1OKXA

Binding structure of elastase inhibitor scyptolin a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title Binding Structure of Elastase Inhibitor Scyptolin A
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1okxA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1okxA01
1JWTA 1WAYB 2WPHS 1K1PA 1PPHE 4YOGA 3ZZDA 1GDUA 3LGYA 1GGDB 2V3OH 3QGJA 2H9HA 2XC0A 1AWFH 2CV3A 1QTFA 1WTHD 3RLWH 2YOLA 1A1RA 1XUFA 2UWLA 1AE5A 1CSOE 3ZYEA 1LO6A 4VGCB 3E0PB 3ZVGA 5GXPA 1VCQA 2BDAA 4MPVA 2BYAX 2OC7A 4I7YH 1P12E 2A4QA 4CR9A 4Y76A 5E0JA 1O33A 1WYKA 1QNJA 1AKSA 1TQ0B 1T7CA 2ZNKH 3CS0A 2I6QA 3M3VA 1AMHA 1TONA 2FS8A 2NU0E 2P3TB 3BTQE 3PO1C 1PPFE 2OXSA 4YOJA 3ZZ6A 3LJOA 3ESTA 4D7GA 1MU8B 4NSYA 2ZU2A 1P2KA 2BOHB 1GJ6A 2B0FA 2G4UA 3GOVB 3BV9B 1ZPCA 5EXLA 5F8ZA 4LZ4B 4RN6A 1MMJN 1ID5H 1OYQA 2BDYA 4UEHH 3MNSA 1J15A 2ANYA 3M5MA 4CRBA 5CE1A 2THFB 1XKAC 1HAOH 1HB0B 1YPHE 3DFJA 8GCHG 1KDQA 1FONA 1YCPH 2FI4E 1DXWA 1GHAG 3SU1A 1ELTA 1QIXB 1T8LA 3U8OH 3EAJA 4CRGA 1WQSA 1O2UA 1SMFE 2XBYA 2PGQB 1FXYA 3LH3A 5CHAC 4NZLA 4AG1A 5L6NH 3SV7A 4Y7AA 3BEUA 3ZV9A 4LK4A 2OBOA 1KXCA 1HXFH 1EP6A 2VWNA 4AZ2B 1XVOA 3HK3B 1UK2A 3T28A 3U8RH 1W10U 2GGVB 1QFKH 1Y3VA 3RM2H 1G30B 1OWEA 1D6WA 3ZVEA 1BQYA 5GJ4B 3B8JA 1TGNA 6GCHF 5EODA 1V6DA 4F49A 1A46H 1C5WB 3W95A 4IC6A 1ELGA 5C1UA 3E3TA 3EDXB 1ANCA 2EC9H 4A1XA 3P8OA 2AMQA 2BX3A 4UFEH 4AYYB 1O5CB 1QB9A 1AE8H 1YLDA 2WPJS 3BIUH 1MTVA 5FXLA 2ALPA 1SGTA 2C8WB 3GDVA 3KIDU 3BTDE 3LGWA 3FP8E 2Z9JA 2ZHQH 2CMYA 1GBFA 1S82A 1N8OB 2ANKH 1KLTA 5JBBS 3RMOH 3BTWE 2HLCA 1HLTH 1O2WA 1TNHA 1EQ9A 1BBRK 1RGQA 5FPSA 1AVWA 1JRSA 3MHWU 2IN2A 4R0IA 3L6PA 3M37A 1GI3A 1ZRBA 3BIVH 1ZZZA 1E37B 1MH0A 2QF0A 3SHAH 3E90B 3Q77A 3VXFH 3PLKA 2TGAA 1FQ3A 3ODDA 1C4Y2 1TNIA 1QQUA 1GBHA 1GHVH 2FDAA 3FP7E 2GMTB 2PWXA 3RU4E 1DDJA 1GVKB 3MNCA 1GBCA 3E0NB 5DP5A 3STJA 1HJAC 1K1IA 3GY2A 3ZZ3A 2TIOA 1KLJH 2W7SA 1OKXA 1SGQE 1TNLA 3RU4T 2HNTF 3TH4H 4ESTE 3JZ1B 1P9SA 4FVDA 3TGJE 5A09A 1AY6H 4MPWA 4BAQB 7KMEH 2A2XH 3TK5A 2ANWA 3QO6A 3BEIB 2R0LA 1K1MA 1MTNC 3GY5A 4H4FA 2A45B 3RXQA 1PPBH 4TWYA 2SGFE 3SU2A 4X6OA 5EPYA 1ZPBA 2CN0H 4RKOB 3SU5A 2QYIA 1AFQB 1D6RA 1UVTH 2ZU5A 1A0HB 3TH2H 1T32A 3BTHE 2NU2E 2VIOA 3ATMA 2NU1E 1Z71A 3MI4A 1W2KH 1TMTH 3M36A 1YPJH 1EX3A 2AGEX 1P2IA 2DUCA 1G3CA 5T3HA 2G5NA 3A8BA 1SFIA 4ZH8A 2BXUH 5GDSH 1TFXA 4ASHA 2EI7A 1P2NA 4JZIA 2GCTC 1DWBH 3Q00A 3QN7A 2V6NA 3DHKH 2GV6A 1LPKB 2ZEBA 1LHFH 3TJNA 1O39A 1YLCA 1BJUA 2C4FH 1RFNA 1HV7A 3EA9A 4CHAC 5ABWA 5E2OA 4FXGH 1CA0B 3SNBA 1FY3A 4WH8A 4KP0A 5A0BA 3HKIB 8ESTE 1V2MT 1K1LA 3S69A 3LGIA 1AKSB 3CP7A 3NUMA 2ZI2H 1OPHB 1ELBA 1LDTT 2OTVA 3ZZAA 1GHBG 2F9UA 2P16A 2AGGX 1VR1H 4DJZB 1D3TB 1TOCB 3K6YA 1W13U 1MU6B 4Y8XA 1OWJA 3HGNA 2NWNA 3RXGA 4A7IB 2BQ7B 3M7QA 4ZKRU 2Y80A 5DP6A 1FDPA 4UFFH 3SUGA 1H8DH 1ZMLA 1GHYH 1ESBA 4ZKSU 5C2ZA 1OP0A 3LIWA 1ZHRA 4ZMAH 3PROA 1J9CH 1HAIH 3QDZB 1EP5A 3QK1A 1BBRH 1DS2E 1AFEH 1KDQB 5DK1A 2K1QA 2ZDVH 3IG6B 4TY7A 1ARCA 1W7GH 2XBWA 1GMDF 1NPMA 4X1NU 2UUYA 4YLUA 3KHVA 1BTYA 1CVWH 3OY5U 4MNYA 4JYTA 1S81A 1P02A 1LHGH 1E35B 2WUBA 2OCVB 2C8YB 3FFGA 3RM0H 3QX5H 3SHCH 1IOEA 4TPIZ 1Z8IB 3SI3H 3VB3A 2ZHEH 1RTLA 1F0TA 4IMZA 5DGJA 2GZ8A 4GHQA 2G8TA 4BNRA 5PTPA 3NWUA 3TJOA 1XVMA 2BLVA 1DICA 1IQJA 1SHHB 4JK5A 3LGVA 1SSXA 1J14A 1ANEA 1GCTC 4CRCA 3A86A 1BOQA 3UWJH 2Y5HA 4U01A 2J4IA 1HJAB 4MNXA 4NFFA 2GZ9A 1GDNA 3VGCB 1QL7A 1THSH 2FOAA 5I25A 1A3BH 2KAIA 2A4OA 3ZZ7A 1ETSH 1S5SA 1D9IA 1SGYE 1UTQA 3T5FH 4Y7BA 3K9XB 1FUJA 2ZKSA 3B9FH 4A92A 1EKBB 3Q76A 1MAYA 1CHGA 1GBMA 3PV4A 2A2QH 4D9RA 1Y3UA 3SU3A 2STBE 1PYTD 3OU0A 2FX4A 3TGIE 2BD8A 1MAXA 3SQEE 2A1DB 2Z7FE 1SGRE 2ZDNA 2ZGBH 2R0KA 3E8LA 1DSTA 2ZG0H 7GCHF 4YOIA 3UFAA 1K1JA 2Z3EA 3NK8A 2P95A 3S7KB 5EPNA 3RC4A 2SGAA 1UO6A 5T6DA 1FN8A 1DLEA 2OQ5A 1C1OA 2J34A 1IQNA 1TMBH 1LTOA 1ZSKA 2V35A 1V2QT 1OWDA 1PQ7A 4TY6A 1C5LH 4UE7H 2ZHDA 1Z1IA 4JK6A 5TJXA 1O2GH 5EQSA 5DO4H 1OP2A 1LHEH 4WVPE 1O5EH 4CBNA 2VVUA 2VH0A 2AIPA 4ISLA 2BB4A 1QL8A 4Y10E 1NT1A 2FXRA 1D3PB 4K8BA 1THRH 1QA0A 4J1YA 1ELCA 3T25A 1GMCG 1V2PT 1C5QA 2P93A 2BQ6B 3GCTG 3KL6A 3S9BA 1C9PA 1ESAA 6CHAC 4ISOA 2JH5D 4SGAE 5L2ZH 1C1UH 2ESTE 1BZXE 3RMMH 1B0EA 1NO9H 2A0QB 5J4SA 3N7OA 4ZHMU 4H6TA 2VB0A 2ODQA 1BITA 1IQFA 2EI8A 4XDEA 2VU8E 3SZNA 1S6FA 3BSQA 2BLOA 5C3NA 1SLWB 2PKSC 4GAWA 3RMLH 5JB8S 3A8AA 1GWAA 3BTFE 4Y0ZE 1C5XB 3V7TA 1F5KU 2ZFQH 4DIIH 3GYLB 4NWLA 1YYY1 2ZPRA 1C1PA 5DJ7A 4I8LA 3QWCH 1BRCE 1MCVA 4B75A 5FX6A 2BY7X 1O5GH 2Y5GA 4FUEA 2ZCHP 2GDDA 1GI2A 3LJJA 1O2RA 1EPTA 3KQDA 1TAWA 4RKJB 2VIPA 3PYHA 4LOYH 1FN6A 1OWKA 1C1WH 1QQ4A 2BY6X 1QHRB 1VCWA 1WQVH 2ZGCA 4AB9A 4INKA 1O3AA 2BY9X 3V0XA 3GY7A 4BTTB 1N6YA 2J92A 4AFZA 4A5TS 1O2XA 1H8IH 4HI3A 1D3QB 1O2IA 2W26A 5JDUB 1O31A 2VJ1A 3TU7H 3BG8A 2ZFRH 1RIWB 2AH4X 4CBOA 2VWMA 2FOHA 1C5PA 2AIQA 1ZTKA 2BY8X 3PMJA 2QGRA 1QB1A 1CE5A 1ZGIA 1FAKH 3HATH 3FZZA 3ZZ4A 4BOHA 3SBKA 3SJKA 2BZAA 4O97A 2FOMB 4X2XA 2TBSA 3O8BA 3TITA 3RXDA 2R2WU 2NU4E 1UVUH 2VIVA 5A8ZA 3AAVA 1HDTH 5FBIA 2VGCC 1P57B 2FX6A 1C2KA 1SOTA 2OC0A 2O8MA 5HMAA 2GX4A 2QC2A 1VJ9U 