1OL2B

Cyclin a binding groove inhibitor h-arg-arg-leu-asn-(p-f-phe)-nh2
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Insights Into Cyclin Groove Recognition. Complex Crystal Structures and Inhibitor Design Through Ligand Exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol2B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol2B02
3EJ1B 1GUXB 1OL2B 1KXUA 1E9HB 4CFNB 1H4LD 2C5VB 4EOLB 5HVYB 1C9BA 2QDJA 1FINB 4BCIB 1H26B 3TNWB 1AD6A 5BNJB 4BCHB 4CFUB 4OGRB 4NSTB 4CFUD 1OKVB 1JOWA 3BHTB 1UNLD 4I3ZB 2G9XB 2UZLB 4IMYB 4BCOB 4RODA 2WPAB 1H1RB 2X1NB 3RGFB 3DDQB 2CJMB 2CCHB 3O0GD 4KRCB 3BHVB 5L2WB 1AISB 3DOGB 2UZEB 4EC9B 3MY5B 3BHUB 4CXAB 4YC3B 4BCPB 4KRDB 1H25B 2WMBB 4G6LB 4OR5B 1OGUB 2WXVB 1H1QB 4BCJB 2IW8B 5HBEB 1OL1B 1VINA 2W9FA 4ELJA 1H24B 2PMIB 1FVVB 4ELLA 4UN0A 5IF1B 4EOQB 1JSUB 4BCKB 4F7NB 1PKDB 1G3NC 1H28B 2C5OB 3QHWB 4EOJB 2W9ZA 1OIUB 4F70B 5LQFB 4EOPB 4EOSB 3K7AM 4BCMB 4EONB 3EOCB 4F7JB 4F6SB 4BCMD 3BLQB 1O9KB 2I53A 4CRLB 5CEIB 5EFQB 2R7GA 4F7LB 4BCFB 1H1PB 3F5XB 3BLHB 1OI9B 4CFVB 1ZP2A 1GUXA 2JGZB 3LQ5B 2IW9B 1VOLA 2B9RA 5HNBB 4EOKB 4CFWB 4TTHA 1P5EB 4BCGB 3QHRB 2C5NB 1D3UB 5CYIB 2C5XB 2IVXA 2WIHB 2WIPB 3TN8B 5HBHB 3POMA 4F6UB 2PK9B 4EOIB 4ROEA 4BCQB 4BCQD 3EIDB 2WMAB 1TFBA 5HBJB 1W98B 1UNHD 1XO2A 2PHGA 4F7SB 3TNIB 5IDPB 1URCB 4F6WB 1N4MA 1QMZB 3BLRB 2BPMB 2UZBB 2W2HA 3MY1B 5IDNB 1F5QB 1GH6B 4II5B 4EOOB 4CFMB 2WEVB 4Y72B 1VYWB 5ICPB 1BU2A 2UZDB 1OKWB 2EUFA 1OIYB 3G33B 2CCIB 4FX3B 3MIAB 2BKZB 4BCNB 1GY3B 4EOMB 4BCND 3TNHB 1H27B 5HQ0B 1JSTB 2IW6B 3DDPB 3H4CA 3MI9B 4YOZA 1JKWA 5FGKB 5ACBA 5LMKB 2I40B 2UUEB 4EORB 4EC8B 3M03A 1H1SB 2WHBB 1O9KA 2V22B 2F2CA 2WFYB 5I5ZB 4ROCA 2W99A 4YOOA 4CFXB 4YOSA 2C6TB 1UNGD 2C4GB 2PK2A 2W96A
chains in the Genus database with same CATH superfamily
3EJ1B 1KXUA 4HL4A 1V29B 3A8MB 1C9BA 1FINB 1AD6A 5BNJB 4BCHB 4BXXX 4CFUD 1OKVB 1JOWA 1UNLD 1H1RB 3RGFB 4NC6A 3BHVB 2ZPFB 3DOGB 2UZEB 4BCPB 3VKHA 4OR5B 1H1QB 2ZPIB 1OL1B 4JX6A 4LOCA 2PMIB 1FVVB 4ELLA 4UN0A 4BCKB 1H28B 2C5OB 2W9ZA 3BG5A 4F7JB 2DPPB 5EJCA 5DQWA 4OB2B 1ZP2A 4Z6YA 4JX5A 4BY1X 5HNBB 4AKIA 4HNVA 3TW7A 1P5EB 2CYZB 2C5XB 2WIPB 4HLQA 3TN8B 4F6UB 