1OKXA

Binding structure of elastase inhibitor scyptolin a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding Structure of Elastase Inhibitor Scyptolin A
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE 1
total genus 63
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1okxA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1okxA01
1TE0A 1OYTH 1E0FD 1AZZA 3TNSA 3RXFA 1T8OA 7LPRA 4Y71A 2FOHA 4NFFA 4YT7H 5I46H 4Y10E 4CHAB 3UPEA 1AE8H 1E38B 1C1UH 4NWLA 3MNCA 1YPKH 2ZGJA 2BD4A 1BRUP 5E0HA 2QXIA 3GDVA 3RXQA 3H5CB 3SUDA 4AFSA 1HFDA 1GG6B 3BEUA 3O8RA 5DJ7A 1GHAF 2G4UA 2O9QA 5T3HA 2ALPA 1W11U 4OGYA 1EZUC 4KTUA 3BIVH 4H6SB 2A5KA 3GDUA 3PYHA 4ZXYH 3RXMA 3MU5A 1ANEA 1O32A 1JRTA 3GDSA 5DPAA 2QIQA 5F03A 1BTHH 1EAIA 1RJXB 3SZNA 2SGAA 1V2ST 1DE7H 2BY7X 3BF6H 3RMLH 1C2FA 4AFQA 2Z9JA 1HXEH 3KIDU 2LPRA 1ABJH 1FI8A 2XC5A 1QL8A 3P6ZB 1EAXA 4LK4A 1ESBA 1AD8H 3M35A 2YNBA 3SO3A 4A92A 1D6WA 1YM0A 1UVUH 3U8TH 3S69A 4FU7A 3V3MA 2FZZA 2OCVB 2Y7ZA 4FUEA 2BDIA 3GYMA 1TNIA 5K0HA 1XUFA 1LHDH 5E0GA 4CRGA 2H9HA 2G00A 1GHZA 2FEQH 3ATLA 3ZZ8A 5ABWA 2ZP0H 1E37B 2FPZA 1L4DA 2AGIX 1C2DA 1GL1A 1ETTH 2Y82A 4F4OC 3S0NA 2ZHDA 1PPFE 1KDQA 2VWLA 3EDXB 4BANB 3F68H 1F5LA 3SV8A 1GI7B 2F3CE 2FYRA 3ITIA 3OSYA 1JIRA 1ESAA 4WMEA 4GUXA 1GVKB 1VCPA 4X2WA 1C5ZB 1DSTA 1FPCH 1WUNH 3E3TA 1JXPA 1L0ZA 3MH4A 3PLKA 1C5WB 1T7CA 2J38A 1PQ7A 1O0DH 1IQLA 3SGBE 1SQOA 2CHAB 3ZZBA 2F9OA 5DP3A 4DW2U 5EXLA 5EPYA 4NA9H 4GHQA 1EOLA 1O2XA 2ANWA 5C67A 3GISB 1BRBE 5FPTA 1D3DB 3QWCH 1Y5AT 3GY5A 1V2OT 1TGNA 3F9EA 4TWYA 1GHBG 1ZSJA 4WH6A 4YTAA 1S81A 1C1MA 1E35B 1S83A 3DHKH 2J95A 2M5TA 1CA0C 5DP5A 7GCHF 2C90B 1LHEH 1QGFA 3EAJA 1P2MA 1XUJA 5GPIB 1C5MD 1P2QA 1PJPA 3VFEA 4ASHA 1K21H 2TIOA 3W95A 3SU3A 1C4V2 4UDWH 3NKKA 4B1TA 3F9HA 5JPMH 5GXPA 3MNBA 2ANKH 3KHVA 2F91A 1PPHE 3GY2A 1T32A 1RS0A 3ESTA 4INKA 2QYIA 1QFKH 1V2RT 1DVAH 2C93B 1HAVB 3BG8A 3D62A 1LVYA 3F1SB 1TNKA 1ELDE 4DGJA 1QHRB 1TGTA 1V6DA 1HAOH 2Y6TA 3RXLA 1MKWH 1IQGA 1SQTA 2JH6D 2JKHA 1ELCA 3QUMP 2VIQA 4D9QA 1AU8A 2HNTF 4VGCC 1O3LA 3PTBA 4GHTA 1DLKB 1CT2E 1EKBB 2BLWA 3BIUH 1TFXA 2FS9A 1O5CB 1Y5UT 3RMNH 1W14U 3H7OA 1F92A 1ELTA 1YPHE 4MLFB 3TJOA 3RLWH 4K8BA 4CRFA 1EPTA 1FY1A 4CRCA 1BB0B 3EQ0H 3V7TA 3RXVA 3NCLA 1K1OA 1QR3E 1GI4A 4BAHB 1O2MA 2EI8A 2B0FA 3BTWE 3N7OA 3A7YA 1C5UA 2ZHEH 3RU4T 5ETXA 3SU4A 1J15A 2AMDA 1Q2WA 3CENA 1BRAA 3EGKH 1DSUA 2R2WU 1PFXC 2GT7A 1GBFA 3KN2A 2FI4E 1DDJA 1BIOA 2TGPZ 7GCHG 7KMEH 2CGAA 3ZZ6A 1WV7H 2OLGA 2BOKA 2H9EH 2ZTZA 1ANBA 4I8HA 1TBRH 2ZG0H 3GYLB 4FXGH 1GI0A 2Z3CA 4K3JA 2FXRA 3VGCC 1F0SA 2XYAA 1EATA 1SVPA 2BX4A 1SL3A 1TNGA 1FY4A 2XWBI 1MBMA 1QJ7B 1SFQB 2BVSH 2A1DB 1VR1H 5DG6A 5A8XA 2C3SA 4XOJA 2ZECA 3SUEA 1UVOA 2OC1A 2FLBH 3DFJA 2VVCA 3RC4A 3IWMA 4AFUA 3B23B 3T29A 4AGJA 1EB2A 1J17T 3BTFE 1ZMJA 2FYQA 4AGKA 3A7WA 3TGKE 1VITF 3E0PB 3U1IB 5JBBS 2I6SA 3Q00A 4GVUA 4MPWA 1GDQA 4X1SU 5BRRE 1NROH 1ZMNA 1P3CA 3UOPA 3L33A 1DXWA 1V2NT 3BSQA 3SU5A 1WTGH 4AFZA 1TNJA 2P8OC 1XXFA 4SGBE 1A1RA 2UUJB 1UK4A 1ZJKA 5A8ZA 3BTEE 1FNIA 3SV6A 1SGFA 4AYYB 3OY6U 1OWDA 5LGOA 1FIWA 1YC0A 3KQCA 4LZ1H 1UTLM 1MKXH 1O2HA 2J9NA 3HKJB 2H2ZA 2FDAA 4I8KA 4BAKB 2OQ5A 2VIVA 4NIXA 1K1JA 4DCDA 4YESB 2H1UA 4AG2A 2BDCA 3ODDA 5DP4A 4A5TS 3QO6A 4B2AA 3HPTB 1O2QA 3RXJA 1C1RA 1OOKB 2PTCE 3BG4B 4B2BA 1WQVH 4IGDA 3ZVDA 1JMOH 2BQWB 2C8XB 1TNLA 1AY6H 4Y8XA 3GY6A 4Q7XA 2NWNA 4K8YA 3T28A 2Y5HA 1DY8A 1XX9A 3BEFB 1UVTH 2EI6A 4KP0A 1C4U2 2ODQA 1C2LA 2VIOA 3PWBA 4Q80A 4KGAA 1BTYA 1CE5A 2CHAC 3RLYH 1DS2E 3L6PA 2F9PA 4SGAE 3SN8A 3EE0B 4IMQA 3UIRA 1P06A 1X7AC 2PV9B 2ZU3A 3M7UA 2A2XH 2OD3B 5ESBA 1GGDC 1GG6C 4ZKOU 1GMDF 4I33A 1GBMA 1DICA 4ABDA 1ZYOA 1MD7A 4YOIA 4R0IA 1CGHA 2D26C 3S9AA 1EAWA 1O2UA 2VVUA 1O2WA 3GICB 5C1UA 1HXFH 1MKXK 2BYAX 3MH5A 5C3NA 1Z1JA 1NESE 3F9FA 1RTFB 3RMOH 2XNIA 8ESTE 1W7XH 4ZUHA 2W26A 5DK1A 3ZVGA 1U6QA 4BOHA 2ZFRH 2NU1E 1GVLA 3UWIA 1P3EA 4ABEA 4KELA 1TGSZ 8LPRA 4K2YA 1AE5A 1C1NA 4TPYA 4FUHA 1ZSKA 2PUXB 3LC5A 2J94A 1GI2A 1HAVA 1SR5C 1NU7B 1FN6A 2W7UA 4HFPB 4CRBA 2BY8X 5FCRA 1T4UH 4TYDA 1TX6A 3KF2A 4XBBA 1DM4B 1YPEH 1HPGA 1AWFH 1EASA 1KSNA 1SGIB 1BBRE 2R2MB 3LC3A 4CBOA 5H4IB 1C5TA 1V2PT 2YOLA 3RXAA 3BEIB 1PQ8A 1HJ9A 1TAWA 1LMWB 5C20A 1MTVA 3LGYA 4JZ1A 1T8NA 2AFQB 3RXRA 5K7RA 3S7HB 1C1QA 4DOQA 1GMCF 1WBGB 3TK6A 2WPMS 3TPIZ 1TMBH 2G4TA 3C1KA 1CHOG 1AVXA 1ZHPA 2AIPA 3BTHE 5EXMA 3U8RH 3TK9A 1UK3A 2ZDVH 2THFB 1ELAA 1GJ8B 2BDBA 3ZZAA 2ZU4A 1N6XA 5JBAS 1BTPA 1O35A 2AYWA 2XBXA 1MBQA 3FFGA 2A4GA 1Z1IA 2BQ7B 2P3TB 1O3DA 1PQ5A 2P95A 2XBWA 1BA8B 2EEKA 1WAYB 2R0KA 3T27A 3PTNA 1TGCA 1YLDA 4E06H 1ZGIA 4KKDA 2NU3E 2FODA 2O8TA 2NU4E 2STAE 4TPIZ 2QXGA 1IOEA 3QDZB 4GAWA 1K9OE 2GCTB 2ZHQH 4YZUA 3BV9B 4X8UH 1BJUA 5GJ4B 2AH4X 1QQ4A 3GY7A 1BJVA 1QRXA 3K9XB 1A61H 3SHCH 3S9CA 2ODYB 1QB1A 1SLXB 4Y7BA 1ELVA 1IHSH 2ASUB 4E7RG 1O30A 1BMNH 1JOUB 3SV7A 4D7GA 2BDYA 1DY9A 4ZXXH 1SGRE 1YPJH 1TOCB 5JYIA 4NIYA 3HK6B 1VGCB 4YLQH 1QB6A 4Y6DA 5FPSA 1UHBB 1W3CA 1OKXA 4Y8YA 1D9IA 1AWHB 1BHXF 2R0LA 1ESTA 2BD5A 1O5GH 4FU9A 4ABBA 1V2WT 1ANCA 1RTKA 1HJAB 1C2EA 2B5TB 2ZFSA 