3AVZA 2ZU1A 3OSYA 3PLBA 3QTOH 3F6UH 2BD3A 2WV4A 2V3HH 1EASA 2ZA5A 1Y3XA 3P6ZB 3KGPA 1O2HA 2OUAA 4B76A 2BTCE 3W94A 1SGDE 3BTEE 1C5ZB 1KSNA 4X8SH 1GBAA 4GLYA 1FIZA 3MH6A 1T8NA 3MU5A 1SG8B 3RXCA 3TNSA 1UHBA 4ISHH 1TA2A 1E38B 2OC8A 2M5TA 3M35A 1NRNH 5GCHG 2Q6GA 3MYWA 1N1LA 1MKWK 4AX9H 2FMJA 1AHTH 3MO9A 3HKJB 2FYRA 2PKAB 4X6NA 1XKBC 4ABDA 2QV1A 2KAIB 5IDKA 2RDLA 2H5DA 4FUHA 4NA9H 1H9HE 2XCNA 3F68H 3TK6A 3SNEA 4WMFA 1SQOA 2ZPSA 2BM2A 2PTCE 1TX8A 3F9HA 4UFDH 1L1NA 1OWIA 4ABAA 2HNTC 1GI8B 4JCNA 4O3TA 4Q7YA 3D65E 4AN7A 2P94A 1L4DA 1SLVB 4K1SA 3D49H 3F1SB 2XW9A 1UK3A 1H9LB 1ZGVA 1ETTH 3U9AH 1BTUA 1CT0E 1ZRKA 1GI0A 4WMDA 2G81E 2PSXA 1GHXH 3LKWA 1YPEH 4XSKU 1ZYOA 2IPHA 2HGTH 1K22H 1SB1H 5JPMH 1AB9C 5LGOA 1P09A 2FOBA 1ZJDA 2GCHF 1EOLA 1GG6B 1NRQH 2O8LA 3RXLA 2Q6FA 4ZHLU 1NY22 5C20A 1MBMA 4NG9H 2ZDAH 4ABFA 2FODA 1MTSA 1BMNH 3V13A 4CH2B 2LNCA 1O38A 2J38A 1CBWC 3A80A 2A4RA 3KEEA 4Q7XA 3UNSA 5JBTA 1IQIA 3GCHC 3MU1A 2QIQA 2UUKB 1ELEE 1O3BA 1Q31A 2R9PA 4Z6AH 1RJXB 4XFQA 1JMOH 2FESH 4Y79A 1G2LA 5G4BA 1LVMA 4B71A 1O34A 5DP8A 1O2TA 2BVSH 1EB2A 4JZEH 3AW1A 1O2SA 4Q80A 2QXIA 3IITA 2BLWA 1EAIA 1KXDA 2W3IA 1V2NT 3BTKE 1KXFA 1Z7KA 4JZDH 2FYQA 1J8AA 3BTME 1TQ7B 4FVBA 3HPTB 1C1NA 1J17T 6GCHG 5HM9A 1CGIE 2PGBB 5ESBA 4X2WA 1VZQH 1C1VH 3A85A 1RD3B 4FUBA 3UOPA 2GVFA 1DUEA 1EAUA 1BUIA 1NESE 2Y6TA 2VGCB 4AOQA 2ULLA 4IN1A 4O03A 1PQAA 1AD8H 2BVXH 5CMXH 1XXFA 1OS8A 3RXPA 2XWAA 3V12A 1EPTB 1VITF 1HIAB 3RXOA 4DOQA 1GBLA 5EGMA 3A7ZA 1SHYA 2ZHFH 1JRTA 1VITG 5A0AE 2G4TA 1VITH 5K7RA 1AVGH 4ZXXH 1H1BA 5A2MH 4FUDA 3A89A 3EGKH 3M3SA 4NZQA 3QUMP 1MKWH 1B0FA 5C1XA 3EQ0H 5FCKA 1BIOA 1AVXA 3SU0A 1G37A 3RC6A 2H5CA 2UUFB 4FU7A 1CA8B 1HJ9A 1V2OT 3OTJE 2F9OA 1Z8JB 3NZIA 5DG6A 1XUGA 3ZVAA 4CR5A 2OBQA 1GJCB 1ZSJA 4Y6DA 1CHOF 1MQ5A 1HAZB 3M7TA 4HTCH 3DD2H 4OS5A 2ZZUH 9ESTA 1A61H 1SLXB 1WCZA 1TPPA 2A7CA 1TPSA 1UCYK 3L3TA 1GMHF 3UUZA 1BDAA 2BMGB 4MPXA 4DG4A 3M3TA 5BRRE 1W3CA 2ZFTA 2QN5T 2ZDMA 5EQQA 2BVRH 1D4PB 4A6LA 3E16B 1O2ZA 4H6SB 1ANBA 1QGFA 2EI6A 4ABBA 1AUTC 1C1MA 1EAWA 4JZ1A 5EU8A 4B73A 1F5RA 4XBBA 3A8CA 3GY8A 4YM9A 2Z9LA 1OX1A 2D26C 5EXNA 3PO1B 1AN1E 4B1TA 2VNTA 1L2EA 5EG4A 1FPHH 2PHBA 3U1IB 5C5NA 1GBDA 4MVNA 4I8KA 5EQRA 1P01A 1UHBB 3KQCA 3A88A 2ZC9H 4NFEA 1NU7B 2GT8A 1U6QA 1LKBA 2TRMA 2ZTZA 2FIRH 4CRAA 1TX7A 2XBXA 2BDIA 2GT7A 4JZFH 3O8CA 1Z6EA 1O3KA 1GBJA 2QXGA 3BG4C 1CBWB 1NC6A 3BF6H 1EUFA 1VCPA 2SGDE 2HPQH 4Y11E 1Y3WA 4AGKA 5AF9H 5HXFA 1E36B 3URCA 3SJOA 5CHAB 1FNIA 5F03A 2R3YA 2ASUB 3F9GA 2SNWA 3BTGE 1IQHA 1CT2E 1CQQA 4X1PU 3SI4H 1QA7A 4OS4A 4HGCA 2ZECA 5AHGH 1W11U 3PWCA 8LPRA 1S0QA 3BN9A 4ZKOU 4D76A 2W3KA 3L33A 1TX6A 2AEIH 4HFPB 1K9OE 1UJ1A 1EB1H 1SOZA 5DPAA 1A5HA 3P95A 2R3UA 3E1XB 2WYJA 4NWKA 3RXMA 4AFUA 2FOEA 1Y59T 5T6FA 1SGCA 1W12U 1NM6A 3MO3A 4J2YB 3MH7A 4WJG2 1ABJH 1W14U 1P8VC 5L30H 4GHTA 4JMYA 2Z9GA 4I8GA 3GY6A 4TWWA 1HUTH 3GICB 3RLYH 2CHAC 1YGCH 2W7UA 1BJVA 2CGAA 3MU0A 2ZDKA 5E8EH 4WXIA 1SFQB 4B2AA 2O8UA 3U69H 1L4ZA 4MQAA 2Z9IA 2IOTA 4X8UH 1O5DH 1EZSC 2CJIA 2RG3A 1DY9A 4TYDA 4O9VA 1GMDG 2WPIS 1K21H 3TH3H 1GBKA 1V2TT 4SGBE 2CF9H 1OYTH 4HZHA 2SNVA 5LH8A 1C5TA 1ARBA 1GI9B 1XUIA 2XCFA 2Y81A 3KQEA 3STIA 1O35A 1DANH 4MTBA 2ZQ2A 3VFEA 4K3JA 4GSOA 3PTBA 4KGAA 2P3FH 1C5SA 1TA6A 2FTMA 1RTKA 2TGDA 1UCYH 4AGJA 1GHWH 2Q6DA 3S7HB 1ZHMA 3RXAA 4FU8A 1QRZA 1IQKA 3VPKA 1N6XA 1LHCH 1BRBE 1FY1A 1ZMJA 3NKKA 2ZWLH 4OS7A 3SGQE 2PKAA 3PLPA 2ZFFH 1LVOA 1GJBB 1BCUH 2BZ6H 4X8VH 3I29A 1ZTLA 3HGPA 1C1TA 2UUJB 3AW0A 4TPYA 2F3CE 1TOMH 3FANA 1MTNB 3TIUA 1DM4B 5DP4A 1C5NH 1YBWA 3SNAA 3P8NA 2FZZA 3RXVA 4BXWA 3RXFA 2WPMS 4GCHF 1BRAA 1YM0A 3Q3KA 3SU6A 4ZAEA 1C2GA 2P8OC 1UCYE 1MD7A 3OYPA 2FEQH 1DE7H 2FLBH 1DPOA 1G36A 3K65B 4B2CA 3ATIA 3PMBB 2OQUA 1AIXH 1OWHA 1O2VA 4DVAU 1TRMA 2BQWB 3SGBE 4CRFA 3C27B 4Y8ZA 1DUAA 2ZTYA 2GV7A 1TBZH 3LGUA 3UR6A 1BB0B 4IW4E 5I46H 1PPGE 3SQHE 7GCHG 2JETC 4YT7H 3IWMA 2G55A 2GCTB 5FX5A 3VB4A 1G32B 2ILNA 3P17H 1CU1A 3TNTA 3FVFB 2HOBA 2GZ7A 1YPMH 5C1YA 1QJ6B 2BLQA 4NIWA 1OSSA 4CHAB 4B74A 4OGXA 4ISNA 1AI8H 4ABGA 1AQ7A 4WMEA 2VVCA 3KCGH 1ZR0A 2BD5A 2ZFPH 1P04A 2A5IA 1AZZA 1DY8A 3RC5A 4DURA 1QRXA 5HM2A 5EW1H 2GP9B 3ZVFA 4I33A 1GGDC 3M7UA 1NFWA 1O2YA 1WSSH 3RXBA 2O8TA 5JBCS 1EOJA 4VGCC 5A8XA 5F8TA 3SNCA 3MWIU 2HPPH 2ZU3A 5TCCA 4UONA 1TYNA 2JH6D 3A87A 2BD9A 2FP7B 2P59A 2PFEA 3ZZCA 1MCTA 1ZHPA 1C2MA 1GBEA 3UQVA 1QL9A 2SFAA 1H9IE 4YESB 4K69A 1SGPE 1DFPA 1S83A 5EOKA 3VB5A 1SGNE 2G51A 3DUXH 3M5NA 1ZLRA 4U30A 2B9LA 1V3XA 2D1JA 4ABJA 1TGSZ 1C9TA 4Z0KA 1ZOMA 3H5CB 2XNIA 1HIAA 3TK9A 3FP6E 1J16A 2YNBA 1TPOA 4FUGA 4IGDA 2PTNA 1RRKA 3DFLA 1G3BA 4X1SU 1RXPA 1Z8RA 4OS6A 1HAPH 1WU1A 1XMNB 2C8ZB 2PV9B 2IJOB 4KTCA 2C8XB 4ZHAA 4X0WU 1GDQA 1MQ6A 2VH6A 2A7JA 4Q2KA 1C2DA 1LQDB 8KME2 1HGTH 1C2FA 4KELA 1NROH 1A2CH 1LHDH 2NU3E 1P9UA 4X1QU 2ZQ1A 1GCTB 4NCYA 1CT4E 1O2QA 1DVAH 3DT0H 2J95A 2F91A 3PM3A 1L0ZA 2AMPA 2TGPZ 3E91A 1IAUA 3PTNA 1BHXB 1GJAB 1YPGH 4E7NA 4AFQA 4X1RU 1C2HA 2PUQH 2VIQA 1XX9A 1HAXB 2BDGA 1BTWA 1EATA 5GIBA 3PMHB 2QXJA 1QRWA 5LPRA 1AUJA 3E6PH 1G3DA 2CXVA 2H9EH 3A8DA 