1OLAA

The structural basis of multispecificity in the oligopeptide-binding protein oppa
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of sequence-independent peptide binding by OppA protein.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Binding protein
molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
total genus 181
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1994-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1olaA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1olaA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1olaA02
1FQEA 4DXCA 2V3UA 4ELPA 3N6UA 5H8FB 3FJ7A 3FXQA 1EU8A 3VLUA 5LOMA 3W15C 4YICA 3U8QA 1FQCA 5FTHA 5BWJA 3S9MC 1MY0A 3K01A 2F7BA 1TFDA 2GFEA 3N26A 4KHZE 4BDRA 2OWTA 1KWHA 4N13A 1OVBA 4BDNA 4DCYA 1Y1MA 4LA9A 2B3FA 3IO4A 3RN8A 1P1WA 1S9TA 3W9WA 3S9NC 3U1OA 1LGBC 3KGCA 1Y9UA 3E3KA 4ECFA 3H06B 2GHBA 1IXCA 1DMBA 5KDTA 4H0WA 2ESNA 1LSTA 2DS9A 2RCAA 4OVJA 2ZNSA 4F1YA 3R6UA 1SD3A 4YB7A 3IORA 3I6VA 3VFJA 1A54A 2AYSA 1MY4A 1FTJA 1XC1A 4P0IA 1B0LA 2RC7A 3B6WA 4KI0E 4MFIA 3UORA 1ZBMA 1ELJA 3FJMA 4NF6B 1UTHB 3JZJA 5AE4A 5I2KA 2M8CA 3WAEA 1OQHA 2F7AA 2ZYMA 3FV1A 4OERA 3GLBA 4H5GA 4POXA 3DP6A 3RUMA 4PETA 1IUDA 2AL4A 2XX7A 4R75A 4OHNA 5L9MA 3HPIA 3OEKA 1LCTA 3C33A 3CR9A 1Z7ME 4YKKA 1ZMGA 3PPNA 2Y7WA 3A3CA 4XXUA 1NFTA 4L17A 2H25A 1A55A 2NVUB 2O68A 2P0SA 2Z8FA 2WOKA 2OCUA 4G8MA 3KOSA 4U1ZA 3RGYA 1GGGA 3G7WA 4I1DA 3MUQA 4GD5A 3V89B 3LSXA 4MLQA 4NF4B 3QYTA 3TCHA 2RCBA 3C32A 5ITOA 4XKNA 4H5FA 4I8CA 1P1NA 5TPAB 3FVOA 1SYIA 1IXIA 2IA4A 3MVXA 3UIFA 1B5IA 3ZS6A 2O51A 3T9VA 5KDTB 3HHFA 3OSRA 4QRZA 2ANJA 4C1TA 3IOVA 1DPPA 3K6UA 4ISUA 5FHNA 2NWJA 4ZEKA 1DSNA 2XXWA 4HCWA 5CI5A 4HTGA 3EF7A 1ZJLA 1UTBA 2QL3A 4NE4A 3U93A 1M5FA 4OYVA 4RY1A 2PYYA 3OOAA 1M5DA 3DLNA 5I59A 3IB2A 4G68A 2DE3A 5L9SA 1JETA 1MXYA 1TT1A 1MDQA 3L6GA 3S4UA 3SKPA 3HSTA 3CIJA 5AA1A 1QW0A 2REGA 1A99A 3MPKA 4BDOA 4F22A 1FTKA 4LQ2A 1B2HA 2Q89A 4OTEA 3FATA 3VVDA 3EPEA 3PV0E 2DXYA 1I69A 1LFHA 3BKIB 3OELA 3UK4A 4EQBA 1LFGA 1IZ1A 3O2AA 3S9EA 4PFTA 3CFZA 1MQDA 4OEVA 2UVJA 1HSEA 3U94A 3K6XA 1D3KA 3KJ7A 3Q26A 1N7WA 3THIA 3K0VA 3V8XB 3IJOB 3KG2A 5I2KB 3B7DA 4I9DA 4GL8A 1TXFA 3B6QA 3TEPA 3RT6B 4DXUA 4F1VA 4RYAA 2OWSA 2PMSA 4Q5TA 1P1QA 1B32A 5AA3A 3HN0A 2HAVA 3RYBA 2F97A 3N5LA 1GR2A 3K2DA 4WEPA 4EXLA 3T22A 5CBRA 5I57A 4U4SA 1L5TA 5AA4B 4Q0CA 4R74A 1B51A 1JVXA 3PD9A 4QFOA 2X26A 4OENA 4WXJA 2QSXA 1NH7A 5IAIA 4ESXA 1T0KA 4H8JA 5H8NB 1FW0A 3BBRA 1P99A 1HSLA 2ONRA 2R6GE 3TKDA 3TMGA 3HHGA 2Q88A 3PPRA 2V3QA 1MXXA 1MH3A 1MPCA 3TTMA 5CBSA 1SYHA 4OFOA 1IXGA 3KN3A 1IEJA 3T93B 4O3CA 1OVTA 4JSDA 3G3GA 3TQWA 2ZYOA 1Y3QA 1Y4CA 2XXQA 3CI8A 3TTKA 4ELQA 2PX1A 2D5WA 3GXAA 4IGRA 3CG3A 3D4CA 4OZ9A 1B46A 2OLBA 4F3BA 3LSLA 4TLMB 3H6TA 5TP9A 2HZKA 1PB8A 4P0GA 1O64A 3OENA 3FTOA 1XS5A 2Z8EA 4KPTA 4KYEA 3JYRA 3U92A 2QMWA 3QIMA 2DE2A 2HEUA 2Q2CA 2B3BA 4ZEBA 2UVHA 4U2RA 1RYXA 5CMBA 4EQ7A 5EYFA 1MH4A 5CMKA 3LC8A 4RXLA 5ITPA 5AA2B 4R73A 1LB8A 1AL3A 1MXWA 1SI0A 4X1DA 1GVCA 2KLFA 2YJPA 1EZ9A 1IQ7A 2B4LA 4ZEFA 4N07A 3QK6A 4HCYA 1LBBA 4X48A 2WOLA 3C4MA 3ZKKA 3T66A 1LCFA 1B1XA 4PP0A 3SEUA 5I58B 1XT8A 4ZE9A 3FD3A 1NNPA 5FTIA 3DP8A 3O29A 5DT6A 3TCGA 2H5YA 2V93A 3EN3A 4GLIA 4F18A 3ECRA 3LSWA 4QHQA 2AL5A 2ONSA 4TLLB 3TFLA 3TZAA 3KSXA 3C35A 3I3VA 1Q1KA 2VD3A 4NF5B 1A7LA 1MPBA 2DWAA 4LONB 3TQLA 1BTJA 4FIMA 2B4MA 1I6AA 2E1SA 2OZZA 2H9BA 4IO5A 4YMAA 1POY1 2I49A 4LP2B 2Q8JA 4OFJA 3UA8A 3VDFA 3VXCA 1SW1A 3OEMA 1POTA 4NF6A 1MG1A 4E0XA 1XOCA 2ZMBA 4LQ5A 1JW4A 1B5HA 3EHSA 1Y20A 2HAUA 2FYIA 1N3WA 1B7UA 3TUSA 4IO4A 5ICQA 1QVSA 2X7PA 4GIZA 4ND9A 5DVJA 1UIVA 4YU0A 3MVZA 5BUUA 1B40A 4NWDA 3V83A 3MBPA 2XXPA 4IB2A 3MW0A 1MPDA 1GTKA 2V25A 3KOTA 4DIGA 3PUZE 4XIGQ 5CC2A 1B5JA 2NXOA 4ELOA 3FV2A 4KYDA 1URGA 3IJXB 4R9FA 2WKYA 3PD8A 4F3GA 1O63A 3G3JA 3E4RA 2OK2A 3PAMA 5DEXA 3B6TA 4EUOA 3OSQA 3MP1A 4NF4A 2R9JA 1SI1A 2FA7A 3G3FA 4XKPA 1H43A 3HCQA 2R71A 2GH9A 2Q9TA 2XX8A 1P1UA 3K02A 3KJTA 4LZ5A 2O7IA 2I58A 3PUVE 3E13X 4I62A 3I5OA 1MXUA 3CSGA 5H8HA 3UN6A 2XD2A 2XD3A 4DZ1A 2B65A 2RC8A 4PFYA 1UQWA 4RPNA 4GF8A 4NF8B 5ISUA 3RTFB 4ESWA 1D9VA 1CB6A 2P1SA 3O6HA 4JWYA 3G3IA 3RTWB 1PBPA 4UACA 1BKAA 2XX9A 2O6AA 3PUWE 4Z7EA 1LBCA 4GFRA 4H6DA 5DTBA 3SETA 3BFUA 1IIWA 1FTMA 1MY3A 4XTCQ 5ELVA 4KQPA 1WVJA 1MQHA 3RT8A 3CHGA 2QS2A 2DWHA 4JWXA 4NWCA 3GBBA 2HCAA 1RYOA 4G8HA 2A5TB 3PPOA 5IKBA 5H8SA 3KSJA 2DWIA 3ODBA 5K2YA 4K3FA 2A5TA 4QSDA 1US5A 4X1BA 2QMXA 1B4ZA 2O7UA 3G3KA 4GWOA 5FHMA 4ZDMA 1FQDA 3P7IA 3VVEA 1WODA 4R6KA 3RPWA 1LB9A 1M5CA 1MXVA 1P1OA 4GOTA 4IO2A 3IOWA 2H99A 2Z23A 3QUFA 1LAHE 1LAGE 2DXRA 2QJEA 3LR1A 1IXHA 4JWOA 4DE8A 2HXWA 2WOPA 3MWBA 4TQUQ 2QS4A 4RPOA 2DP8A 4H65A 5H8QA 4QFLA 2P2AA 3R7XA 4FATA 3IOUA 3T96B 3SEYA 3FUZA 5A5XB 2Y7IA 3TTRA 1URSA 3GBAA 3OO8A 1PC3A 2NUVA 4FJPA 5CM6A 4F39A 3MVWA 5I56A 1Y3PA 2F36A 2DWJA 1N76A 2D21A 2IEEA 4FECA 3SESA 2GHAA 1NL5A 1XHYA 2V84A 1B9JA 4UA8A 3T9HB 1PBQA 5HBCA 4F3SA 4FAJA 3H6WA 1FTLA 4M1VA 2XXIA 3H4ZA 4FORA 4KCCA 4TOZA 1N84A 4ELRA 3FVGA 4FE8A 2GRVA 2PT2A 3EHTA 3VE1B 1AH5A 1N04A 4MLVA 2O1LA 2I4BA 3DELB 4KFQA 4JB7A 3H3GA 3IR1A 1Q35A 2DQVA 5JTYB 4IGTA 2DOJA 1WDNA 1AMFA 2O69A 3A09A 2RC9A 3TDJA 4EDPA 5B70A 5J1DA 2ONKE 1GV8A 3VXBA 4E0WA 1SBPA 2F8DA 3IL1B 1Y4TA 1YPNA 3JV9A 4JBZA 2F35A 3MJNA 2I4CA 3KFMA 2H4IA 1B3HA 4PQJA 2FNCA 4RJZA 1AOVA 1R6ZA 4FEDA 3FXUA 1N3XA 1M5EA 4X9TA 2VOZA 2UVIA 4YZZA 2A5SA 3ILTB 4F31B 5L8DA 4GL0A 3TYHA 1AIVA 5KCJA 5B7DA 1US4A 1MQGA 4JXIA 2PVUA 5M2VA 1ZTYA 2F6GA 1B0HA 1JQFA 4OFLA 1QJMA 2DYXA 1A8FA 3IB1A 3QUJA 4LZ8A 4KD5A 3SERA 1PB9A 4QSCA 2DVZA 2QS1A 5CMMA 3KEIA 3FZVA 4F19A 3RY3A 2REJA 4EQ9A 2YPNA 3DRGA 1A8EA 2CZLA 4G4PA 4NEDA 4EXKA 4IY6A 1JW1A 5A5XA 1EZPA 1H44A 3ILUB 1NMUA 4R6YA 1LAXA 4OXVA 1CE2A 4U23A 2O1MA 3OMBA 2LAOA 1B3FA 2O84X 2UXAA 3GZGA 5AA2A 2HQ0A 1B3EA 2BJJX 5EHMA 4YKJA 1TFAA 1B3LA 2UYEA 3DRIA 4QF9A 4RNSA 3WAFA 4MBPA 3IOTA 4F1UA 3T9UA 4YMBA 4ZECA 5EHSA 3T9XB 4NF5A 4EF1A 1OLAA 2G93A 2XXHA 3MP6A 1DOTA 4KYSA 2XXTA 1D4NA 4O3BA 1F9BA 4YAHX 1FCKA 5KZTA 3O97A 3O6IA 4LATA 4Q8RA 5KCJB 1VE4A 1H76A 1LAFE 3KN8A 2VHAA 2Y7RA 1B7HA 2F34A 2OJTA 2RF1A 2Z8DA 1OLCA 4ZZAA 3N94A 1DTGA 1JNFA 3TTNA 3FVNA 3S2VA 5H8HB 1JEUA 3CVGA 4GXSB 4H67A 3BFTA 2H98A 4ZS9A 4QFNA 1II5A 4G68C 1PDAA 1MM7A 3OO9A 5I59B 2X7QA 1ATGA 3C9HA 4MF3A 1B05A 5FHOA 4U22A 3VVFA 1MQIA 4DXBA 4QFPA 1OQGA 1NNKA 1MRPA 4WKMA 4HW8A 1FQFA 5JK4A 3ZKLA 4YKPA 3V5AA 3R26A 1D9YA 1MXZA 1VFDA 1N7XA 3IB0A 1B3GA 1S7YA 3MZBA 4OESA 1QUKA 1OMPA 3RQTA 2VP1A 4FEBA 2UVGA 1SVXB 2ZYKA 3KBRA 1UIUA 1DPEA 2Y7KA 3M3KA 3MQ9A 3PMVA 4GQOA 1MDP1 1B1HA 3PPQA 4G77A 1XVYA 1MM6A 3QAXA 4LZ7A 1A40A 3MZ9A 3MAMA 3TCFA 4YB5A 3IX1A 5H8QB 3G3HA 3QSLA 3C31A 1HSJA 3K6WA 3K6VA 5DVIA 4ZE8A 1IITA 1BP5A 5DYHA 2I3VA 4DDDA 5I2NA 3DRFA 1N0TA 2XXUA 4P11A 3SEWA 1SW2A 2DE4A 3H03A 4OETA 2VD2A 4U4XA 4OWDA 3ZSFA 5I56B 5I58A 3HV1A 4F3PA 3KN7A 2UYFA 2OBGA 2I6EA 2ZNUA 4MH5A 3D4GA 4BDLA 4EF2A 4LVQA 4DCXA 4WEDA 3CSBA 3LSFB 1VFEA 1VSOA 1NNTA 5DEXB 1B52A 4R9GA 2AIXA 3VLWA 1BLFA 1SW4A 1I6QA 1EH3A 2DVCA 4NMYA 2E0SA 3Q25A 5I57B 4ZEIA 3OO7A 3MP8A 4PFUA 3IK6B 5CRYA 3TODA 3SDFA 4AB5A 2D3IA 1USYH 5F1QA 4BLAA 1J1NA 5TP9B 2QS3A 3M3LA 3PUXE 5K2XA 3RNNA 1QKBA 3OXNA 2I0BA 2HZLA 1M5BA 1ANFA 2XXYA 4R6HA 1SDXA 3A3UA 