3UNRA 1D4PB 2VB0A 2WINI 1THSH 5EQRA 2K1QA 2ZFFH 2BLVA 1C1OA 1PPEE 2SGPE 1O3HA 1UO6A 1OSSA 1NZQH 1Z8IB 1AQ7A 4KTSA 3PB1E 1N1LA 2H6MA 2R3UA 1P12E 2WPJS 1YCPM 1MKWK 3ZVCA 3Q3KA 1O2SA 4WXVA 3LGTA 2GCHF 4HGCA 1GDUA 1WCZA 1UMAH 3SHAH 4BAOB 2FOBA 1GPZA 1Z71A 4IBLH 3FP8E 3RP2A 3MWIU 1YGCH 1BMAA 1G32B 2PKSC 2GMTC 3FVFB 4RN6A 1FY8E 1P05A 3K6ZA 3LONA 2YNAA 5HGGA 4HTCH 1O2ZA 4X8TH 1GMHG 5HXFA 1TRNA 8GCHG 3BTME 1P2OA 1ZRKA 2GMTB 4K1EA 3BTQE 1JBUH 1P9SA 1RRKA 2A5AA 3RXBA 1ELEE 3UNQA 4NFEA 1PYTC 4K60A 1YF4A 2JH0D 5A0AE 1T8LA 1UCYE 1CHGA 2F9VA 3UFAA 5LPFA 2GV7A 1LHCH 1NRPH 4Y76A 3SU0A 2BDAA 4B76A 1YPHC 3MNXA 4ZH8A 3SNCA 1L1JA 1Q3XA 2ZNKH 3URDA 2Q6GA 3PMBB 3E16B 3RM2H 4CHAC 3SNDA 2PGBB 3S7KB 1A0HB 4U01A 3DUXH 5DO4H 4BNRA 3A7XA 3K2UA 4CR9A 4ZHAA 1DITH 2SGDE 1T31A 1HRTH 1S0RA 1O3CA 6GCHG 3SU2A 2TBSA 2WYGA 2BQ6B 2OBOA 3NWUA 2QXHA 1D3QB 2QN5T 2FX4A 4ISNA 1NS3A 3PLBA 2J92A 5AHGH 1DLEA 2V6NA 3A86A 3NUMA 3M3VA 1QQUA 1EPTC 3SUGA 4FVDA 3U9AH 1AUTC 3FZZA 1EZSC 1NTPA 1W2KH 2HLCA 4D76A 4FUGA 1SGNE 2AGEX 1O3OA 1E36B 2ZFQH 4Y11E 2ZGXH 2VNTA 1AKSA 1GHVH 2SGEE 1RD3B 3ZVEA 3PROA 2BB4A 2C8ZB 4DG4A 1TRYA 5GDSH 2P8OB 1GJ6A 2PLXA 1P8VC 4Q7ZA 1C5RA 1DOJA 5FHTA 1NFWA 2Z9IA 3M37A 2ZGHA 1O2TA 1MZDA 1SB1H 2TPIZ 3U1JB 3W94A 3ZVAA 2QF3A 2A4QA 2LNCA 3LGUA 2FX6A 1NY22 1AVGH 1GJ9B 1O36A 2PR3A 2BLOA 1GBLA 1IQEA 1RXPA 1BQYA 3GOVB 5DP8A 1C5LH 1Y3VA 5FPYA 1OS8A 2GP9B 3M7TA 5E0JA 2TGDA 1SG8B 1OX1A 3A8CA 3SGQE 1P04A 5FAHA 1F0RA 4R8TB 4I8GA 1KIGH 3KQDA 2OXSA 3SJ8A 4UFGH 1AO5A 1ZTLA 1B7XB 4JK5A 3TGJE 1RFNA 1SLWB 3M61U 3TLOA 1VJAU 6CHAC 4YT6H 3VB3A 1RIWC 4ZAEA 4J2YB 4I32A 1TA6A 1SI5H 1BRCE 3LH3A 1VGCC 1N8OB 4O03A 1ZPZA 1O3IA 3EA9A 3MNSA 3VB5A 3C27B 4IC6A 3M5NA 1Z8GA 1C5XB 2ZGCA 3AAVA 1EZQA 1BMLA 3M3SA 4X6MA 1ZLRA 1A5IA 1Y3YA 4FUDA 3VB4A 1TYNA 2Y5FA 4OS4A 1OWEA 1P2KA 1C1WH 3UTUH 3MU0A 1TQ7B 1ARBA 3SU1A 4OGXA 3E0NB 3M36A 1OWJA 1EPTB 1F0TA 3K6YA 1V2KT 5FXLA 2ZC9H 3PMHB 1NC6A 1NN6A 3SJKA 1VITG 4LOYH 1O3JA 3LGWA 1OWKA 2FWWA 3EA8A 1YCPH 3URCA 1NRSH 1GBDA 2V3OH 4XBDA 4WWYA 2GTBA 1M9UA 1J8AA 4XFQA 4JK6A 1QBNA 2RCEA 2VIPA 4KTCA 4TY7A 1J16A 4DIHH 1O5EH 2DE8A 1K22H 3CS7A 2FMJA 2AERH 2Z9GA 1BZXE 3A85A 3LH1A 3A87A 5EG4A 1AFQC 1LO6A 2W5EA 1Z6JH 3PO1C 2ZZUH 5DP9A 4CBNA 1AHTH 3HGPA 1GHYH 2TGAA 5JBCS 1SPJA 1TX8A 4A1XA 3D23A 4MNYA 4HZHA 4AN7A 1DWEH 2SNVA 5JB8S 5EW2H 2BZ6H 1FY5A 1G2MA 4AX9H 2BTCE 5A2MH 1A3BH 2ZDMA 3P8FA 3JZ2B 1LQEA 2ZPQA 2HPPH 3MYWA 3ZZ7A 1HIAB 3BTDE 3SJOA 4UEHH 5JBTA 1DX5M 3RC5A 1P2NA 2B7DH 5AF9H 5F6MA 1O3AA 2C8WB 2RA0A 1MU6B 2HRVA 2A5IA 2Z3EA 1P10A 3ATWA 4Q2KA 1TBQH 4JZEH 5E2OA 1LHGH 2BD2A 3E8LA 1YCPK 2ZDKA 2ALVA 3AW1A 2V35A 5AFZH 1FMGA 1SQAA 2ZWLH 3RU4E 3F9GA 2FOEA 1DANH 3QK1A 2VWMA 2R9PA 1G9IE 3MH7A 5CE1A 4XE4A 1LHFH 1GBTA 1NRRH 4I8LA 1A46H 1QL7A 1ZGVA 2C4FH 3PMAB 2D8WA 1BMMH 1V3XA 1AFQB 3SQHE 1LPZB 2PHBA 2PKAB 5ESTE 2KAIA 1GBKA 1C2GA 3SV9A 3GY4A 3A81A 2BMGB 1YPGH 1GHAG 1YKTA 5JDUB 2IOTA 3U8OH 2FTLE 4YOJA 4IN1A 4OS5A 3MO6A 3TH3H 3OX7U 1SLUB 3MU4A 1GCTC 4MG3A 3U98H 2XWAA 5I25A 2BXTH 5GWZA 2HGTH 3OY5U 1DPOA 2ZHFH 2FOAA 1KXEA 1YP9A 4M7GA 3TVJB 2P93A 4U32A 4UONA 1V2UT 4NG9H 1B0FA 1H4WA 5EGMA 1IHTH 1MTNB 2HWLB 2QGRA 1MAXA 3T62A 3NZIA 1GL0E 1G36A 3LU9B 4ISLA 1L2EA 4NZQA 4JMYA 1S6HA 3RXPA 4IN2A 1DUAA 1AFEH 1O2OA 3PM3A 1DWCH 1BBRK 4FUIA 4RSPA 4X2VA 2RDLA 3STIA 2O8LA 2H9TH 3I78A 1IQJA 3SJ9A 2J34A 3M5LA 2SFAA 2WV4A 3QZRA 1V2QT 1Q31A 4WJG2 4FUBA 2Y7XA 3S9BA 1TIOA 4ISOA 2P3FH 1ELGA 1P0SH 2PW8H 1TBZH 3PLPA 5E2PA 1BTXA 2C8YB 3GCOA 3QGNB 1OP8A 1GJDB 2BD7A 2JH5D 1MU8B 2BDGA 3QZQA 3SV2H 4D7FA 2Z6BD 1HAYB 2GKVE 1G30B 1ABIH 5G4BA 1ZZZA 1K1PA 5IYTA 2P59A 3UR6A 1IQKA 1FIZA 2CJIA 1TWXB 2QV1A 1SGFG 1TMUH 3Q3XA 1BTZA 1LVBA 4DJZB 4INLA 1Y3XA 2ZCLP 1FUJA 1QIXB 1CT4E 1EB1H 1CO7E 2FP7B 1EQ9A 4B71A 2WPLS 1MTWA 1KDQB 7ESTE 1C4Y2 2JETC 2TGTA 2FOGA 1FJSA 1GBBA 5F8XA 4NIWA 1GHXH 2FM2A 4B75A 1O3GA 1KYNA 1RIWB 3TH2H 4BTIB 1AIXH 3IG6B 2WV5A 2R3YA 2ILNA 3RXCA 1OP0A 5DGJA 1C9TA 2CF9H 3VGCB 1A3EH 2STBE 1ZMLA 3RXHA 1ZTKA 1LPKB 1DFPA 1A7SA 2WYJA 4TY6A 3RC6A 1C5OH 2ZPSA 2W7SA 4CH2B 3O8CA 2F83A 1UTJA 1VCWA 1IQNA 4ABIA 1H8IH 3JZ1B 4THNH 5DP7A 4MTBA 1SC8U 4AG1A 3LDXH 4ABJA 1CBWC 2WPHS 2GGVB 1P57B 2FTMA 2ODPA 2VU8E 1W0YH 1UTOA 4YO9A 3RXKA 3A8DA 1QA7A 3A7TA 3ZV8A 4NA8A 2BD8A 4O97A 3TIUA 1HGTH 1GJBB 1O3MA 3LKWA 1CSOE 1GCTB 4X2YA 1LVMA 4O9VA 9LPRA 2Q6FA 4X1QU 2WPKS 5L6NH 3QLPH 1WU1A 2ZFPH 4X1PU 3AAUA 1ZTJA 1HUTH 3GCTF 3Q76A 4J1YA 1GBCA 2FESH 1P11E 5J4QA 1O2JA 1PPBH 1C2JA 1OPHB 1EZXC 1G3CA 2OP9A 4Y0YE 1H9LB 1AN1E 5B6OA 4WY3A 5PTPA 3CP7A 3D65E 3PWCA 3Q3YA 3STJA 1HAZB 1TONA 1O3FA 3LGVA 1XUIA 2PTNA 3NK8A 3FZDA 4XSKU 1H9HE 1V2TT 1P9UA 2A7HA 1C5QA 1MCVA 1GVZA 3RXGA 3B8JA 1TRMA 2B9LA 3A84A 4WXIA 1RGQA 1J9CH 3QX5H 4U2WA 1K2I1 5FBIA 3UQOA 1FPHH 1AVWA 1VITH 1KLTA 1G37A 2ZF0H 3M7QA 4X1RU 1SHHB 4CH8B 1LKAA 1KY9A 1GI1A 1FZZA 3RXUA 1L1GA 3KQBA 5BPEA 1FLEE 1S0QA 4GPGA 4X2XA 3R0FA 5DP6A 3UREA 4TWWA 2FIRH 1NU9A 1O34A 4MPXA 4ZROA 3ENSB 3EA7A 3SGAE 4RKJB 3MO3A 1HIAA 4ESTE 1WSSH 9ESTA 4LXBH 1HBTH 2O8MA 2VINA 1O2KA 2WPIS 3PV4A 3KQEA 