3A7XA 1V2JT 4MPUA 2WUCA 2Z94A 3SV8A 3QLPH 4FUIA 3UOUA 1TIOA 1EAXA 1O3MA 1D3DB 1TMUH 1W0ZU 4ABEA 1IQLA 1O3HA 1N8OC 2GKVE 1KTSB 2C93B 1AU8A 4FU9A 5DP3A 3SUFA 1DXPA 2A31A 4DGJA 3URDA 1TGTA 4NIYA 1CGHA 1NRRH 3RXTA 1FZZA 2ODPA 2PUXB 3A82A 1IQGA 2Z9KA 4ABIA 1UTMA 1Q2WA 1V2ST 1Z6JH 1GI1A 1ABIH 1P2JA 4MNVA 3GCNA 5A8YA 5LPFA 3ZVDA 1Z1JA 3UPEA 1O2LA 1YC0A 4WH6A 3RXRA 3DA9B 5IYTA 1DWEH 1Y5BT 4B2BA 1FLEE 3B23B 4PROA 5LPEA 1ZSLA 1C2LA 5JBAS 2FOGA 3ZZ8A 3ENSB 3MU8A 4I32A 1OOKB 4BAOB 1O37A 1V2RT 2GMTC 1NFUA 2TGTA 1O5BB 2DE8A 4Q7ZA 1FV9A 3SJ9A 3LGTA 6CHAB 1MZAA 1QBOA 4ISIH 2SGPE 1BTPA 1TWXB 2VWOA 3OY6U 1P05A 1Y3YA 1O2OA 2AGIX 5FAHA 2BX4A 1A0JA 5AFZH 1LVBA 5FHTA 3UNQA 1C5OH 4IMQA 1F92A 4X2YA 1WV7H 5DP9A 1O30A 3V3MA 1TLDA 1C5UA 3SJIA 1GJ8B 1LKAA 2PKSB 3P70B 5F6MA 1GJ5H 1SGIB 2H6MA 2ZDLA 3M5LA 1AFQC 2JH0D 2TPIZ 4NIVA 1LCYA 2GCHG 2LPRA 1BRUP 4F4OC 2VIDA 1BTXA 2Z3DA 4NSVA 2R2MB 2PLXA 1YKTA 2WPKS 3G01A 3NPSA 1SQAA 1W0YH 4QT8C 2ZFSA 2BD4A 2WINI 1DT2A 4H42U 2ZCLP 3Q3YA 1HPGA 1IHSH 4WY3A 1C5MD 3LONA 1TRYA 1VGCC 1FY5A 1XXDA 4DT7B 8GCHF 1GVLA 4AG2A 1SGEE 1GHAF 2QXHA 4K1TA 3VXEH 1A7SA 4XBDA 1TB6H 2AS9A 1UTPA 1V2WT 2VWLA 2B7DH 1ELDE 5HGGA 1HYLA 1ELVA 1P0SH 1S6HA 3U1JB 1KY9A 2BDCA 3PMAB 5ETXA 1CA0C 1WUNH 4R8TB 1DWDH 3LC3A 1FJSA 1YF4A 2BY5X 3H7OA 3SJ8A 5JB9S 1PJPA 2BD2A 4IS5A 4BXSA 2OD3B 1Y8TA 1EJMA 1YCPM 1HCGA 7ESTE 1P06A 1QR3E 1GL1A 3RXSA 1KLIH 4LXBH 1FAXA 1W8BH 2F9PA 3P92A 2HALA 3MH4A 1G9IE 3A7YA 3S9AA 2C90B 1HNEE 2ZHWH 3QZRA 4WF8A 2AERH 3VB6A 3LU9B 1S84A 1F7ZA 4BTIB 1AO5A 1V2UT 2SGEE 1O2MA 3BEFB 4DW2U 2Y5FA 4E05H 3NCLA 3U8TH 1ANDA 5BPEA 1YPKH 2VINA 4ABHA 1L1GA 3A84A 5FPYA 1JIRA 1MD8A 3JZ2B 1VJAU 2ZPQA 1BT7A 4MG3A 3T29A 3LDXH 2ZF0H 2VIWA 3S0NA 2B8OH 2RCEA 1HAYB 2EA3A 4IC5A 2XTTB 4GVUA 3MOCA 3TVJB 3ZV8A 1C4V2 4I31A 3RXIA 4YT6H 1SBWA 1KXEA 1FPCH 1FMGA 3VB7A 1HAVA 1UVPA 3TJVA 1KIGH 4XE4A 1ACBE 1BMLA 2XXLA 4ZKNU 3BTTE 3NXPA 4X6PA 2BOKA 3SUEA 3EA8A 3LOXA 1PQ5A 2O9QA 1O2KA 2H1UA 4IN2A 1CHOG 2UWPA 4K60A 3UY9A 4GPGA 3MO6A 4UFGH 3S9CA 1CGJE 1H4WA 2DE9A 1GMHG 3PB1E 2FI5E 3PWBA 4K8YA 5EXMA 1SVPA 2Q1JA 2QF3A 4E06H 2D2DA 3TJUA 2ZO3H 4E7RG 1AZ8A 2A7HA 1XUKA 3A81A 3VGCC 4YZUA 3A7WA 1GI5A 3MH5A 1O3JA 3EYDA 4LZ1H 3GY3A 2A4GA 3LT3A 5FCRA 1GI7B 2C3SA 1GJDB 1QURH 1T8OA 3SU4A 4BAHB 1AB9B 1C1RA 3UQOA 2F9VA 1TNJA 3UR9A 4D9QA 1HRTH 4I8JA 3GYMA 2BDHA 2FOCA 3ZYDA 1GPZA 4MNWA 1NZQH 2HWLB 1KXBA 3UWIA 1UVOA 4ZXYH 3T62A 1QJ1B 4INLA 1O3OA 3VEQB 2O8WA 1TBQH 3ZZ5A 1QBNA 3AAUA 3ATWA 3MTYA 1Y5AT 1K1NA 3GCHB 1MKXK 1SGFG 1FI8A 2J2UA 2ZTXA 2A5KA 2EEKA 3ZZBA 2PW8H 1O2JA 4BANB 4D7FA 1VGCB 3QTVH 1P11E 3T2NA 2HNTE 2OLGA 4DIHH 1O3IA 6LPRA 2AMDA 1P3CA 2FPZA 3SUDA 1DX5M 2FTLE 1GBIA 1ORFA 3K6ZA 3D23A 1K1OA 1S85A 1UMAH 1O3LA 2YNAA 1C1SA 3MNXA 4BAKB 2XRCA 1DLKB 2RA3A 3SNDA 4K5ZA 3UNRA 1IHTH 1MTUA 4A1TA 4AFSA 4K1EA 1GHBF 2ZCKP 3GDUA 1HAHH 4WXVA 4YLQH 3GCOA 2QCYA 3OX7U 3SV6A 2Y82A 3TLOA 5J4QA 1GHZA 5A0CA 2P3UB 5F8XA 2AYWA 1MBQA 1TABE 1XUJA 1HJ8A 1P3EA 4JYUH 3QZQA 1DITH 3A7VA 4FUFA 1BTZA 1OP8A 3KN2A 1Y5UT 5GPIB 1DWCH 6ESTA 3UREA 1L1JA 3SV2H 3ITIA 2H9TH 2FO9A 4OGYA 1GBBA 5DKMA 3GY4A 2ZGHA 1S0RA 1BA8B 3RXKA 1P03A 1GI6A 1C4U2 1O5AB 2QY0B 4I8HA 2Y7XA 3F9EA 4THNH 1EZQA 3QGNB 2XBVA 4AB8A 1XUHA 1TNKA 3I78A 4CH8B 4X6MA 2I6SA 3K2UA 1T8MA 3CS7A 1K2I1 1NN6A 3ZVCA 2ZGJA 1ESTA 4JYVH 5GWZA 1A5GH 1O3GA 3EA7A 1C2EA 1F0SA 1WBGB 1YPLH 3A83A 4O3UA 1JBUH 4OS1A 1FY4A 3P8FA 1EJNA 1ELAA 2D8WA 2G5VA 1RIWC 2Y7ZA 3RP2A 1SLUB 1BBRE 1UTJA 1WOFA 1F0UA 1P2OA 2ZP0H 2ZGXH 4BTUB 1GJ7B 1NRSH 5HYOA 3M61U 1GCDA 1C2JA 1ETRH 3U98H 5EW2H 5FPTA 3O8RA 1NFYA 5B6OA 1UTNA 1Z8GA 1GJ9B 1ZMNA 1EZUC 1FY8E 1SI5H 5AFYH 4GCHG 1B7XB 2WYGA 4MDSA 3R0FA 3RUOA 3RXJA 1MUEB 3LH1A 3TGKE 1F2SE 1EJAA 1BMAA 5JYIA 1SC8U 4U32A 2Z3CA 1QJ7B 3RXEA 2A32A 1O3NA 2HRVA 1HAVB 2ODYB 2ZU4A 1MKXH 1SQTA 1TGCA 2FOFA 3CENA 4UDWH 3BG4B 4NA7A 1EZXC 3MFJA 2STAE 4UD9H 5AVDA 2J94A 3SOSA 3UTUH 4OS2A 1OXGA 2F83A 1INCA 3LPRA 1O0DH 1NFXA 2WV5A 3ZZ9A 1HXEH 2WPLS 5C67A 1SPJA 1YP9A 3WY8A 1V2KT 1HBTH 3HK6B 3MMGA 5L2YH 1PYTC 1QBVH 4BAMB 2ZIQH 2PR3A 4KTSA 1TNGA 1C2IA 1YPHC 3ELAH 1LQEA 9LPRA 4IBLH 2FS9A 1GI4A 1LMWB 1ZJKA 1GMCF 3P8GA 1K28D 1WTGH 3KNXA 3GCTF 4X2VA 2OP9A 1SL3A 1LPZB 5FBEA 2PSYA 1HFDA 1A3EH 2UWOA 1HAGE 1TGBA 1O2PA 3UIRA 4DCDA 3RXUA 1UK4A 1NU9A 1O36A 2GTBA 4CREA 4NA8A 5ESTE 3A7TA 5K0HA 4M7GA 4XBCA 1PPCE 3GDSA 2CF8H 3R3GB 1SR5C 1UTLM 2CHAB 2SGQE 1THPB 4Y0YE 1O3PB 1GJ4H 1TPAE 2QA9E 2XC4A 2FM2A 1PFXC 1A5IA 1BMMH 2GDEH 2JKHA 4WWYA 1NRPH 5SGAE 2A5AA 3M5OA 4NIXA 2XC5A 1FIWA 1O3DA 5E0HA 1O3CA 3FZDA 1AWHB 1V2LT 2XYAA 3LC5A 1MTWA 3TPIZ 1GG6C 3GISB 4KTUA 1KTTB 1CO7E 3O8DA 2BD7A 1QCPA 2J9NA 1B5GH 3EE0B 4A1VA 2GD4B 1F5LA 1P10A 4KKDA 4FUCA 1ELFA 2ALVA 1O3EA 2H2ZA 3C1KA 3SGAE 2FLRH 2FWWA 3SO3A 4U2WA 2W5EA 1T31A 2V0BA 1F0RA 3RDZA 3KF2A 3MU4A 3RU4D 1TALA 1YCPK 1XM1A 1JOUB 1UTOA 4NGAH 4YO9A 3RXHA 4D8NA 1PPZA 2XWBI 1UTKA 5C5OA 2BDBA 4FUJA 5H4IB 4YTAA 1C1QA 1BTHH 1NS3A 1KXAA 5E0GA 1T4VH 1QB6A 1UVSH 1JIMA 1TE0A 1PPEE 3MNBA 4X8TH 1BHXF 1C5VA 1G2MA 1JXPA 4RSPA 1P2QA 1QY6A 1C5YB 5DP7A 1NTPA 3D62A 2BXTH 1A4WH 2ANMH 1DOJA 1GBTA 3FAOA 2P8OB 3ATKA 3SW2B 1ZPZA 1ZTJA 1AGJA 1T4UH 4Y71A 3SN8A 3AASA 1O3FA 1IQEA 1TRNA 1O5FH 5T6GA 3Q3XA 3ODFA 4AYVB 5E2PA 1MZDA 3ATLA 7LPRA 2B5TB 2RA0A 3SORA 2AFQB 2Z6BD 3T27A 4AORA 3KQBA 1GVZA 1TBRH 3I77A 4MLFB 1EPTC 1E0FD 2G00A 2HVXA 2JETB 3H7TA 4GUXA 3T26A 1KYNA 1A0LA 1LPGB 1RS0A 1IQMA 1E34B 4ZROA 2OINA 4XOJA 4ZUHA 2OC1A 4Y8YA 1C5RA 1M9UA 2F9NA 1W7XH 2F9BH 4DY7B 1O2NA 5GCHF 1RTFB 1LVYA 3RMNH 3F9FA 2VVVA 3ZVBA 5TCAA 2QAAA 2G52A 2FI3E 1P2MA 1SGFA 1DSUA 3SV9A 2BHGA 1G3EA 1X7AC 1Q3XA 1GL0E 4K2YA 4CRDA 1EXFA 1O32A 1V2VT 4INHA 1PQ8A