4OB0B 4ZGJB 3HO8A 4BCQD 2WMAB 5HBJB 1UNHD 3TNIB 3BLRB 4FM4B 2UZBB 1UGPB 2W2HA 5IDNB 1F5QB 4II5B 1VYWB 2QFZA 2BKZB 4AKGA 2BS4A 2I40B 2QF7A 2WFYB 2ZPEB 1OL2B 2C5VB 2ZPGB 5DQVA 3DL1A 3BHTB 4IMYB 2G9XB 2UZLB 2CCHB 5L2WB 3BHUB 3QZ5B 4YC3B 4KRDB 2KR6A 1H25B 3TW6A 5HBEB 4ZGDB 1H24B 3VKGA 3BG9A 4F7NB 4MFDA 3QHWB 4EOJB 1E7PA 4EOSB 3K7AM 4BCMB 4EONB 4F6SB 4OB3B 3BLQB 5IHYA 2I53A 3KHIA 3VYHB 3F5XB 3BLHB 3NDQA 4CFVB 1GUXA 2JGZB 2IW9B 2B9RA 5HBHB 1W98B 1XO2A 2PHGA 4F7SB 3DJBA 3X26B 2BPMB 3GTMS 1GH6B 4EOOB 5ICPB 2BS3A 2UZDB 4MFEA 1OKWB 2EUFA 3HBLA 1UGRB 4FX3B 3MIAB 2PJQA 4BCND 2IW6B 3MI9B 4YOZA 5LMKB 1H1SB 1O9KA 2V22B 4CFXB 3WVEB 2PK2A 3QYGB 1E9HB 4EOLB 2QDJA 4BY7X 1H26B 3TNWB 4CFUB 1TD6A 4OGRB 2CZ0B 4RODA 3VYGB 2WPAB 2X1NB 4HNTA 3O0GD 4EC9B 2LW4A 2WMBB 2G77A 4HNUA 4OB1B 1OGUB 4BCJB 3A8OB 2IW8B 1VINA 3A8GB 2W9FA 3QYHB 5IF1B 4EOQB 1PKDB 1G3NC 2IN3A 5LQFB 2ZZDB 3QXEB 4CRLB 5CEIB 5EFQB 4F7LB 1UGQB 1H1PB 1OI9B 3X28B 3BG3A 4BBRM 3LQ5B 1VOLA 4EOKB 3HB9A 4CFWB 4TTHA 3X20B 1FKMA 2WIHB 4EOIB 4ROEA 4BCQB 2CZ6B 3A8LB 1TFBA 5IDPB 4F6WB 1QMZB 3HHTB 3MY1B 4JX4A 2QGSA 1OIYB 3G33B 2CCIB 4EOMB 3QZ9B 3TNHB 2QDYB 2ZCFB 3DDPB 1JKWA 2WJ9A 3QWLA 4EORB 2UUEB 1IREB 2WHBB 4ROCA 5FGKB 2C4GB 1GUXB 1UGSB 4CFNB 4AI6A 1H4LD 5HVYB 4BCIB 2DD4B 4NSTB 4I3ZB 4BCOB 1AHJB 3DDQB 2CJMB 4KRCB 4M6VA 1AISB 2DXBB 3MY5B 4CXAB 4MIMA 1QLBA 3HZJA 2AHJB 4G6LB 3WVDB 2WXVB 4ELJA 2CZ7B 1JSUB 2QQ8A 3DTOA 1OIUB 4F70B 4EOPB 3QYEA 3EOCB 3B57A 4BCMD 1O9KB 3X25B 4QSHA 2R7GA 3PO3S 4BCFB 2KMGA 2DD5B 4BCGB 3QHRB 2C5NB 1D3UB 5CYIB 2IVXA 3POMA 2PK9B 4AKHA 4BBSM 2D0QB 3EIDB 2DXCB 2CZ1B 1URCB 1N4MA 2ZPHB 3X24B 4CFMB 2WEVB 4Y72B 2ZPBB 3QYBA 1BU2A 2DMEA 4BCNB 1GY3B 3A8HB 1H27B 5HQ0B 2BS2A 1JSTB 3H4CA 5ACBA 1ENWA 4EC8B 3M03A 4ZGEB 2F2CA 5I5ZB 2W99A 4YOOA 4YOSA 2C6TB 1UNGD 2W96A
chains in the Genus database with same CATH topology