1ELFA 1KXBA 4ZKSU 2D2DA 3AVZA 5CMXH 4OS7A 1C1VH 3RXOA 3M3TA 3ZZCA 2G52A 3P95A 1PQAA 2BY6X 2ZCHP 3FANA 3T26A 1FAXA 1HAXB 1O33A 2UWOA 4Z6AH 3HGNA 3VB6A 4O3UA 2G55A 3P8NA 4MPUA 5T6FA 3ZZDA 1KTSB 5LH8A 5GCHF 1KXCA 4JZIA 1MAYA 1UVPA 1E34B 1P2IA 1P01A 1CGIE 1O2LA 4AYVB 3ZZ5A 3E6PH 1J14A 3P70B 1DWBH 1LCYA 1THRH 3T5FH 2CN0H 2FS8A 3A83A 4GCHF 1CU1A 1O3BA 4JZFH 1ANDA 1ZRBA 1LKBA 5C1XA 4ZHMU 1V2MT 3ZVFA 1NFYA 2BY5X 2NU2E 2Y80A 4H42U 4WVPE 1QA0A 1OYQA 1GJ4H 1KXAA 2ZDLA 1N6YA 4JYTA 5EOKA 3O8BA 3SNEA 3BN9A 2AIQA 2BLQA 2Q1JA 3T25A 3LOXA 1TQ0B 1AKSB 1JWTA 1F7ZA 2XTTB 1BCUH 3TITA 2F9UA 1GHBF 3SW2B 1CHOF 1NT1A 3ATMA 1O2IA 2A31A 4D8NA 1V2LT 1EJMA 3M5OA 2A7CA 2BVXH 1KLJH 3OU0A 4ZKRU 3DT0H 1D3TB 5HM9A 4CRDA 2BY9X 5CHAB 5EQQA 1NPMA 2B8OH 2G81E 2XCFA 1TPOA 3L3TA 4NCYA 2GT8A 1T4VH 2OC0A 3SOSA 4VGCB 2UWPA 3RXIA 1W12U 1VZQH 3Q77A 1GJ5H 3LJOA 1UK2A 5L30H 2GZ7A 3PMJA 1UTKA 5A09A 5JB9S 2GV6A 4JYVH 3V13A 3MFJA 1BDAA 1LTOA 3GCNA 4WMFA 2VH0A 1YLCA 2QCYA 2Y5GA 3RU4D 1EJAA 3A7ZA 1D6RA 2ZQ2A 2ANYA 1ZHRA 2FO9A 5A0BA 2CXVA 4ZHLU 3TK5A 5EXNA 4NWKA 5T6GA 4XBCA 4UD9H 5F8ZA 2Y81A 4HI3A 3BTKE 1LVOA 2GZ8A 4Y79A 3V0XA 1HAIH 5TCAA 1BHXB 1S84A 1PPZA 1EAUA 3BTGE 2OC7A 1O5AB 1PPGE 4A1VA 1GJ7B 3R3GB 1GWAA 2ZEBA 2BM2A 1H8DH 2Z9KA 2ZTYA 2PGQB 3P8OA 1A5HA 1K28D 1FDPA 4I8JA 1XUGA 1AB9C 1QRWA 3RXEA 1GBJA 3P17H 1C5PA 1NFXA 1O3EA 3TJVA 2ZCKP 2VJ1A 1TOMH 1LDTT 1K1MA 1CA8B 2ZDAH 1IAUA 5E8EH 1BOQA 3ZZ3A 1TMTH 4INHA 3ZVBA 1G2LA 2RG3A 2FI5E 1TGBA 4JYUH 1ARCA 1GBAA 2HNTE 2VVVA 2I6QA 3I29A 4UE7H 2VWNA 3A82A 5TJXA 1G3DA 2XW9A 2EC9H 4I7YH 5EPNA 4MPVA 4ABGA 2FOMB 2V0BA 1DT2A 3RXTA 2TRMA 2W3KA 4WH8A 2ZI2H 3SI4H 1K1IA 1C2MA 1Y3UA 1YYY1 2ESTE 2IN2A 4IC5A 1YPMH 5FBEA 1T8MA 3P8GA 1TABE 4X6PA 5TCCA 1PYTD 1HCGA 2ZQ1A 2D1JA 4GSOA 3HATH 1GBHA 1A5GH 4CREA 3KNXA 4UFEH 1YPLH 1PPCE 1FN8A 1TALA 2V3HH 2VGCB 8KME2 1JRSA 1KXFA 2PWXA 1F2SE 1ZJDA 4Y0ZE 3A7VA 1O2YA 1LQDB 2ZKSA 1BUIA 2UUFB 4OS6A 1C1TA 5C2ZA 4X1NU 3SJIA 2XBYA 4H4FA 1XUKA 3DA9B 3MH6A 3FP7E 1KXDA 1DXPA 4FUCA 3UNSA 1NRNH 3UWJH 3LIWA 1NRQH 1F5RA 3MTYA 1MUEB 1A4WH 4E05H 1QJ1B 1S6FA 3G01A 1UCYH 3FP6E 5AFYH 2P3UB 2BD9A 2XBVA 1FXYA 2FI3E 4NZLA 1K1NA 2VIWA 4K1TA 1GI6A 6ESTA 3QTOH 1ZSLA 3A8AA 4NA7A 6GCHF 1CBWB 1KLIH 2HVXA 1QRZA 2OTVA 3VXFH 2KAIB 4FVBA 4Q7YA 1QTFA 1GDNA 1Z6EA 2A4OA 4AZ2B 2ZU2A 1HJAC 4ABAA 2WUBA 4X8VH 1B0EA 2FOFA 1GGDB 4WMDA 3KL6A 3B9FH 4E7NA 1EXFA 3AW0A 3GY8A 3P92A 4NIVA 1TA2A 3SI3H 1QY6A 2ZIQH 3UR9A 1C2IA 4X8SH 1A0JA 1MZAA 2ZO3H 5HM2A 1HLTH 1INCA 1SGDE 1UCYK 5HMAA 1BBRH 4MDSA 3ODFA 1GMDG 2XC4A 3ZZ9A 2PSXA 5IDKA 4A6LA 3I77A 2SGQE 4IS5A 2GZ9A 4GCHG 1SGCA 4FUJA 2OQUA 2GDDA 2ZU5A 1O37A 5J4SA 2VWOA 1P02A 4BXSA 1FQ3A 1SBWA 1WOFA 3ZV9A 4OS1A 2BVRH 3RXDA 1TPSA 2FOCA 3H7TA 2Z94A 1WQSA 3U69H 1O39A 1HAPH 3RUOA 1XMNB 1G3BA 3KGPA 4ZMAH 4IW4E 2OBQA 2AGGX 2BOHB 1UTNA 5EODA 3RM0H 3A88A 2OUAA 5AVDA 5T6DA 1H1BA 1AGJA 1NO9H 4I31A 1YBWA 3TH4H 1QL9A 1W0ZU 2SGFE 1ETSH 4K1SA 1XVMA 3MHWU 2G5VA 2Z3DA 1KTTB 2G8TA 4NSYA 4D9RA 1F5KU 1QJ6B 3D49H 2O8WA 1HV7A 1BTUA 4ABFA 4IMZA 1B5GH 4JCNA 1XXDA 5SGAE 2GX4A 4Y7AA 1SGEE 1ZOMA 1Z7KA 1DWDH 1UJ1A 4BXWA 5EW1H 1MTSA 1C1SA 3TU7H 1SGPE 2ZA5A 1TNHA 2VIDA 4LZ4B 5A0CA 3V12A 3NPSA 4U30A 1NM6A 1SLVB 1ACBE 1GJCB 3MU1A 1WYKA 1MH0A 1O3PB 3ATIA 5HYOA 1CA0B 1S85A 3FAOA 4BAMB 2Q6DA 1C1PA 1RTLA 1O38A 2JETB 2SNWA 3LPRA 2ZHWH 4DY7B 4X6NA 2XC0A 5EU8A 2G51A 1O5FH 1MTNC 1Y59T 3NXPA 2PUQH 1P09A 1VJ9U 1HDTH 1C2HA 2W3IA 4AORA 4O3TA 4MNXA 1IQMA 4YM9A 2ZGBH 4PROA 4RKOB 1V2JT 1AUJA 1Z8RA 1TB6H 1ZPBA 4JZDH 2QA9E 3VXEH 1XKAC 1QB9A 1HB0B 3AASA 2HOBA 1O3KA 1O2GH 4CRAA 4OS2A 1ORFA 5C5OA 1GI8B 4X0WU 3SBKA 1W8BH 1C5SA 3OYPA 1Y3WA 4F49A 2HPQH 4Y8ZA 4GLYA 1C2KA 1GBIA 3ZYDA 3ELAH 1HJ8A 1OWHA 1BT7A 3K65B 1F0UA 1XUHA 1ETRH 4B73A 1JIMA 1S5SA 2EI7A 1TPAE 2BDHA 1W10U 3A8BA 3TGIE 2H5CA 1W7GH 2VGCC 4FUFA 4BTUB 4XDEA 1GMCG 1GCDA 3MI4A 1SHYA 4K5ZA 4H6TA 3IITA 2BX3A 2ZFTA 1QNJA 2ZDNA 1OP2A 1GBEA 3M5MA 1SOZA 1IQFA 1WTHD 1BTWA 2BHGA 1FONA 2DE9A 1CVWH 2F9NA 4BAQB 2PKSB 4ZKNU 4UFDH 2GVFA 2GDEH 3DFLA 1HNEE 1K1LA 1TPPA 5DKMA 3BG4C 3KEEA 4FU8A 2AMQA 2H5DA 3A80A 2XRCA 2J4IA 1MMJN 3E1XB 3GCHB 1UHBA 2HALA 1ZPCA 5GCHG 1UVSH 1AMHA 2QC2A 1BITA 2A7JA 2QF0A 2Z9LA 3SQEE 1A0LA 2A32A 1THPB 3ZZ4A 2A4RA 1W13U 1MD8A 3HK3B 4AB8A 2G5NA 2GD4B 1GI3A 3CS0A 2PSYA 3VPKA 2GCHG 1AI8H 4ISIH 3VEQB 3HKIB 3MO9A 2FLRH 1GJAB 3MOCA 2QY0B 2CV3A 3QN7A 1S82A 3RDZA 4B2CA 2BXUH 4WF8A 1H9IE 3GCHC 4X6OA 2AMPA 3SNBA 2ZPRA 3T2NA 3UQVA 2XCNA 3E90B 1C5NH 3QTVH 1ELBA 4DURA 2AS9A 3UY9A 5C5NA 3ZYEA 2XXLA 2OINA 3PO1B 4DIIH 2A2QH 3UOUA 1O2PA 3MMGA 4NSVA 2P16A 1EP5A 4DVAU 1UTQA 1SGYE 3QGJA 2WUCA 1O2NA 1OWIA 1IQIA 4B74A 5FX6A 1MCTA 6LPRA 1MQ6A 5F8TA 5EQSA 1O31A 2HNTC 3F6UH 2UUYA 1GHWH 3WY8A 4Z0KA 2A0QB 1GI5A 3ATKA 4A1TA 3SNAA 2PFEA 2CMYA 1ZR0A 4QT8C 3EYDA 1DUEA 3RMMH 2CF8H 2RA3A 3OTJE 6CHAB 1EOJA 2GCTC 2ULLA 1FAKH 2ZTXA 5GIBA 2NU0E 1IQHA 4MNVA 5FX5A 1MQ5A 1Y8TA 3E91A 4YLUA 3TJNA 4YOGA 3KCGH 1SFIA 1SGTA 2A45B 1OXGA 3GY3A 1QCPA 2Z7FE 1FV9A 1LPGB 5CHAC 1G3EA 1SSXA 2OC8A 1O2RA 1TLDA 3O8DA 3LT3A 4AOQA 3VB7A 1HAHH 2F9BH 1NFUA 1O5BB 1UTMA 1CGJE 1C9PA 1P03A 2VH6A 4MNWA 2IJOB 4CR5A 5LPEA 4NGAH 3SU6A 1HYLA 1TX7A 4BTTB 1MTUA 1GI9B 1UTPA 1ID5H 1QBOA 3SUFA 1O3NA 2UWLA 3LJJA 4MVNA 2BZAA 5FCKA 1P2JA 1CT0E 1L1NA 1EJNA 3BTTE 5A8YA 1AB9B 1AZ8A 4DT7B 1QBVH 3UUZA 2BD3A 1EP6A 3TNTA 3A89A 5L2ZH 3DD2H 2J2UA 5C1YA 2QAAA 1SGQE 1ZHMA 4ABHA 1D3PB 3GCTG 1Z8JB 1L4ZA 1A2CH 1EX3A 1O2VA 1CQQA 2AEIH 1C5YB 3SORA 2IPHA 1C5VA 1Y5BT 4MQAA 1O5DH 4ISHH 4A7IB 3RXSA 2P94A 4UFFH 4K69A 2PKAA 2O8UA 1SMFE 3MU8A 4AB9A 5LPRA 5L2YH 1XVOA 2ANMH 2DUCA 1GMHF 2QXJA 8GCHF 2EA3A 1HAGE 1N8OC 1EUFA 1XM1A 2UUKB 1VCQA 1XKBC 2ZU1A 3LGIA 1QURH 1FY3A 1SOTA 3TJUA 1V2VT