chains in the Genus database with same CATH superfamily
1JWTA 1WAYB 2WPHS 1K1PA 1PPHE 4YOGA 3ZZDA 1GDUA 3LGYA 1GGDB 2V3OH 3QGJA 2H9HA 2XC0A 1AWFH 2CV3A 1QTFA 1WTHD 3RLWH 2YOLA 1A1RA 1XUFA 2UWLA 1AE5A 1CSOE 3ZYEA 1LO6A 4VGCB 3E0PB 2KCAA 3ZVGA 5GXPA 1VCQA 2BDAA 4MPVA 3AK5A 3WWFA 2BYAX 2OC7A 4I7YH 1P12E 2A4QA 3CNRA 4CR9A 4Y76A 2JJ2D 5E0JA 3VG8A 1O33A 1WYKA 1QNJA 1AKSA 1TQ0B 1T7CA 2ZNKH 3CS0A 2I6QA 3M3VA 3F2FA 1AMHA 1TONA 2FS8A 2NU0E 2P3TB 3BTQE 3PO1C 1PPFE 2OXSA 4YOJA 3ZZ6A 3LJOA 3ESTA 4D7GA 1MU8B 4NSYA 2ZU2A 1P2KA 2BOHB 1GJ6A 2B0FA 2G4UA 3GOVB 3BV9B 1ZPCA 2LP6A 5EXLA 5F8ZA 4LZ4B 4RN6A 1MMJN 1ID5H 1OYQA 5C0UA 2BDYA 4UEHH 3MNSA 1J15A 2ANYA 3M5MA 4CRBA 5CE1A 2THFB 1XKAC 1HAOH 1HB0B 1YPHE 3DFJA 8GCHG 1KDQA 1FONA 1YCPH 2FI4E 1DXWA 1GHAG 3SU1A 1ELTA 1QIXB 1T8LA 3U8OH 3PRBA 3EAJA 4CRGA 1WQSA 4F55A 1O2UA 1SMFE 2XBYA 2PGQB 1FXYA 3LH3A 5CHAC 4NZLA 4AG1A 5L6NH 3SV7A 4Y7AA 3BEUA 3ZV9A 4LK4A 2OBOA 1KXCA 1HXFH 1EP6A 2VWNA 4AZ2B 1XVOA 3HK3B 1UK2A 3T28A 3U8RH 1W10U 2GGVB 1QFKH 1Y3VA 3RM2H 1G30B 1OWEA 1D6WA 3ZVEA 1BQYA 5GJ4B 3B8JA 1TGNA 6GCHF 5EODA 1V6DA 5KGOA 4F49A 1A46H 1C5WB 3W95A 4IC6A 1ELGA 5C1UA 3E3TA 3EDXB 1ANCA 2EC9H 4A1XA 3P8OA 2AMQA 2BX3A 4UFEH 4AYYB 1O5CB 1QB9A 1AE8H 1YLDA 2WPJS 3BIUH 1MTVA 5FXLA 2ALPA 1SGTA 2C8WB 3GDVA 3KIDU 3N99A 4F48B 3BTDE 3LGWA 3FP8E 2Z9JA 2ZHQH 2CMYA 1GBFA 1S82A 1N8OB 2ANKH 1KLTA 5JBBS 3RMOH 2WZQA 3BTWE 2HLCA 1HLTH 1O2WA 1TNHA 1EQ9A 1BBRK 1RGQA 5FPSA 1AVWA 1JRSA 3MHWU 2IN2A 4R0IA 3L6PA 3M37A 1GI3A 1ZRBA 3BIVH 1ZZZA 2J5UA 1E37B 1MH0A 2QF0A 3W1EA 3SHAH 3E90B 3Q77A 3VXFH 3PLKA 2TGAA 1FQ3A 3ODDA 1C4Y2 1TNIA 1QQUA 1GBHA 1GHVH 2FDAA 3FP7E 2GMTB 2PWXA 3RU4E 1DDJA 1GVKB 3MNCA 1GBCA 3E0NB 5DP5A 3STJA 1HJAC 1K1IA 3GY2A 3ZZ3A 2TIOA 1KLJH 2W7SA 1OKXA 1SGQE 1TNLA 3RU4T 2HNTF 3TH4H 4ESTE 3JZ1B 1P9SA 4FVDA 3TGJE 5A09A 1AY6H 4MPWA 4BAQB 7KMEH 2A2XH 3TK5A 2ANWA 3QO6A 3BEIB 2R0LA 1K1MA 1MTNC 3GY5A 4H4FA 2A45B 3RXQA 5EJ1A 1PPBH 4TWYA 2SGFE 3SU2A 4X6OA 5EPYA 2IJD1 1ZPBA 2CN0H 4RKOB 3SU5A 2QYIA 1AFQB 1D6RA 2W6ID 1UVTH 2ZU5A 1A0HB 3TH2H 5IK2D 1T32A 3BTHE 5C17A 2NU2E 3OTPA 2VIOA 3ATMA 2NU1E 1Z71A 2L74A 3MI4A 1W2KH 1TMTH 2JIZD 3M36A 1YPJH 1EX3A 2AGEX 1P2IA 2DUCA 5B6LA 5CDFE 1G3CA 5T3HA 2G5NA 3A8BA 1SFIA 4ZH8A 2BXUH 5GDSH 1TFXA 4ASHA 2EI7A 1P2NA 4JZIA 4HG6A 2GCTC 1DWBH 3Q00A 3QN7A 2V6NA 3DHKH 2GV6A 5FL7D 1LPKB 2ZEBA 1QZ8A 1LHFH 3TJNA 1O39A 1YLCA 1BJUA 2C4FH 1RFNA 1HV7A 3EA9A 4CHAC 5ABWA 2JDID 5E2OA 4FXGH 1CA0B 3SNBA 1FY3A 4WH8A 4KP0A 1SKYE 5A0BA 3HKIB 8ESTE 1V2MT 1K1LA 3S69A 3LGIA 1AKSB 3CP7A 3NUMA 2ZI2H 1OPHB 4TSFD 1ELBA 1LDTT 2OTVA 3ZZAA 1GHBG 2F9UA 2P16A 2AGGX 1VR1H 4DJZB 1D3TB 1TOCB 3K6YA 5HIZA 1W13U 1MU6B 4Y8XA 1OWJA 3HGNA 2NWNA 3RXGA 4A7IB 2BQ7B 3M7QA 4ZKRU 2Y80A 5DP6A 1FDPA 4UFFH 3SUGA 1H8DH 1ZMLA 1GHYH 1ESBA 4ZKSU 5C2ZA 1OP0A 3LIWA 2VBCA 1ZHRA 4ZMAH 3PROA 1J9CH 1HAIH 3QDZB 1EP5A 3QK1A 1BBRH 1DS2E 3KQ5A 1AFEH 1KDQB 5DK1A 2K1QA 2ZDVH 3IG6B 4TY7A 1ARCA 1W7GH 2XBWA 1GMDF 1NPMA 4X1NU 1E1RD 2UUYA 4YLUA 3KHVA 1MABB 1BTYA 1CVWH 3OY5U 4MNYA 4JYTA 1S81A 1P02A 1LHGH 1E35B 2WUBA 2OCVB 2C8YB 3FFGA 3RM0H 3QX5H 3SHCH 1IOEA 4TPIZ 1K0HA 1Z8IB 3SI3H 5HKKD 3VB3A 2ZHEH 1RTLA 1F0TA 4IMZA 5DGJA 2GZ8A 4GHQA 2G8TA 4BNRA 5PTPA 3NWUA 5EIYA 1YLNA 3TJOA 1XVMA 2BLVA 1DICA 1IQJA 1SHHB 4JK5A 3LGVA 1SSXA 1J14A 1ANEA 1GCTC 2KZ4A 4CRCA 3A86A 1BOQA 3UWJH 2Y5HA 4U01A 2J4IA 1HJAB 4MNXA 3GS9A 4NFFA 2GZ9A 1GDNA 3VGCB 1QL7A 1THSH 2FOAA 5I25A 1A3BH 2KAIA 2A4OA 4P00A 3ZZ7A 1ETSH 1S5SA 1D9IA 1SGYE 1UTQA 2KCYA 3T5FH 4Y7BA 3K9XB 1FUJA 2ZKSA 3B9FH 4A92A 1EKBB 3Q76A 1MAYA 1CHGA 1WDIA 1GBMA 3PV4A 2A2QH 4XRNA 4D9RA 1Y3UA 3SU3A 2STBE 1PYTD 3OU0A 2FX4A 3TGIE 2BD8A 1MAXA 3SQEE 2A1DB 2Z7FE 1SGRE 2ZDNA 2ZGBH 2R0KA 3E8LA 1DSTA 2ZG0H 7GCHF 4YOIA 3UFAA 1K1JA 2Z3EA 2PP6A 3NK8A 2P95A 3S7KB 5EPNA 3RC4A 2SGAA 1UO6A 5T6DA 1FN8A 1DLEA 2OQ5A 1C1OA 2J34A 1IQNA 3ZIAD 1TMBH 1LTOA 1ZSKA 2V35A 1V2QT 1OWDA 1PQ7A 4TY6A 1C5LH 4UE7H 2ZHDA 1Z1IA 4JK6A 5TJXA 1O2GH 5EQSA 5DO4H 1OP2A 1LHEH 4WVPE 1O5EH 4CBNA 2VVUA 2VH0A 2AIPA 4ISLA 2BB4A 1QL8A 4Y10E 1NT1A 2FXRA 1D3PB 4K8BA 4B6FA 1THRH 1QA0A 4J1YA 1ELCA 3T25A 1GMCG 1V2PT 1C5QA 2P93A 2BQ6B 3GCTG 3KL6A 3S9BA 3N7EA 1C9PA 1ESAA 6CHAC 4ISOA 2JH5D 4SGAE 5L2ZH 1C1UH 2ESTE 1BZXE 3RMMH 1B0EA 1NO9H 2A0QB 5J4SA 3DSOA 3N7OA 4ZHMU 4H6TA 2VB0A 2ODQA 1BITA 1IQFA 2EI8A 4XDEA 2VU8E 3SZNA 1S6FA 3BSQA 4ASUD 2BLOA 2RDEA 5C3NA 1SLWB 2PKSC 4GAWA 3RMLH 5JB8S 3A8AA 1GWAA 3BTFE 4Y0ZE 1C5XB 