3EJ1B 1GUXB 1OL2B 1KXUA 1E9HB 4CFNB 1H4LD 2C5VB 4EOLB 5HVYB 1C9BA 2QDJA 1FINB 4BCIB 1H26B 3TNWB 1AD6A 5BNJB 4BCHB 4CFUB 4OGRB 4NSTB 4CFUD 1OKVB 1JOWA 3BHTB 1UNLD 4I3ZB 2G9XB 2UZLB 4IMYB 4BCOB 4RODA 2WPAB 1H1RB 2X1NB 3RGFB 3DDQB 2CJMB 2CCHB 3O0GD 4KRCB 3BHVB 5L2WB 1AISB 3DOGB 2UZEB 4EC9B 3MY5B 3BHUB 4CXAB 4YC3B 4BCPB 4KRDB 1H25B 2WMBB 4G6LB 4OR5B 1OGUB 2WXVB 1H1QB 4BCJB 2IW8B 5HBEB 1OL1B 1VINA 2W9FA 4ELJA 1H24B 2PMIB 1FVVB 4ELLA 4UN0A 5IF1B 4EOQB 1JSUB 4BCKB 4F7NB 1PKDB 1G3NC 1H28B 2C5OB 3QHWB 4EOJB 2W9ZA 1OIUB 4F70B 5LQFB 4EOPB 4EOSB 3K7AM 4BCMB 4EONB 3EOCB 4F7JB 4F6SB 4BCMD 3BLQB 1O9KB 2I53A 4CRLB 5CEIB 5EFQB 2R7GA 4F7LB 4BCFB 1H1PB 3F5XB 3BLHB 1OI9B 4CFVB 1ZP2A 1GUXA 2JGZB 3LQ5B 2IW9B 1VOLA 2B9RA 5HNBB 4EOKB 4CFWB 4TTHA 1P5EB 4BCGB 3QHRB 2C5NB 1D3UB 5CYIB 2C5XB 2IVXA 2WIHB 2WIPB 3TN8B 5HBHB 3POMA 4F6UB 2PK9B 4EOIB 4ROEA 4BCQB 4BCQD 3EIDB 2WMAB 1TFBA 5HBJB 1W98B 1UNHD 1XO2A 2PHGA 4F7SB 3TNIB 5IDPB 1URCB 4F6WB 1N4MA 1QMZB 3BLRB 2BPMB 2UZBB 2W2HA 3MY1B 5IDNB 1F5QB 1GH6B 4II5B 4EOOB 4CFMB 2WEVB 4Y72B 1VYWB 5ICPB 1BU2A 2UZDB 1OKWB 2EUFA 1OIYB 3G33B 2CCIB 4FX3B 3MIAB 2BKZB 4BCNB 1GY3B 4EOMB 4BCND 3TNHB 1H27B 5HQ0B 1JSTB 2IW6B 3DDPB 3H4CA 3MI9B 4YOZA 1JKWA 5FGKB 5ACBA 5LMKB 2I40B 2UUEB 4EORB 4EC8B 3M03A 1H1SB 2WHBB 1O9KA 2V22B 2F2CA 2WFYB 5I5ZB 4ROCA 2W99A 4YOOA 4CFXB 4YOSA 2C6TB 1UNGD 2C4GB 2PK2A 2W96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJ1 B;  1GUX B;  1OL2 B;  1KXU A;  1E9H B;  4CFN B;  1H4L D;  2C5V B;  4EOL B;  5HVY B;  1C9B A;  2QDJ A;  1FIN B;  4BCI B;  1H26 B;  3TNW B;  1AD6 A;  5BNJ B;  4BCH B;  4CFU B;  4OGR B;  4NST B;  4CFU D;  1OKV B;  1JOW A;  3BHT B;  1UNL D;  4I3Z B;  2G9X B;  2UZL B;  4IMY B;  4BCO B;  4ROD A;  2WPA B;  1H1R B;  2X1N B;  3RGF B;  3DDQ B;  2CJM B;  2CCH B;  3O0G D;  4KRC B;  3BHV B;  5L2W B;  1AIS B;  3DOG B;  2UZE B;  4EC9 B;  3MY5 B;  3BHU B;  4CXA B;  4YC3 B;  4BCP B;  4KRD B;  1H25 B;  2WMB B;  4G6L B;  4OR5 B;  1OGU B;  2WXV B;  1H1Q B;  4BCJ B;  2IW8 B;  5HBE B;  1OL1 B;  1VIN A;  2W9F A;  4ELJ A;  1H24 B;  2PMI B;  1FVV B;  4ELL A;  4UN0 A;  5IF1 B;  4EOQ B;  1JSU B;  4BCK B;  4F7N B;  1PKD B;  1G3N C;  1H28 B;  2C5O B;  3QHW B;  4EOJ B;  2W9Z A;  1OIU B;  4F70 B;  5LQF B;  4EOP B;  4EOS B;  3K7A M;  4BCM B;  4EON B;  3EOC B;  4F7J B;  4F6S B;  4BCM D;  3BLQ B;  1O9K B;  2I53 A;  4CRL B;  5CEI B;  5EFQ B;  2R7G A;  4F7L B;  4BCF B;  1H1P B;  3F5X B;  3BLH B;  1OI9 B;  4CFV B;  1ZP2 A;  