chains in the Genus database with same CATH superfamily
1TE0A 1OYTH 1E0FD 1AZZA 3TNSA 3RXFA 1T8OA 7LPRA 4Y71A 2FOHA 4NFFA 4YT7H 5I46H 4Y10E 4CHAB 3UPEA 1AE8H 1E38B 1C1UH 1YWUA 4NWLA 3MNCA 1YPKH 2ZGJA 2BD4A 1BRUP 5E0HA 2QXIA 3GDVA 3RXQA 3H5CB 3SUDA 4AFSA 1HFDA 1GG6B 3BEUA 3O8RA 5DJ7A 1GHAF 2G4UA 2O9QA 5T3HA 2ALPA 1W11U 4OGYA 1EZUC 4KTUA 3BIVH 4H6SB 2A5KA 3GDUA 3PYHA 4ZXYH 3RXMA 3MU5A 1ANEA 1O32A 1JRTA 3GDSA 5DPAA 2QIQA 5F03A 1BTHH 1EAIA 1RJXB 3SZNA 2SGAA 1V2ST 1DE7H 2BY7X 3BF6H 3RMLH 1C2FA 4AFQA 2Z9JA 1HXEH 3KQ5A 2J98B 3KIDU 2LPRA 1ABJH 1FI8A 2XC5A 1QL8A 3P6ZB 1EAXA 4LK4A 1ESBA 2GJGA 1AD8H 2L74A 3M35A 2YNBA 3SO3A 4A92A 1D6WA 1YM0A 1UVUH 3U8TH 3S69A 4FU7A 3V3MA 4AC9A 2FZZA 2OCVB 2Y7ZA 4FUEA 2BDIA 3GYMA 2WPDD 1TNIA 5K0HA 1XUFA 1LHDH 5E0GA 4CRGA 2H9HA 2G00A 2JJ1D 1GHZA 2FEQH 3ATLA 3ZZ8A 5ABWA 2ZP0H 1E37B 3UAIC 2FPZA 1L4DA 2AGIX 1C2DA 1GL1A 1ETTH 2Y82A 4F4OC 3S0NA 2ZHDA 1PPFE 1KDQA 2VWLA 3EDXB 4BANB 3F68H 1F5LA 3SV8A 1GI7B 2F3CE 3U28C 2FYRA 3ITIA 3OSYA 2W6ID 5C17A 1JIRA 1ESAA 3PRDA 4WMEA 4GUXA 1GVKB 1VCPA 4X2WA 1C5ZB 1DSTA 1FPCH 1WUNH 3E3TA 1JXPA 1L0ZA 3MH4A 3PLKA 1C5WB 1T7CA 2J38A 1PQ7A 1O0DH 1IQLA 3SGBE 1SQOA 2CHAB 3ZZBA 2F9OA 5DP3A 4DW2U 5EXLA 5EPYA 4NA9H 4GHQA 1EOLA 1O2XA 2ANWA 5C67A 3GISB 1BRBE 5FPTA 1D3DB 4OM9A 3QWCH 1Y5AT 3GY5A 1V2OT 1TGNA 3F9EA 4TWYA 1GHBG 1ZSJA 4WH6A 4YTAA 1S81A 1C1MA 1E35B 1S83A 3DHKH 2J95A 2M5TA 1CA0C 5DP5A 7GCHF 2C90B 1LHEH 1QGFA 3EAJA 3F0OA 1P2MA 5CHBA 1XUJA 5GPIB 1C5MD 1P2QA 1PJPA 3VFEA 4ASHA 1K21H 2TIOA 3W95A 3SU3A 5C0TA 1C4V2 4UDWH 3NKKA 4B1TA 3F9HA 5JPMH 5GXPA 3MNBA 2ANKH 3KHVA 2F91A 1PPHE 3GY2A 1T32A 1RS0A 3ESTA 4INKA 3OTPA 2QYIA 1QFKH 1V2RT 4RI0A 1DVAH 2C93B 1HAVB 3BG8A 3D62A 1LVYA 3F1SB 1TNKA 1ELDE 4DGJA 1QHRB 1TGTA 1V6DA 1HAOH 2Y6TA 3RXLA 1MKWH 1IQGA 1SQTA 2JH6D 2JKHA 1ELCA 3QUMP 2VIQA 4D9QA 1AU8A 2HNTF 4VGCC 1O3LA 3PTBA 4GHTA 1DLKB 1CT2E 1EKBB 2BLWA 3BIUH 1TFXA 2FS9A 1O5CB 1Y5UT 3RMNH 1W14U 3H7OA 1F92A 1ELTA 1YPHE 4MLFB 3TJOA 3RLWH 4K8BA 4CRFA 1EPTA 1FY1A 4CRCA 1BB0B 3EQ0H 3V7TA 3RXVA 3NCLA 1K1OA 1QR3E 1GI4A 4BAHB 3SYJA 1O2MA 2EI8A 2B0FA 3BTWE 3N7OA 3A7YA 1C5UA 2ZHEH 2K8IA 3RU4T 5ETXA 3SU4A 1J15A 2W6JD 2AMDA 1Q2WA 4TT3D 3CENA 1BRAA 3EGKH 1DSUA 2R2WU 1PFXC 2GT7A 1GBFA 3KN2A 4Z1MD 2FI4E 1DDJA 1BIOA 2TGPZ 7GCHG 7KMEH 2CGAA 3ZZ6A 1WV7H 2OLGA 2BOKA 2H9EH 2ZTZA 1ANBA 4I8HA 1TBRH 2ZG0H 3GYLB 4FXGH 1GI0A 2Z3CA 4K3JA 2FXRA 3VGCC 1F0SA 2XYAA 1EATA 1SVPA 2BX4A 1SL3A 1TNGA 1FY4A 2XWBI 1MBMA 1QJ7B 1SFQB 2BVSH 2A1DB 1VR1H 5DG6A 5A8XA 2C3SA 4XOJA 2ZECA 3SUEA 1UVOA 2OC1A 2FLBH 3DFJA 2VVCA 3RC4A 3IWMA 4AFUA 3B23B 3T29A 1YLNA 1EB2A 4AGJA 1J17T 3BTFE 1ZMJA 2FYQA 4AGKA 3A7WA 3TGKE 1VITF 3E0PB 3U1IB 5JBBS 2I6SA 3Q00A 4GVUA 4MPWA 1GDQA 4X1SU 5BRRE 1NROH 1ZMNA 1P3CA 3UOPA 3L33A 5HKKD 1DXWA 1V2NT 3BSQA 5C94A 3SU5A 1WTGH 4AFZA 1TNJA 2P8OC 1XXFA 4XD7D 4SGBE 1A1RA 2UUJB 1UK4A 1ZJKA 5A8ZA 3BTEE 1FNIA 3SV6A 1SGFA 4AYYB 3OY6U 1OWDA 5LGOA 1FIWA 1YC0A 3KQCA 4LZ1H 1UTLM 1MKXH 1O2HA 2J9NA 3HKJB 5GNDA 2H2ZA 2YMSB 2FDAA 4I8KA 4BAKB 2OQ5A 2VIVA 4NIXA 1K1JA 4DCDA 4YESB 2H1UA 4AG2A 2BDCA 3ODDA 5DP4A 4A5TS 3QO6A 4B2AA 3HPTB 1O2QA 3RXJA 1C1RA 1OOKB 2PTCE 3BG4B 4B2BA 1WQVH 4IGDA 3ZVDA 1JMOH 2BQWB 2C8XB 1TNLA 1AY6H 4Y8XA 3GY6A 4Q7XA 2NWNA 4K8YA 3T28A 2Y5HA 1DY8A 1XX9A 3BEFB 1UVTH 2EI6A 2J97A 4KP0A 1C4U2 2ODQA 1C2LA 2VIOA 3PWBA 4Q80A 4KGAA 1BTYA 1CE5A 2CHAC 3RLYH 2JIZD 1DS2E 3L6PA 2F9PA 4SGAE 3SN8A 3EE0B 4IMQA 3UIRA 2VBCA 1P06A 1X7AC 2PV9B 2ZU3A 2LELA 3M7UA 3DSOA 3FO8D 2A2XH 2OD3B 5ESBA 2XNDD 1GGDC 1GG6C 4ASUD 4ZKOU 1GMDF 4I33A 1GBMA 1DICA 4ABDA 1ZYOA 1MD7A 4YOIA 4R0IA 2J98A 1CGHA 3N7DA 2D26C 3S9AA 1EAWA 1O2UA 2VVUA 2HVYB 1O2WA 3GICB 5C1UA 1HXFH 1MKXK 2BYAX 3MH5A 5C3NA 1Z1JA 3UB0A 1NESE 3F9FA 1RTFB 3RMOH 2XNIA 8ESTE 1W7XH 4ZUHA 2W26A 5DK1A 3ZVGA 1U6QA 4BOHA 2ZFRH 2NU1E 1GVLA 3UWIA 1P3EA 4ABEA 4KELA 1TGSZ 8LPRA 4K2YA 1AE5A 1C1NA 4TPYA 4FUHA 1ZSKA 2PUXB 3LC5A 2J94A 1GI2A 1HAVA 1SR5C 1NU7B 1FN6A 2W7UA 4HFPB 4CRBA 2BY8X 5FCRA 1T4UH 4TYDA 1TX6A 3KF2A 4XBBA 1DM4B 1YPEH 1HPGA 1AWFH 2KM0A 1EASA 1KSNA 1SGIB 1BBRE 2R2MB 3LC3A 4CBOA 5H4IB 1C5TA 1V2PT 2YOLA 3RXAA 3BEIB 1PQ8A 3F2GA 1HJ9A 1TAWA 1LMWB 5C20A 1MTVA 3LGYA 2IPQX 4JZ1A 1T8NA 2AFQB 3RXRA 5K7RA 3S7HB 4I86A 1C1QA 4DOQA 1GMCF 1WBGB 3TK6A 2WPMS 3TPIZ 1TMBH 2G4TA 3AK5A 3C1KA 1CHOG 1AVXA 1ZHPA 2AIPA 3BTHE 5EXMA 3U8RH 3TK9A 1UK3A 2ZDVH 2THFB 1ELAA 1GJ8B 2BDBA 3ZZAA 2ZU4A 1N6XA 