3VV5A 5HM4B 2PBWA 3K4UA 3IO6A 3K1MA 3PU5A 4U1OA 4RK9A 1JEVA 3K1NA 5JEIA 2F7CA 2G29A 4RA1A 2VGQA 5F7VA 4ONYA 2V3TA 4Z0IA 3KZGA 2ZNTA 4NTLA 5CMCA 3DP4A 5H8FA 1LLSA 4G68B 1LFIA 1O7TA 2THIA 3K00A 4R2BA 2Z22A 4G2ZA 1R1NA 4IY5A 4LUBA 4OMBA 4ZZEA 3USDA 5AA4A 1ZLQA 1ZU0A 3FVKA 4GXAA 3U72A 4YKIA 3HO7A 4PE5B 1ZKBA 2RINA 3LVUA 1PEBA 1YCJA 3M8UA 1H3DA 2F78A 2F5XA 1YTVA 4OEUA 2Q2AA 3C34A 2NOOA 3L6HA 2RKMA 4C0RA 4OQOA 1BIYA 5HPQA 2ALUA 4THIA 3LBSA 3M3FA 1UTHA 3EHUA 4IO7A 3PMWA 3Q28A 2DSFA 1RKMA 3IAZA 1FTOA 1URDA 3FXRA 3UGWA 3PUYE 2Y7PA 5I84A 1B58A 2Y84A 3FGSA 4YB6A 3CFXA 3FIRA 2I48A 4KCDA 2I3WA 3DRHA 1NH8A 2I0CA 3H7MA 4U21A 2ZYNA 3PMXA 3MVYA 3CG1A 1ZIUA 1VR5A 1B7ZA 2CMOA 3Q29A 3Q27A 1USYE 3SEVA 1I6BA 4IO3A 4POWA 3O6PA 4C1UA 1DTZA 4R72A 4BDQA 5DVFA 3H6UA 1TWYA 4M4GA 4JSOA 4AB6A 3O66A 4O3AA 4XKQA 4JDFA 2XXXA 1OIBA 3CFLA 3PGFA 4BDMA 1Z7NE 3K1PA 4QSEA 2QRYA 3ONMA 4G8NA 1SQYA 3DM0A 1PB7A 3MZ1A 4RK2A 3TAJA 1S50A 2W7YA 1FQBA 2F6PA 1FQAA 3LUYA 3TPAA 4H1XA 3S9LC 1MQJA 1MY1A 3O6GA 4DLDA 5H8NA 3FASA 1MS7A 1UTBB 1SW5A 3E9XA 3N6TA 5ICTA 3UP9A 3OO6A 4NF8A 2PT1A 2XXVA 3RLFE 1MY2A 4Q30B 1R9LA 5L9OA 1QUJA 4KR5A 4R2FA 5I2NB 1XVXA 2QPQA 3O28A 3AXFA 4HS7A 3QXMA 3SEXA 4F29A 5AA2D 1JVYA 3DRJA 3F11A 4GVOA 1EZOA 3TTLA 1H45A 5JTYA 4QFKA 1Y3NA 4F2OA 1QULA 2XHDA 1JW5A 1NKXA 1NNFA 4GRKA 1B6HA 3H6VA 2XXRA 3RYAA 4N6PA 2HFBA 1QKAA 4XKRA 1YAEA 4H8IA 1B4HA 3FJGA 4F2QA 3MPLA 3PPPA 3C36A 2YLNA 3EQ1A 5TU0A 3VLVA 4AQ4A 3O9PA 2ZXTA 1Y1ZA 3MC2A 5TPAA 3TELA 4ZEDA 3W9VA 3OD7A 1R9QA 4PFWA 2ABHA 3DRKA 1QUIA 3CRBA 4IO6A
chains in the Genus database with same CATH superfamily
4DXCA 2V3UA 3N6UA 5H8FB 5LOMA 1EU8A 3S9MC 1MY0A 2WBBA 1KWHA 1OVBA 4BDNA 1Y1MA 2B3FA 3IO4A 4DI4B 3E3KA 4ECFA 3H06B 2GHBA 1IXCA 1DMBA 1LSTA 2ZNSA 5ESYA 3R6UA 1A54A 1B0LA 3B6WA 3DP6A 2XX7A 1FPKA 1Z7ME 4YKKA 1NFTA 1A55A 1IMBA 2WOKA 4U1ZA 1GGGA 4O7MA 4XF5A 3TCHA 4I8CA 1YYZA 4AS5A 4QRZA 2ANJA 4N91A 2NWJA 4ZEKA 1DSNA 2XXWA 1ZJLA 1UTBA 2QL3A 1M5FA 4OYVA 1M5DA 3IB2A 2DE3A 1TT1A 3L6GA 3HSTA 2REGA 4BDOA 4F22A 3VVDA 3OELA 3S9EA 4PFTA 5T3JA 1HSEA 1D3KA 3Q26A 3K0VA 3V8XB 5I2KB 3B7DA 1P1QA 1VDWA 3RYBA 4EXLA 3K2DA 4Q0CA 4QFOA 2ZZVA 1G0IA 5H8NB 1FW0A 1P99A 1HSLA 2ONRA 2R6GE 3TKDA 3HHGA 3EKIA 1MPCA 5CBSA 1IEJA 1OVTA 4UABA 3TQWA 1Y4CA 2XXQA 4ELQA 1DBZA 2OLBA 5IZZA 3H6TA 1PB8A 1QGXA 1O64A 3NOHA 2DE2A 4ZEBA 5CMBA 1RYXA 5CMKA 1LBZA 4RXLA 2QVVA 1LB8A 4R73A 1IQ7A 4HCYA 4X48A 3ZKKA 3SEUA 4ZE9A 5FTIA 1NNPA 3O29A 2V93A 3LSWA 1FBCA 2XWVA 4XFEA 1A7LA 4FIMA 4IO5A 4YMAA 1I6AA 2OZZA 1POY1 2Q8JA 4OFJA 1SW1A 1B5HA 5ICQA 1BK4A 1UIVA 1Q9DA 1B40A 3FV2A 4GWZA 3IJXB 1YXIA 4EUOA 3OSQA 3MP1A 4NF4A 4FECA 4XKPA 1H43A 2GH9A 1P1UA 5I7IA 1K9YA 2O7IA 2RC8A 3RTFB 5ISUA 4ESWA 2P1SA 4GWUA 4JWYA 3RTWB 4UACA 1LBCA 4H6DA 3BFUA 1FTMA 4N81A 5H8SA 1US5A 1LB9A 3IOWA 2H99A 2DXRA 2QJEA 4JWOA 4OVTA 3MWBA 4H65A 5EQAA 2P2AA 4FATA 3TTRA 5EQ8A 2D21A 5ET8A 1NL5A 1XHYA 4UA8A 1B9JA 3H6WA 1KA0A 3H4ZA 4FORA 1N84A 1FRPA 4N15A 1N04A 2O1LA 2VPOA 4JB7A 1Q35A 2DOJA 4OVQA 4E0WA 3IL1B 1Y4TA 1YPNA 4P56A 2I4CA 4PC9A 2FNCA 1AOVA 1R6ZA 1M5EA 2CEYA 2VOZA 4YZZA 3U65A 2A5SA 5L8DA 4GL0A 1MQGA 4HE0A 5M2VA 4LZ8A 1JQFA 1A8FA 4QSCA 2REJA 1JW1A 5A5XA 4OXVA 1CE2A 4U23A 1B3FA 2UXAA 2BJJX 2UYEA 3IOTA 4ZECA 4NF5A 4YAHX 3KN8A 4ZZAA 4H46A 3TTNA 1JNFA 3S2VA 4ZS9A 2X7QA 5FHOA 1CNQA 1NNKA 3MYUA 1N7XA 3IB0A 2VP1A 1UIUA 4G77A 1A40A 3KC1A 5H8QB 3KC0A 3QSLA 4DDDA 4P1EA 2DE4A 5I56B 4F3PA 3KN7A 4BDLA 5EQ7A 4EF2A 4DCXA 3CSBA 2F3BA 1I6QA 1EH3A 3MP8A 4PFUA 4P3LA 5CRYA 3SDFA 4AB5A 1USYH 5F1QA 5K2XA 1QKBA 1ANFA 3VV5A 3A3UA 4U1OA 3K1NA 5JEIA 4RA1A 5F7VA 1LFIA 3K00A 4R2BA 4IY5A 4QBAA 2RINA 3LVUA 1PEBA 4HE1A 4C0RA 3LBSA 3M3FA 4IO7A 2DSFA 1RKMA 3IAZA 1B58A 4YB6A 3FIRA 4LN5A 4U21A 1ZIUA 2CMOA 1DTZA 4OVRA 4R72A 5DVFA 4M4GA 4MAGA 4GBWA 4JDFA 3CFLA 4BDMA 4HE2A 3K1PA 4QSEA 2QRYA 1PB7A 2F6PA 1FQAA 3LUYA 3TPAA 3FASA 1UTBB 1SW5A 3OO6A 1RDXA 1R9LA 5L9OA 4HS7A 3QXMA 3DRJA 4GVOA 5JTYA 4QFKA 1Y3NA 1NKXA 2FIEA 3H6VA 2XXRA 3RYAA 1QKAA 4H8IA 1YAEA 3MPLA 3PPPA 5TU0A 3EQ1A 4MX6A 1Y1ZA 4O94A 2ABHA 1QUIA 4ELPA 2GFEA 1TFDA 4MIJA 5A5LA 3RN8A 3W9WA 1LGBC 3KGCA 1Y9UA 4H0WA 2ESNA 2RCAA 4YB7A 4P0IA 1XC1A 3FJMA 1FJ6A 5AE4A 3FV1A 2ZYMA 4H5GA 1IUDA 4OHNA 3C33A 3IFAA 3PPNA 2Y7WA 4MNPA 2H25A 2NVUB 2P0SA 2OCUA 4GD5A 4XKNA 4H5FA 4P8BA 4P9KA 1IMCA 4C1TA 5FHNA 5CI5A 4HTGA 3U93A 2PYYA 3OOAA 4G68A 5L9SA 1JETA 5AA1A 1FBFA 1A99A 1FTKA 2Q89A 2ZZWA 3UK4A 4PCDA 1MQDA 4PFBA 4I9DA 4GL8A 1LEVA 3B6QA 3RT6B 2PMSA 2HAVA 2F97A 3N5LA 3T22A 1LBVA 1L5TA 2X26A 4WXJA 4XEQA 2Q88A 2V3QA 3TTMA 3D1RA 4NG7A 1Y3QA 3TTKA 4IGRA 4OZ9A 4TLMB 4PF8A 1XS5A 1NUWA 3U92A 2Q2CA 2UVHA 2B3BA 5EYFA 1MH4A 3LC8A 1NV3A 4X1DA 1FPBA 2KLFA 3QK6A 1LCFA 4PP0A 1XT8A 5DT6A 2XWOA 3EN3A 5LDZA 2ONSA 2HPGA 3C35A 2VD3A 4F2OA 2E1SA 3VDFA 3UA8A 4NF6A 1MG1A 4LQ5A 2HAUA 4N6DA 5DVJA 5BUUA 3MBPA 2KQZA 4IB2A 1NV6A 1MPDA 1GTKA 3KOTA 3PUZE 4PBHA 5LTCA 4ELOA 4R9FA 2WKYA 4GX4A 4F3GA 3E4RA 3G3FA 3HCQA 2XX8A 2Q9TA 3K02A 2I58A 4JVDA 1MXUA 4XTCQ 5ELVA 3CHGA 3PTYA 2A5TB 3KSJA 5K2YA 4X1BA 3UIFA 5FHMA 1B4ZA 3G3KA 4GWOA 3RPWA 1MXVA 1P1OA 1LAHE 2XWKA 4DE8A 2QVRA 2DDKA 2QS4A 4TQUQ 2DP8A 5H8QA 4QFLA 3T96B 2Y7IA 3GBAA 3A29A 1Y3PA 1N76A 2IEEA 3SESA 3T9HB 1PBQA 4F3SA 4PTKA 1FTLA 2XXIA 4N6KA 4KCCA 4ELRA 4TOZA 3EHTA 1AH5A 2I4BA 2FBPA 3RYDA 3RPLA 2DQVA 2O69A 3VXBA 2F8DA 1D9QA 2F35A 4RJZA 5EQ9A 1N3XA 4F31B 3TYHA 5B7DA 2F6GA 1B0HA 4OFLA 1FBGA 1QJMA 3IB1A 3QUJA 3KEIA 4F19A 2F3DA 2Q8MA 1NMUA 4R6YA 1LAXA 2O84X 5EHMA 3B8BA 3DRIA 4HXVA 4F1UA 3T9UA 4YMBA 4OVPA 4EF1A 1OLAA 3T9VA 1D4NA 4X04A 1F9BA 1FCKA 4Q8RA 3O6IA 5ET5A 1B7HA 2OJTA 4FBPA 3CVGA 2H98A 4GWYA 1MM7A 1FPGA 1FBPA 4MF3A 5IZ3A 3VVFA 4GX6A 4WKMA 2R8TA 4GBVA 3R26A 2WX9A 1S7YA 3MZBA 3RQTA 5ET6A 4GQOA 1MDP1 4LZ7A 1MM6A 3QAXA 3IX1A 4ZE8A 1BP5A 5DYHA 2I3VA 1N0TA 1NUXA 3SEWA 3ZSFA 3H03A 4P47A 2I6EA 2ZNUA 4MH5A 4WEDA 2WEFA 1NNTA 2AIXA 3VLWA 1BLFA 1NV4A 4NMYA 2E0SA 2CZHA 5I57B 4ZEIA 4MJOA 5TP9B 3PUXE 2HZLA 1M5BA 4R6HA 1SDXA 3IO6A 2VGQA 4ONYA 3KZGA 5H8FA 2WYPA 1LLSA 4G68B 1O7TA 1JP4A 2Z22A 1R1NA 4ZZEA 4GXAA 3U72A 1ZKBA 1H3DA 3C34A 3KBZA 2RKMA 1BIYA 1FBEA 3FXRA 3PUYE 2Y84A 3FGSA 2I48A 4KCDA 3DRHA 4MEVA 2ZYNA 3PMXA 3SEVA 4C1UA 4POWA 3LV0A 1TWYA 4JSOA 4AB6A 3O66A 4O3AA 3DM0A 1NV2A 3S9LC 1MY1A 4DLDA 2HHMA 1MS7A 4JVIA 2WYKA 2PT1A 1AWBA 4R2FA 2P3VA 4F29A 5AA2D 3TTLA 1QULA 1NNFA 4XKRA 3FJGA 3C36A 2YLNA 1NV1A 4AQ4A 4N8YA 1YZ0A 3CRBA 1GVCA 3FXQA 3VLUA 4YICA 3U8QA 1FQCA 5FTHA 2F7BA 4BDRA 4DCYA 1S9TA 3S9NC 1FPIA 5KDTA 4F1YA 4OVJA 4NHBA 1SD3A 3IORA 3UORA 4KI0E 1ELJA 1UTHB 3JZJA 2F7AA 3RUMA 3GLBA 4O8MA 4POXA 5L9MA 3HPIA 1LCTA 1ZMGA 3A3CA 4XXUA 4L17A 2Z8FA 4G8MA 3V89B 3LSXA 3QYTA 2RCBA 5ITOA 1P1NA 1DCUA 3MVXA 1B5IA 3ZS6A 2O51A 5KDTB 3OSRA 4MHFA 1DPPA 4ISUA 4HCWA 3EF7A 1KA1A 4NE4A 5I59A 1MDQA 4LQ2A 3FATA 3EPEA 3PV0E 2DXYA 1I69A 1LFHA 3BKIB 4EQBA 4OVSA 1LFGA 5J16A 4GWSA 4OEVA 3ROJA 3U94A 3KJ7A 1N7WA 3THIA 5DW8A 2XXKA 4F1VA 5AA3A 1NV5A 3HN0A 2JJKA 4WEPA 1GR2A 5I57A 4R74A 1JVXA 1FTAA 4OENA 2QSXA 1EYIA 5I5PA 2GQ1A 1SYHA 4OFOA 1IXGA 3T93B 3LUZA 4O3CA 2ZYOA 3CI8A 2PX1A 3GXAA 3LSLA 4P0GA 3FXBA 3OENA 3FTOA 2Z8EA 4KYEA 3JYRA 1G0HA 4EQ7A 5AA2B 1MXWA 1AL3A 1SI0A 1EZ9A 4I40A 1LBBA 3C4MA 3E79A 4PBQA 3T66A 3DP8A 3TCGA 4F18A 2AL5A 3TFLA 4NF5B 5IZ1A 1K9ZA 