  3A5I A;  3APS A;  3FMW A;  4KCA A;  3G7I A;  4IP6 A;  2DIZ A;  3GFK A;  4YAP A;  5GZZ B;  1JHB A;  1TP9 A;  2FWF A;  4KB3 A;  5AIS A;  4KH7 A;  2GS3 A;  2HRN A;  3D6I A;  5F0G A;  5HQP A;  16GS A;  2H1D A;  5G2Z A;  3HJM A;  3MIX A;  1F3A A;  2WUL A;  4K2X A;  1RW1 A;  3UBK A;  4PQ1 A;  5A4V A;  1GNW A;  4HZ4 A;  4W66 A;  1PX7 A;  3HKR A;  4IGJ A;  3UVH A;  4A5P A;  5LNK e;  3U5R E;  4HUA A;  3CTG A;  1GLQ A;  3ISO A;  2EIO A;  4HS1 A;  5ECL B;  1SL2 B;  2A4H A;  3ZRD A;  2AUV A;  2R37 A;  4JR4 A;  2E7P A;  1TRU A;  5C04 A;  1B8X A;  3DD3 A;  5FT3 A;  2CX4 A;  3WT1 A;  3MYD A;  3ZFB A;  4G19 A;  1O7U A;  4GCI A;  2HLS A;  4Q5R A;  3PPU A;  4Z2T A;  1TRV A;  4EKZ A;  3OR5 A;  2KHP A;  1VGL A;  2EFE A;  2O7K A;  3O6T A;  1E6B A;  1DE1 A;  2GSS A;  2BTO T;  3HYP A;  3L78 A;  4HDE A;  1T00 A;  4K5R A;  4ZL9 A;  4ZB7 A;  2LNT A;  3ZYW A;  1CQG A;  5GSS A;  4PQH A;  3TUE A;  1JZO A;  3D4M A;  2IMI A;  1Z7R A;  5D9T A;  2CX3 A;  1ZYE A;  3GH9 A;  2K8S A;  2YWM A;  4RI6 A;  3F0I A;  5ECS A;  4MDC A;  2JAD A;  5ABR A;  2NVL A;  4ULX A;  3F8U A;  1N2A A;  2GSR A;  2IN3 A;  3WT2 A;  4PNF A;  1F2E A;  5IMD A;  1XVQ A;  2DJ1 A;  3KD0 A;  3HJO A;  3H79 A;  4JR6 A;  3CYN A;  2AV4 A;  4OFT A;  3IC8 A;  17GS A;  4USS A;  2C3Q A;  1GUK A;  4ML1 A;  3GUS A;  2FCH A;  1V57 A;  3GKX A;  3UL3 A;  1CQH A;  5JWQ B;  4LLR A;  5DCH A;  1K0A A;  1YEX A;  4DVC A;  1GUM A;  3RAZ A;  1R4W A;  1T4Z A;  4OWY A;  2C0F A;  2MMO A;  4XRA A;  4GLT A;  2DML A;  2HSM A;  1VF3 A;  2IMD A;  3QR6 A;  4QL9 A;  4LL1 B;  4GF0 A;  4KUN A;  3APO A;  1PA3 A;  2NTO A;  2WS2 A;  2OKA A;  3KMN A;  3LFL A;  2H1A A;  2KLX A;  3TKR A;  2CAQ A;  2VAF A;  3M9K A;  1QGV A;  5A4U A;  4WBR D;  2FHE A;  1EWX A;  1MEK A;  1URM A;  5LD0 A;  1JZD A;  3GX8 A;  3MSZ A;  2R4V A;  4KF9 A;  5ECK B;  3FHK A;  1SD8 A;  1M2D A;  4AJ8 A;  4WR4 A;  5ELA A;  1GWC A;  1M7T A;  2CAI A;  2DJK A;  5A5K A;  3LJR A;  2QGV A;  5IMV A;  4ZXG A;  2HZE B;  1WPI A;  3DKS A;  2YN1 A;  5JCU A;  2IIY A;  1SYX A;  3TKQ A;  3L0H A;  1R5P A;  4K7N A;  2M46 A;  2ZUP A;  1F9M A;  1YF0 A;  4NAX A;  1R5A A;  1QXH A;  2XBQ A;  2PBJ A;  1TRS A;  4O7H A;  2GZP A;  3CSJ A;  2P31 A;  4CDO A;  2GGT