5JBAS 1BTPA 1O35A 2AYWA 2XBXA 1MBQA 3FFGA 2A4GA 1Z1IA 2BQ7B 2P3TB 1O3DA 1PQ5A 2P95A 2XBWA 1BA8B 2EEKA 1WAYB 2R0KA 3T27A 3PTNA 1TGCA 1YLDA 4E06H 1ZGIA 4KKDA 2NU3E 2FODA 2O8TA 2NU4E 2KCOA 2STAE 2QXGA 4TPIZ 1IOEA 3QDZB 4GAWA 1K9OE 2GCTB 2ZHQH 4YZUA 3BV9B 4X8UH 1BJUA 5GJ4B 2AH4X 1QQ4A 3GY7A 1BJVA 1QRXA 3K9XB 1A61H 3SHCH 3S9CA 2ODYB 1QB1A 1SLXB 4Y7BA 1ELVA 1IHSH 2ASUB 4E7RG 1O30A 1BMNH 1JOUB 3SV7A 4D7GA 2BDYA 1DY9A 4ZXXH 3OEED 1SGRE 1YPJH 1TOCB 5JYIA 4NIYA 3HK6B 1VGCB 4YLQH 1QB6A 4Y6DA 5FPSA 1UHBB 1W3CA 1OKXA 4Y8YA 1D9IA 1AWHB 1BHXF 2R0LA 1ESTA 2BD5A 1O5GH 4FU9A 4ABBA 1V2WT 1ANCA 1UW7A 1RTKA 1HJAB 1C2EA 2B5TB 2ZFSA 3UNRA 1D4PB 2VB0A 2WINI 1THSH 5EQRA 4RT0A 2K1QA 2ZFFH 2BLVA 5HIZA 1C1OA 1PPEE 2SGPE 1O3HA 1UO6A 2JDID 1NZQH 1OSSA 1Z8IB 1AQ7A 4KTSA 3PB1E 1N1LA 2H6MA 2R3UA 1P12E 2WPJS 1YCPM 1MKWK 3ZVCA 3Q3KA 1O2SA 4WXVA 3LGTA 2GCHF 4HGCA 1GDUA 1WCZA 1UMAH 3SHAH 4BAOB 2FOBA 1GPZA 1Z71A 1E1RD 4IBLH 3FP8E 3RP2A 3MWIU 1YGCH 1BMAA 1G32B 2PKSC 2GMTC 3FVFB 4RN6A 1FY8E 1P05A 3K6ZA 3LONA 2YNAA 5HGGA 4HTCH 1O2ZA 4X8TH 1GMHG 5HXFA 1TRNA 8GCHG 3BTME 1P2OA 1ZRKA 2GMTB 4K1EA 3BTQE 1JBUH 1P9SA 3WWFA 1RRKA 2A5AA 3RXBA 3OAAD 1ELEE 3UNQA 4NFEA 1PYTC 4K60A 1YF4A 5CDFE 2JH0D 5A0AE 1T8LA 1UCYE 1VKYA 1CHGA 2F9VA 3UFAA 1WXRA 5LPFA 2GV7A 5EJZA 1LHCH 1NRPH 4Y76A 3SU0A 2BDAA 4B76A 1YPHC 3MNXA 4ZH8A 3SNCA 1L1JA 1Q3XA 2ZNKH 3URDA 2Q6GA 3PMBB 3DSPA 3E16B 3RM2H 4CHAC 3SNDA 2PGBB 3S7KB 1A0HB 4U01A 3DUXH 5DO4H 4BNRA 3A7XA 3K2UA 4CR9A 1COWD 1H8HD 4ZHAA 5DSFA 1DITH 2SGDE 1T31A 1HRTH 1S0RA 1O3CA 6GCHG 3SU2A 2TBSA 2WYGA 2QE7D 2BQ6B 2OBOA 3NWUA 3EE7A 2QXHA 1D3QB 2QN5T 2FX4A 4ISNA 1NS3A 3PLBA 2J92A 5AHGH 1DLEA 2V6NA 3A86A 3NUMA 3M3VA 1QQUA 1EPTC 3SUGA 4FVDA 3U9AH 1AUTC 3FZZA 1EZSC 1NTPA 1W2KH 2HLCA 4D76A 1MABB 4FUGA 1SGNE 2AGEX 1O3OA 3CNRA 1E36B 2ZFQH 4Y11E 2ZGXH 2VNTA 1AKSA 1GHVH 2SGEE 1RD3B 3ZVEA 2LP6A 2RDEA 2BB4A 2C8ZB 1SQRA 3PROA 1TRYA 4DG4A 5GDSH 2P8OB 1GJ6A 2PLXA 1P8VC 4Q7ZA 1C5RA 1DOJA 5FHTA 1NFWA 2Z9IA 3M37A 2ZGHA 1O2TA 1MZDA 1SB1H 2WHXA 2TPIZ 2QF4A 3U1JB 3W94A 3DSGA 3ZVAA 2QF3A 2A4QA 2LNCA 3LGUA 5FL7D 2FX6A 1NY22 1AVGH 1GJ9B 1O36A 2PR3A 2BLOA 1GBLA 1IQEA 1RXPA 1BQYA 3GOVB 5DP8A 1C5LH 1Y3VA 5FPYA 1OS8A 2GP9B 3M7TA 5E0JA 2TGDA 1SG8B 1OX1A 3A8CA 3SGQE 1P04A 5FAHA 1F0RA 4R8TB 4I8GA 1KIGH 3KQDA 2OXSA 3SJ8A 4UFGH 1AO5A 1ZTLA 1B7XB 4JK5A 3TGJE 1RFNA 1SLWB 3M61U 3TLOA 1VJAU 6CHAC 4YT6H 3VB3A 1RIWC 4ZAEA 4J2YB 4I32A 1TA6A 1SI5H 1BRCE 3LH3A 1VGCC 1N8OB 4O03A 1ZPZA 1O3IA 3EA9A 3MNSA 3VB5A 3C27B 4IC6A 2OK5A 3M5NA 1Z8GA 1C5XB 3F0PA 1KMHB 2ZGCA 3AAVA 3ZIAD 1EZQA 2EY4C 1BMLA 3M3SA 4X6MA 1ZLRA 1A5IA 1Y3YA 4FUDA 3VB4A 1TYNA 2Y5FA 4OS4A 1OWEA 1P2KA 1C1WH 3UTUH 3MU0A 2WSSD 1TQ7B 1ARBA 3SU1A 4OGXA 3E0NB 3M36A 1OWJA 1EPTB 1F0TA 3K6YA 1V2KT 5FXLA 2ZC9H 3PMHB 1NC6A 1NN6A 3KYFA 1VITG 3SJKA 4LOYH 1O3JA 3LGWA 1OWKA 2FWWA 3KYGA 3EA8A 1YCPH 3URCA 1NRSH 1GBDA 2V3OH 4XBDA 4WWYA 2GTBA 1M9UA 1J8AA 4XFQA 4JK6A 1QBNA 2RCEA 2VIPA 4KTCA 4TY7A 1J16A 4DIHH 1O5EH 2DE8A 1K22H 3CS7A 2FMJA 2AERH 2Z9GA 1BZXE 2KZ4A 4F48B 3A85A 3LH1A 3A87A 5EG4A 1AFQC 1LO6A 2W5EA 1Z6JH 3PO1C 2ZZUH 5DP9A 4CBNA 1AHTH 3HGPA 5EJ1A 1GHYH 2TGAA 5JBCS 1SPJA 1TX8A 4A1XA 3D23A 4MNYA 4HZHA 4AN7A 1DWEH 2SNVA 5JB8S 5EW2H 4ZCNA 2BZ6H 1FY5A 1G2MA 4ACBA 4AX9H 2BTCE 5A2MH 1A3BH 2ZDMA 3P8FA 3JZ2B 1LQEA 2ZPQA 2HPPH 3MYWA 3ZZ7A 1HIAB 3BTDE 3SJOA 4UEHH 5JBTA 1DX5M 3RC5A 1P2NA 2B7DH 5AF9H 5F6MA 1O3AA 2C8WB 2RA0A 1MU6B 2HRVA 2A5IA 2Z3EA 1P10A 1QZ8A 3ATWA 4Q2KA 1TBQH 4JZEH 5E2OA 1LHGH 2BD2A 3E8LA 1YCPK 2ZDKA 2ALVA 3AW1A 2V35A 5AFZH 1FMGA 1SQAA 2ZWLH 3RU4E 2KX4A 3F9GA 2FOEA 1DANH 3QK1A 2VWMA 2R9PA 1G9IE 3MH7A 5CE1A 4XE4A 1LHFH 1GBTA 1NRRH 4I8LA 1A46H 1QL7A 1ZGVA 2C4FH 3PMAB 2D8WA 3SZEA 1BMMH 1V3XA 1AFQB 4B6FA 3SQHE 2KFWA 1LPZB 2PHBA 2PKAB 5ESTE 2KAIA 1GBKA 1C2GA 3SV9A 3GY4A 3A81A 2BMGB 1YPGH 1GHAG 1E1QD 1YKTA 5EIYA 5JDUB 2IOTA 3U8OH 5DN6D 2M2AA 2FTLE 4YOJA 4IN1A 4OS5A 3MO6A 3TH3H 3OX7U 1SLUB 3MU4A 1GCTC 4MG3A 3U98H 2XWAA 5I25A 2BXTH 5GWZA 2HGTH 3OY5U 1NBMD 1DPOA 2ZHFH 2FOAA 1KXEA 3FN8A 4Q63A 1YP9A 4M7GA 3TVJB 2P93A 4U32A 4HG6A 4UONA 1V2UT 4NG9H 1B0FA 1H4WA 5EGMA 1IHTH 1MTNB 4M9FA 2HWLB 2QGRA 1MAXA 3T62A 3NZIA 1GL0E 1G36A 3LU9B 2EQNA 4ISLA 1L2EA 4NZQA 2KCYA 4JMYA 1S6HA 3RXPA 4IN2A 1DUAA 1AFEH 1O2OA 3PM3A 1DWCH 1BBRK 4FUIA 4RSPA 4X2VA 2RDLA 1EFRD 3STIA 2O8LA 2H9TH 3I78A 1IQJA 3SJ9A 2J34A 3M5LA 2SFAA 2WV4A 3QZRA 1V2QT 1Q31A 3OFND 4WJG2 4FUBA 2Y7XA 3S9BA 1TIOA 4ISOA 2P3FH 3PRBA 1ELGA 1P0SH 2PW8H 1TBZH 3PLPA 5E2PA 1BTXA 2C8YB 3GCOA 3QGNB 1OP8A 1GJDB 2BD7A 2JH5D 1MU8B 2BDGA 3QZQA 3SV2H 4D7FA 2Z6BD 1HAYB 2GKVE 1G30B 1ABIH 1S6LA 1ZZZA 5G4BA 1K1PA 5IYTA 2P59A 3UR6A 1IQKA 1FIZA 2CJIA 1TWXB 2QV1A 1SGFG 1TMUH 3Q3XA 1BTZA 1LVBA 4DJZB 4INLA 1Y3XA 4TSFD 2ZCLP 1FUJA 1QIXB 1CT4E 1EB1H 1CO7E 2FP7B 1EQ9A 4B71A 2WPLS 1MTWA 1KDQB 7ESTE 1C4Y2 2JETC 2TGTA 2FOGA 1FJSA 1GBBA 5F8XA 4NIWA 1GHXH 2FM2A 4B75A 1O3GA 1KYNA 1RIWB 3TH2H 4BTIB 1AIXH 3IG6B 2WV5A 2R3YA 5KECA 2ILNA 3RXCA 3W1EA 1OP0A 5DGJA 1C9TA 2CF9H 3VGCB 1A3EH 2STBE 1ZMLA 3RXHA 1ZTKA 1LPKB 1DFPA 