3TQLA 1BTJA 2B4MA 2H9BA 2I49A 3MSTA 3OEMA 1XOCA 2ZMBA 1JW4A 3EHSA 2FYIA 1B7UA 4GIZA 1QVSA 4GWWA 2PCRA 4YU0A 4NWDA 4DIGA 2V25A 4XIGQ 5CC2A 4KYDA 4N8GA 1URGA 3PD8A 1O63A 3PAMA 5DEXA 3B6TA 4P1LA 4PETA 1SI1A 3KJTA 4LZ5A 4I62A 5H8HA 3UN6A 2B65A 1UQWA 4RPNA 4GF8A 4NF8B 4PDDA 5I2NB 1CB6A 1PBPA 3PUWE 5DTBA 4KQPA 1MQHA 3RT8A 2DWHA 4G8HA 2DWIA 3ODBA 4QSDA 1FQDA 4GX3A 3VVEA 1WODA 1M5CA 4GOTA 4IO2A 1EYJA 3QUFA 1LAGE 1IXHA 2HXWA 2WOPA 4RPOA 3ISPA 3R7XA 3FUZA 5A5XB 4GWXA 1URSA 4FJPA 4X8RA 3MVWA 2F36A 1NUYA 2GHAA 4FAJA 4MCOA 4FE8A 2PT2A 4MLVA 3IR1A 1FPDA 5JTYB 3A09A 2RC9A 3TDJA 5B70A 1NV0A 2ONKE 1SBPA 3MJNA 2H4IA 1B3HA 4FEDA 4X9TA 2XA5A 2UVIA 2Q74A 1AIVA 5KCJA 1US4A 4JXIA 3SZPA 1ZTYA 2DYXA 3SERA 4NAPA 4KD5A 1PB9A 4KXPA 2DVZA 2QS1A 5CMMA 3FZVA 3RY3A 4EQ9A 3DRGA 4NEDA 4IY6A 1EZPA 1H44A 3ILUB 2QVUA 3OMBA 2Y5KA 3GZGA 5AA2A 2HQ0A 1B3EA 4YKJA 4DI3D 1EYKA 4QF9A 3WAFA 4MBPA 3E78A 2XXHA 3MP6A 1DOTA 4KYSA 4O3BA 5KZTA 3O97A 1VE4A 1H76A 1LAFE 2Y7RA 2F34A 2Z8DA 1OLCA 1NUZA 3N94A 1DTGA 5H8HB 4GXSB 1PDAA 3OO9A 1ATGA 4U22A 1MQIA 4DXBA 1FQFA 5JK4A 3ZKLA 3V5AA 1VFDA 1B3GA 2ZZXA 1OMPA 3KBRA 1SVXB 2ZYKA 3M3KA 1DPEA 2Y7KA 3MQ9A 4PE3A 1B1HA 3PPQA 1RDYA 3MZ9A 1FPFA 3T0JA 3TCFA 4YB5A 3G3HA 1HSJA 3K6WA 5DVIA 1IITA 5I2NA 3DRFA 4P11A 4U4XA 4OETA 2VD2A 4OWDA 5I58A 3HV1A 2OBGA 3D4GA 4LVQA 1VSOA 2P3NA 5DEXB 5I3SA 3OO7A 3TODA 1J1NA 1INPA 4H45A 3RNNA 2I0BA 2XXYA 5HM4B 2PBWA 3K4UA 3PU5A 3K1MA 4MNIA 1JEVA 4RK9A 2HXRA 4NGUA 2G29A 2V3TA 4NTLA 5CMCA 3DP4A 5AA4A 4G2ZA 3USDA 1ZLQA 4YKIA 1YCJA 3M8UA 3L6HA 4OQOA 2ALUA 1UTHA 2VT5A 3EHUA 1FPEA 3Q28A 1FTOA 2Y7PA 3RPLB 5I84A 3CFXA 1NH8A 2I0CA 1USYE 1I6BA 3H6UA 4XKQA 3PGFA 1OIBA 4G8NA 1SQYA 3MZ1A 3TAJA 2W7YA 4H1XA 3N6TA 5ICTA 2XXVA 1FSAA 3AXFA 3SEXA 1JVYA 4NN3A 1EZOA 2CZKA 1JW5A 4GRKA 1B6HA 1B4HA 3VLVA 3O9PA 3B50A 3TELA 3W9VA 2FHYA 3OD7A 1R9QA 3DRKA 1LBXA 4Q5TA 4IO6A 1FQEA 2Y5LA 3FJ7A 3W15C 5BWJA 1IMEA 3K01A 3N26A 5IM2A 1XI6A 4KHZE 5IGAA 2OWTA 4N13A 4LA9A 1P1WA 3U1OA 2DS9A 3I6VA 3VFJA 2AYSA 1MY4A 1FTJA 2RC7A 4MFIA 1ZBMA 4NF6B 5I2KA 2M8CA 3WAEA 1OQHA 5J1DA 4OERA 2AL4A 4R75A 3OEKA 3CR9A 4N4UA 2FIXA 2O68A 3KOSA 3RGYA 3G7WA 4I1DA 3MUQA 4PFIA 4MLQA 4NF4B 3C32A 5TPAB 3T1BA 3FVOA 1SYIA 1IXIA 2IA4A 3HHFA 3IOVA 3K6UA 4RY1A 3DLNA 1MXYA 3S4UA 3SKPA 3CIJA 1QW0A 3MPKA 1B2HA 4OTEA 4OA4A 2PFZA 1IZ1A 3O2AA 2CZIA 3CFZA 1SPIA 2UVJA 3K6XA 3IJOB 3KG2A 1TXFA 3TEPA 4DXUA 4RYAA 2OWSA 3HFUA 1B32A 1NV7A 4U4SA 1B51A 3PD9A 5IAIA 1NH7A 4ESXA 1T0KA 4H8JA 3BBRA 3QMFA 3TMGA 3PPRA 4OANA 1MXXA 1MH3A 3KN3A 4JSDA 3G3GA 1FPLA 2PFYA 2D5WA 4F3BA 3CG3A 3D4CA 1B46A 5F24A 5TP9A 2HZKA 4NQ8A 4KPTA 1IMDA 2QMWA 3QIMA 2HEUA 4U2RA 1FJ9A 4PAFA 5ITPA 1IMAA 2YJPA 2B4LA 4ZEFA 4N07A 2MKZA 2WOLA 5I58B 1B1XA 2XWIA 3FD3A 2H5YA 4GLIA 4NF0A 3ECRA 4QHQA 4TLLB 3TZAA 3KSXA 3I3VA 1Q1KA 1MPBA 2DWAA 2WBDA 4LONB 3VXCA 4LP2B 1POTA 4E0XA 1Y20A 1N3WA 3TUSA 4IO4A 4PDHA 2X7PA 4JVCA 4ND9A 3MVZA 3V83A 2CEXA 2XXPA 5EYGA 3MW0A 1FBHA 4N17A 1B5JA 2NXOA 3G3JA 2OK2A 3FBPA 5IZ3B 2R9JA 5AA4B 2FA7A 2R71A 4I3EA 3PUVE 3E13X 3I5OA 3CSGA 2XD2A 2XD3A 4DZ1A 4PFYA 1D9VA 3O6HA 4Z7EA 3G3IA 1BKAA 2XX9A 2O6AA 4GFRA 3SETA 1IIWA 1MY3A 1WVJA 2QS2A 2V4CA 4JWXA 4NWCA 3GBBA 2HCAA 4PFRA 1KZ8A 1RYOA 5IKBA 3PPOA 4K3FA 2A5TA 2QMXA 2O7UA 4ZDMA 3P7IA 4AS4A 4R6KA 2Z23A 1LBYA 3LR1A 3IOUA 3SEYA 3OO8A 1PC3A 2NUVA 5CM6A 4F39A 5I56A 2DWJA 3BIHA 4PAIA 2V84A 5HBCA 4M1VA 2OX3A 4PGPA 3FVGA 2GRVA 3VE1B 3DELB 4KFQA 3H3GA 3GYYA 4IGTA 4MNCA 1WDNA 1AMFA 4EDPA 1GV8A 1RDZA 3JV9A 4JBZA 3KFMA 4PQJA 4MMPA 3FXUA 3ILTB 5EYHA 2PVUA 4PGNA 2YPNA 1A8EA 2CZLA 4EXKA 4G4PA 1DK4A 2O1MA 2LAOA 2OWZA 1TFAA 1B3LA 4RNSA 3IFCA 4PF6A 5EHSA 3T9XB 2G93A 2XXTA 4LATA 5KCJB 2VHAA 2RF1A 3FVNA 1JEUA 4H67A 3BFTA 4QFNA 1II5A 4G68C 5I59B 3C9HA 1B05A 4QFPA 1OQGA 4IR8A 1MRPA 4HW8A 4YKPA 1D9YA 1MXZA 4OESA 1QUKA 4FEBA 2UVGA 3PMVA 2QFLA 1XVYA 3MAMA 1NI9A 3C31A 4PAKA 3K6VA 4NX1A 2XXUA 1SW2A 2UYFA 3LSFB 1VFEA 1B52A 4R9GA 1FBDA 1SW4A 5ET7A 2DVCA 3Q25A 3IK6B 4O7IA 2D3IA 4BLAA 2QS3A 3M3LA 3OXNA 2F7CA 4Z0IA 2ZNTA 2THIA 4LUBA 4OMBA 1ZU0A 3FVKA 1FPJA 3HO7A 1IMFA 4PE5B 5FBPA 2F78A 2Q2AA 2F5XA 1YTVA 4OEUA 5CBRA 2NOOA 5HPQA 4THIA 4QXDA 3PMWA 3UGWA 1URDA 4G61A 2I3WA 3H7MA 3MVYA 3CG1A 3Q27A 1VR5A 1B7ZA 3Q29A 4IO3A 3O6PA 1LBWA 4BDQA 2VPNA 2XXXA 1Z7NE 3ONMA 4RK2A 1S50A 1FQBA 1MQJA 3O6GA 5H8NA 3BIGA 3E9XA 3UP9A 4I3YA 4NF8A 3RLFE 1MY2A 4Q30B 1QUJA 4KR5A 1XVXA 2QPQA 3O28A 2BJIA 3F11A 1H45A 2XHDA 2FVZA 4N6PA 2HFBA 4F2QA 2L5VA 2ZXTA 3MC2A 5TPAA 4ZEDA 2KR0A 4PFWA
chains in the Genus database with same CATH topology
1FQEA 4DXCA 2V3UA 4ELPA 3N6UA 5H8FB 3FJ7A 3FXQA 1EU8A 3VLUA 5LOMA 3W15C 4YICA 3U8QA 1FQCA 5FTHA 5BWJA 3S9MC 1MY0A 3K01A 2F7BA 1TFDA 2GFEA 3N26A 4KHZE 4BDRA 2OWTA 1KWHA 4N13A 1OVBA 4BDNA 4DCYA 1Y1MA 4LA9A 2B3FA 3IO4A 3RN8A 1P1WA 1S9TA 3W9WA 3S9NC 3U1OA 1LGBC 3KGCA 1Y9UA 3E3KA 4ECFA 3H06B 2GHBA 1IXCA 1DMBA 5KDTA 4H0WA 2ESNA 1LSTA 2DS9A 2RCAA 4OVJA 2ZNSA 4F1YA 3R6UA 1SD3A 4YB7A 3IORA 3I6VA 3VFJA 1A54A 2AYSA 1MY4A 1FTJA 1XC1A 4P0IA 1B0LA 2RC7A 3B6WA 4KI0E 4MFIA 3UORA 1ZBMA 1ELJA 3FJMA 4NF6B 1UTHB 3JZJA 5AE4A 5I2KA 2M8CA 3WAEA 1OQHA 2F7AA 2ZYMA 3FV1A 4OERA 3GLBA 4H5GA 4POXA 3DP6A 3RUMA 4PETA 1IUDA 2AL4A 2XX7A 4R75A 4OHNA 5L9MA 3HPIA 3OEKA 1LCTA 3C33A 3CR9A 1Z7ME 4YKKA 1ZMGA 3PPNA 2Y7WA 3A3CA 4XXUA 1NFTA 4L17A 2H25A 1A55A 2NVUB 2O68A 2P0SA 2Z8FA 2WOKA 2OCUA 4G8MA 3KOSA 4U1ZA 3RGYA 1GGGA 3G7WA 4I1DA 3MUQA 4GD5A 3V89B 3LSXA 4MLQA 4NF4B 3QYTA 3TCHA 2RCBA 3C32A 5ITOA 4XKNA 4H5FA 4I8CA 1P1NA 5TPAB 3FVOA 1SYIA 1IXIA 2IA4A 3MVXA 3UIFA 1B5IA 3ZS6A 2O51A 3T9VA 5KDTB 3HHFA 3OSRA 4QRZA 2ANJA 4C1TA 3IOVA 1DPPA 3K6UA 4ISUA 5FHNA 2NWJA 4ZEKA 1DSNA 2XXWA 4HCWA 5CI5A 4HTGA 3EF7A 1ZJLA 1UTBA 2QL3A 4NE4A 3U93A 1M5FA 4OYVA 4RY1A 2PYYA 3OOAA 1M5DA 3DLNA 5I59A 3IB2A 4G68A 2DE3A 5L9SA 1JETA 1MXYA 1TT1A 1MDQA 3L6GA 3S4UA 3SKPA 3HSTA 3CIJA 5AA1A 1QW0A 2REGA 1A99A 3MPKA 4BDOA 4F22A 1FTKA 4LQ2A 1B2HA 2Q89A 4OTEA 3FATA 3VVDA 3EPEA 3PV0E 2DXYA 1I69A 1LFHA 3BKIB 3OELA 3UK4A 4EQBA 1LFGA 1IZ1A 3O2AA 3S9EA 4PFTA 3CFZA 1MQDA 4OEVA 2UVJA 1HSEA 3U94A 3K6XA 1D3KA 3KJ7A 3Q26A 1N7WA 3THIA 3K0VA 3V8XB 3IJOB 3KG2A 5I2KB 3B7DA 4I9DA 4GL8A 1TXFA 3B6QA 3TEPA 3RT6B 4DXUA 4F1VA 4RYAA 2OWSA 2PMSA 4Q5TA 1P1QA 1B32A 5AA3A 3HN0A 2HAVA 3RYBA 2F97A 3N5LA 1GR2A 3K2DA 4WEPA 4EXLA 3T22A 5CBRA 5I57A 4U4SA 1L5TA 5AA4B 4Q0CA 4R74A 1B51A 1JVXA 3PD9A 4QFOA 2X26A 4OENA 4WXJA 2QSXA 1NH7A 5IAIA 4ESXA 1T0KA 4H8JA 5H8NB 1FW0A 3BBRA 1P99A 1HSLA 2ONRA 2R6GE 3TKDA 3TMGA 3HHGA 2Q88A 3PPRA 2V3QA 1MXXA 1MH3A 1MPCA 3TTMA 5CBSA 1SYHA 4OFOA 1IXGA 3KN3A 1IEJA 3T93B 4O3CA 1OVTA 4JSDA 3G3GA 3TQWA 2ZYOA 1Y3QA 1Y4CA 2XXQA 3CI8A 3TTKA 4ELQA 2PX1A 2D5WA 3GXAA 4IGRA 3CG3A 3D4CA 4OZ9A 1B46A 2OLBA 4F3BA 3LSLA 4TLMB 3H6TA 5TP9A 2HZKA 1PB8A 4P0GA 1O64A 3OENA 3FTOA 1XS5A 2Z8EA 4KPTA 4KYEA 3JYRA 3U92A 2QMWA 3QIMA 2DE2A 2HEUA 2Q2CA 2B3BA 4ZEBA 2UVHA 4U2RA 1RYXA 5CMBA 4EQ7A 5EYFA 1MH4A 5CMKA 3LC8A 4RXLA 5ITPA 5AA2B 4R73A 1LB8A 1AL3A 1MXWA 1SI0A 4X1DA 1GVCA 2KLFA 2YJPA 1EZ9A 1IQ7A 2B4LA 4ZEFA 4N07A 3QK6A 4HCYA 1LBBA 4X48A 2WOLA 3C4MA 3ZKKA 3T66A 1LCFA 1B1XA 4PP0A 3SEUA 5I58B 1XT8A 4ZE9A 3FD3A 1NNPA 5FTIA 3DP8A 3O29A 5DT6A 3TCGA 2H5YA 2V93A 3EN3A 4GLIA 4F18A 3ECRA 3LSWA 4QHQA 2AL5A 2ONSA 4TLLB 3TFLA 3TZAA 3KSXA 3C35A 3I3VA 