3V7TA 1F5KU 2ZFQH 4DIIH 3GYLB 4NWLA 2WHXA 1YYY1 2ZPRA 1C1PA 5DJ7A 4I8LA 3QWCH 1BRCE 3UAIC 1MCVA 2W6JD 4B75A 3PV5A 5FX6A 2BY7X 1O5GH 2Y5GA 4FUEA 2ZCHP 2GDDA 1GI2A 3LJJA 1O2RA 1EPTA 3KQDA 1TAWA 4RKJB 2VIPA 3PYHA 4LOYH 1FN6A 1OWKA 1C1WH 1QQ4A 2BY6X 1QHRB 1VCWA 1WQVH 2KCPA 2ZGCA 4AB9A 4INKA 1O3AA 2BY9X 3V0XA 3GY7A 4BTTB 1N6YA 2J92A 4AFZA 4A5TS 1KMHB 4Q63A 1O2XA 1H8IH 4HI3A 1D3QB 1O2IA 2W26A 5JDUB 1O31A 2VJ1A 3TU7H 3BG8A 2ZFRH 1W0JD 1RIWB 2AH4X 4CBOA 4FETA 2VWMA 2FOHA 1C5PA 2AIQA 3U28C 1ZTKA 2BY8X 3PMJA 2QGRA 1QB1A 1CE5A 1ZGIA 1FAKH 3HATH 3FZZA 3ZZ4A 4BOHA 3SBKA 3SJKA 2BZAA 4O97A 2FOMB 4X2XA 2TBSA 3O8BA 3TITA 3RXDA 4AC9A 2R2WU 2KCOA 2NU4E 1UVUH 2VIVA 4P02A 5A8ZA 3AAVA 1HDTH 5FBIA 2VGCC 3F3BA 1P57B 2FX6A 1C2KA 1SOTA 2EQNA 2OC0A 2O8MA 5HMAA 2GX4A 2QC2A 1VJ9U 4ACAA 3AVZA 2ZU1A 3OSYA 3PLBA 3QTOH 3F6UH 2BD3A 2WV4A 2V3HH 1EASA 2ZA5A 1Y3XA 3P6ZB 3KGPA 1O2HA 2OUAA 4B76A 2BTCE 3W94A 3OAAD 1SGDE 3BTEE 1C5ZB 1KSNA 4X8SH 1GBAA 4GLYA 1FIZA 3MH6A 1T8NA 3MU5A 1SG8B 3RXCA 3TNSA 1UHBA 4ISHH 1TA2A 1E38B 2OC8A 2M5TA 3M35A 1NRNH 5GCHG 2Q6GA 3MYWA 1N1LA 1MKWK 4AX9H 2FMJA 1AHTH 2QF4A 3MO9A 3HKJB 2FYRA 2PKAB 4X6NA 1XKBC 4ABDA 2QV1A 2KAIB 5IDKA 2RDLA 2H5DA 3DSGA 4FUHA 4NA9H 1H9HE 2XCNA 3F68H 3TK6A 3SNEA 4WMFA 1SQOA 2ZPSA 2BM2A 2PTCE 1TX8A 3F9HA 4UFDH 1L1NA 1OWIA 4ABAA 2HNTC 1GI8B 4JCNA 4O3TA 4Q7YA 3D65E 4AN7A 1W0KD 2P94A 1L4DA 1SLVB 4K1SA 4M9FA 3D49H 3F1SB 2XW9A 1UK3A 1H9LB 1ZGVA 1ETTH 3U9AH 1BTUA 1CT0E 1ZRKA 1GI0A 4WMDA 2G81E 2PSXA 3F0OA 1GHXH 3LKWA 1YPEH 4XSKU 1ZYOA 2IPHA 2HGTH 1K22H 1SB1H 5JPMH 1AB9C 5LGOA 1P09A 2FOBA 1ZJDA 2GCHF 1EOLA 1GG6B 1NRQH 2O8LA 3RXLA 2Q6FA 4ZHLU 5F53A 1NY22 5C20A 1MBMA 4NG9H 2ZDAH 4ABFA 2FODA 1MTSA 1BMNH 3V13A 4CH2B 2LNCA 1O38A 2J38A 1CBWC 2K0QA 3A80A 2A4RA 3KEEA 4Q7XA 3UNSA 5JBTA 1IQIA 2KFWA 3GCHC 3MU1A 2QIQA 2UUKB 1ELEE 1O3BA 1Q31A 2R9PA 4I86A 4Z6AH 4ACBA 1RJXB 4XFQA 1JMOH 2FESH 4Y79A 1G2LA 5G4BA 1LVMA 4B71A 1O34A 5DP8A 1O2TA 2BVSH 1EB2A 2YMSB 4JZEH 3AW1A 1O2SA 4Q80A 2QXIA 3IITA 2BLWA 1EAIA 1KXDA 2W3IA 1V2NT 3BTKE 1KXFA 1Z7KA 4JZDH 2FYQA 1J8AA 3BTME 1TQ7B 4FVBA 3HPTB 1C1NA 1J17T 6GCHG 5HM9A 1CGIE 2PGBB 5HIYA 5ESBA 4X2WA 1VZQH 1C1VH 3SZEA 3A85A 1RD3B 4FUBA 3UOPA 2GVFA 1DUEA 1EAUA 1BUIA 1NESE 2Y6TA 2VGCB 4AOQA 2ULLA 4IN1A 4O03A 1PQAA 1AD8H 2BVXH 5CMXH 1XXFA 2GJGA 1OS8A 3RXPA 2XWAA 3V12A 1EPTB 1VITF 1HIAB 3RXOA 4DOQA 1GBLA 5EGMA 3A7ZA 1SHYA 2ZHFH 1JRTA 1VITG 5A0AE 2G4TA 3EE7A 1VITH 5K7RA 1AVGH 4ZXXH 1H1BA 5A2MH 4FUDA 3A89A 3EGKH 3M3SA 4NZQA 2F4LA 3QUMP 1MKWH 1B0FA 5C1XA 3EQ0H 5FCKA 1BIOA 1AVXA 3SU0A 1G37A 3RC6A 2H5CA 2UUFB 4FU7A 1CA8B 1HJ9A 1V2OT 3OTJE 2F9OA 1Z8JB 3NZIA 5DG6A 1XUGA 3ZVAA 4CR5A 2OBQA 1GJCB 1ZSJA 4Y6DA 1CHOF 1MQ5A 1HAZB 3M7TA 4HTCH 3DD2H 4OS5A 2ZZUH 9ESTA 1A61H 1SLXB 1WCZA 1TPPA 2A7CA 1TPSA 1UCYK 3L3TA 1GMHF 3UUZA 1BDAA 2BMGB 4MPXA 4DG4A 5KEDA 3M3TA 4B6EA 1W3CA 5BRRE 2ZFTA 2QN5T 2ZDMA 2WPDD 5EQQA 2BVRH 1D4PB 4A6LA 3E16B 1O2ZA 3DCLA 1ANBA 4H6SB 1QGFA 2EI6A 4ABBA 1AUTC 1C1MA 1EAWA 4JZ1A 5EU8A 4B73A 1F5RA 3WWBA 3OE7D 4XBBA 3A8CA 3GY8A 4YM9A 2Z9LA 1OX1A 2D26C 5EXNA 3PO1B 1AN1E 4B1TA 2VNTA 1L2EA 5EG4A 1FPHH 2PHBA 3U1IB 5C5NA 1GBDA 4MVNA 4I8KA 5EQRA 1P01A 5EJZA 1UHBB 3KQCA 3A88A 2ZC9H 4NFEA 3SYJA 1NU7B 2GT8A 1U6QA 1LKBA 2TRMA 2ZTZA 5EJLA 4RT0A 2FIRH 4CRAA 1TX7A 2XBXA 2BDIA 2GT7A 4JZFH 3O8CA 1Z6EA 1O3KA 1GBJA 2QXGA 3BG4C 1CBWB 5DN6D 1NC6A 3BF6H 5C94A 1EUFA 1VCPA 2SGDE 2HPQH 4Y11E 1Y3WA 4AGKA 5AF9H 5HXFA 1E36B 2IPQX 3URCA 3SJOA 5CHAB 1FNIA 5F03A 2R3YA 2ASUB 3F9GA 2SNWA 3BTGE 1IQHA 1CT2E 1CQQA 4X1PU 3SI4H 1QA7A 4OS4A 4HGCA 2ZECA 5AHGH 1W11U 3PWCA 8LPRA 1S0QA 3BN9A 4ZKOU 4D76A 2W3KA 3L33A 1TX6A 2AEIH 4HFPB 1K9OE 1UJ1A 1EFRD 1EB1H 1SOZA 5DPAA 2LELA 1A5HA 3P95A 2R3UA 3E1XB 2WYJA 4NWKA 3RXMA 4AFUA 2FOEA 1Y59T 5T6FA 1SGCA 1W12U 1NM6A 3MO3A 4J2YB 3MH7A 4WJG2 1ABJH 1W14U 1P8VC 5L30H 4GHTA 4JMYA 2Z9GA 4I8GA 3GY6A 4TWWA 1HUTH 3KYGA 4FOUC 3GICB 3RLYH 2CHAC 1YGCH 2W7UA 1BJVA 2CGAA 3MU0A 2ZDKA 5E8EH 4WXIA 1SFQB 4B2AA 2O8UA 3U69H 1L4ZA 4MQAA 2Z9IA 2IOTA 4X8UH 1O5DH 1EZSC 2CJIA 2RG3A 1DY9A 4TYDA 4O9VA 1GMDG 2WPIS 1K21H 3TH3H 1GBKA 1V2TT 4SGBE 2CF9H 1OYTH 4HZHA 2SNVA 5LH8A 1C5TA 1ARBA 1GI9B 1XUIA 2XCFA 2Y81A 3KQEA 3STIA 1O35A 1DANH 4MTBA 2ZQ2A 3VFEA 4K3JA 4GSOA 3PTBA 4KGAA 2P3FH 1C5SA 1TA6A 2FTMA 1RTKA 2TGDA 1UCYH 4AGJA 1GHWH 2Q6DA 3S7HB 4Z1MD 1ZHMA 3RXAA 2KX4A 4FU8A 1QRZA 1IQKA 3VPKA 1N6XA 1LHCH 1BRBE 1FY1A 1ZMJA 3NKKA 2ZWLH 4OS7A 3SGQE 2PKAA 3PLPA 2ZFFH 1LVOA 1GJBB 1BCUH 2BZ6H 4X8VH 3I29A 1ZTLA 3HGPA 1C1TA 2UUJB 3AW0A 4TPYA 2F3CE 1TOMH 3FANA 1MTNB 3TIUA 1YWUA 1DM4B 5DP4A 1C5NH 1YBWA 3SNAA 3P8NA 2FZZA 3RXVA 4BXWA 3RXFA 2WPMS 4GCHF 1BRAA 1YM0A 2EY4C 3Q3KA 3SU6A 4ZAEA 3H09A 1C2GA 2P8OC 1UCYE 1MD7A 3OYPA 2FEQH 1DE7H 2FLBH 1DPOA 1G36A 3K65B 4B2CA 3ATIA 3PMBB 2OQUA 1AIXH 1OWHA 1O2VA 4DVAU 1TRMA 2BQWB 3SGBE 4CRFA 3C27B 1YY3A 4Y8ZA 1DUAA 2ZTYA 2GV7A 1TBZH 3LGUA 3UR6A 1BB0B 4IW4E 5I46H 1PPGE 3SQHE 7GCHG 2JETC 4YT7H 3IWMA 2G55A 2GCTB 5FX5A 3VB4A 1G32B 2ILNA 3P17H 1CU1A 3TNTA 3FVFB 2HOBA 2GZ7A 1YPMH 3NRLA 5DSFA 5C1YA 