A;  3G7J A;  3IOS A;  3F63 A;  4IJI A;  2HQT A;  4MNN A;  4MF7 A;  3CRU A;  3VWW A;  3QDN A;  1GSD A;  1YY7 A;  3KP8 A;  4ISD A;  2CZ3 A;  4N0V A;  1HD2 A;  5DBQ A;  1MDJ A;  1OC9 B;  1M9B A;  1A8Y A;  4I2U A;  5GAN D;  1PSQ A;  4G10 A;  4KGI A;  2C3T A;  3H4K A;  4L0W A;  4K7I A;  2GT5 A;  5J9C A;  2LST A;  3M1G A;  3IA1 A;  3TKS E;  2H0G A;  1DUG A;  5B8A A;  4MPF A;  2DJ2 A;  3GV1 A;  1TRW A;  3DVW A;  2V32 A;  3RHB A;  4N30 A;  1FOV A;  1A8L A;  2FNO A;  5G5E A;  4ZL8 A;  2LNS A;  3DWV A;  4L5O A;  1Z6N A;  1FW1 A;  2P0G A;  14GS A;  5IO0 A;  4CHS A;  2YV9 A;  2YV7 A;  4F0C A;  3A2W A;  1X5E A;  2FA8 A;  2G2Q A;  2GQK A;  2YZH A;  3UIW A;  4N0Z A;  2DSA A;  2X64 A;  4GTU A;  2CZ2 A;  2EC4 A;  4PTS A;  5INY A;  1GSE A;  3QFA C;  3BBY A;  3H8Q A;  4KAE A;  3HVS A;  1TW9 A;  1K3L A;  5LCZ A;  2JZT A;  3TRP A;  2R3X A;  1TU7 A;  3QAG A;  5FHI A;  4F2I A;  1Z7P A;  1K0N A;  1V40 A;  2HNL A;  1G6W A;  3GX0 A;  2R2J A;  1PD2 1;  4G9H A;  1OYJ A;  1TK0 B;  2D2Z A;  3VI7 A;  3ZVJ D;  1TI1 A;  5J9B A;  5COH A;  2ES7 A;  2I1U A;  3EU4 A;  5KN0 A;  1A0R P;  3KMO A;  5KN2 A;  1BJX A;  3TJK A;  3KP9 A;  2FWH A;  1SKS B;  4IHU A;  4TR1 A;  2B7K A;  4F03 A;  2VCT A;  2LKU A;  3RHC A;  5EVO A;  2F9S A;  3Q6O A;  5ELG A;  2MMZ A;  5CO3 A;  4I6X A;  2EFD A;  5J3R A;  3I69 A;  5EY6 A;  1AQV A;  4KND A;  4J56 E;  2V2G A;  3N5O A;  1FVJ A;  1AAZ A;  1JLV A;  3ZZX A;  5FWG A;  2JL4 A;  2IFQ A;  2PU9 C;  3HY2 A;  4GSS A;  5J40 A;  1PGT A;  1T8E B;  3GKM A;  1HQO A;  2PPT A;  2OT3 A;  2H74 A;  4IP1 A;  3TOU A;  2X49 A;  2GQM A;  2C4J A;  3C1R A;  1EP8 A;  5D73 A;  4KDU A;  4XIH A;  5JWR B;  1UC7 A;  3R3E A;  5F8B A;  1YJ6 A;  2JSY A;  1AIU A;  2PVQ A;  3TJB A;  3CMI A;  4PQI A;  2L6C A;  1K0B A;  3TJJ A;  1XCC A;  1SJ6 A;  6GSS A;  1PMT A;  5H5Q A;  3TJG A;  2L5L A;  5ENU A;  1JFU A;  1S3D A;  2YPM A;  1A2L A;  2E2G A;  3GUR A;  2MBS A;  2VL2 C;  5KEJ A;  1PN9 A;  4JZQ A;  2C0D A;  4GRF A;  2K6V A;  3QFB C;  4P3Y B;  3IV4 A;  4L8E A;  1NHY A;  4N3Z A;  2OBK A;  4JE1 A;  3J7Y b;  3KZQ A;  2IPA A;  4HI7 A;  2YWN A;  4IBP A;  2K18 A;  2NDO A;  4WET A;  3KGK A;  1EV9 A;  2H73 A;  2HYX A;  3LSZ A;  3C7M A;  3LQ7 A;  3G9B A;  3KEB