1Q1KA 2VD3A 4NF5B 1A7LA 1MPBA 2DWAA 4LONB 3TQLA 1BTJA 4FIMA 2B4MA 1I6AA 2E1SA 2OZZA 2H9BA 4IO5A 4YMAA 1POY1 2I49A 4LP2B 2Q8JA 4OFJA 3UA8A 3VDFA 3VXCA 1SW1A 3OEMA 1POTA 4NF6A 1MG1A 4E0XA 1XOCA 2ZMBA 4LQ5A 1JW4A 1B5HA 3EHSA 1Y20A 2HAUA 2FYIA 1N3WA 1B7UA 3TUSA 4IO4A 5ICQA 1QVSA 2X7PA 4GIZA 4ND9A 5DVJA 1UIVA 4YU0A 3MVZA 5BUUA 1B40A 4NWDA 3V83A 3MBPA 2XXPA 4IB2A 3MW0A 1MPDA 1GTKA 2V25A 3KOTA 4DIGA 3PUZE 4XIGQ 5CC2A 1B5JA 2NXOA 4ELOA 3FV2A 4KYDA 1URGA 3IJXB 4R9FA 2WKYA 3PD8A 4F3GA 1O63A 3G3JA 3E4RA 2OK2A 3PAMA 5DEXA 3B6TA 4EUOA 3OSQA 3MP1A 4NF4A 2R9JA 1SI1A 2FA7A 3G3FA 4XKPA 1H43A 3HCQA 2R71A 2GH9A 2Q9TA 2XX8A 1P1UA 3K02A 3KJTA 4LZ5A 2O7IA 2I58A 3PUVE 3E13X 4I62A 3I5OA 1MXUA 3CSGA 5H8HA 3UN6A 2XD2A 2XD3A 4DZ1A 2B65A 2RC8A 4PFYA 1UQWA 4RPNA 4GF8A 4NF8B 5ISUA 3RTFB 4ESWA 1D9VA 1CB6A 2P1SA 3O6HA 4JWYA 3G3IA 3RTWB 1PBPA 4UACA 1BKAA 2XX9A 2O6AA 3PUWE 4Z7EA 1LBCA 4GFRA 4H6DA 5DTBA 3SETA 3BFUA 1IIWA 1FTMA 1MY3A 4XTCQ 5ELVA 4KQPA 1WVJA 1MQHA 3RT8A 3CHGA 2QS2A 2DWHA 4JWXA 4NWCA 3GBBA 2HCAA 1RYOA 4G8HA 2A5TB 3PPOA 5IKBA 5H8SA 3KSJA 2DWIA 3ODBA 5K2YA 4K3FA 2A5TA 4QSDA 1US5A 4X1BA 2QMXA 1B4ZA 2O7UA 3G3KA 4GWOA 5FHMA 4ZDMA 1FQDA 3P7IA 3VVEA 1WODA 4R6KA 3RPWA 1LB9A 1M5CA 1MXVA 1P1OA 4GOTA 4IO2A 3IOWA 2H99A 2Z23A 3QUFA 1LAHE 1LAGE 2DXRA 2QJEA 3LR1A 1IXHA 4JWOA 4DE8A 2HXWA 2WOPA 3MWBA 4TQUQ 2QS4A 4RPOA 2DP8A 4H65A 5H8QA 4QFLA 2P2AA 3R7XA 4FATA 3IOUA 3T96B 3SEYA 3FUZA 5A5XB 2Y7IA 3TTRA 1URSA 3GBAA 3OO8A 1PC3A 2NUVA 4FJPA 5CM6A 4F39A 3MVWA 5I56A 1Y3PA 2F36A 2DWJA 1N76A 2D21A 2IEEA 4FECA 3SESA 2GHAA 1NL5A 1XHYA 2V84A 1B9JA 4UA8A 3T9HB 1PBQA 5HBCA 4F3SA 4FAJA 3H6WA 1FTLA 4M1VA 2XXIA 3H4ZA 4FORA 4KCCA 4TOZA 1N84A 4ELRA 3FVGA 4FE8A 2GRVA 2PT2A 3EHTA 3VE1B 1AH5A 1N04A 4MLVA 2O1LA 2I4BA 3DELB 4KFQA 4JB7A 3H3GA 3IR1A 1Q35A 2DQVA 5JTYB 4IGTA 2DOJA 1WDNA 1AMFA 2O69A 3A09A 2RC9A 3TDJA 4EDPA 5B70A 5J1DA 2ONKE 1GV8A 3VXBA 4E0WA 1SBPA 2F8DA 3IL1B 1Y4TA 1YPNA 3JV9A 4JBZA 2F35A 3MJNA 2I4CA 3KFMA 2H4IA 1B3HA 4PQJA 2FNCA 4RJZA 1AOVA 1R6ZA 4FEDA 3FXUA 1N3XA 1M5EA 4X9TA 2VOZA 2UVIA 4YZZA 2A5SA 3ILTB 4F31B 5L8DA 4GL0A 3TYHA 1AIVA 5KCJA 5B7DA 1US4A 1MQGA 4JXIA 2PVUA 5M2VA 1ZTYA 2F6GA 1B0HA 1JQFA 4OFLA 1QJMA 2DYXA 1A8FA 3IB1A 3QUJA 4LZ8A 4KD5A 3SERA 1PB9A 4QSCA 2DVZA 2QS1A 5CMMA 3KEIA 3FZVA 4F19A 3RY3A 2REJA 4EQ9A 2YPNA 3DRGA 1A8EA 2CZLA 4G4PA 4NEDA 4EXKA 4IY6A 1JW1A 5A5XA 1EZPA 1H44A 3ILUB 1NMUA 4R6YA 1LAXA 4OXVA 1CE2A 4U23A 2O1MA 3OMBA 2LAOA 1B3FA 2O84X 2UXAA 3GZGA 5AA2A 2HQ0A 1B3EA 2BJJX 5EHMA 4YKJA 1TFAA 1B3LA 2UYEA 3DRIA 4QF9A 4RNSA 3WAFA 4MBPA 3IOTA 4F1UA 3T9UA 4YMBA 4ZECA 5EHSA 3T9XB 4NF5A 4EF1A 1OLAA 2G93A 2XXHA 3MP6A 1DOTA 4KYSA 2XXTA 1D4NA 4O3BA 1F9BA 4YAHX 1FCKA 5KZTA 3O97A 3O6IA 4LATA 4Q8RA 5KCJB 1VE4A 1H76A 1LAFE 3KN8A 2VHAA 2Y7RA 1B7HA 2F34A 2OJTA 2RF1A 2Z8DA 1OLCA 4ZZAA 3N94A 1DTGA 1JNFA 3TTNA 3FVNA 3S2VA 5H8HB 1JEUA 3CVGA 4GXSB 4H67A 3BFTA 2H98A 4ZS9A 4QFNA 1II5A 4G68C 1PDAA 1MM7A 3OO9A 5I59B 2X7QA 1ATGA 3C9HA 4MF3A 1B05A 5FHOA 4U22A 3VVFA 1MQIA 4DXBA 4QFPA 1OQGA 1NNKA 1MRPA 4WKMA 4HW8A 1FQFA 5JK4A 3ZKLA 4YKPA 3V5AA 3R26A 1D9YA 1MXZA 1VFDA 1N7XA 3IB0A 1B3GA 1S7YA 3MZBA 4OESA 1QUKA 1OMPA 3RQTA 2VP1A 4FEBA 2UVGA 1SVXB 2ZYKA 3KBRA 1UIUA 1DPEA 2Y7KA 3M3KA 3MQ9A 3PMVA 4GQOA 1MDP1 1B1HA 3PPQA 4G77A 1XVYA 1MM6A 3QAXA 4LZ7A 1A40A 3MZ9A 3MAMA 3TCFA 4YB5A 3IX1A 5H8QB 3G3HA 3QSLA 3C31A 1HSJA 3K6WA 3K6VA 5DVIA 4ZE8A 1IITA 1BP5A 5DYHA 2I3VA 4DDDA 5I2NA 3DRFA 1N0TA 2XXUA 4P11A 3SEWA 1SW2A 2DE4A 3H03A 4OETA 2VD2A 4U4XA 4OWDA 3ZSFA 5I56B 5I58A 3HV1A 4F3PA 3KN7A 2UYFA 2OBGA 2I6EA 2ZNUA 4MH5A 3D4GA 4BDLA 4EF2A 4LVQA 4DCXA 4WEDA 3CSBA 3LSFB 1VFEA 1VSOA 1NNTA 5DEXB 1B52A 4R9GA 2AIXA 3VLWA 1BLFA 1SW4A 1I6QA 1EH3A 2DVCA 4NMYA 2E0SA 3Q25A 5I57B 4ZEIA 3OO7A 3MP8A 4PFUA 3IK6B 5CRYA 3TODA 3SDFA 4AB5A 2D3IA 1USYH 5F1QA 4BLAA 1J1NA 5TP9B 2QS3A 3M3LA 3PUXE 5K2XA 3RNNA 1QKBA 3OXNA 2I0BA 2HZLA 1M5BA 1ANFA 2XXYA 4R6HA 1SDXA 3A3UA 3VV5A 5HM4B 2PBWA 3K4UA 3IO6A 3K1MA 3PU5A 4U1OA 4RK9A 1JEVA 3K1NA 5JEIA 2F7CA 2G29A 4RA1A 2VGQA 5F7VA 4ONYA 2V3TA 4Z0IA 3KZGA 2ZNTA 4NTLA 5CMCA 3DP4A 5H8FA 1LLSA 4G68B 1LFIA 1O7TA 2THIA 3K00A 4R2BA 2Z22A 4G2ZA 1R1NA 4IY5A 4LUBA 4OMBA 4ZZEA 3USDA 5AA4A 1ZLQA 1ZU0A 3FVKA 4GXAA 3U72A 4YKIA 3HO7A 4PE5B 1ZKBA 2RINA 3LVUA 1PEBA 1YCJA 3M8UA 1H3DA 2F78A 2F5XA 1YTVA 4OEUA 2Q2AA 3C34A 2NOOA 3L6HA 2RKMA 4C0RA 4OQOA 1BIYA 5HPQA 2ALUA 4THIA 3LBSA 3M3FA 1UTHA 3EHUA 4IO7A 3PMWA 3Q28A 2DSFA 1RKMA 3IAZA 1FTOA 1URDA 3FXRA 3UGWA 3PUYE 2Y7PA 5I84A 1B58A 2Y84A 3FGSA 4YB6A 3CFXA 3FIRA 2I48A 4KCDA 2I3WA 3DRHA 1NH8A 2I0CA 3H7MA 4U21A 2ZYNA 3PMXA 3MVYA 3CG1A 1ZIUA 1VR5A 1B7ZA 2CMOA 3Q29A 3Q27A 1USYE 3SEVA 1I6BA 4IO3A 4POWA 3O6PA 4C1UA 1DTZA 4R72A 4BDQA 5DVFA 3H6UA 1TWYA 4M4GA 4JSOA 4AB6A 3O66A 4O3AA 4XKQA 4JDFA 2XXXA 1OIBA 3CFLA 3PGFA 4BDMA 1Z7NE 3K1PA 4QSEA 2QRYA 3ONMA 4G8NA 1SQYA 3DM0A 1PB7A 3MZ1A 4RK2A 3TAJA 1S50A 2W7YA 1FQBA 2F6PA 1FQAA 3LUYA 3TPAA 4H1XA 3S9LC 1MQJA 1MY1A 3O6GA 4DLDA 5H8NA 3FASA 1MS7A 1UTBB 1SW5A 3E9XA 3N6TA 5ICTA 3UP9A 3OO6A 4NF8A 2PT1A 2XXVA 3RLFE 1MY2A 4Q30B 1R9LA 5L9OA 1QUJA 4KR5A 4R2FA 5I2NB 1XVXA 2QPQA 3O28A 3AXFA 4HS7A 3QXMA 3SEXA 4F29A 5AA2D 1JVYA 3DRJA 3F11A 4GVOA 1EZOA 3TTLA 1H45A 5JTYA 4QFKA 1Y3NA 4F2OA 1QULA 2XHDA 1JW5A 1NKXA 1NNFA 4GRKA 1B6HA 3H6VA 2XXRA 3RYAA 4N6PA 2HFBA 1QKAA 4XKRA 1YAEA 4H8IA 1B4HA 3FJGA 4F2QA 3MPLA 3PPPA 3C36A 2YLNA 3EQ1A 5TU0A 3VLVA 4AQ4A 3O9PA 2ZXTA 1Y1ZA 3MC2A 5TPAA 3TELA 4ZEDA 3W9VA 3OD7A 1R9QA 4PFWA 2ABHA 3DRKA 1QUIA 3CRBA 4IO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FQE A;  4DXC A;  2V3U A;  4ELP A;  3N6U A;  5H8F B;  3FJ7 A;  3FXQ A;  1EU8 A;  3VLU A;  5LOM A;  3W15 C;  4YIC A;  3U8Q A;  1FQC A;  5FTH A;  5BWJ A;  3S9M C;  1MY0 A;  3K01 A;  2F7B A;  1TFD A;  2GFE A;  3N26 A;  4KHZ E;  4BDR A;  2OWT A;  1KWH A;  4N13 A;  1OVB A;  4BDN A;  4DCY A;  1Y1M A;  4LA9 A;  2B3F A;  3IO4 A;  3RN8 A;  1P1W A;  1S9T A;  3W9W A;  3S9N C;  3U1O A;  1LGB C;  3KGC A;  1Y9U A;  3E3K A;  4ECF A;  3H06 B;  2GHB A;  1IXC A;  1DMB A;  5KDT A;  4H0W A;  2ESN A;  1LST A;  2DS9 A;  2RCA A;  4OVJ A;  2ZNS A;  4F1Y A;  3R6U A;  1SD3 A;  4YB7 A;  3IOR A;  3I6V A;  3VFJ A;  1A54 A;  2AYS A;  1MY4 A;  1FTJ A;  1XC1 A;  4P0I A;  1B0L A;  2RC7 A;  3B6W A;  4KI0 E;  4MFI A;  3UOR A;  1ZBM A;  1ELJ A;  3FJM A;  4NF6 B;  1UTH B;  3JZJ A;  5AE4 A;  5I2K A;  2M8C A;  3WAE A;  1OQH A;  2F7A A;  2ZYM A;  3FV1 A;  4OER A;  3GLB A;  4H5G A;  4POX A;  3DP6 A;  3RUM A;  4PET A;  1IUD A;  2AL4 A;  2XX7 A;  4R75 A;  4OHN A;  5L9M A;  3HPI A;  3OEK A;  1LCT A;  3C33 A;  3CR9 A;  1Z7M E;  4YKK A;  1ZMG A;  3PPN A;  2Y7W A;  3A3C A;  4XXU A;  1NFT A;  4L17 A;  2H25 A;  1A55 A;  2NVU B;  2O68 A;  2P0S A;  2Z8F A;  2WOK A;  2OCU A;  4G8M A;  3KOS A;  4U1Z A;  3RGY A;  1GGG A;  3G7W A;  4I1D A;  3MUQ A;  4GD5 A;  3V89 B;  3LSX A;  4MLQ A;  4NF4 B;  3QYT A;  3TCH A;  2RCB A;  3C32 A;  5ITO A;  4XKN A;  4H5F A;  4I8C A;  1P1N A;  5TPA B;  3FVO A;  1SYI A;  1IXI A;  2IA4 A;  3MVX A;  3UIF A;  1B5I A;  3ZS6 A;  2O51 A;  3T9V A;  5KDT B;  3HHF A;  3OSR A;  4QRZ A;  2ANJ A;  4C1T A;  3IOV A;  1DPP A;  3K6U A;  4ISU A;  5FHN A;  2NWJ A;  4ZEK A;  1DSN A;  2XXW A;  4HCW A;  5CI5 A;  4HTG A;  3EF7 A;  