3PRDA 1QJ6B 2BLQA 4NIWA 1OSSA 4CHAB 4B74A 4OGXA 4ISNA 1AI8H 4ABGA 1AQ7A 4WMEA 2VVCA 2V7QD 3FKSD 1E79D 3KCGH 1ZR0A 2QF5A 2BD5A 4ZCNA 2ZFPH 1P04A 2A5IA 1AZZA 1DY8A 3RC5A 4DURA 1QRXA 5HM2A 5EW1H 2GP9B 3ZVFA 4I33A 1GGDC 3M7UA 1NFWA 4XD7D 1O2YA 1WSSH 3RXBA 2O8TA 5JBCS 1EOJA 5C0TA 4VGCC 5A8XA 5F8TA 3SNCA 3MWIU 2HPPH 2ZU3A 5TCCA 4UONA 1TYNA 2JH6D 1BMFD 3A87A 2BD9A 2FP7B 2P59A 2PFEA 3N7DA 3ZZCA 1MCTA 1ZHPA 1C2MA 1GBEA 3UQVA 1QL9A 2SFAA 1H9IE 4YESB 4K69A 1SGPE 1DFPA 1S83A 5EOKA 3VB5A 1SGNE 2G51A 3DUXH 3M5NA 1ZLRA 4U30A 2B9LA 1V3XA 2D1JA 4ABJA 1TGSZ 1C9TA 4Z0KA 1ZOMA 3H5CB 2XNIA 1HIAA 3TK9A 3FP6E 1J16A 2YNBA 1TPOA 4FUGA 4IGDA 2J97A 2PTNA 2KR7A 1RRKA 3DFLA 2K8IA 1G3BA 4X1SU 1RXPA 1Z8RA 4OS6A 1HAPH 1WU1A 1XMNB 2C8ZB 2PV9B 2IJOB 4KTCA 2C8XB 4ZHAA 4X0WU 1GDQA 1MQ6A 3UB0A 2VH6A 2A7JA 4Q2KA 1C2DA 1LQDB 8KME2 1HGTH 1C2FA 4KELA 1NROH 1A2CH 1LHDH 2NU3E 1P9UA 4X1QU 2ZQ1A 1GCTB 4NCYA 1CT4E 2V3MA 1O2QA 1DVAH 3DT0H 2RFKC 2J95A 2F91A 3PM3A 1L0ZA 2AMPA 2TGPZ 3E91A 1IAUA 3PTNA 1BHXB 1GJAB 1YPGH 4E7NA 3PV2A 4AFQA 4X1RU 1C2HA 2PUQH 2VIQA 1XX9A 1HAXB 2BDGA 1BTWA 1EATA 5GIBA 3PMHB 2QXJA 1QRWA 5LPRA 1AUJA 3E6PH 1G3DA 2CXVA 2H9EH 3A8DA 3DSPA 3A7XA 1V2JT 4MPUA 2WUCA 2Z94A 1FX0B 3SV8A 3QLPH 4FUIA 2CK3D 3UOUA 1TIOA 1EAXA 1O3MA 1D3DB 1TMUH 1WXRA 1W0ZU 4ABEA 1IQLA 1O3HA 1N8OC 2GKVE 1KTSB 2C93B 1AU8A 4FU9A 1H8HD 5DP3A 3SUFA 1DXPA 2A31A 3F0PA 4DGJA 3FN8A 3URDA 1TGTA 4NIYA 1CGHA 1NRRH 3RXTA 1FZZA 2ODPA 2PUXB 3A82A 1IQGA 2Z9KA 4ABIA 1UTMA 1Q2WA 1V2ST 1Z6JH 1GI1A 1ABIH 1P2JA 4MNVA 3GCNA 2OK5A 5A8YA 5LPFA 3ZVDA 1Z1JA 3UPEA 1O2LA 1YC0A 4WH6A 3RXRA 3DA9B 5IYTA 1DWEH 1Y5BT 4B2BA 1FLEE 3B23B 4PROA 2F43B 5LPEA 1ZSLA 1C2LA 4DT4A 5JBAS 2FOGA 3ZZ8A 3ENSB 4RT1A 3MU8A 4I32A 1OOKB 4BAOB 1O37A 1V2RT 2GMTC 1NFUA 2TGTA 1O5BB 2DE8A 4Q7ZA 1FV9A 3SJ9A 3LGTA 6CHAB 1MZAA 1QBOA 4ISIH 2SGPE 1BTPA 1TWXB 2VWOA 3OY6U 1P05A 1Y3YA 1O2OA 2AGIX 5FAHA 2BX4A 1A0JA 5AFZH 1LVBA 5FHTA 3UNQA 1C5OH 4IMQA 1F92A 4X2YA 1WV7H 5DP9A 3OFND 1O30A 3V3MA 1TLDA 1C5UA 3SJIA 1GJ8B 1LKAA 2PKSB 3P70B 5F6MA 1GJ5H 1SGIB 2H6MA 2ZDLA 3M5LA 1AFQC 2JH0D 2TPIZ 4NIVA 1LCYA 2GCHG 2LPRA 1BRUP 4F4OC 2VIDA 1BTXA 2Z3DA 4NSVA 5CHBA 2R2MB 2HVYB 2PLXA 1YKTA 2WPKS 3G01A 3NPSA 1SQAA 1W0YH 4QT8C 2ZFSA 2BD4A 2WINI 1DT2A 4H42U 2ZCLP 3Q3YA 1HPGA 1IHSH 2KM0A 4WY3A 1C5MD 3LONA 1TRYA 1VGCC 1FY5A 1XXDA 4DT7B 8GCHF 1GVLA 4AG2A 1SGEE 1GHAF 2QXHA 4K1TA 3VXEH 1A7SA 4XBDA 1TB6H 2AS9A 1UTPA 1V2WT 2VWLA 2B7DH 1ELDE 5HGGA 1HYLA 1ELVA 1P0SH 1S6HA 3U1JB 1KY9A 2BDCA 3PMAB 5ETXA 1CA0C 1WUNH 4R8TB 1DWDH 3LC3A 1FJSA 1YF4A 2BY5X 3H7OA 3SJ8A 5JB9S 1PJPA 4OM9A 4RI0A 2BD2A 4IS5A 4BXSA 2OD3B 1Y8TA 1EJMA 1YCPM 1HCGA 7ESTE 1P06A 1QR3E 1GL1A 3RXSA 1KLIH 4LXBH 1FAXA 1W8BH 2F9PA 3P92A 2HALA 3MH4A 1G9IE 3A7YA 3S9AA 2C90B 5KECA 3MQKC 1HNEE 2ZHWH 3QZRA 4WF8A 2AERH 3VB6A 2J98A 1S84A 1F7ZA 3KYFA 3LU9B 1AO5A 1V2UT 4BTIB 2SGEE 1O2MA 3BEFB 4DW2U 2Y5FA 4E05H 3NCLA 3U8TH 1ANDA 5BPEA 1YPKH 2VINA 4ABHA 1L1GA 3A84A 5FPYA 1JIRA 1MD8A 3JZ2B 1VJAU 2ZPQA 1BT7A 1UW7A 4MG3A 3T29A 3LDXH 2ZF0H 2VIWA 3S0NA 2B8OH 2RCEA 1HAYB 2EA3A 4IC5A 2XTTB 4GVUA 3MOCA 2M2AA 3TVJB 3ZV8A 1C4V2 4I31A 3RXIA 4YT6H 1SBWA 1KXEA 1FPCH 2HLDD 1FMGA 1SQRA 3VB7A 1HAVA 1UVPA 3TJVA 1KIGH 4XE4A 1ACBE 1BMLA 2XXLA 4ZKNU 3BTTE 3NXPA 4X6PA 2BOKA 3SUEA 3EA8A 3LOXA 1PQ5A 2O9QA 1O2KA 2H1UA 4IN2A 4Q4LA 1CHOG 2UWPA 4K60A 3UY9A 4GPGA 3MO6A 4UFGH 1NBMD 3S9CA 2XNDD 1CGJE 1H4WA 2DE9A 1GMHG 3PB1E 2FI5E 3PWBA 4K8YA 5EXMA 1SVPA 2Q1JA 2QF3A 4E06H 2D2DA 3OEED 3TJUA 2ZO3H 4E7RG 1AZ8A 2A7HA 1XUKA 3A81A 3VGCC 4YZUA 2L6OA 3A7WA 1GI5A 3MH5A 1O3JA 3EYDA 4LZ1H 3GY3A 2A4GA 3LT3A 5FCRA 1GI7B 2C3SA 1GJDB 1QURH 1T8OA 3SU4A 4BAHB 1AB9B 1C1RA 3UQOA 2F9VA 1TNJA 3UR9A 4D9QA 1HRTH 4I8JA 3GYMA 2BDHA 2FOCA 3ZYDA 1GPZA 4MNWA 1NZQH 2HWLB 1KXBA 3UWIA 1UVOA 4ZXYH 3T62A 1QJ1B 4INLA 1O3OA 3VEQB 2O8WA 1TBQH 3ZZ5A 1QBNA 3AAUA 3ATWA 3MTYA 1Y5AT 1K1NA 3GCHB 1MKXK 1SGFG 1FI8A 2J2UA 2ZTXA 2A5KA 2EEKA 1H8ED 3ZZBA 2PW8H 1O2JA 4BANB 4D7FA 1VGCB 3FOAA 3QTVH 1P11E 3T2NA 2HNTE 2OLGA 4DIHH 1O3IA 6LPRA 2AMDA 1P3CA 2FPZA 3SUDA 1DX5M 2FTLE 1GBIA 1ORFA 3K6ZA 3D23A 1K1OA 1S85A 1UMAH 1O3LA 2QE7D 2YNAA 1C1SA 3MNXA 4BAKB 2XRCA 1DLKB 2RA3A 3SNDA 4K5ZA 3UNRA 1IHTH 1MTUA 4A1TA 4AFSA 4K1EA 1GHBF 2ZCKP 3GDUA 1HAHH 2WSSD 4WXVA 4YLQH 3GCOA 2QCYA 3OX7U 3SV6A 2Y82A 3TLOA 5J4QA 1GHZA 5A0CA 2P3UB 5F8XA 2AYWA 1MBQA 1TABE 1XUJA 1HJ8A 1P3EA 4JYUH 3QZQA 1DITH 3OEHD 3A7VA 4FUFA 1BTZA 1OP8A 3KN2A 1Y5UT 5GPIB 1DWCH 6ESTA 3UREA 1L1JA 3SV2H 3ITIA 2H9TH 2FO9A 4OGYA 1GBBA 5DKMA 3GY4A 2ZGHA 1S0RA 1BA8B 3RXKA 1P03A 1GI6A 1C4U2 2WV9A 1O5AB 2QY0B 4I8HA 2Y7XA 3F9EA 4THNH 1EZQA 3QGNB 2XBVA 4AB8A 1XUHA 1TNKA 3I78A 4CH8B 4X6MA 2I6SA 3K2UA 1T8MA 3CS7A 1K2I1 1NN6A 3ZVCA 2ZGJA 1ESTA 4JYVH 5GWZA 1A5GH 1O3GA 3EA7A 1C2EA 1F0SA 1WBGB 1YPLH 2AHME 2XOKD 3A83A 4O3UA 1JBUH 4OS1A 1FY4A 3P8FA 1EJNA 1ELAA 2D8WA 5T1VA 2G5VA 1RIWC 1S6LA 2Y7ZA 3RP2A 1SLUB 1BBRE 1UTJA 2J98B 1WOFA 4YXWD 1F0UA 1P2OA 2ZP0H 2ZGXH 4BTUB 1GJ7B 1NRSH 5HYOA 3M61U 1GCDA 1C2JA 1ETRH 3U98H 5EW2H 5FPTA 3O8RA 1NFYA 5B6OA 1UTNA 