A;  2FUG 2;  4QQ7 A;  1G6Y A;  3IHQ A;  2OAD A;  3US3 A;  2X4A A;  1H4O A;  3KH7 A;  2YNX A;  1GL8 A;  2FWG A;  3ERG A;  4KDX A;  2B5E A;  1K3Y A;  1WP0 A;  2PER A;  4NXI A;  1HNC A;  3P7X A;  1SVM A;  1BG5 A;  1VF2 A;  1K3O A;  1EOG A;  1USB A;  1WRY A;  3PH9 A;  4J2F A;  2X8C A;  5DVB A;  1YEP A;  1W4V A;  2HRA A;  2V41 A;  1YQ1 A;  2R5G A;  3UJ1 A;  5DJL A;  1XPV A;  5DAK A;  3EU3 A;  4LMW A;  5ECN B;  1THO A;  4AGS A;  4Z2R A;  2QKE A;  3HHV A;  3APQ A;  1BAY A;  3GTU B;  2P5R A;  4NPB A;  2H72 A;  2DC5 A;  5AIX A;  2OAC A;  18GS A;  5HFK A;  2VCW A;  1AC1 A;  3HMJ G;  2B5Y A;  4XS4 B;  3KTL A;  4MF5 A;  2QC7 A;  4OO5 A;  5A5H A;  4MLY A;  3PR8 A;  4EL1 A;  2MBT A;  1X9S B;  3FR9 A;  6GST A;  5F07 A;  2LQO A;  2EIQ A;  5J5N A;  1EGR A;  4NHW A;  2EIR A;  4BL7 A;  2Z9S A;  4BVY B;  3J7Y k;  5B7C A;  4H86 A;  4OCF A;  3LW9 A;  3VK9 A;  3ERW A;  5D93 A;  3D0Z A;  2OE0 A;  4KSO A;  1A23 A;  2XBI A;  4ID0 A;  5JWO B;  3FW2 A;  2LUS A;  1F3B A;  2GT6 A;  1EZK A;  2WRT A;  4TOP A;  2NBS A;  3F3Q A;  1EV4 A;  1WE0 A;  4GWR A;  4TXV A;  2E0Q A;  3DYR A;  3LEF A;  2LJA A;  3A2V A;  1Y1U A;  1ZGN A;  2J23 A;  1GSF A;  5ID2 B;  3R2Q A;  1EP7 A;  1UA5 A;  5F05 A;  1I9D A;  4MF6 A;  2HRF A;  2RUE A;  1SJI A;  2ZCT A;  1F37 A;  1B9Y C;  4IS0 A;  4OFN A;  5G1K A;  1Y6E A;  4YKF A;  3GNJ A;  4HJM A;  5EPF A;  2AHE A;  2BJX A;  5A34 B;  2IMF A;  4CY8 A;  3ME8 A;  3GRX A;  5D9W A;  5D96 A;  4RQX A;  3UAR A;  2X8H A;  2GVP A;  6GSW A;  2QA2 A;  3QD9 A;  4ZIJ A;  3LXT A;  3CXG A;  3HDC A;  3C1S A;  3DVX A;  13GS A;  4MJC A;  4MH3 A;  7GSS A;  3KXO A;  4TXO B;  1OAZ A;  5IOW A;  3UOM A;  2VCZ A;  4HOJ A;  1ZCP A;  4N10 A;  4Z2U A;  1T4Y A;  3W6G A;  2HZF A;  4MJA A;  5J47 A;  1OVN A;  3GMF A;  1YKC A;  1ML6 A;  3CSH A;  4LA1 A;  3Q18 A;  4MK3 A;  1XXU A;  2XPE A;  5AN1 A;  2QSI A;  3D22 A;  3GH6 A;  1BQ7 A;  4OCE A;  1V98 A;  1Q98 A;  3EPT A;  4GXZ A;  3QPM A;  5IM9 A;  2LEG A;  5ECH B;  4K1F A;  2HI7 A;  1FOH A;  2MMA A;  5BRT A;  2DIY A;  1XW9 A;  5CRW A;  1QK8 A;  4O32 A;  5JCW A;  1TXU A;  1IYH A;  3U6V A;  4HU9 A;  1RQM A;  5G5F A;  2N5F A;  3GKN A;  3RBT A;  5B8B A;  3CTF A;  4JBB A;  2VO4 A;  2A2R A;  5DCG A;  