1GUX A;  2JGZ B;  3LQ5 B;  2IW9 B;  1VOL A;  2B9R A;  5HNB B;  4EOK B;  4CFW B;  4TTH A;  1P5E B;  4BCG B;  3QHR B;  2C5N B;  1D3U B;  5CYI B;  2C5X B;  2IVX A;  2WIH B;  2WIP B;  3TN8 B;  5HBH B;  3POM A;  4F6U B;  2PK9 B;  4EOI B;  4ROE A;  4BCQ B;  4BCQ D;  3EID B;  2WMA B;  1TFB A;  5HBJ B;  1W98 B;  1UNH D;  1XO2 A;  2PHG A;  4F7S B;  3TNI B;  5IDP B;  1URC B;  4F6W B;  1N4M A;  1QMZ B;  3BLR B;  2BPM B;  2UZB B;  2W2H A;  3MY1 B;  5IDN B;  1F5Q B;  1GH6 B;  4II5 B;  4EOO B;  4CFM B;  2WEV B;  4Y72 B;  1VYW B;  5ICP B;  1BU2 A;  2UZD B;  1OKW B;  2EUF A;  1OIY B;  3G33 B;  2CCI B;  4FX3 B;  3MIA B;  2BKZ B;  4BCN B;  1GY3 B;  4EOM B;  4BCN D;  3TNH B;  1H27 B;  5HQ0 B;  1JST B;  2IW6 B;  3DDP B;  3H4C A;  3MI9 B;  4YOZ A;  1JKW A;  5FGK B;  5ACB A;  5LMK B;  2I40 B;  2UUE B;  4EOR B;  4EC8 B;  3M03 A;  1H1S B;  2WHB B;  1O9K A;  2V22 B;  2F2C A;  2WFY B;  5I5Z B;  4ROC A;  2W99 A;  4YOO A;  4CFX B;  4YOS A;  2C6T B;  1UNG D;  2C4G B;  2PK2 A;  2W96 A; 
#chains in the Genus database with same CATH topology
 3EJ1 B;  1KXU A;  4HL4 A;  1V29 B;  3A8M B;  1C9B A;  1FIN B;  1AD6 A;  5BNJ B;  4BCH B;  4BXX X;  4CFU D;  1OKV B;  1JOW A;  1UNL D;  1H1R B;  3RGF B;  4NC6 A;  3BHV B;  2ZPF B;  3DOG B;  2UZE B;  4BCP B;  3VKH A;  4OR5 B;  1H1Q B;  2ZPI B;  1OL1 B;  4JX6 A;  4LOC A;  2PMI B;  1FVV B;  4ELL A;  4UN0 A;  4BCK B;  1H28 B;  2C5O B;  2W9Z A;  3BG5 A;  4F7J B;  2DPP B;  5EJC A;  5DQW A;  4OB2 B;  1ZP2 A;  4Z6Y A;  4JX5 A;  4BY1 X;  5HNB B;  4AKI A;  4HNV A;  3TW7 A;  1P5E B;  2CYZ B;  2C5X B;  2WIP B;  4HLQ A;  3TN8 B;  4F6U B;  4OB0 B;  4ZGJ B;  3HO8 A;  4BCQ D;  2WMA B;  5HBJ B;  1UNH D;  3TNI B;  3BLR B;  4FM4 B;  2UZB B;  1UGP B;  2W2H A;  5IDN B;  1F5Q B;  4II5 B;  1VYW B;  2QFZ A;  2BKZ B;  4AKG A;  2BS4 A;  2I40 B;  2QF7 A;  2WFY B;  2ZPE B;  1OL2 B;  2C5V B;  2ZPG B;  5DQV A;  3DL1 A;  3BHT B;  4IMY B;  2G9X B;  2UZL B;  2CCH B;  5L2W B;  3BHU B;  3QZ5 B;  4YC3 B;  4KRD B;  2KR6 A;  1H25 B;  3TW6 A;  5HBE B;  4ZGD B;  1H24 B;  3VKG A;  3BG9 A;  4F7N B;  4MFD A;  3QHW B;  4EOJ B;  1E7P A;  4EOS B;  3K7A M;  4BCM B;  4EON B;  4F6S B;  