1Z8GA 1GJ9B 1ZMNA 1VKYA 1EZUC 1FY8E 1SI5H 5AFYH 3FO8D 4GCHG 1B7XB 2WYGA 4MDSA 4TT3D 3R0FA 3RUOA 3RXJA 1MUEB 3LH1A 3TGKE 1F2SE 1EJAA 1BMAA 5JYIA 1SC8U 4U32A 2Z3CA 1QJ7B 3RXEA 2A32A 1O3NA 2HRVA 1HAVB 2ODYB 2ZU4A 1MKXH 1SQTA 1TGCA 2FOFA 3CENA 1COWD 4UDWH 3BG4B 4NA7A 1EZXC 3MFJA 2STAE 4UD9H 5AVDA 2J94A 3SOSA 3UTUH 4OS2A 1OXGA 2F83A 1INCA 3F2GA 3LPRA 1O0DH 1NFXA 2WV5A 3ZZ9A 1HXEH 2WPLS 5C67A 1SPJA 1YP9A 3WY8A 1V2KT 1HBTH 3HK6B 3MMGA 5L2YH 1PYTC 1QBVH 4BAMB 2ZIQH 2PR3A 4KTSA 1TNGA 1C2IA 1YPHC 3ELAH 1LQEA 9LPRA 4IBLH 2FS9A 1GI4A 1LMWB 1ZJKA 1NBME 1OHHD 1GMCF 3P8GA 1K28D 1WTGH 3KNXA 3GCTF 4X2VA 2OP9A 1SL3A 1LPZB 5FBEA 2PSYA 1HFDA 1A3EH 2UWOA 1HAGE 1TGBA 1O2PA 3UIRA 4DCDA 3RXUA 1UK4A 1NU9A 1O36A 2GTBA 4CREA 4NA8A 5ESTE 3A7TA 5K0HA 4M7GA 4XBCA 1E1QD 1PPCE 3GDSA 2CF8H 3R3GB 1SR5C 1UTLM 2CHAB 2SGQE 1THPB 4Y0YE 1O3PB 1GJ4H 1TPAE 2QA9E 2XC4A 2FM2A 1PFXC 1A5IA 1BMMH 2GDEH 2JKHA 4WWYA 1NRPH 5SGAE 2A5AA 3M5OA 4NIXA 2XC5A 1FIWA 1O3DA 5E0HA 1O3CA 3FZDA 1AWHB 1V2LT 2XYAA 3LC5A 1MTWA 3TPIZ 1GG6C 3GISB 4KTUA 1KTTB 1CO7E 2YMSD 3O8DA 2BD7A 1QCPA 2J9NA 1B5GH 3EE0B 4A1VA 2GD4B 1F5LA 1P10A 4KKDA 4FUCA 1ELFA 2ALVA 1O3EA 2H2ZA 3C1KA 3SGAE 2FLRH 2FWWA 3SO3A 4U2WA 2W5EA 1T31A 2V0BA 1F0RA 3WW7A 3RDZA 3KF2A 3MU4A 3RU4D 1TALA 1YCPK 1XM1A 1JOUB 2JJ1D 1UTOA 4NGAH 4YO9A 3RXHA 4D8NA 1PPZA 2YMSC 2XWBI 1UTKA 5C5OA 2BDBA 4FUJA 5H4IB 4YTAA 1C1QA 1BTHH 1NS3A 1KXAA 5E0GA 1T4VH 1QB6A 1UVSH 1JIMA 1TE0A 1PPEE 3MNBA 4X8TH 1BHXF 1C5VA 1G2MA 1JXPA 4RSPA 1P2QA 1QY6A 1C5YB 5DP7A 1NTPA 3D62A 2BXTH 1A4WH 2ANMH 1DOJA 1GBTA 3FAOA 2P8OB 3ATKA 3SW2B 1ZPZA 1ZTJA 1AGJA 1T4UH 4Y71A 3SN8A 3AASA 1O3FA 1IQEA 1TRNA 1O5FH 5T6GA 3Q3XA 3ODFA 4AYVB 5E2PA 1MZDA 3ATLA 7LPRA 2B5TB 2RA0A 3SORA 2AFQB 2Z6BD 3T27A 4AORA 3KQBA 1GVZA 1TBRH 3I77A 4MLFB 1EPTC 1E0FD 2G00A 2HVXA 2JETB 3H7TA 4GUXA 3T26A 1KYNA 1A0LA 1LPGB 1RS0A 1IQMA 1E34B 4ZROA 2OINA 4XOJA 4ZUHA 2OC1A 4Y8YA 1C5RA 1M9UA 2F9NA 1W7XH 2F9BH 4DY7B 1O2NA 5GCHF 1RTFB 1LVYA 3RMNH 5GNDA 3F9FA 2VVVA 3ZVBA 5TCAA 2QAAA 2G52A 2FI3E 1P2MA 1SGFA 1DSUA 3SV9A 2BHGA 1G3EA 1X7AC 1Q3XA 1GL0E 4K2YA 4CRDA 1EXFA 1O32A 3F2HA 1V2VT 4INHA 1PQ8A
chains in the Genus database with same CATH topology
1JWTA 1WAYB 2WPHS 1K1PA 1PPHE 4YOGA 3ZZDA 1GDUA 3LGYA 1GGDB 2V3OH 3QGJA 2H9HA 2XC0A 1AWFH 2CV3A 1QTFA 1WTHD 3RLWH 2YOLA 1A1RA 1XUFA 2UWLA 1AE5A 1CSOE 3ZYEA 1LO6A 4VGCB 3E0PB 3ZVGA 5GXPA 1VCQA 2BDAA 4MPVA 2BYAX 2OC7A 4I7YH 1P12E 2A4QA 4CR9A 4Y76A 5E0JA 1O33A 1WYKA 1QNJA 1AKSA 1TQ0B 1T7CA 2ZNKH 3CS0A 2I6QA 3M3VA 1AMHA 1TONA 2FS8A 2NU0E 2P3TB 3BTQE 3PO1C 1PPFE 2OXSA 4YOJA 3ZZ6A 3LJOA 3ESTA 4D7GA 1MU8B 4NSYA 2ZU2A 1P2KA 2BOHB 1GJ6A 2B0FA 2G4UA 3GOVB 3BV9B 1ZPCA 5EXLA 5F8ZA 4LZ4B 4RN6A 1MMJN 1ID5H 1OYQA 2BDYA 4UEHH 3MNSA 1J15A 2ANYA 3M5MA 4CRBA 5CE1A 2THFB 1XKAC 1HAOH 1HB0B 1YPHE 3DFJA 8GCHG 1KDQA 1FONA 1YCPH 2FI4E 1DXWA 1GHAG 3SU1A 1ELTA 1QIXB 1T8LA 3U8OH 3EAJA 4CRGA 1WQSA 1O2UA 1SMFE 2XBYA 2PGQB 1FXYA 3LH3A 5CHAC 4NZLA 4AG1A 5L6NH 3SV7A 4Y7AA 3BEUA 3ZV9A 4LK4A 2OBOA 1KXCA 1HXFH 1EP6A 2VWNA 4AZ2B 1XVOA 3HK3B 1UK2A 3T28A 3U8RH 1W10U 2GGVB 1QFKH 1Y3VA 3RM2H 1G30B 1OWEA 1D6WA 3ZVEA 1BQYA 5GJ4B 3B8JA 1TGNA 6GCHF 5EODA 1V6DA 4F49A 1A46H 1C5WB 3W95A 4IC6A 1ELGA 5C1UA 3E3TA 3EDXB 1ANCA 2EC9H 4A1XA 3P8OA 2AMQA 2BX3A 4UFEH 4AYYB 1O5CB 1QB9A 1AE8H 1YLDA 2WPJS 3BIUH 1MTVA 5FXLA 2ALPA 1SGTA 2C8WB 3GDVA 3KIDU 3BTDE 3LGWA 3FP8E 2Z9JA 2ZHQH 2CMYA 1GBFA 1S82A 1N8OB 2ANKH 1KLTA 5JBBS 3RMOH 3BTWE 2HLCA 1HLTH 1O2WA 1TNHA 1EQ9A 1BBRK 1RGQA 5FPSA 1AVWA 1JRSA 3MHWU 2IN2A 4R0IA 3L6PA 3M37A 1GI3A 1ZRBA 3BIVH 1ZZZA 1E37B 1MH0A 2QF0A 3SHAH 3E90B 3Q77A 3VXFH 3PLKA 2TGAA 1FQ3A 3ODDA 1C4Y2 1TNIA 1QQUA 1GBHA 1GHVH 2FDAA 3FP7E 2GMTB 2PWXA 3RU4E 1DDJA 1GVKB 3MNCA 1GBCA 3E0NB 5DP5A 3STJA 1HJAC 1K1IA 3GY2A 3ZZ3A 2TIOA 1KLJH 2W7SA 1OKXA 1SGQE 1TNLA 3RU4T 2HNTF 3TH4H 4ESTE 3JZ1B 1P9SA 4FVDA 3TGJE 5A09A 1AY6H 4MPWA 4BAQB 7KMEH 2A2XH 3TK5A 2ANWA 3QO6A 3BEIB 2R0LA 1K1MA 1MTNC 3GY5A 4H4FA 2A45B 3RXQA 1PPBH 4TWYA 2SGFE 3SU2A 4X6OA 5EPYA 1ZPBA 2CN0H 4RKOB 3SU5A 2QYIA 1AFQB 1D6RA 1UVTH 2ZU5A 1A0HB 3TH2H 1T32A 3BTHE 2NU2E 2VIOA 3ATMA 2NU1E 1Z71A 3MI4A 1W2KH 1TMTH 3M36A 1YPJH 1EX3A 2AGEX 1P2IA 2DUCA 1G3CA 5T3HA 2G5NA 3A8BA 1SFIA 4ZH8A 2BXUH 5GDSH 1TFXA 4ASHA 2EI7A 1P2NA 4JZIA 2GCTC 1DWBH 3Q00A 3QN7A 2V6NA 3DHKH 2GV6A 1LPKB 2ZEBA 1LHFH 3TJNA 1O39A 1YLCA 1BJUA 2C4FH 1RFNA 1HV7A 3EA9A 4CHAC 5ABWA 5E2OA 4FXGH 1CA0B 3SNBA 1FY3A 4WH8A 4KP0A 5A0BA 3HKIB 8ESTE 1V2MT 1K1LA 3S69A 3LGIA 1AKSB 3CP7A 3NUMA 2ZI2H 1OPHB 1ELBA 1LDTT 2OTVA 3ZZAA 1GHBG 2F9UA 2P16A 2AGGX 1VR1H 4DJZB 1D3TB 1TOCB 3K6YA 1W13U 1MU6B 4Y8XA 1OWJA 3HGNA 2NWNA 3RXGA 4A7IB 2BQ7B 3M7QA 4ZKRU 2Y80A 5DP6A 1FDPA 4UFFH 3SUGA 1H8DH 1ZMLA 1GHYH 1ESBA 4ZKSU 5C2ZA 1OP0A 3LIWA 1ZHRA 4ZMAH 3PROA 1J9CH 1HAIH 3QDZB 1EP5A 3QK1A 1BBRH 1DS2E 1AFEH 1KDQB 5DK1A 2K1QA 2ZDVH 3IG6B 4TY7A 1ARCA 1W7GH 2XBWA 1GMDF 1NPMA 4X1NU 2UUYA 4YLUA 3KHVA 1BTYA 1CVWH 3OY5U 4MNYA 4JYTA 1S81A 1P02A 1LHGH 1E35B 2WUBA 2OCVB 2C8YB 3FFGA 3RM0H 3QX5H 3SHCH 1IOEA 4TPIZ 1Z8IB 3SI3H 3VB3A 