3MNG A;  3JCM L;  3FKF A;  2IMK A;  4ZBB A;  4LL4 B;  2BMX A;  2RM6 A;  3E3E A;  5DAL B;  1WIK A;  1GLP A;  2H6X A;  4KE3 A;  3VWU A;  1J9B A;  4TW5 A;  3TRQ A;  2OBI A;  2OJL A;  1HNA A;  3EYT A;  1ZYQ B;  2H6Z A;  4O92 A;  2HRK A;  2I9H A;  4EDZ A;  1H75 A;  2M72 A;  2PGT A;  1M0U A;  2O85 A;  4WKW A;  1SKR B;  2LTK A;  20GS A;  4I2T A;  3CBU A;  1JZW A;  2DKI A;  4MCU A;  4XS6 A;  3F6F A;  1PL2 A;  4D73 B;  2PUK C;  1Z3E A;  6GSU A;  4MH2 A;  1J0F A;  4QMK A;  2GLR A;  5A1N B;  2B6M A;  4ZB9 A;  3GHA A;  4ECJ A;  3TOT A;  1OKT A;  2A2P A;  1T7P B;  2ZNM A;  4BPY A;  6GSX A;  4Z7X A;  1A24 A;  3P8W A;  1ST9 A;  1K0D A;  2I3Y A;  1GTA A;  4N11 A;  3O76 A;  3ZRE A;  1OC8 A;  4EIQ A;  4I97 A;  1AQW A;  3A2X A;  3QCP A;  4E8H A;  2H0I A;  3ZFL A;  4FYC A;  1SEN A;  4X1U A;  4MJE A;  3IPZ A;  12GS A;  1VRS D;  5HFG A;  1XBS A;  3M0F A;  3VUR A;  3HZ8 A;  2DLX A;  1GSQ A;  3E0U A;  1G7O A;  1U3A A;  5DJM A;  4MPG A;  5J41 A;  2WB9 A;  3TCO A;  3MAK A;  1QMV A;  4OFM A;  4AF2 A;  4CY6 A;  4IQ1 A;  2L4Q A;  1ZL9 A;  1LU4 A;  2FLS A;  2I81 A;  3RDW A;  1K0M A;  1UVZ A;  2JAC A;  4ECB A;  1ERW A;  1EOH A;  3GN3 A;  3I9V 2;  4POM A;  4ILF A;  2DJ3 A;  2OE1 A;  2REM A;  4PUR A;  2N5A A;  1KTE A;  1XWG A;  2MMN A;  4F82 A;  2KOK A;  2O5V A;  3UAP A;  4K7O A;  3A3T A;  4IW9 A;  3IR4 A;  2ON5 A;  3FYG A;  2V1M A;  4IEL A;  2B1K A;  4IJ3 A;  2B5X A;  2XHF A;  3LYP A;  5GST A;  4DSS A;  2P5Q A;  5B6N A;  4YQV A;  3VPT A;  5KN1 A;  2JZR A;  4MA9 A;  5BMU A;  3KJY A;  2WZ9 A;  1FHE A;  3IE3 A;  1QFN A;  1WMJ A;  1Z6M A;  3L4N A;  2PWJ A;  4FYU A;  1YDK A;  4GQF A;  4FO5 A;  1T1V A;  4X43 A;  1SK1 A;  3QOU A;  2TIR A;  2B3S A;  1U3I A;  1DBY A;  1R26 A;  2H1B A;  5EL8 A;  1SU9 A;  4V2N A;  3HA9 A;  1GSU A;  4DEJ A;  5A4W A;  4HJ2 A;  2H0H A;  5G31 A;  3E9J B;  1M2A A;  3F4R A;  4L5L A;  5CP1 A;  5IO2 A;  3TU3 B;  1XOA A;  1O6J A;  2VM2 A;  1ON4 A;  2HSN A;  2HSM B;  1OE8 A;  3LWA A;  2H30 A;  1PN0 A;  1N25 A;  2YOI A;  5G1L A;  4BWS A;  1Q4J A;  1B4Q A;  1V9W A;  1X5C A;  3DIE A;  3EMX A;  4V2M A;  2C80 A;  3C71 A;  2L57 A;  3V1W A;  2LRC A;  1ZMA A;  4BVX A;  1WJK A;  3GSS A;  4AKX B;  4FQU A;  1BX9 A;  2A2S A;  1DE2 A;  