1A7SA 2WYJA 4TY6A 3RC6A 1C5OH 2ZPSA 2W7SA 4CH2B 3O8CA 2F83A 1UTJA 1VCWA 1IQNA 4ABIA 1H8IH 1W0JD 3JZ1B 3NRLA 4THNH 5DP7A 4MTBA 3PV2A 1SC8U 4AG1A 3LDXH 4ABJA 1CBWC 2WPHS 2GGVB 1P57B 2FTMA 2ODPA 2VU8E 1W0YH 1UTOA 4YO9A 3RXKA 4YXWD 3A8DA 1QA7A 3A7TA 3ZV8A 4NA8A 2BD8A 4O97A 3TIUA 1HGTH 2IJD1 1GJBB 1O3MA 3LKWA 1CSOE 1GCTB 4X2YA 4F55A 1LVMA 1W0KD 4O9VA 9LPRA 2Q6FA 4X1QU 2WPKS 5L6NH 3QLPH 3H09A 1WU1A 2ZFPH 4X1PU 3AAUA 1ZTJA 1HUTH 3GCTF 3Q76A 4J1YA 1GBCA 2FESH 1P11E 5J4QA 1O2JA 1PPBH 1C2JA 1OPHB 1EZXC 1G3CA 3F3BA 2OP9A 4Y0YE 1H9LB 1AN1E 5B6OA 4WY3A 5PTPA 3CP7A 3D65E 3PWCA 3Q3YA 3STJA 2CK3D 1HAZB 1TONA 1O3FA 3LGVA 1XUIA 2PTNA 3NK8A 3FZDA 4XSKU 1H9HE 1V2TT 1P9UA 2A7HA 5EJLA 1C5QA 1MCVA 2PP6A 1GVZA 3RXGA 3B8JA 1TRMA 1WDIA 2B9LA 3A84A 4WXIA 1RGQA 1J9CH 3QX5H 4U2WA 1K2I1 5FBIA 3UQOA 1FPHH 1AVWA 3GS9A 1VITH 1KLTA 1G37A 2ZF0H 3M7QA 4X1RU 1SHHB 4CH8B 1LKAA 1KY9A 1GI1A 1FZZA 3RXUA 1L1GA 3KQBA 5BPEA 1FLEE 1S0QA 4GPGA 4X2XA 3R0FA 5DP6A 3UREA 4TWWA 2FIRH 1NU9A 1O34A 4MPXA 4ZROA 3ENSB 3EA7A 3SGAE 4RKJB 3MO3A 1HIAA 4ESTE 1WSSH 2YMSC 9ESTA 4LXBH 1HBTH 2O8MA 2VINA 5C0UA 1O2KA 2WPIS 3PV4A 3KQEA 1ELFA 1KXBA 4ZKSU 3FOAA 2D2DA 3AVZA 5CMXH 5T1VA 4OS7A 1C1VH 3RXOA 3M3TA 3ZZCA 2G52A 3P95A 1PQAA 2BY6X 2ZCHP 4P02A 3FANA 3T26A 1FAXA 1HAXB 1O33A 2UWOA 4Z6AH 3HGNA 3VB6A 4O3UA 2G55A 3P8NA 4MPUA 5T6FA 3ZZDA 1KTSB 5LH8A 5GCHF 1KXCA 2KR7A 4JZIA 1MAYA 1UVPA 1E34B 1P2IA 1P01A 1CGIE 1O2LA 4AYVB 3ZZ5A 3E6PH 1J14A 2XOKD 3P70B 1DWBH 1LCYA 1THRH 3T5FH 2CN0H 2FS8A 3A83A 4GCHF 1CU1A 1O3BA 4JZFH 1ANDA 1ZRBA 1LKBA 5C1XA 4ZHMU 1V2MT 3ZVFA 1NFYA 2BY5X 2NU2E 2Y80A 4H42U 4WVPE 1QA0A 1OYQA 1GJ4H 1KXAA 2ZDLA 1N6YA 4JYTA 5EOKA 3O8BA 3SNEA 3BN9A 2AIQA 2BLQA 2Q1JA 3T25A 3LOXA 1TQ0B 1AKSB 1JWTA 1F7ZA 2XTTB 1BCUH 4RT1A 3TITA 2F9UA 1GHBF 3SW2B 1CHOF 1NT1A 3ATMA 1O2IA 3DCLA 2A31A 4D8NA 1V2LT 1EJMA 3M5OA 2A7CA 2BVXH 1KLJH 3OU0A 4ZKRU 3DT0H 1D3TB 5HM9A 4CRDA 4DT4A 2BY9X 5CHAB 5EQQA 1NPMA 2B8OH 2G81E 2XCFA 1TPOA 3L3TA 4NCYA 2GT8A 1T4VH 2OC0A 3SOSA 4VGCB 2UWPA 3RXIA 1W12U 1VZQH 3Q77A 1GJ5H 3LJOA 1UK2A 5L30H 2GZ7A 1BMFD 3PMJA 1UTKA 5A09A 5JB9S 2GV6A 4JYVH 3V13A 3MFJA 1BDAA 1LTOA 5KGOA 3GCNA 4WMFA 2VH0A 1YLCA 2QCYA 3F2HA 2Y5GA 3RU4D 1EJAA 3A7ZA 1D6RA 2ZQ2A 2ANYA 1ZHRA 2FO9A 5A0BA 2CXVA 4ZHLU 3TK5A 5EXNA 4NWKA 5T6GA 4XBCA 4UD9H 5F8ZA 2Y81A 2F4LA 4HI3A 3BTKE 1LVOA 2GZ8A 4Y79A 3V0XA 1HAIH 5TCAA 1BHXB 1S84A 1PPZA 1EAUA 3BTGE 2OC7A 1O5AB 1PPGE 3WW7A 4A1VA 1GJ7B 3R3GB 1GWAA 2ZEBA 2BM2A 1H8DH 2Z9KA 2ZTYA 2PGQB 3P8OA 1A5HA 1K28D 1FDPA 4I8JA 1XUGA 1AB9C 1QRWA 3RXEA 1GBJA 3P17H 1C5PA 1NFXA 3FKSD 4B6EA 1O3EA 3TJVA 2ZCKP 2VJ1A 1TOMH 1LDTT 1K1MA 1CA8B 2ZDAH 1IAUA 5E8EH 1BOQA 3ZZ3A 1TMTH 4INHA 2JJ2D 3ZVBA 1G2LA 2RG3A 2FI5E 1TGBA 4JYUH 1ARCA 1GBAA 2HNTE 2VVVA 2I6QA 3I29A 4UE7H 2VWNA 3A82A 5TJXA 1G3DA 2XW9A 2EC9H 4I7YH 5EPNA 4MPVA 4ABGA 2FOMB 2V0BA 1DT2A 3RXTA 2TRMA 2W3KA 4WH8A 2ZI2H 3SI4H 1K1IA 4Q4LA 1C2MA 1Y3UA 1YYY1 2ESTE 2IN2A 4IC5A 1YPMH 2V3MA 5FBEA 1T8MA 3P8GA 1TABE 4X6PA 5TCCA 1PYTD 1HCGA 2ZQ1A 2D1JA 4GSOA 3HATH 1GBHA 3OEHD 1A5GH 4CREA 3KNXA 4UFEH 1YPLH 1PPCE 2YMSD 1FN8A 1TALA 2V3HH 2VGCB 8KME2 1JRSA 1KXFA 2PWXA 1F2SE 1ZJDA 4Y0ZE 3A7VA 1O2YA 1LQDB 2ZKSA 1BUIA 2UUFB 4OS6A 1C1TA 5C2ZA 4X1NU 3SJIA 2XBYA 4H4FA 1XUKA 3DA9B 3MH6A 3FP7E 1KXDA 1DXPA 4FUCA 5HIYA 3UNSA 3OE7D 1NRNH 3UWJH 3LIWA 1NRQH 3N7EA 1F5RA 3MTYA 1MUEB 1A4WH 4E05H 1QJ1B 1S6FA 3G01A 1UCYH 3FP6E 5AFYH 2P3UB 2BD9A 2XBVA 1FXYA 2FI3E 4NZLA 1K1NA 2VIWA 4K1TA 1GI6A 6ESTA 3QTOH 1ZSLA 3A8AA 3F2FA 4NA7A 6GCHF 1CBWB 1KLIH 2HVXA 1QRZA 2OTVA 3VXFH 2KAIB 4FVBA 4Q7YA 1QTFA 1GDNA 1Z6EA 2A4OA 4AZ2B 2ZU2A 1HJAC 4ABAA 2WUBA 4X8VH 1B0EA 2FOFA 1GGDB 4WMDA 3KL6A 2QF5A 3B9FH 4E7NA 1EXFA 3AW0A 3GY8A 3P92A 4NIVA 1TA2A 3SI3H 1QY6A 2ZIQH 3UR9A 1C2IA 4X8SH 1A0JA 1MZAA 2ZO3H 5HM2A 1HLTH 1INCA 1SGDE 1UCYK 5HMAA 1BBRH 4MDSA 3ODFA 1GMDG 2XC4A 3ZZ9A 2PSXA 5IDKA 4A6LA 1YY3A 3I77A 2SGQE 4IS5A 2GZ9A 4GCHG 1SGCA 4FUJA 2OQUA 2GDDA 2ZU5A 1O37A 5J4SA 2VWOA 1P02A 4BXSA 1FQ3A 1SBWA 1WOFA 3ZV9A 4OS1A 2BVRH 1H8ED 3RXDA 1TPSA 2FOCA 3H7TA 2Z94A 1WQSA 3U69H 1O39A 1HAPH 3RUOA 1XMNB 1G3BA 3KGPA 2J5UA 4ZMAH 4IW4E 2OBQA 2AGGX 2BOHB 1UTNA 5EODA 1E79D 3RM0H 3A88A 2OUAA 5AVDA 5T6DA 1H1BA 1AGJA 3VG8A 1NO9H 4I31A 1YBWA 3TH4H 1QL9A 1W0ZU 2SGFE 1ETSH 4K1SA 1XVMA 3MHWU 3MQKC 2G5VA 2Z3DA 1KTTB 2G8TA 4NSYA 4D9RA 1F5KU 1QJ6B 3D49H 2O8WA 1HV7A 1BTUA 4ABFA 4IMZA 1B5GH 4JCNA 1XXDA 5SGAE 2GX4A 4Y7AA 1SGEE 4ACAA 1ZOMA 1Z7KA 1DWDH 1UJ1A 4BXWA 5EW1H 1MTSA 1C1SA 3TU7H 1SGPE 2ZA5A 1TNHA 2VIDA 4LZ4B 5A0CA 3V12A 3NPSA 4U30A 1NM6A 1SLVB 1ACBE 3WWBA 1GJCB 2WV9A 3MU1A 1WYKA 1MH0A 1O3PB 3ATIA 5HYOA 1FX0B 4FETA 1CA0B 1S85A 3FAOA 4BAMB 2Q6DA 1C1PA 1RTLA 1O38A 2JETB 2SNWA 3LPRA 2ZHWH 1NBME 4DY7B 4X6NA 2XC0A 5EU8A 2G51A 1O5FH 1MTNC 1Y59T 3NXPA 2PUQH 1P09A 1VJ9U 1HDTH 1C2HA 2W3IA 4AORA 4O3TA 4MNXA 1IQMA 4YM9A 2ZGBH 4PROA 4RKOB 1V2JT 1AUJA 1Z8RA 1OHHD 1TB6H 1ZPBA 4JZDH 2QA9E 3VXEH 1XKAC 1QB9A 2HLDD 1HB0B 3AASA 2HOBA 1O3KA 1O2GH 4CRAA 4OS2A 1ORFA 5C5OA 1GI8B 4X0WU 3SBKA 1W8BH 2RFKC 1C5SA 3OYPA 1Y3WA 4F49A 2HPQH 