1ZJL A;  1UTB A;  2QL3 A;  4NE4 A;  3U93 A;  1M5F A;  4OYV A;  4RY1 A;  2PYY A;  3OOA A;  1M5D A;  3DLN A;  5I59 A;  3IB2 A;  4G68 A;  2DE3 A;  5L9S A;  1JET A;  1MXY A;  1TT1 A;  1MDQ A;  3L6G A;  3S4U A;  3SKP A;  3HST A;  3CIJ A;  5AA1 A;  1QW0 A;  2REG A;  1A99 A;  3MPK A;  4BDO A;  4F22 A;  1FTK A;  4LQ2 A;  1B2H A;  2Q89 A;  4OTE A;  3FAT A;  3VVD A;  3EPE A;  3PV0 E;  2DXY A;  1I69 A;  1LFH A;  3BKI B;  3OEL A;  3UK4 A;  4EQB A;  1LFG A;  1IZ1 A;  3O2A A;  3S9E A;  4PFT A;  3CFZ A;  1MQD A;  4OEV A;  2UVJ A;  1HSE A;  3U94 A;  3K6X A;  1D3K A;  3KJ7 A;  3Q26 A;  1N7W A;  3THI A;  3K0V A;  3V8X B;  3IJO B;  3KG2 A;  5I2K B;  3B7D A;  4I9D A;  4GL8 A;  1TXF A;  3B6Q A;  3TEP A;  3RT6 B;  4DXU A;  4F1V A;  4RYA A;  2OWS A;  2PMS A;  4Q5T A;  1P1Q A;  1B32 A;  5AA3 A;  3HN0 A;  2HAV A;  3RYB A;  2F97 A;  3N5L A;  1GR2 A;  3K2D A;  4WEP A;  4EXL A;  3T22 A;  5CBR A;  5I57 A;  4U4S A;  1L5T A;  5AA4 B;  4Q0C A;  4R74 A;  1B51 A;  1JVX A;  3PD9 A;  4QFO A;  2X26 A;  4OEN A;  4WXJ A;  2QSX A;  1NH7 A;  5IAI A;  4ESX A;  1T0K A;  4H8J A;  5H8N B;  1FW0 A;  3BBR A;  1P99 A;  1HSL A;  2ONR A;  2R6G E;  3TKD A;  3TMG A;  3HHG A;  2Q88 A;  3PPR A;  2V3Q A;  1MXX A;  1MH3 A;  1MPC A;  3TTM A;  5CBS A;  1SYH A;  4OFO A;  1IXG A;  3KN3 A;  1IEJ A;  3T93 B;  4O3C A;  1OVT A;  4JSD A;  3G3G A;  3TQW A;  2ZYO A;  1Y3Q A;  1Y4C A;  2XXQ A;  3CI8 A;  3TTK A;  4ELQ A;  2PX1 A;  2D5W A;  3GXA A;  4IGR A;  3CG3 A;  3D4C A;  4OZ9 A;  1B46 A;  2OLB A;  4F3B A;  3LSL A;  4TLM B;  3H6T A;  5TP9 A;  2HZK A;  1PB8 A;  4P0G A;  1O64 A;  3OEN A;  3FTO A;  1XS5 A;  2Z8E A;  4KPT A;  4KYE A;  3JYR A;  3U92 A;  2QMW A;  3QIM A;  2DE2 A;  2HEU A;  2Q2C A;  2B3B A;  4ZEB A;  2UVH A;  4U2R A;  1RYX A;  5CMB A;  4EQ7 A;  5EYF A;  1MH4 A;  5CMK A;  3LC8 A;  4RXL A;  5ITP A;  5AA2 B;  4R73 A;  1LB8 A;  1AL3 A;  1MXW A;  1SI0 A;  4X1D A;  1GVC A;  2KLF A;  2YJP A;  1EZ9 A;  1IQ7 A;  2B4L A;  4ZEF A;  4N07 A;  3QK6 A;  4HCY A;  1LBB A;  4X48 A;  2WOL A;  3C4M A;  3ZKK A;  3T66 A;  1LCF A;  1B1X A;  4PP0 A;  3SEU A;  5I58 B;  1XT8 A;  4ZE9 A;  3FD3 A;  1NNP A;  5FTI A;  3DP8 A;  3O29 A;  5DT6 A;  3TCG A;  2H5Y A;  2V93 A;  3EN3 A;  4GLI A;  4F18 A;  3ECR A;  3LSW A;  4QHQ A;  2AL5 A;  2ONS A;  4TLL B;  3TFL A;  3TZA A;  3KSX A;  3C35 A;  3I3V A;  1Q1K A;  2VD3 A;  4NF5 B;  1A7L A;  1MPB A;  2DWA A;  4LON B;  3TQL A;  1BTJ A;  4FIM A;  2B4M A;  1I6A A;  2E1S A;  2OZZ A;  2H9B A;  4IO5 A;  4YMA A;  1POY 1;  2I49 A;  4LP2 B;  2Q8J A;  4OFJ A;  3UA8 A;  3VDF A;  3VXC A;  1SW1 A;  3OEM A;  1POT A;  4NF6 A;  1MG1 A;  4E0X A;  1XOC A;  2ZMB A;  4LQ5 A;  1JW4 A;  1B5H A;  3EHS A;  1Y20 A;  2HAU A;  2FYI A;  1N3W A;  1B7U A;  3TUS A;  4IO4 A;  5ICQ A;  1QVS A;  2X7P A;  4GIZ A;  4ND9 A;  5DVJ A;  1UIV A;  4YU0 A;  3MVZ A;  5BUU A;  1B40 A;  4NWD A;  3V83 A;  3MBP A;  2XXP A;  4IB2 A;  3MW0 A;  1MPD A;  1GTK A;  2V25 A;  3KOT A;  4DIG A;  3PUZ E;  4XIG Q;  5CC2 A;  1B5J A;  2NXO A;  4ELO A;  3FV2 A;  4KYD A;  1URG A;  3IJX B;  4R9F A;  2WKY A;  3PD8 A;  4F3G A;  1O63 A;  3G3J A;  3E4R A;  2OK2 A;  3PAM A;  5DEX A;  3B6T A;  4EUO A;  3OSQ A;  3MP1 A;  4NF4 A;  2R9J A;  1SI1 A;  2FA7 A;  3G3F A;  4XKP A;  1H43 A;  3HCQ A;  2R71 A;  2GH9 A;  2Q9T A;  2XX8 A;  1P1U A;  3K02 A;  3KJT A;  4LZ5 A;  2O7I A;  2I58 A;  3PUV E;  3E13 X;  4I62 A;  3I5O A;  1MXU A;  3CSG A;  5H8H A;  3UN6 A;  2XD2 A;  2XD3 A;  4DZ1 A;  2B65 A;  2RC8 A;  4PFY A;  1UQW A;  4RPN A;  4GF8 A;  4NF8 B;  5ISU A;  3RTF B;  4ESW A;  1D9V A;  1CB6 A;  2P1S A;  3O6H A;  4JWY A;  3G3I A;  3RTW B;  1PBP A;  4UAC A;  1BKA A;  2XX9 A;  2O6A A;  3PUW E;  4Z7E A;  1LBC A;  4GFR A;  4H6D A;  5DTB A;  3SET A;  3BFU A;  1IIW A;  1FTM A;  1MY3 A;  4XTC Q;  5ELV A;  4KQP A;  1WVJ A;  1MQH A;  3RT8 A;  3CHG A;  2QS2 A;  2DWH A;  4JWX A;  4NWC A;  3GBB A;  2HCA A;  1RYO A;  4G8H A;  2A5T B;  3PPO A;  5IKB A;  5H8S A;  3KSJ A;  2DWI A;  3ODB A;  5K2Y A;  4K3F A;  2A5T A;  4QSD A;  1US5 A;  4X1B A;  2QMX A;  1B4Z A;  2O7U A;  3G3K A;  4GWO A;  5FHM A;  4ZDM A;  1FQD A;  3P7I A;  3VVE A;  1WOD A;  4R6K A;  3RPW A;  1LB9 A;  1M5C A;  1MXV A;  1P1O A;  4GOT A;  4IO2 A;  3IOW A;  2H99 A;  2Z23 A;  3QUF A;  1LAH E;  1LAG E;  2DXR A;  2QJE A;  3LR1 A;  1IXH A;  4JWO A;  4DE8 A;  2HXW A;  2WOP A;  3MWB A;  4TQU Q;  2QS4 A;  4RPO A;  2DP8 A;  4H65 A;  5H8Q A;  4QFL A;  2P2A A;  3R7X A;  4FAT A;  3IOU A;  3T96 B;  3SEY A;  3FUZ A;  5A5X B;  2Y7I A;  3TTR A;  1URS A;  3GBA A;  3OO8 A;  1PC3 A;  2NUV A;  4FJP A;  5CM6 A;  4F39 A;  3MVW A;  5I56 A;  1Y3P A;  2F36 A;  2DWJ A;  1N76 A;  2D21 A;  2IEE A;  4FEC A;  3SES A;  2GHA A;  1NL5 A;  1XHY A;  2V84 A;  1B9J A;  4UA8 A;  3T9H B;  1PBQ A;  5HBC A;  4F3S A;  4FAJ A;  3H6W A;  1FTL A;  4M1V A;  2XXI A;  3H4Z A;  4FOR A;  4KCC A;  4TOZ A;  1N84 A;  4ELR A;  3FVG A;  4FE8 A;  2GRV A;  2PT2 A;  3EHT A;  3VE1 B;  1AH5 A;  1N04 A;  4MLV A;  2O1L A;  2I4B A;  3DEL B;  4KFQ A;  4JB7 A;  3H3G A;  3IR1 A;  1Q35 A;  2DQV A;  5JTY B;  4IGT A;  2DOJ A;  1WDN A;  1AMF A;  2O69 A;  3A09 A;  2RC9 A;  3TDJ A;  4EDP A;  5B70 A;  5J1D A;  2ONK E;  1GV8 A;  3VXB A;  4E0W A;  1SBP A;  2F8D A;  3IL1 B;  1Y4T A;  1YPN A;  3JV9 A;  4JBZ A;  2F35 A;  3MJN A;  2I4C A;  3KFM A;  2H4I A;  1B3H A;  4PQJ A;  2FNC A;  4RJZ A;  1AOV A;  1R6Z A;  4FED A;  3FXU A;  1N3X A;  1M5E A;  4X9T A;  2VOZ A;  2UVI A;  4YZZ A;  2A5S A;  3ILT B;  4F31 B;  5L8D A;  4GL0 A;  3TYH A;  1AIV A;  5KCJ A;  5B7D A;  1US4 A;  1MQG A;  4JXI A;  2PVU A;  5M2V A;  1ZTY A;  2F6G A;  1B0H A;  1JQF A;  4OFL A;  1QJM A;  2DYX A;  1A8F A;  3IB1 A;  3QUJ A;  4LZ8 A;  4KD5 A;  3SER A;  1PB9 A;  4QSC A;  2DVZ A;  2QS1 A;  5CMM A;  3KEI A;  3FZV A;  4F19 A;  3RY3 A;  2REJ A;  4EQ9 A;  2YPN A;  3DRG A;  1A8E A;  2CZL A;  4G4P A;  4NED A;  4EXK A;  4IY6 A;  1JW1 A;  5A5X A;  1EZP A;  1H44 A;  3ILU B;  1NMU A;  4R6Y A;  1LAX A;  4OXV A;  1CE2 A;  4U23 A;  2O1M A;  3OMB A;  2LAO A;  1B3F A;  2O84 X;  2UXA A;  3GZG A;  5AA2 A;  2HQ0 A;  1B3E A;  2BJJ X;  5EHM A;  4YKJ A;  1TFA A;  1B3L A;  2UYE A;  3DRI A;  4QF9 A;  4RNS A;  3WAF A;  4MBP A;  3IOT A;  4F1U A;  3T9U A;  4YMB A;  4ZEC A;  5EHS A;  3T9X B;  4NF5 A;  4EF1 A;  1OLA A;  2G93 A;  2XXH A;  3MP6 A;  1DOT A;  4KYS A;  2XXT A;  1D4N A;  4O3B A;  1F9B A;  4YAH X;  1FCK A;  5KZT A;  3O97 A;  3O6I A;  4LAT A;  4Q8R A;  5KCJ B;  1VE4 A;  1H76 A;  1LAF E;  3KN8 A;  2VHA A;  2Y7R A;  1B7H A;  2F34 A;  2OJT A;  2RF1 A;  2Z8D A;  1OLC A;  4ZZA A;  3N94 A;  1DTG A;  1JNF A;  3TTN A;  3FVN A;  3S2V A;  5H8H B;  1JEU A;  3CVG A;  4GXS B;  4H67 A;  3BFT A;  2H98 A;  4ZS9 A;  4QFN A;  1II5 A;  4G68 C;  1PDA A;  1MM7 A;  3OO9 A;  5I59 B;  2X7Q A;  1ATG A;  3C9H A;  4MF3 A;  1B05 A;  5FHO A;  4U22 A;  3VVF A;  1MQI A;  4DXB A;  4QFP A;  1OQG A;  1NNK A;  1MRP A;  4WKM A;  4HW8 A;  1FQF A;  5JK4 A;  3ZKL A;  4YKP A;  3V5A A;  3R26 A;  1D9Y A;  1MXZ A;  1VFD A;  1N7X A;  3IB0 A;  1B3G A;  1S7Y A;  3MZB A;  4OES A;  1QUK A;  1OMP A;  3RQT A;  2VP1 A;  4FEB A;  2UVG A;  1SVX B;  2ZYK A;  3KBR A;  1UIU A;  1DPE A;  2Y7K A;  3M3K A;  3MQ9 A;  3PMV A;  