4OB3 B;  3BLQ B;  5IHY A;  2I53 A;  3KHI A;  3VYH B;  3F5X B;  3BLH B;  3NDQ A;  4CFV B;  1GUX A;  2JGZ B;  2IW9 B;  2B9R A;  5HBH B;  1W98 B;  1XO2 A;  2PHG A;  4F7S B;  3DJB A;  3X26 B;  2BPM B;  3GTM S;  1GH6 B;  4EOO B;  5ICP B;  2BS3 A;  2UZD B;  4MFE A;  1OKW B;  2EUF A;  3HBL A;  1UGR B;  4FX3 B;  3MIA B;  2PJQ A;  4BCN D;  2IW6 B;  3MI9 B;  4YOZ A;  5LMK B;  1H1S B;  1O9K A;  2V22 B;  4CFX B;  3WVE B;  2PK2 A;  3QYG B;  1E9H B;  4EOL B;  2QDJ A;  4BY7 X;  1H26 B;  3TNW B;  4CFU B;  1TD6 A;  4OGR B;  2CZ0 B;  4ROD A;  3VYG B;  2WPA B;  2X1N B;  4HNT A;  3O0G D;  4EC9 B;  2LW4 A;  2WMB B;  2G77 A;  4HNU A;  4OB1 B;  1OGU B;  4BCJ B;  3A8O B;  2IW8 B;  1VIN A;  3A8G B;  2W9F A;  3QYH B;  5IF1 B;  4EOQ B;  1PKD B;  1G3N C;  2IN3 A;  5LQF B;  2ZZD B;  3QXE B;  4CRL B;  5CEI B;  5EFQ B;  4F7L B;  1UGQ B;  1H1P B;  1OI9 B;  3X28 B;  3BG3 A;  4BBR M;  3LQ5 B;  1VOL A;  4EOK B;  3HB9 A;  4CFW B;  4TTH A;  3X20 B;  1FKM A;  2WIH B;  4EOI B;  4ROE A;  4BCQ B;  2CZ6 B;  3A8L B;  1TFB A;  5IDP B;  4F6W B;  1QMZ B;  3HHT B;  3MY1 B;  4JX4 A;  2QGS A;  1OIY B;  3G33 B;  2CCI B;  4EOM B;  3QZ9 B;  3TNH B;  2QDY B;  2ZCF B;  3DDP B;  1JKW A;  2WJ9 A;  3QWL A;  4EOR B;  2UUE B;  1IRE B;  2WHB B;  4ROC A;  5FGK B;  2C4G B;  1GUX B;  1UGS B;  4CFN B;  4AI6 A;  1H4L D;  5HVY B;  4BCI B;  2DD4 B;  4NST B;  4I3Z B;  4BCO B;  1AHJ B;  3DDQ B;  2CJM B;  4KRC B;  4M6V A;  1AIS B;  2DXB B;  3MY5 B;  4CXA B;  4MIM A;  1QLB A;  3HZJ A;  2AHJ B;  4G6L B;  3WVD B;  2WXV B;  4ELJ A;  2CZ7 B;  1JSU B;  2QQ8 A;  3DTO A;  1OIU B;  4F70 B;  4EOP B;  3QYE A;  3EOC B;  3B57 A;  4BCM D;  1O9K B;  3X25 B;  4QSH A;  2R7G A;  3PO3 S;  4BCF B;  2KMG A;  2DD5 B;  4BCG B;  3QHR B;  2C5N B;  1D3U B;  5CYI B;  2IVX A;  3POM A;  2PK9 B;  4AKH A;  4BBS M;  2D0Q B;  3EID B;  2DXC B;  2CZ1 B;  1URC B;  1N4M A;  2ZPH B;  3X24 B;  4CFM B;  2WEV B;  4Y72 B;  2ZPB B;  3QYB A;  1BU2 A;  2DME A;  4BCN B;  1GY3 B;  3A8H B;  1H27 B;  5HQ0 B;  2BS2 A;  1JST B;  3H4C A;  5ACB A;  1ENW A;  4EC8 B;  3M03 A;  4ZGE B;  2F2C A;  5I5Z B;  2W99 A;  4YOO A;  4YOS A;  2C6T B;  1UNG D;  2W96 A; 