2ZHEH 1RTLA 1F0TA 4IMZA 5DGJA 2GZ8A 4GHQA 2G8TA 4BNRA 5PTPA 3NWUA 3TJOA 1XVMA 2BLVA 1DICA 1IQJA 1SHHB 4JK5A 3LGVA 1SSXA 1J14A 1ANEA 1GCTC 4CRCA 3A86A 1BOQA 3UWJH 2Y5HA 4U01A 2J4IA 1HJAB 4MNXA 4NFFA 2GZ9A 1GDNA 3VGCB 1QL7A 1THSH 2FOAA 5I25A 1A3BH 2KAIA 2A4OA 3ZZ7A 1ETSH 1S5SA 1D9IA 1SGYE 1UTQA 3T5FH 4Y7BA 3K9XB 1FUJA 2ZKSA 3B9FH 4A92A 1EKBB 3Q76A 1MAYA 1CHGA 1GBMA 3PV4A 2A2QH 4D9RA 1Y3UA 3SU3A 2STBE 1PYTD 3OU0A 2FX4A 3TGIE 2BD8A 1MAXA 3SQEE 2A1DB 2Z7FE 1SGRE 2ZDNA 2ZGBH 2R0KA 3E8LA 1DSTA 2ZG0H 7GCHF 4YOIA 3UFAA 1K1JA 2Z3EA 3NK8A 2P95A 3S7KB 5EPNA 3RC4A 2SGAA 1UO6A 5T6DA 1FN8A 1DLEA 2OQ5A 1C1OA 2J34A 1IQNA 1TMBH 1LTOA 1ZSKA 2V35A 1V2QT 1OWDA 1PQ7A 4TY6A 1C5LH 4UE7H 2ZHDA 1Z1IA 4JK6A 5TJXA 1O2GH 5EQSA 5DO4H 1OP2A 1LHEH 4WVPE 1O5EH 4CBNA 2VVUA 2VH0A 2AIPA 4ISLA 2BB4A 1QL8A 4Y10E 1NT1A 2FXRA 1D3PB 4K8BA 1THRH 1QA0A 4J1YA 1ELCA 3T25A 1GMCG 1V2PT 1C5QA 2P93A 2BQ6B 3GCTG 3KL6A 3S9BA 1C9PA 1ESAA 6CHAC 4ISOA 2JH5D 4SGAE 5L2ZH 1C1UH 2ESTE 1BZXE 3RMMH 1B0EA 1NO9H 2A0QB 5J4SA 3N7OA 4ZHMU 4H6TA 2VB0A 2ODQA 1BITA 1IQFA 2EI8A 4XDEA 2VU8E 3SZNA 1S6FA 3BSQA 2BLOA 5C3NA 1SLWB 2PKSC 4GAWA 3RMLH 5JB8S 3A8AA 1GWAA 3BTFE 4Y0ZE 1C5XB 3V7TA 1F5KU 2ZFQH 4DIIH 3GYLB 4NWLA 1YYY1 2ZPRA 1C1PA 5DJ7A 4I8LA 3QWCH 1BRCE 1MCVA 4B75A 5FX6A 2BY7X 1O5GH 2Y5GA 4FUEA 2ZCHP 2GDDA 1GI2A 3LJJA 1O2RA 1EPTA 3KQDA 1TAWA 4RKJB 2VIPA 3PYHA 4LOYH 1FN6A 1OWKA 1C1WH 1QQ4A 2BY6X 1QHRB 1VCWA 1WQVH 2ZGCA 4AB9A 4INKA 1O3AA 2BY9X 3V0XA 3GY7A 4BTTB 1N6YA 2J92A 4AFZA 4A5TS 1O2XA 1H8IH 4HI3A 1D3QB 1O2IA 2W26A 5JDUB 1O31A 2VJ1A 3TU7H 3BG8A 2ZFRH 1RIWB 2AH4X 4CBOA 2VWMA 2FOHA 1C5PA 2AIQA 1ZTKA 2BY8X 3PMJA 2QGRA 1QB1A 1CE5A 1ZGIA 1FAKH 3HATH 3FZZA 3ZZ4A 4BOHA 3SBKA 3SJKA 2BZAA 4O97A 2FOMB 4X2XA 2TBSA 3O8BA 3TITA 3RXDA 2R2WU 2NU4E 1UVUH 2VIVA 5A8ZA 3AAVA 1HDTH 5FBIA 2VGCC 1P57B 2FX6A 1C2KA 1SOTA 2OC0A 2O8MA 5HMAA 2GX4A 2QC2A 1VJ9U 3AVZA 2ZU1A 3OSYA 3PLBA 3QTOH 3F6UH 2BD3A 2WV4A 2V3HH 1EASA 2ZA5A 1Y3XA 3P6ZB 3KGPA 1O2HA 2OUAA 4B76A 2BTCE 3W94A 1SGDE 3BTEE 1C5ZB 1KSNA 4X8SH 1GBAA 4GLYA 1FIZA 3MH6A 1T8NA 3MU5A 1SG8B 3RXCA 3TNSA 1UHBA 4ISHH 1TA2A 1E38B 2OC8A 2M5TA 3M35A 1NRNH 5GCHG 2Q6GA 3MYWA 1N1LA 1MKWK 4AX9H 2FMJA 1AHTH 3MO9A 3HKJB 2FYRA 2PKAB 4X6NA 1XKBC 4ABDA 2QV1A 2KAIB 5IDKA 2RDLA 2H5DA 4FUHA 4NA9H 1H9HE 2XCNA 3F68H 3TK6A 3SNEA 4WMFA 1SQOA 2ZPSA 2BM2A 2PTCE 1TX8A 3F9HA 4UFDH 1L1NA 1OWIA 4ABAA 2HNTC 1GI8B 4JCNA 4O3TA 4Q7YA 3D65E 4AN7A 2P94A 1L4DA 1SLVB 4K1SA 3D49H 3F1SB 2XW9A 1UK3A 1H9LB 1ZGVA 1ETTH 3U9AH 1BTUA 1CT0E 1ZRKA 1GI0A 4WMDA 2G81E 2PSXA 1GHXH 3LKWA 1YPEH 4XSKU 1ZYOA 2IPHA 2HGTH 1K22H 1SB1H 5JPMH 1AB9C 5LGOA 1P09A 2FOBA 1ZJDA 2GCHF 1EOLA 1GG6B 1NRQH 2O8LA 3RXLA 2Q6FA 4ZHLU 1NY22 5C20A 1MBMA 4NG9H 2ZDAH 4ABFA 2FODA 1MTSA 1BMNH 3V13A 4CH2B 2LNCA 1O38A 2J38A 1CBWC 3A80A 2A4RA 3KEEA 4Q7XA 3UNSA 5JBTA 1IQIA 3GCHC 3MU1A 2QIQA 2UUKB 1ELEE 1O3BA 1Q31A 2R9PA 4Z6AH 1RJXB 4XFQA 1JMOH 2FESH 4Y79A 1G2LA 5G4BA 1LVMA 4B71A 1O34A 5DP8A 1O2TA 2BVSH 1EB2A 4JZEH 3AW1A 1O2SA 4Q80A 2QXIA 3IITA 2BLWA 1EAIA 1KXDA 2W3IA 1V2NT 3BTKE 1KXFA 1Z7KA 4JZDH 2FYQA 1J8AA 3BTME 1TQ7B 4FVBA 3HPTB 1C1NA 1J17T 6GCHG 5HM9A 1CGIE 2PGBB 5ESBA 4X2WA 1VZQH 1C1VH 3A85A 1RD3B 4FUBA 3UOPA 2GVFA 1DUEA 1EAUA 1BUIA 1NESE 2Y6TA 2VGCB 4AOQA 2ULLA 4IN1A 4O03A 1PQAA 1AD8H 2BVXH 5CMXH 1XXFA 1OS8A 3RXPA 2XWAA 3V12A 1EPTB 1VITF 1HIAB 3RXOA 4DOQA 1GBLA 5EGMA 3A7ZA 1SHYA 2ZHFH 1JRTA 1VITG 5A0AE 2G4TA 1VITH 5K7RA 1AVGH 4ZXXH 1H1BA 5A2MH 4FUDA 3A89A 3EGKH 3M3SA 4NZQA 3QUMP 1MKWH 1B0FA 5C1XA 3EQ0H 5FCKA 1BIOA 1AVXA 3SU0A 1G37A 3RC6A 2H5CA 2UUFB 4FU7A 1CA8B 1HJ9A 1V2OT 3OTJE 2F9OA 1Z8JB 3NZIA 5DG6A 1XUGA 3ZVAA 4CR5A 2OBQA 1GJCB 1ZSJA 4Y6DA 1CHOF 1MQ5A 1HAZB 3M7TA 4HTCH 3DD2H 4OS5A 2ZZUH 9ESTA 1A61H 1SLXB 1WCZA 1TPPA 2A7CA 1TPSA 1UCYK 3L3TA 1GMHF 3UUZA 1BDAA 2BMGB 4MPXA 4DG4A 3M3TA 5BRRE 1W3CA 2ZFTA 2QN5T 2ZDMA 5EQQA 2BVRH 1D4PB 4A6LA 3E16B 1O2ZA 4H6SB 1ANBA 1QGFA 2EI6A 4ABBA 1AUTC 1C1MA 1EAWA 4JZ1A 5EU8A 4B73A 1F5RA 4XBBA 3A8CA 3GY8A 4YM9A 2Z9LA 1OX1A 2D26C 5EXNA 3PO1B 1AN1E 4B1TA 2VNTA 1L2EA 5EG4A 1FPHH 2PHBA 3U1IB 5C5NA 1GBDA 4MVNA 4I8KA 5EQRA 1P01A 1UHBB 3KQCA 3A88A 2ZC9H 4NFEA 1NU7B 2GT8A 1U6QA 1LKBA 2TRMA 2ZTZA 2FIRH 4CRAA 1TX7A 2XBXA 2BDIA 2GT7A 4JZFH 3O8CA 1Z6EA 1O3KA 1GBJA 2QXGA 3BG4C 1CBWB 1NC6A 3BF6H 1EUFA 1VCPA 2SGDE 2HPQH 4Y11E 1Y3WA 4AGKA 5AF9H 5HXFA 1E36B 3URCA 3SJOA 5CHAB 1FNIA 5F03A 2R3YA 2ASUB 3F9GA 2SNWA 3BTGE 1IQHA 1CT2E 1CQQA 4X1PU 3SI4H 1QA7A 4OS4A 4HGCA 2ZECA 5AHGH 1W11U 3PWCA 8LPRA 1S0QA 3BN9A 4ZKOU 4D76A 2W3KA 3L33A 1TX6A 2AEIH 4HFPB 1K9OE 1UJ1A 1EB1H 1SOZA 5DPAA 1A5HA 3P95A 2R3UA 3E1XB 2WYJA 4NWKA 3RXMA 4AFUA 2FOEA 1Y59T 5T6FA 1SGCA 1W12U 1NM6A 3MO3A 4J2YB 3MH7A 4WJG2 1ABJH 1W14U 1P8VC 5L30H 4GHTA 4JMYA 2Z9GA 4I8GA 3GY6A 4TWWA 1HUTH 3GICB 3RLYH 2CHAC 1YGCH 2W7UA 1BJVA 2CGAA 3MU0A 2ZDKA 5E8EH 4WXIA 1SFQB 4B2AA 2O8UA 3U69H 1L4ZA 4MQAA 2Z9IA 2IOTA 4X8UH 1O5DH 1EZSC 2CJIA 2RG3A 1DY9A 4TYDA 4O9VA 1GMDG 2WPIS 1K21H 3TH3H 1GBKA 1V2TT 4SGBE 2CF9H 1OYTH 4HZHA 2SNVA 5LH8A 1C5TA 1ARBA 1GI9B 1XUIA