4Y8ZA 4GLYA 1C2KA 1GBIA 3ZYDA 3ELAH 1HJ8A 1OWHA 1BT7A 3K65B 1F0UA 1XUHA 1ETRH 4B73A 1JIMA 1S5SA 2EI7A 1TPAE 2BDHA 2KCAA 1W10U 3A8BA 3TGIE 2H5CA 1W7GH 2VGCC 4FUFA 4BTUB 4XDEA 1GMCG 1GCDA 3MI4A 1SHYA 4K5ZA 5B6LA 4H6TA 3IITA 2BX3A 2ZFTA 1QNJA 2ZDNA 1OP2A 1GBEA 3M5MA 1SOZA 1IQFA 1WTHD 1BTWA 2BHGA 1FONA 2DE9A 1CVWH 2F9NA 4BAQB 2PKSB 4ZKNU 4UFDH 3N99A 2GVFA 2GDEH 3DFLA 1HNEE 1K1LA 1TPPA 5DKMA 3BG4C 3KEEA 4FU8A 2AMQA 2H5DA 3A80A 2XRCA 2J4IA 1MMJN 3E1XB 3GCHB 2KCPA 1UHBA 2HALA 1ZPCA 5GCHG 1UVSH 1AMHA 2QC2A 1BITA 2A7JA 2QF0A 2Z9LA 3SQEE 1A0LA 2A32A 1THPB 3ZZ4A 2A4RA 1W13U 1MD8A 3HK3B 4AB8A 2G5NA 2GD4B 1GI3A 3CS0A 2PSYA 3VPKA 2GCHG 1AI8H 4ISIH 3VEQB 3HKIB 3MO9A 2FLRH 1GJAB 3MOCA 2QY0B 2CV3A 3QN7A 1S82A 3RDZA 4B2CA 2BXUH 4WF8A 1H9IE 3GCHC 4X6OA 2AMPA 3SNBA 2ZPRA 3T2NA 3UQVA 2XCNA 3E90B 1C5NH 2WZQA 1ELBA 3QTVH 4DURA 2AS9A 3UY9A 5C5NA 3ZYEA 2XXLA 2OINA 3PO1B 4DIIH 2A2QH 3UOUA 1O2PA 3MMGA 4NSVA 2P16A 1EP5A 4DVAU 1UTQA 1SGYE 3QGJA 2WUCA 1O2NA 1OWIA 1IQIA 4B74A 2K0QA 5FX6A 1MCTA 6LPRA 1MQ6A 5F8TA 5EQSA 1O31A 2HNTC 3F6UH 2UUYA 1GHWH 3WY8A 4Z0KA 2A0QB 1GI5A 3ATKA 4A1TA 3SNAA 2PFEA 2CMYA 1ZR0A 4QT8C 3EYDA 1DUEA 3PV5A 3RMMH 2CF8H 2RA3A 3OTJE 6CHAB 1EOJA 2GCTC 2ULLA 1FAKH 5IK2D 2ZTXA 5GIBA 5F53A 2NU0E 1IQHA 4MNVA 5FX5A 1MQ5A 1Y8TA 3E91A 4YLUA 3TJNA 4YOGA 4FOUC 3KCGH 1SFIA 1SGTA 2A45B 1OXGA 3GY3A 1QCPA 2Z7FE 1FV9A 1LPGB 5CHAC 1G3EA 1SSXA 2OC8A 1O2RA 1TLDA 3O8DA 3LT3A 4AOQA 3VB7A 1HAHH 2F9BH 1NFUA 1O5BB 1UTMA 1CGJE 1C9PA 1P03A 2VH6A 4MNWA 2IJOB 2V7QD 4CR5A 5LPEA 4NGAH 3SU6A 2F43B 1HYLA 2AHME 1TX7A 4BTTB 1MTUA 1GI9B 1UTPA 1ID5H 1QBOA 3SUFA 1O3NA 2UWLA 3LJJA 2L6OA 4MVNA 2BZAA 5FCKA 1P2JA 4XRNA 1CT0E 1L1NA 1EJNA 3BTTE 5A8YA 1AB9B 1AZ8A 4DT7B 1QBVH 3UUZA 2BD3A 1SKYE 1K0HA 1EP6A 3TNTA 3A89A 5L2ZH 3DD2H 2J2UA 5C1YA 2QAAA 1SGQE 1ZHMA 4ABHA 1D3PB 3GCTG 1Z8JB 1L4ZA 1A2CH 1EX3A 1O2VA 1CQQA 2AEIH 1C5YB 3SORA 5KEDA 2IPHA 1C5VA 1Y5BT 4MQAA 1O5DH 4ISHH 4A7IB 3RXSA 2P94A 4UFFH 4K69A 2PKAA 2O8UA 1SMFE 3MU8A 4AB9A 5LPRA 5L2YH 1XVOA 2ANMH 2DUCA 1GMHF 2QXJA 8GCHF 2EA3A 1HAGE 1N8OC 1EUFA 1XM1A 2UUKB 1VCQA 1XKBC 2ZU1A 3LGIA 1QURH 1FY3A 4P00A 1SOTA 3TJUA 1V2VT
chains in the Genus database with same CATH topology
1TE0A 1OYTH 1E0FD 1AZZA 3TNSA 3RXFA 1T8OA 7LPRA 4Y71A 2FOHA 4NFFA 4YT7H 5I46H 4Y10E 4CHAB 3UPEA 1AE8H 1E38B 1C1UH 4NWLA 3MNCA 1YPKH 2ZGJA 2BD4A 1BRUP 5E0HA 2QXIA 3GDVA 3RXQA 3H5CB 3SUDA 4AFSA 1HFDA 1GG6B 3BEUA 3O8RA 5DJ7A 1GHAF 2G4UA 2O9QA 5T3HA 2ALPA 1W11U 4OGYA 1EZUC 4KTUA 3BIVH 4H6SB 2A5KA 3GDUA 3PYHA 4ZXYH 3RXMA 3MU5A 1ANEA 1O32A 1JRTA 3GDSA 5DPAA 2QIQA 5F03A 1BTHH 1EAIA 1RJXB 3SZNA 2SGAA 1V2ST 1DE7H 2BY7X 3BF6H 3RMLH 1C2FA 4AFQA 2Z9JA 1HXEH 3KIDU 2LPRA 1ABJH 1FI8A 2XC5A 1QL8A 3P6ZB 1EAXA 4LK4A 1ESBA 1AD8H 3M35A 2YNBA 3SO3A 4A92A 1D6WA 1YM0A 1UVUH 3U8TH 3S69A 4FU7A 3V3MA 2FZZA 2OCVB 2Y7ZA 4FUEA 2BDIA 3GYMA 1TNIA 5K0HA 1XUFA 1LHDH 5E0GA 4CRGA 2H9HA 2G00A 1GHZA 2FEQH 3ATLA 3ZZ8A 5ABWA 2ZP0H 1E37B 2FPZA 1L4DA 2AGIX 1C2DA 1GL1A 1ETTH 2Y82A 4F4OC 3S0NA 2ZHDA 1PPFE 1KDQA 2VWLA 3EDXB 4BANB 3F68H 1F5LA 3SV8A 1GI7B 2F3CE 2FYRA 3ITIA 3OSYA 1JIRA 1ESAA 4WMEA 4GUXA 1GVKB 1VCPA 4X2WA 1C5ZB 1DSTA 1FPCH 1WUNH 3E3TA 1JXPA 1L0ZA 3MH4A 3PLKA 1C5WB 1T7CA 2J38A 1PQ7A 1O0DH 1IQLA 3SGBE 1SQOA 2CHAB 3ZZBA 2F9OA 5DP3A 4DW2U 5EXLA 5EPYA 4NA9H 4GHQA 1EOLA 1O2XA 2ANWA 5C67A 3GISB 1BRBE 5FPTA 1D3DB 3QWCH 1Y5AT 3GY5A 1V2OT 1TGNA 3F9EA 4TWYA 1GHBG 1ZSJA 4WH6A 4YTAA 1S81A 1C1MA 1E35B 1S83A 3DHKH 2J95A 2M5TA 1CA0C 5DP5A 7GCHF 2C90B 1LHEH 1QGFA 3EAJA 1P2MA 1XUJA 5GPIB 1C5MD 1P2QA 1PJPA 3VFEA 4ASHA 1K21H 2TIOA 3W95A 3SU3A 1C4V2 4UDWH 3NKKA 4B1TA 3F9HA 5JPMH 5GXPA 3MNBA 2ANKH 3KHVA 2F91A 1PPHE 3GY2A 1T32A 1RS0A 3ESTA 4INKA 2QYIA 1QFKH 1V2RT 1DVAH 2C93B 1HAVB 3BG8A 3D62A 1LVYA 3F1SB 1TNKA 1ELDE 4DGJA 1QHRB 1TGTA 1V6DA 1HAOH 2Y6TA 3RXLA 1MKWH 1IQGA 1SQTA 2JH6D 2JKHA 1ELCA 3QUMP 2VIQA 4D9QA 1AU8A 2HNTF 4VGCC 1O3LA 3PTBA 4GHTA 1DLKB 1CT2E 1EKBB 2BLWA 3BIUH 1TFXA 2FS9A 1O5CB 1Y5UT 3RMNH 1W14U 3H7OA 1F92A 1ELTA 1YPHE 4MLFB 3TJOA 3RLWH 4K8BA 4CRFA 1EPTA 1FY1A 4CRCA 1BB0B 3EQ0H 3V7TA 3RXVA 3NCLA 1K1OA 1QR3E 1GI4A 4BAHB 1O2MA 2EI8A 2B0FA 3BTWE 3N7OA 3A7YA 1C5UA 2ZHEH 3RU4T 5ETXA 3SU4A 1J15A 2AMDA 1Q2WA 3CENA 1BRAA 3EGKH 1DSUA 2R2WU 1PFXC 2GT7A 1GBFA 3KN2A 2FI4E 1DDJA 1BIOA 2TGPZ 7GCHG 7KMEH 2CGAA 3ZZ6A 1WV7H 2OLGA 2BOKA 2H9EH 2ZTZA 1ANBA 4I8HA 1TBRH 2ZG0H 3GYLB 4FXGH 1GI0A 2Z3CA 4K3JA 2FXRA 3VGCC 1F0SA 2XYAA 1EATA 1SVPA 2BX4A 1SL3A 1TNGA 1FY4A 2XWBI 1MBMA 1QJ7B 1SFQB 2BVSH 2A1DB 1VR1H 5DG6A 5A8XA 2C3SA 4XOJA 2ZECA 3SUEA 1UVOA 2OC1A 2FLBH 3DFJA 2VVCA 3RC4A 3IWMA 4AFUA 3B23B 3T29A 4AGJA 1EB2A 1J17T 3BTFE 1ZMJA 2FYQA 4AGKA 3A7WA 3TGKE 1VITF 3E0PB 3U1IB 5JBBS 2I6SA 3Q00A 4GVUA 4MPWA 1GDQA 4X1SU 5BRRE 1NROH 1ZMNA 1P3CA 3UOPA 3L33A 1DXWA 1V2NT 3BSQA 3SU5A 1WTGH 4AFZA 1TNJA 2P8OC 1XXFA 4SGBE 1A1RA 2UUJB 1UK4A 1ZJKA 5A8ZA 3BTEE 1FNIA 3SV6A 1SGFA 4AYYB 3OY6U 1OWDA 5LGOA 1FIWA 1YC0A 3KQCA 4LZ1H 1UTLM 1MKXH 1O2HA 2J9NA 3HKJB 2H2ZA 2FDAA 4I8KA 4BAKB 2OQ5A 2VIVA 4NIXA 1K1JA 4DCDA 4YESB 2H1UA 4AG2A 