1GRX A;  4PNG A;  3KIJ A;  3H1N A;  2VD1 A;  2VL2 A;  4IVF A;  1ILO A;  3UVT A;  2VM1 A;  1O73 A;  1S3C A;  2PVO C;  2VOC A;  1NSW A;  1Z5Y E;  1X0R A;  4TKY A;  3IAM 2;  4I5Q A;  1XIY A;  2DBC A;  1ERU A;  3NZN A;  1DSB A;  2K8V A;  3F6D A;  4Q5Q A;  3EIN A;  2YAN A;  2YCD A;  3IXR A;  3F4S A;  1AW9 A;  2X99 A;  3ZIT A;  3M9J A;  3BCK A;  2XPD A;  2A4V A;  3IHG A;  4PGT A;  4TN8 A;  1XWK A;  4MP4 A;  4ZB8 A;  4ICY A;  5IPG A;  4GST A;  1Y25 A;  4XS1 A;  2WGR A;  4POL A;  3UEM A;  5IMC A;  5HR1 A;  2FWE A;  2F51 A;  1AQX A;  1M9A A;  3VPQ A;  4NHZ A;  4K2D A;  3QAV A;  2B1L A;  4TR3 A;  1M2B A;  1NM3 A;  3RPP A;  3K8N A;  1AUC A;  1ERT A;  4GQC A;  4YQU A;  4J57 E;  2H8L A;  9GSS A;  2CQ9 A;  2H76 A;  1U88 A;  1SVO A;  3O3T A;  1THX A;  2DMM A;  3GIX A;  1LBK A;  3PGT A;  4K0G A;  2YP6 A;  2GQL A;  4K8M A;  3TKS C;  4PUA A;  3I6A A;  1T3B A;  2OA7 A;  3IAS 2;  4OO4 A;  5ECM B;  2LRN A;  2WCI A;  4BWQ A;  5CRG A;  4LMV A;  1SL0 B;  4JU5 A;  5CAX A;  1EEJ A;  3Q74 A;  1GSS A;  1O85 A;  4EVM A;  4K9Z A;  1B9X C;  1VF4 A;  2YWI A;  3W8S A;  1EGO A;  1FB0 A;  2O8V B;  3FZ9 A;  4POB A;  1BF5 A;  1I5G A;  4O5Q A;  2HZE A;  3ZVJ A;  4DSR A;  2FY6 A;  3W8J A;  3ZMK A;  2ALB A;  4F0B A;  4X0X A;  1XVW A;  4G01 A;  3VI5 A;  3ZL5 A;  1HYU A;  2GST A;  2H1L A;  2JSZ A;  3EWL A;  4K5S A;  1RK4 A;  3N9J A;  2FA4 A;  1SD9 A;  4OMV A;  1A0F A;  1W89 A;  2WJU A;  2K9F A;  4E8E A;  4AJ7 A;  1OC9 A;  1YVL A;  1S3A A;  2CV4 A;  3LOR A;  4TR1 B;  2DJ0 A;  3WGE A;  5B6M A;  4V2L A;  2HSY A;  4KSM A;  1KBN A;  5GAP D;  3ME7 A;  3DXB A;  4RQR A;  2LQQ A;  3HD5 A;  4EF0 A;  2QA1 A;  4NMU A;  19GS A;  4XRD A;  2FGX A;  3GST A;  2HSN B;  5IMF A;  3C8E A;  4V1A p;  2CVK A;  2F8F A;  2IFQ B;  3Q19 A;  10GS A;  5ECO B;  5ECP B;  1O81 A;  3VWV A;  3FZ4 A;  4XHM A;  2E2M A;  4XCS A;  1IYI A;  1OC3 A;  1V58 A;  4YKG A;  1B4P A;  4IKH A;  4BVX B;  1FVK A;  4TVE A;  1J08 A;  4GDF A;  2MZC A;  4CW9 A;  1YZX A;  3L9V A;  5ECI B;  2XC2 A;  1U6T A;  4K0N A;  1BED A;  1MDK A;  5J4Y A;  1TI3 A;  2RUF A;  1PQN A;  4PUF C;  3DGQ A;  4NWY A;  2VCQ A;  3MDK A;  1MDI A;  4WF4 A;  2CVB A;  5H5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...