#chains in the Genus database with same CATH homology
 3EJ1 B;  1GUX B;  1OL2 B;  1KXU A;  1E9H B;  4CFN B;  1H4L D;  2C5V B;  4EOL B;  5HVY B;  1C9B A;  2QDJ A;  1FIN B;  4BCI B;  1H26 B;  3TNW B;  1AD6 A;  5BNJ B;  4BCH B;  4CFU B;  4OGR B;  4NST B;  4CFU D;  1OKV B;  1JOW A;  3BHT B;  1UNL D;  4I3Z B;  2G9X B;  2UZL B;  4IMY B;  4BCO B;  4ROD A;  2WPA B;  1H1R B;  2X1N B;  3RGF B;  3DDQ B;  2CJM B;  2CCH B;  3O0G D;  4KRC B;  3BHV B;  5L2W B;  1AIS B;  3DOG B;  2UZE B;  4EC9 B;  3MY5 B;  3BHU B;  4CXA B;  4YC3 B;  4BCP B;  4KRD B;  1H25 B;  2WMB B;  4G6L B;  4OR5 B;  1OGU B;  2WXV B;  1H1Q B;  4BCJ B;  2IW8 B;  5HBE B;  1OL1 B;  1VIN A;  2W9F A;  4ELJ A;  1H24 B;  2PMI B;  1FVV B;  4ELL A;  4UN0 A;  5IF1 B;  4EOQ B;  1JSU B;  4BCK B;  4F7N B;  1PKD B;  1G3N C;  1H28 B;  2C5O B;  3QHW B;  4EOJ B;  2W9Z A;  1OIU B;  4F70 B;  5LQF B;  4EOP B;  4EOS B;  3K7A M;  4BCM B;  4EON B;  3EOC B;  4F7J B;  4F6S B;  4BCM D;  3BLQ B;  1O9K B;  2I53 A;  4CRL B;  5CEI B;  5EFQ B;  2R7G A;  4F7L B;  4BCF B;  1H1P B;  3F5X B;  3BLH B;  1OI9 B;  4CFV B;  1ZP2 A;  1GUX A;  2JGZ B;  3LQ5 B;  2IW9 B;  1VOL A;  2B9R A;  5HNB B;  4EOK B;  4CFW B;  4TTH A;  1P5E B;  4BCG B;  3QHR B;  2C5N B;  1D3U B;  5CYI B;  2C5X B;  2IVX A;  2WIH B;  2WIP B;  3TN8 B;  5HBH B;  3POM A;  4F6U B;  2PK9 B;  4EOI B;  4ROE A;  4BCQ B;  4BCQ D;  3EID B;  2WMA B;  1TFB A;  5HBJ B;  1W98 B;  1UNH D;  1XO2 A;  2PHG A;  4F7S B;  3TNI B;  5IDP B;  1URC B;  4F6W B;  1N4M A;  1QMZ B;  3BLR B;  2BPM B;  2UZB B;  2W2H A;  3MY1 B;  5IDN B;  1F5Q B;  1GH6 B;  4II5 B;  4EOO B;  4CFM B;  2WEV B;  4Y72 B;  1VYW B;  5ICP B;  1BU2 A;  2UZD B;  1OKW B;  2EUF A;  1OIY B;  3G33 B;  2CCI B;  4FX3 B;  3MIA B;  2BKZ B;  4BCN B;  1GY3 B;  4EOM B;  4BCN D;  3TNH B;  1H27 B;  5HQ0 B;  1JST B;  2IW6 B;  3DDP B;  3H4C A;  3MI9 B;  4YOZ A;  1JKW A;  5FGK B;  5ACB A;  5LMK B;  2I40 B;  2UUE B;  4EOR B;  4EC8 B;  3M03 A;  1H1S B;  2WHB B;  1O9K A;  2V22 B;  2F2C A;  2WFY B;  5I5Z B;  4ROC A;  2W99 A;  4YOO A;  4CFX B;  4YOS A;  2C6T B;  1UNG D;  2C4G B;  2PK2 A;  2W96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...