4GQO A;  1MDP 1;  1B1H A;  3PPQ A;  4G77 A;  1XVY A;  1MM6 A;  3QAX A;  4LZ7 A;  1A40 A;  3MZ9 A;  3MAM A;  3TCF A;  4YB5 A;  3IX1 A;  5H8Q B;  3G3H A;  3QSL A;  3C31 A;  1HSJ A;  3K6W A;  3K6V A;  5DVI A;  4ZE8 A;  1IIT A;  1BP5 A;  5DYH A;  2I3V A;  4DDD A;  5I2N A;  3DRF A;  1N0T A;  2XXU A;  4P11 A;  3SEW A;  1SW2 A;  2DE4 A;  3H03 A;  4OET A;  2VD2 A;  4U4X A;  4OWD A;  3ZSF A;  5I56 B;  5I58 A;  3HV1 A;  4F3P A;  3KN7 A;  2UYF A;  2OBG A;  2I6E A;  2ZNU A;  4MH5 A;  3D4G A;  4BDL A;  4EF2 A;  4LVQ A;  4DCX A;  4WED A;  3CSB A;  3LSF B;  1VFE A;  1VSO A;  1NNT A;  5DEX B;  1B52 A;  4R9G A;  2AIX A;  3VLW A;  1BLF A;  1SW4 A;  1I6Q A;  1EH3 A;  2DVC A;  4NMY A;  2E0S A;  3Q25 A;  5I57 B;  4ZEI A;  3OO7 A;  3MP8 A;  4PFU A;  3IK6 B;  5CRY A;  3TOD A;  3SDF A;  4AB5 A;  2D3I A;  1USY H;  5F1Q A;  4BLA A;  1J1N A;  5TP9 B;  2QS3 A;  3M3L A;  3PUX E;  5K2X A;  3RNN A;  1QKB A;  3OXN A;  2I0B A;  2HZL A;  1M5B A;  1ANF A;  2XXY A;  4R6H A;  1SDX A;  3A3U A;  3VV5 A;  5HM4 B;  2PBW A;  3K4U A;  3IO6 A;  3K1M A;  3PU5 A;  4U1O A;  4RK9 A;  1JEV A;  3K1N A;  5JEI A;  2F7C A;  2G29 A;  4RA1 A;  2VGQ A;  5F7V A;  4ONY A;  2V3T A;  4Z0I A;  3KZG A;  2ZNT A;  4NTL A;  5CMC A;  3DP4 A;  5H8F A;  1LLS A;  4G68 B;  1LFI A;  1O7T A;  2THI A;  3K00 A;  4R2B A;  2Z22 A;  4G2Z A;  1R1N A;  4IY5 A;  4LUB A;  4OMB A;  4ZZE A;  3USD A;  5AA4 A;  1ZLQ A;  1ZU0 A;  3FVK A;  4GXA A;  3U72 A;  4YKI A;  3HO7 A;  4PE5 B;  1ZKB A;  2RIN A;  3LVU A;  1PEB A;  1YCJ A;  3M8U A;  1H3D A;  2F78 A;  2F5X A;  1YTV A;  4OEU A;  2Q2A A;  3C34 A;  2NOO A;  3L6H A;  2RKM A;  4C0R A;  4OQO A;  1BIY A;  5HPQ A;  2ALU A;  4THI A;  3LBS A;  3M3F A;  1UTH A;  3EHU A;  4IO7 A;  3PMW A;  3Q28 A;  2DSF A;  1RKM A;  3IAZ A;  1FTO A;  1URD A;  3FXR A;  3UGW A;  3PUY E;  2Y7P A;  5I84 A;  1B58 A;  2Y84 A;  3FGS A;  4YB6 A;  3CFX A;  3FIR A;  2I48 A;  4KCD A;  2I3W A;  3DRH A;  1NH8 A;  2I0C A;  3H7M A;  4U21 A;  2ZYN A;  3PMX A;  3MVY A;  3CG1 A;  1ZIU A;  1VR5 A;  1B7Z A;  2CMO A;  3Q29 A;  3Q27 A;  1USY E;  3SEV A;  1I6B A;  4IO3 A;  4POW A;  3O6P A;  4C1U A;  1DTZ A;  4R72 A;  4BDQ A;  5DVF A;  3H6U A;  1TWY A;  4M4G A;  4JSO A;  4AB6 A;  3O66 A;  4O3A A;  4XKQ A;  4JDF A;  2XXX A;  1OIB A;  3CFL A;  3PGF A;  4BDM A;  1Z7N E;  3K1P A;  4QSE A;  2QRY A;  3ONM A;  4G8N A;  1SQY A;  3DM0 A;  1PB7 A;  3MZ1 A;  4RK2 A;  3TAJ A;  1S50 A;  2W7Y A;  1FQB A;  2F6P A;  1FQA A;  3LUY A;  3TPA A;  4H1X A;  3S9L C;  1MQJ A;  1MY1 A;  3O6G A;  4DLD A;  5H8N A;  3FAS A;  1MS7 A;  1UTB B;  1SW5 A;  3E9X A;  3N6T A;  5ICT A;  3UP9 A;  3OO6 A;  4NF8 A;  2PT1 A;  2XXV A;  3RLF E;  1MY2 A;  4Q30 B;  1R9L A;  5L9O A;  1QUJ A;  4KR5 A;  4R2F A;  5I2N B;  1XVX A;  2QPQ A;  3O28 A;  3AXF A;  4HS7 A;  3QXM A;  3SEX A;  4F29 A;  5AA2 D;  1JVY A;  3DRJ A;  3F11 A;  4GVO A;  1EZO A;  3TTL A;  1H45 A;  5JTY A;  4QFK A;  1Y3N A;  4F2O A;  1QUL A;  2XHD A;  1JW5 A;  1NKX A;  1NNF A;  4GRK A;  1B6H A;  3H6V A;  2XXR A;  3RYA A;  4N6P A;  2HFB A;  1QKA A;  4XKR A;  1YAE A;  4H8I A;  1B4H A;  3FJG A;  4F2Q A;  3MPL A;  3PPP A;  3C36 A;  2YLN A;  3EQ1 A;  5TU0 A;  3VLV A;  4AQ4 A;  3O9P A;  2ZXT A;  1Y1Z A;  3MC2 A;  5TPA A;  3TEL A;  4ZED A;  3W9V A;  3OD7 A;  1R9Q A;  4PFW A;  2ABH A;  3DRK A;  1QUI A;  3CRB A;  4IO6 A; 
#chains in the Genus database with same CATH topology
 4DXC A;  2V3U A;  3N6U A;  5H8F B;  5LOM A;  1EU8 A;  3S9M C;  1MY0 A;  2WBB A;  1KWH A;  1OVB A;  4BDN A;  1Y1M A;  2B3F A;  3IO4 A;  4DI4 B;  3E3K A;  4ECF A;  3H06 B;  2GHB A;  1IXC A;  1DMB A;  1LST A;  2ZNS A;  5ESY A;  3R6U A;  1A54 A;  1B0L A;  3B6W A;  3DP6 A;  2XX7 A;  1FPK A;  1Z7M E;  4YKK A;  1NFT A;  1A55 A;  1IMB A;  2WOK A;  4U1Z A;  1GGG A;  4O7M A;  4XF5 A;  3TCH A;  4I8C A;  1YYZ A;  4AS5 A;  4QRZ A;  2ANJ A;  4N91 A;  2NWJ A;  4ZEK A;  1DSN A;  2XXW A;  1ZJL A;  1UTB A;  2QL3 A;  1M5F A;  4OYV A;  1M5D A;  3IB2 A;  2DE3 A;  1TT1 A;  3L6G A;  3HST A;  2REG A;  4BDO A;  4F22 A;  3VVD A;  3OEL A;  3S9E A;  4PFT A;  5T3J A;  1HSE A;  1D3K A;  3Q26 A;  3K0V A;  3V8X B;  5I2K B;  3B7D A;  1P1Q A;  1VDW A;  3RYB A;  4EXL A;  3K2D A;  4Q0C A;  4QFO A;  2ZZV A;  1G0I A;  5H8N B;  1FW0 A;  1P99 A;  1HSL A;  2ONR A;  2R6G E;  3TKD A;  3HHG A;  3EKI A;  1MPC A;  5CBS A;  1IEJ A;  1OVT A;  4UAB A;  3TQW A;  1Y4C A;  2XXQ A;  4ELQ A;  1DBZ A;  2OLB A;  5IZZ A;  3H6T A;  1PB8 A;  1QGX A;  1O64 A;  3NOH A;  2DE2 A;  4ZEB A;  5CMB A;  1RYX A;  5CMK A;  1LBZ A;  4RXL A;  2QVV A;  1LB8 A;  4R73 A;  1IQ7 A;  4HCY A;  4X48 A;  3ZKK A;  3SEU A;  4ZE9 A;  5FTI A;  1NNP A;  3O29 A;  2V93 A;  3LSW A;  1FBC A;  2XWV A;  4XFE A;  1A7L A;  4FIM A;  4IO5 A;  4YMA A;  1I6A A;  2OZZ A;  1POY 1;  2Q8J A;  4OFJ A;  1SW1 A;  1B5H A;  5ICQ A;  1BK4 A;  1UIV A;  1Q9D A;  1B40 A;  3FV2 A;  4GWZ A;  3IJX B;  1YXI A;  4EUO A;  3OSQ A;  3MP1 A;  4NF4 A;  4FEC A;  4XKP A;  1H43 A;  2GH9 A;  1P1U A;  5I7I A;  1K9Y A;  2O7I A;  2RC8 A;  3RTF B;  5ISU A;  4ESW A;  2P1S A;  4GWU A;  4JWY A;  3RTW B;  4UAC A;  1LBC A;  4H6D A;  3BFU A;  1FTM A;  4N81 A;  5H8S A;  1US5 A;  1LB9 A;  3IOW A;  2H99 A;  2DXR A;  2QJE A;  4JWO A;  4OVT A;  3MWB A;  4H65 A;  5EQA A;  2P2A A;  4FAT A;  3TTR A;  5EQ8 A;  2D21 A;  5ET8 A;  1NL5 A;  1XHY A;  4UA8 A;  1B9J A;  3H6W A;  1KA0 A;  3H4Z A;  4FOR A;  1N84 A;  1FRP A;  4N15 A;  1N04 A;  2O1L A;  2VPO A;  4JB7 A;  1Q35 A;  2DOJ A;  4OVQ A;  4E0W A;  3IL1 B;  1Y4T A;  1YPN A;  4P56 A;  2I4C A;  4PC9 A;  2FNC A;  1AOV A;  1R6Z A;  1M5E A;  2CEY A;  2VOZ A;  4YZZ A;  3U65 A;  2A5S A;  5L8D A;  4GL0 A;  1MQG A;  4HE0 A;  5M2V A;  4LZ8 A;  1JQF A;  1A8F A;  4QSC A;  2REJ A;  1JW1 A;  5A5X A;  4OXV A;  1CE2 A;  4U23 A;  1B3F A;  2UXA A;  2BJJ X;  2UYE A;  3IOT A;  4ZEC A;  4NF5 A;  4YAH X;  3KN8 A;  4ZZA A;  4H46 A;  3TTN A;  1JNF A;  3S2V A;  4ZS9 A;  2X7Q A;  5FHO A;  1CNQ A;  1NNK A;  3MYU A;  1N7X A;  3IB0 A;  2VP1 A;  1UIU A;  4G77 A;  1A40 A;  3KC1 A;  5H8Q B;  3KC0 A;  3QSL A;  4DDD A;  4P1E A;  2DE4 A;  5I56 B;  4F3P A;  3KN7 A;  4BDL A;  5EQ7 A;  4EF2 A;  4DCX A;  3CSB A;  2F3B A;  1I6Q A;  1EH3 A;  3MP8 A;  4PFU A;  4P3L A;  5CRY A;  3SDF A;  4AB5 A;  1USY H;  5F1Q A;  5K2X A;  1QKB A;  1ANF A;  3VV5 A;  3A3U A;  4U1O A;  3K1N A;  5JEI A;  4RA1 A;  5F7V A;  1LFI A;  3K00 A;  4R2B A;  4IY5 A;  4QBA A;  2RIN A;  3LVU A;  1PEB A;  4HE1 A;  4C0R A;  3LBS A;  3M3F A;  4IO7 A;  2DSF A;  1RKM A;  3IAZ A;  1B58 A;  4YB6 A;  3FIR A;  4LN5 A;  4U21 A;  1ZIU A;  2CMO A;  1DTZ A;  4OVR A;  4R72 A;  5DVF A;  4M4G A;  4MAG A;  4GBW A;  4JDF A;  3CFL A;  4BDM A;  4HE2 A;  3K1P A;  4QSE A;  2QRY A;  1PB7 A;  2F6P A;  1FQA A;  3LUY A;  3TPA A;  3FAS A;  1UTB B;  1SW5 A;  3OO6 A;  1RDX A;  1R9L A;  5L9O A;  4HS7 A;  3QXM A;  3DRJ A;  4GVO A;  5JTY A;  4QFK A;  1Y3N A;  1NKX A;  2FIE A;  3H6V A;  2XXR A;  3RYA A;  1QKA A;  4H8I A;  1YAE A;  3MPL A;  3PPP A;  5TU0 A;  3EQ1 A;  4MX6 A;  1Y1Z A;  4O94 A;  2ABH A;  1QUI A;  4ELP A;  2GFE A;  1TFD A;  4MIJ A;  5A5L A;  3RN8 A;  3W9W A;  1LGB C;  3KGC A;  1Y9U A;  4H0W A;  2ESN A;  2RCA A;  4YB7 A;  4P0I A;  1XC1 A;  3FJM A;  