2BDCA 3ODDA 5DP4A 4A5TS 3QO6A 4B2AA 3HPTB 1O2QA 3RXJA 1C1RA 1OOKB 2PTCE 3BG4B 4B2BA 1WQVH 4IGDA 3ZVDA 1JMOH 2BQWB 2C8XB 1TNLA 1AY6H 4Y8XA 3GY6A 4Q7XA 2NWNA 4K8YA 3T28A 2Y5HA 1DY8A 1XX9A 3BEFB 1UVTH 2EI6A 4KP0A 1C4U2 2ODQA 1C2LA 2VIOA 3PWBA 4Q80A 4KGAA 1BTYA 1CE5A 2CHAC 3RLYH 1DS2E 3L6PA 2F9PA 4SGAE 3SN8A 3EE0B 4IMQA 3UIRA 1P06A 1X7AC 2PV9B 2ZU3A 3M7UA 2A2XH 2OD3B 5ESBA 1GGDC 1GG6C 4ZKOU 1GMDF 4I33A 1GBMA 1DICA 4ABDA 1ZYOA 1MD7A 4YOIA 4R0IA 1CGHA 2D26C 3S9AA 1EAWA 1O2UA 2VVUA 1O2WA 3GICB 5C1UA 1HXFH 1MKXK 2BYAX 3MH5A 5C3NA 1Z1JA 1NESE 3F9FA 1RTFB 3RMOH 2XNIA 8ESTE 1W7XH 4ZUHA 2W26A 5DK1A 3ZVGA 1U6QA 4BOHA 2ZFRH 2NU1E 1GVLA 3UWIA 1P3EA 4ABEA 4KELA 1TGSZ 8LPRA 4K2YA 1AE5A 1C1NA 4TPYA 4FUHA 1ZSKA 2PUXB 3LC5A 2J94A 1GI2A 1HAVA 1SR5C 1NU7B 1FN6A 2W7UA 4HFPB 4CRBA 2BY8X 5FCRA 1T4UH 4TYDA 1TX6A 3KF2A 4XBBA 1DM4B 1YPEH 1HPGA 1AWFH 1EASA 1KSNA 1SGIB 1BBRE 2R2MB 3LC3A 4CBOA 5H4IB 1C5TA 1V2PT 2YOLA 3RXAA 3BEIB 1PQ8A 1HJ9A 1TAWA 1LMWB 5C20A 1MTVA 3LGYA 4JZ1A 1T8NA 2AFQB 3RXRA 5K7RA 3S7HB 1C1QA 4DOQA 1GMCF 1WBGB 3TK6A 2WPMS 3TPIZ 1TMBH 2G4TA 3C1KA 1CHOG 1AVXA 1ZHPA 2AIPA 3BTHE 5EXMA 3U8RH 3TK9A 1UK3A 2ZDVH 2THFB 1ELAA 1GJ8B 2BDBA 3ZZAA 2ZU4A 1N6XA 5JBAS 1BTPA 1O35A 2AYWA 2XBXA 1MBQA 3FFGA 2A4GA 1Z1IA 2BQ7B 2P3TB 1O3DA 1PQ5A 2P95A 2XBWA 1BA8B 2EEKA 1WAYB 2R0KA 3T27A 3PTNA 1TGCA 1YLDA 4E06H 1ZGIA 4KKDA 2NU3E 2FODA 2O8TA 2NU4E 2STAE 4TPIZ 2QXGA 1IOEA 3QDZB 4GAWA 1K9OE 2GCTB 2ZHQH 4YZUA 3BV9B 4X8UH 1BJUA 5GJ4B 2AH4X 1QQ4A 3GY7A 1BJVA 1QRXA 3K9XB 1A61H 3SHCH 3S9CA 2ODYB 1QB1A 1SLXB 4Y7BA 1ELVA 1IHSH 2ASUB 4E7RG 1O30A 1BMNH 1JOUB 3SV7A 4D7GA 2BDYA 1DY9A 4ZXXH 1SGRE 1YPJH 1TOCB 5JYIA 4NIYA 3HK6B 1VGCB 4YLQH 1QB6A 4Y6DA 5FPSA 1UHBB 1W3CA 1OKXA 4Y8YA 1D9IA 1AWHB 1BHXF 2R0LA 1ESTA 2BD5A 1O5GH 4FU9A 4ABBA 1V2WT 1ANCA 1RTKA 1HJAB 1C2EA 2B5TB 2ZFSA 3UNRA 1D4PB 2VB0A 2WINI 1THSH 5EQRA 2K1QA 2ZFFH 2BLVA 1C1OA 1PPEE 2SGPE 1O3HA 1UO6A 1OSSA 1NZQH 1Z8IB 1AQ7A 4KTSA 3PB1E 1N1LA 2H6MA 2R3UA 1P12E 2WPJS 1YCPM 1MKWK 3ZVCA 3Q3KA 1O2SA 4WXVA 3LGTA 2GCHF 4HGCA 1GDUA 1WCZA 1UMAH 3SHAH 4BAOB 2FOBA 1GPZA 1Z71A 4IBLH 3FP8E 3RP2A 3MWIU 1YGCH 1BMAA 1G32B 2PKSC 2GMTC 3FVFB 4RN6A 1FY8E 1P05A 3K6ZA 3LONA 2YNAA 5HGGA 4HTCH 1O2ZA 4X8TH 1GMHG 5HXFA 1TRNA 8GCHG 3BTME 1P2OA 1ZRKA 2GMTB 4K1EA 3BTQE 1JBUH 1P9SA 1RRKA 2A5AA 3RXBA 1ELEE 3UNQA 4NFEA 1PYTC 4K60A 1YF4A 2JH0D 5A0AE 1T8LA 1UCYE 1CHGA 2F9VA 3UFAA 5LPFA 2GV7A 1LHCH 1NRPH 4Y76A 3SU0A 2BDAA 4B76A 1YPHC 3MNXA 4ZH8A 3SNCA 1L1JA 1Q3XA 2ZNKH 3URDA 2Q6GA 3PMBB 3E16B 3RM2H 4CHAC 3SNDA 2PGBB 3S7KB 1A0HB 4U01A 3DUXH 5DO4H 4BNRA 3A7XA 3K2UA 4CR9A 4ZHAA 1DITH 2SGDE 1T31A 1HRTH 1S0RA 1O3CA 6GCHG 3SU2A 2TBSA 2WYGA 2BQ6B 2OBOA 3NWUA 2QXHA 1D3QB 2QN5T 2FX4A 4ISNA 1NS3A 3PLBA 2J92A 5AHGH 1DLEA 2V6NA 3A86A 3NUMA 3M3VA 1QQUA 1EPTC 3SUGA 4FVDA 3U9AH 1AUTC 3FZZA 1EZSC 1NTPA 1W2KH 2HLCA 4D76A 4FUGA 1SGNE 2AGEX 1O3OA 1E36B 2ZFQH 4Y11E 2ZGXH 2VNTA 1AKSA 1GHVH 2SGEE 1RD3B 3ZVEA 3PROA 2BB4A 2C8ZB 4DG4A 1TRYA 5GDSH 2P8OB 1GJ6A 2PLXA 1P8VC 4Q7ZA 1C5RA 1DOJA 5FHTA 1NFWA 2Z9IA 3M37A 2ZGHA 1O2TA 1MZDA 1SB1H 2TPIZ 3U1JB 3W94A 3ZVAA 2QF3A 2A4QA 2LNCA 3LGUA 2FX6A 1NY22 1AVGH 1GJ9B 1O36A 2PR3A 2BLOA 1GBLA 1IQEA 1RXPA 1BQYA 3GOVB 5DP8A 1C5LH 1Y3VA 5FPYA 1OS8A 2GP9B 3M7TA 5E0JA 2TGDA 1SG8B 1OX1A 3A8CA 3SGQE 1P04A 5FAHA 1F0RA 4R8TB 4I8GA 1KIGH 3KQDA 2OXSA 3SJ8A 4UFGH 1AO5A 1ZTLA 1B7XB 4JK5A 3TGJE 1RFNA 1SLWB 3M61U 3TLOA 1VJAU 6CHAC 4YT6H 3VB3A 1RIWC 4ZAEA 4J2YB 4I32A 1TA6A 1SI5H 1BRCE 3LH3A 1VGCC 1N8OB 4O03A 1ZPZA 1O3IA 3EA9A 3MNSA 3VB5A 3C27B 4IC6A 3M5NA 1Z8GA 1C5XB 2ZGCA 3AAVA 1EZQA 1BMLA 3M3SA 4X6MA 1ZLRA 1A5IA 1Y3YA 4FUDA 3VB4A 1TYNA 2Y5FA 4OS4A 1OWEA 1P2KA 1C1WH 3UTUH 3MU0A 1TQ7B 1ARBA 3SU1A 4OGXA 3E0NB 3M36A 1OWJA 1EPTB 1F0TA 3K6YA 1V2KT 5FXLA 2ZC9H 3PMHB 1NC6A 1NN6A 3SJKA 1VITG 4LOYH 1O3JA 3LGWA 1OWKA 2FWWA 3EA8A 1YCPH 3URCA 1NRSH 1GBDA 2V3OH 4XBDA 4WWYA 2GTBA 1M9UA 1J8AA 4XFQA 4JK6A 1QBNA 2RCEA 2VIPA 4KTCA 4TY7A 1J16A 4DIHH 1O5EH 2DE8A 1K22H 3CS7A 2FMJA 2AERH 2Z9GA 1BZXE 3A85A 3LH1A 3A87A 5EG4A 1AFQC 1LO6A 2W5EA 1Z6JH 3PO1C 2ZZUH 5DP9A 4CBNA 1AHTH 3HGPA 1GHYH 2TGAA 5JBCS 1SPJA 1TX8A 4A1XA 3D23A 4MNYA 4HZHA 4AN7A 1DWEH 2SNVA 5JB8S 5EW2H 2BZ6H 1FY5A 1G2MA 4AX9H 2BTCE 5A2MH 1A3BH 2ZDMA 3P8FA 3JZ2B 1LQEA 2ZPQA 2HPPH 3MYWA 3ZZ7A 1HIAB 3BTDE 3SJOA 4UEHH 5JBTA 1DX5M 3RC5A 1P2NA 2B7DH 5AF9H 5F6MA 1O3AA 2C8WB 2RA0A 1MU6B 2HRVA 2A5IA 2Z3EA 1P10A 3ATWA 4Q2KA 1TBQH 4JZEH 5E2OA 1LHGH 2BD2A 3E8LA 1YCPK 2ZDKA 2ALVA 3AW1A 2V35A 5AFZH 1FMGA 1SQAA 2ZWLH 3RU4E 3F9GA 2FOEA 1DANH 3QK1A 2VWMA 2R9PA 1G9IE 3MH7A 5CE1A 4XE4A 1LHFH 1GBTA 1NRRH 4I8LA 1A46H 1QL7A 1ZGVA 2C4FH 3PMAB 2D8WA 1BMMH 1V3XA 1AFQB 3SQHE 1LPZB 2PHBA 2PKAB 5ESTE 2KAIA 1GBKA 1C2GA 3SV9A 3GY4A 3A81A 2BMGB 1YPGH 1GHAG 1YKTA 5JDUB 2IOTA 3U8OH 2FTLE 4YOJA 4IN1A 4OS5A 3MO6A 3TH3H 3OX7U 1SLUB 3MU4A 1GCTC 4MG3A 3U98H 2XWAA 5I25A 2BXTH 5GWZA 2HGTH 3OY5U 1DPOA 2ZHFH 2FOAA 1KXEA 1YP9A 4M7GA 3TVJB 2P93A 4U32A 4UONA 1V2UT 4NG9H 1B0FA 1H4WA 5EGMA 1IHTH 1MTNB 2HWLB 2QGRA 1MAXA 3T62A 3NZIA 1GL0E 1G36A 3L