1FJ6 A;  5AE4 A;  3FV1 A;  2ZYM A;  4H5G A;  1IUD A;  4OHN A;  3C33 A;  3IFA A;  3PPN A;  2Y7W A;  4MNP A;  2H25 A;  2NVU B;  2P0S A;  2OCU A;  4GD5 A;  4XKN A;  4H5F A;  4P8B A;  4P9K A;  1IMC A;  4C1T A;  5FHN A;  5CI5 A;  4HTG A;  3U93 A;  2PYY A;  3OOA A;  4G68 A;  5L9S A;  1JET A;  5AA1 A;  1FBF A;  1A99 A;  1FTK A;  2Q89 A;  2ZZW A;  3UK4 A;  4PCD A;  1MQD A;  4PFB A;  4I9D A;  4GL8 A;  1LEV A;  3B6Q A;  3RT6 B;  2PMS A;  2HAV A;  2F97 A;  3N5L A;  3T22 A;  1LBV A;  1L5T A;  2X26 A;  4WXJ A;  4XEQ A;  2Q88 A;  2V3Q A;  3TTM A;  3D1R A;  4NG7 A;  1Y3Q A;  3TTK A;  4IGR A;  4OZ9 A;  4TLM B;  4PF8 A;  1XS5 A;  1NUW A;  3U92 A;  2Q2C A;  2UVH A;  2B3B A;  5EYF A;  1MH4 A;  3LC8 A;  1NV3 A;  4X1D A;  1FPB A;  2KLF A;  3QK6 A;  1LCF A;  4PP0 A;  1XT8 A;  5DT6 A;  2XWO A;  3EN3 A;  5LDZ A;  2ONS A;  2HPG A;  3C35 A;  2VD3 A;  4F2O A;  2E1S A;  3VDF A;  3UA8 A;  4NF6 A;  1MG1 A;  4LQ5 A;  2HAU A;  4N6D A;  5DVJ A;  5BUU A;  3MBP A;  2KQZ A;  4IB2 A;  1NV6 A;  1MPD A;  1GTK A;  3KOT A;  3PUZ E;  4PBH A;  5LTC A;  4ELO A;  4R9F A;  2WKY A;  4GX4 A;  4F3G A;  3E4R A;  3G3F A;  3HCQ A;  2XX8 A;  2Q9T A;  3K02 A;  2I58 A;  4JVD A;  1MXU A;  4XTC Q;  5ELV A;  3CHG A;  3PTY A;  2A5T B;  3KSJ A;  5K2Y A;  4X1B A;  3UIF A;  5FHM A;  1B4Z A;  3G3K A;  4GWO A;  3RPW A;  1MXV A;  1P1O A;  1LAH E;  2XWK A;  4DE8 A;  2QVR A;  2DDK A;  2QS4 A;  4TQU Q;  2DP8 A;  5H8Q A;  4QFL A;  3T96 B;  2Y7I A;  3GBA A;  3A29 A;  1Y3P A;  1N76 A;  2IEE A;  3SES A;  3T9H B;  1PBQ A;  4F3S A;  4PTK A;  1FTL A;  2XXI A;  4N6K A;  4KCC A;  4ELR A;  4TOZ A;  3EHT A;  1AH5 A;  2I4B A;  2FBP A;  3RYD A;  3RPL A;  2DQV A;  2O69 A;  3VXB A;  2F8D A;  1D9Q A;  2F35 A;  4RJZ A;  5EQ9 A;  1N3X A;  4F31 B;  3TYH A;  5B7D A;  2F6G A;  1B0H A;  4OFL A;  1FBG A;  1QJM A;  3IB1 A;  3QUJ A;  3KEI A;  4F19 A;  2F3D A;  2Q8M A;  1NMU A;  4R6Y A;  1LAX A;  2O84 X;  5EHM A;  3B8B A;  3DRI A;  4HXV A;  4F1U A;  3T9U A;  4YMB A;  4OVP A;  4EF1 A;  1OLA A;  3T9V A;  1D4N A;  4X04 A;  1F9B A;  1FCK A;  4Q8R A;  3O6I A;  5ET5 A;  1B7H A;  2OJT A;  4FBP A;  3CVG A;  2H98 A;  4GWY A;  1MM7 A;  1FPG A;  1FBP A;  4MF3 A;  5IZ3 A;  3VVF A;  4GX6 A;  4WKM A;  2R8T A;  4GBV A;  3R26 A;  2WX9 A;  1S7Y A;  3MZB A;  3RQT A;  5ET6 A;  4GQO A;  1MDP 1;  4LZ7 A;  1MM6 A;  3QAX A;  3IX1 A;  4ZE8 A;  1BP5 A;  5DYH A;  2I3V A;  1N0T A;  1NUX A;  3SEW A;  3ZSF A;  3H03 A;  4P47 A;  2I6E A;  2ZNU A;  4MH5 A;  4WED A;  2WEF A;  1NNT A;  2AIX A;  3VLW A;  1BLF A;  1NV4 A;  4NMY A;  2E0S A;  2CZH A;  5I57 B;  4ZEI A;  4MJO A;  5TP9 B;  3PUX E;  2HZL A;  1M5B A;  4R6H A;  1SDX A;  3IO6 A;  2VGQ A;  4ONY A;  3KZG A;  5H8F A;  2WYP A;  1LLS A;  4G68 B;  1O7T A;  1JP4 A;  2Z22 A;  1R1N A;  4ZZE A;  4GXA A;  3U72 A;  1ZKB A;  1H3D A;  3C34 A;  3KBZ A;  2RKM A;  1BIY A;  1FBE A;  3FXR A;  3PUY E;  2Y84 A;  3FGS A;  2I48 A;  4KCD A;  3DRH A;  4MEV A;  2ZYN A;  3PMX A;  3SEV A;  4C1U A;  4POW A;  3LV0 A;  1TWY A;  4JSO A;  4AB6 A;  3O66 A;  4O3A A;  3DM0 A;  1NV2 A;  3S9L C;  1MY1 A;  4DLD A;  2HHM A;  1MS7 A;  4JVI A;  2WYK A;  2PT1 A;  1AWB A;  4R2F A;  2P3V A;  4F29 A;  5AA2 D;  3TTL A;  1QUL A;  1NNF A;  4XKR A;  3FJG A;  3C36 A;  2YLN A;  1NV1 A;  4AQ4 A;  4N8Y A;  1YZ0 A;  3CRB A;  1GVC A;  3FXQ A;  3VLU A;  4YIC A;  3U8Q A;  1FQC A;  5FTH A;  2F7B A;  4BDR A;  4DCY A;  1S9T A;  3S9N C;  1FPI A;  5KDT A;  4F1Y A;  4OVJ A;  4NHB A;  1SD3 A;  3IOR A;  3UOR A;  4KI0 E;  1ELJ A;  1UTH B;  3JZJ A;  2F7A A;  3RUM A;  3GLB A;  4O8M A;  4POX A;  5L9M A;  3HPI A;  1LCT A;  1ZMG A;  3A3C A;  4XXU A;  4L17 A;  2Z8F A;  4G8M A;  3V89 B;  3LSX A;  3QYT A;  2RCB A;  5ITO A;  1P1N A;  1DCU A;  3MVX A;  1B5I A;  3ZS6 A;  2O51 A;  5KDT B;  3OSR A;  4MHF A;  1DPP A;  4ISU A;  4HCW A;  3EF7 A;  1KA1 A;  4NE4 A;  5I59 A;  1MDQ A;  4LQ2 A;  3FAT A;  3EPE A;  3PV0 E;  2DXY A;  1I69 A;  1LFH A;  3BKI B;  4EQB A;  4OVS A;  1LFG A;  5J16 A;  4GWS A;  4OEV A;  3ROJ A;  3U94 A;  3KJ7 A;  1N7W A;  3THI A;  5DW8 A;  2XXK A;  4F1V A;  5AA3 A;  1NV5 A;  3HN0 A;  2JJK A;  4WEP A;  1GR2 A;  5I57 A;  4R74 A;  1JVX A;  1FTA A;  4OEN A;  2QSX A;  1EYI A;  5I5P A;  2GQ1 A;  1SYH A;  4OFO A;  1IXG A;  3T93 B;  3LUZ A;  4O3C A;  2ZYO A;  3CI8 A;  2PX1 A;  3GXA A;  3LSL A;  4P0G A;  3FXB A;  3OEN A;  3FTO A;  2Z8E A;  4KYE A;  3JYR A;  1G0H A;  4EQ7 A;  5AA2 B;  1MXW A;  1AL3 A;  1SI0 A;  1EZ9 A;  4I40 A;  1LBB A;  3C4M A;  3E79 A;  4PBQ A;  3T66 A;  3DP8 A;  3TCG A;  4F18 A;  2AL5 A;  3TFL A;  4NF5 B;  5IZ1 A;  1K9Z A;  3TQL A;  1BTJ A;  2B4M A;  2H9B A;  2I49 A;  3MST A;  3OEM A;  1XOC A;  2ZMB A;  1JW4 A;  3EHS A;  2FYI A;  1B7U A;  4GIZ A;  1QVS A;  4GWW A;  2PCR A;  4YU0 A;  4NWD A;  4DIG A;  2V25 A;  4XIG Q;  5CC2 A;  4KYD A;  4N8G A;  1URG A;  3PD8 A;  1O63 A;  3PAM A;  5DEX A;  3B6T A;  4P1L A;  4PET A;  1SI1 A;  3KJT A;  4LZ5 A;  4I62 A;  5H8H A;  3UN6 A;  2B65 A;  1UQW A;  4RPN A;  4GF8 A;  4NF8 B;  4PDD A;  5I2N B;  1CB6 A;  1PBP A;  3PUW E;  5DTB A;  4KQP A;  1MQH A;  3RT8 A;  2DWH A;  4G8H A;  2DWI A;  3ODB A;  4QSD A;  1FQD A;  4GX3 A;  3VVE A;  1WOD A;  1M5C A;  4GOT A;  4IO2 A;  1EYJ A;  3QUF A;  1LAG E;  1IXH A;  2HXW A;  2WOP A;  4RPO A;  3ISP A;  3R7X A;  3FUZ A;  5A5X B;  4GWX A;  1URS A;  4FJP A;  4X8R A;  3MVW A;  2F36 A;  1NUY A;  2GHA A;  4FAJ A;  4MCO A;  4FE8 A;  2PT2 A;  4MLV A;  3IR1 A;  1FPD A;  5JTY B;  3A09 A;  2RC9 A;  3TDJ A;  5B70 A;  1NV0 A;  2ONK E;  1SBP A;  3MJN A;  2H4I A;  1B3H A;  4FED A;  4X9T A;  2XA5 A;  2UVI A;  2Q74 A;  1AIV A;  5KCJ A;  1US4 A;  4JXI A;  3SZP A;  1ZTY A;  2DYX A;  3SER A;  4NAP A;  4KD5 A;  1PB9 A;  4KXP A;  2DVZ A;  2QS1 A;  5CMM A;  3FZV A;  3RY3 A;  4EQ9 A;  3DRG A;  4NED A;  4IY6 A;  1EZP A;  1H44 A;  3ILU B;  2QVU A;  3OMB A;  2Y5K A;  3GZG A;  5AA2 A;  2HQ0 A;  1B3E A;  4YKJ A;  4DI3 D;  1EYK A;  4QF9 A;  3WAF A;  4MBP A;  3E78 A;  2XXH A;  3MP6 A;  1DOT A;  4KYS A;  4O3B A;  5KZT A;  3O97 A;  1VE4 A;  1H76 A;  1LAF E;  2Y7R A;  2F34 A;  2Z8D A;  1OLC A;  1NUZ A;  3N94 A;  1DTG A;  5H8H B;  4GXS B;  1PDA A;  3OO9 A;  1ATG A;  4U22 A;  1MQI A;  4DXB A;  1FQF A;  5JK4 A;  3ZKL A;  3V5A A;  1VFD A;  1B3G A;  2ZZX A;  1OMP A;  3KBR A;  1SVX B;  2ZYK A;  3M3K A;  1DPE A;  2Y7K A;  3MQ9 A;  4PE3 A;  1B1H A;  3PPQ A;  1RDY A;  3MZ9 A;  1FPF A;  3T0J A;  3TCF A;  4YB5 A;  3G3H A;  1HSJ A;  3K6W A;  5DVI A;  1IIT A;  5I2N A;  3DRF A;  4P11 A;  4U4X A;  4OET A;  2VD2 A;  4OWD A;  5I58 A;  3HV1 A;  2OBG A;  3D4G A;  4LVQ A;  1VSO A;  2P3N A;  5DEX B;  5I3S A;  3OO7 A;  3TOD A;  1J1N A;  1INP A;  4H45 A;  3RNN A;  2I0B A;  2XXY A;  5HM4 B;  2PBW A;  3K4U A;  3PU5 A;  3K1M A;  4MNI A;  1JEV A;  4RK9 A;  2HXR A;  4NGU A;  2G29 A;  2V3T A;  4NTL A;  5CMC A;  3DP4 A;  5AA4 A;  4G2Z A;  3USD A;  1ZLQ A;  4YKI A;  1YCJ A;  3M8U A;  3L6H A;  4OQO A;  2ALU A;  1UTH A;  2VT5 A;  3EHU A;  1FPE A;  3Q28 A;  1FTO A;  2Y7P A;  3RPL B;  5I84 A;  3CFX A;  1NH8 A;  2I0C A;  1USY E;  1I6B A;  3H6U A;  4XKQ A;  3PGF A;  1OIB A;  4G8N A;  1SQY A;  3MZ1 A;  3TAJ A;  2W7Y A;  4H1X A;  3N6T A;  5ICT A;  2XXV A;  1FSA A;  3AXF A;  3SEX A;  1JVY A;  4NN3 A;  1EZO A;  2CZK A;  1JW5 A;  4GRK A;  1B6H A;  1B4H A;  3VLV A;  3O9P A;  3B50 A;  3TEL A;  3W9V A;  2FHY A;  3OD7 A;  1R9Q A;  3DRK A;  1LBX A;  4Q5T A;  4IO6 A;  1FQE A;  2Y5L A;  3FJ7 A;  3W15 C;  5BWJ A;  1IME A;  3K01 A;  3N26 A;  5IM2 A;  1XI6 A;  4KHZ E;  5IGA A;  2OWT A;  4N13 A;  4LA9 A;  1P1W A;  3U1O A;  2DS9 A;  3I6V A;  3VFJ A;  2AYS A;  1MY4 A;  1FTJ A;  2RC7 A;  4MFI A;  1ZBM A;  4NF6 B;  5I2K A;  2M8C A;  3WAE A;  1OQH A;  5J1D A;  4OER A;  2AL4 A;  4R75 A;  3OEK A;  3CR9 A;  4N4U A;  2FIX A;  2O68 A;  3KOS A;  3RGY A;  3G7W A;  4I1D A;  3MUQ A;  4PFI A;  4MLQ A;  4NF4 B;  3C32 A;  5TPA B;  3T1B A;  3FVO A;  1SYI A;  1IXI A;  2IA4 A;  3HHF A;  3IOV A;  3K6U A;  4RY1 A;  3DLN A;  1MXY A;  3S4U A;  3SKP A;  3CIJ A;  1QW0 A;  3MPK A;  1B2H A;  4OTE A;  4OA4 A;  2PFZ A;  1IZ1 A;  3O2A A;  2CZI A;  3CFZ A;  1SPI A;  2UVJ A;  3K6X A;  3IJO B;  3KG2 A;  1TXF A;  3TEP A;  4DXU A;  4RYA A;  2OWS A;  3HFU A;  1B32 A;  1NV7 A;  4U4S A;  1B51 A;  3PD9 A;  5IAI A;  1NH7 A;  4ESX A;  1T0K A;  4H8J A;  3BBR A;  3QMF A;  3TMG A;  3PPR A;  4OAN A;  1MXX A;  1MH3 A;  3KN3 A;  4JSD A;  3G3G A;  1FPL A;  2PFY A;  2D5W A;  4F3B A;  3CG3 A;  3D4C A;  1B46 A;  5F24 A;  5TP9 A;  2HZK A;  4NQ8 A;  4KPT A;  1IMD A;  2QMW A;  3QIM A;  2HEU A;  4U2R A;  1FJ9 A;  4PAF A;  5ITP A;  1IMA A;  2YJP A;  2B4L A;  4ZEF A;  4N07 A;  2MKZ A;  2WOL A;  5I58 B;  1B1X A;  2XWI A;  3FD3 A;  2H5Y A;  4GLI A;  4NF0 A;  3ECR A;  4QHQ A;  4TLL B;  3TZA A;  3KSX A;  3I3V A;  1Q1K A;  1MPB A;  2DWA A;  2WBD A;  4LON B;  3VXC A;  4LP2 B;  1POT A;  4E0X A;  1Y20 A;  1N3W A;  3TUS A;  4IO4 A;  4PDH A;  2X7P A;  4JVC A;  4ND9 A;  3MVZ A;  3V83 A;  2CEX A;  2XXP A;  5EYG A;  3MW0 A;  1FBH A;  4N17 A;  1B5J A;  2NXO A;  3G3J A;  2OK2 A;  3FBP A;  5IZ3 B;  2R9J A;  5AA4 B;  2FA7 A;  2R71 A;  4I3E A;  3PUV E;  3E13 X;  3I5O A;  3CSG A;  2XD2 A;  2XD3 A;  4DZ1 A;  4PFY A;  1D9V A;  3O6H A;  4Z7E A;  3G3I A;  1BKA A;  2XX9 A;  2O6A A;  4GFR A;  3SET A;  1IIW A;  1MY3 A;  1WVJ A;  2QS2 A;  2V4C A;  4JWX A;  4NWC A;  3GBB A;  2HCA A;  4PFR A;  1KZ8 A;  1RYO A;  5IKB A;  3PPO A;  4K3F A;  2A5T A;  2QMX A;  2O7U A;  4ZDM A;  3P7I A;  4AS4 A;  4R6K A;  2Z23 A;  1LBY A;  3LR1 A;  3IOU A;  3SEY A;  3OO8 A;  1PC3 A;  2NUV A;  5CM6 A;  4F39 A;  5I56 A;  2DWJ A;  3BIH A;  4PAI A;  2V84 A;  5HBC A;  4M1V A;  2OX3 A;  4PGP A;  3FVG A;  2GRV A;  3VE1 B;  3DEL B;  4KFQ A;  3H3G A;  3GYY A;  4IGT A;  4MNC A;  1WDN A;  1AMF A;  4EDP A;  1GV8 A;  1RDZ A;  3JV9 A;  4JBZ A;  3KFM A;  4PQJ A;  4MMP A;  3FXU A;  3ILT B;  5EYH A;  2PVU A;  4PGN A;  2YPN A;  1A8E A;  2CZL A;  4EXK A;  4G4P A;  1DK4 A;  2O1M A;  2LAO A;  2OWZ A;  1TFA A;  1B3L A;  4RNS A;  3IFC A;  4PF6 A;  5EHS A;  3T9X B;  2G93 A;  2XXT A;  4LAT A;  5KCJ B;  2VHA A;  2RF1 A;  3FVN A;  1JEU A;  4H67 A;  3BFT A;  4QFN A;  1II5 A;  4G68 C;  5I59 B;  3C9H A;  1B05 A;  4QFP A;  1OQG A;  4IR8 A;  1MRP A;  4HW8 A;  4YKP A;  1D9Y A;  1MXZ A;  4OES A;  1QUK A;  4FEB A;  2UVG A;  3PMV A;  2QFL A;  1XVY A;  3MAM A;  1NI9 A;  3C31 A;  4PAK A;  3K6V A;  4NX1 A;  2XXU A;  1SW2 A;  2UYF A;  3LSF B;  1VFE A;  1B52 A;  4R9G A;  1FBD A;  1SW4 A;  5ET7 A;  2DVC A;  3Q25 A;  3IK6 B;  4O7I A;  2D3I A;  4BLA A;  2QS3 A;  3M3L A;  3OXN A;  2F7C A;  4Z0I A;  2ZNT A;  2THI A;  4LUB A;  4OMB A;  1ZU0 A;  3FVK A;  1FPJ A;  3HO7 A;  1IMF A;  4PE5 B;  5FBP A;  2F78 A;  2Q2A A;  2F5X A;  1YTV A;  4OEU A;  5CBR A;  2NOO A;  5HPQ A;  4THI A;  4QXD A;  3PMW A;  3UGW A;  1URD A;  4G61 A;  2I3W A;  3H7M A;  3MVY A;  3CG1 A;  3Q27 A;  1VR5 A;  1B7Z A;  3Q29 A;  4IO3 A;  3O6P A;  1LBW A;  4BDQ A;  2VPN A;  2XXX A;  1Z7N E;  3ONM A;  4RK2 A;  1S50 A;  1FQB A;  1MQJ A;  3O6G A;  5H8N A;  3BIG A;  3E9X A;  3UP9 A;  4I3Y A;  4NF8 A;  3RLF E;  1MY2 A;  4Q30 B;  1QUJ A;  4KR5 A;  1XVX A;  2QPQ A;  3O28 A;  2BJI A;  3F11 A;  1H45 A;  2XHD A;  2FVZ A;  4N6P A;  2HFB A;  4F2Q A;  2L5V A;  2ZXT A;  3MC2 A;  5TPA A;  4ZED A;  2KR0 A;  4PFW A; 
#chains in the Genus database with same CATH homology
 1FQE A;  4DXC A;  2V3U A;  4ELP A;  3N6U A;  5H8F B;  3FJ7 A;  3FXQ A;  1EU8 A;  3VLU A;  5LOM A;  3W15 C;  4YIC A;  3U8Q A;  1FQC A;  5FTH A;  5BWJ A;  3S9M C;  1MY0 A;  3K01 A;  2F7B A;  1TFD A;  2GFE A;  3N26 A;  4KHZ E;  4BDR A;  2OWT A;  1KWH A;  4N13 A;  1OVB A;  4BDN A;  4DCY A;  1Y1M A;  4LA9 A;  2B3F A;  3IO4 A;  3RN8 A;  1P1W A;  1S9T A;  3W9W A;  3S9N C;  3U1O A;  1LGB C;  3KGC A;  1Y9U A;  3E3K A;  4ECF A;  3H06 B;  2GHB A;  1IXC A;  1DMB A;  5KDT A;  4H0W A;  2ESN A;  1LST A;  2DS9 A;  2RCA A;  4OVJ A;  2ZNS A;  4F1Y A;  3R6U A;  1SD3 A;  4YB7 A;  3IOR A;  3I6V A;  3VFJ A;  1A54 A;  2AYS A;  1MY4 A;  1FTJ A;  1XC1 A;  4P0I A;  1B0L A;  2RC7 A;  3B6W A;  4KI0 E;  4MFI A;  3UOR A;  1ZBM A;  1ELJ A;  3FJM A;  4NF6 B;  1UTH B;  3JZJ A;  5AE4 A;  5I2K A;  2M8C A;  3WAE A;  1OQH A;  2F7A A;  2ZYM A;  3FV1 A;  4OER A;  3GLB A;  4H5G A;  4POX A;  3DP6 A;  3RUM A;  4PET A;  1IUD A;  2AL4 A;  2XX7 A;  4R75 A;  4OHN A;  5L9M A;  3HPI A;  3OEK A;  1LCT A;  3C33 A;  3CR9 A;  1Z7M E;  4YKK A;  1ZMG A;  3PPN A;  2Y7W A;  3A3C A;  4XXU A;  1NFT A;  4L17 A;  2H25 A;  1A55 A;  2NVU B;  2O68 A;  2P0S A;  2Z8F A;  2WOK A;  2OCU A;  4G8M A;  3KOS A;  4U1Z A;  3RGY A;  1GGG A;  3G7W A;  4I1D A;  3MUQ A;  4GD5 A;  3V89 B;  3LSX A;  4MLQ A;  4NF4 B;  3QYT A;  3TCH A;  2RCB A;  3C32 A;  5ITO A;  4XKN A;  4H5F A;  4I8C A;  1P1N A;  5TPA B;  3FVO A;  1SYI A;  1IXI A;  2IA4 A;  3MVX A;  3UIF A;  1B5I A;  3ZS6 A;  2O51 A;  3T9V A;  5KDT B;  3HHF A;  3OSR A;  4QRZ A;  2ANJ A;  4C1T A;  3IOV A;  1DPP A;  3K6U A;  4ISU A;  5FHN A;  2NWJ A;  4ZEK A;  1DSN A;  2XXW A;  4HCW A;  5CI5 A;  4HTG A;  3EF7 A;  1ZJL A;  1UTB A;  2QL3 A;  4NE4 A;  3U93 A;  1M5F A;  4OYV A;  4RY1 A;  2PYY A;  3OOA A;  1M5D A;  3DLN A;  5I59 A;  3IB2 A;  4G68 A;  2DE3 A;  5L9S A;  1JET A;  1MXY A;  1TT1 A;  1MDQ A;  3L6G A;  3S4U A;  3SKP A;  3HST A;  3CIJ A;  5AA1 A;  1QW0 A;  2REG A;  1A99 A;  3MPK A;  4BDO A;  4F22 A;  1FTK A;  4LQ2 A;  1B2H A;  2Q89 A;  4OTE A;  3FAT A;  3VVD A;  3EPE A;  3PV0 E;  2DXY A;  1I69 A;  1LFH A;  3BKI B;  3OEL A;  3UK4 A;  4EQB A;  1LFG A;  1IZ1 A;  3O2A A;  3S9E A;  4PFT A;  3CFZ A;  1MQD A;  4OEV A;  2UVJ A;  1HSE A;  3U94 A;  3K6X A;  1D3K A;  3KJ7 A;  3Q26 A;  1N7W A;  3THI A;  3K0V A;  3V8X B;  3IJO B;  3KG2 A;  5I2K B;  3B7D A;  4I9D A;  4GL8 A;  1TXF A;  3B6Q A;  3TEP A;  3RT6 B;  4DXU A;  4F1V A;  4RYA A;  2OWS A;  2PMS A;  4Q5T A;  1P1Q A;  1B32 A;  5AA3 A;  3HN0 A;  2HAV A;  3RYB A;  2F97 A;  3N5L A;  1GR2 A;  3K2D A;  4WEP A;  4EXL A;  3T22 A;  5CBR A;  5I57 A;  4U4S A;  1L5T A;  5AA4 B;  4Q0C A;  4R74 A;  1B51 A;  1JVX A;  3PD9 A;  4QFO A;  2X26 A;  4OEN A;  4WXJ A;  2QSX A;  1NH7 A;  5IAI A;  4ESX A;  1T0K A;  4H8J A;  5H8N B;  1FW0 A;  3BBR A;  1P99 A;  1HSL A;  2ONR A;  2R6G E;  3TKD A;  3TMG A;  3HHG A;  2Q88 A;  3PPR A;  2V3Q A;  1MXX A;  1MH3 A;  1MPC A;  3TTM A;  5CBS A;  1SYH A;  4OFO A;  1IXG A;  3KN3 A;  1IEJ A;  3T93 B;  4O3C A;  1OVT A;  4JSD A;  3G3G A;  3TQW A;  2ZYO A;  1Y3Q A;  1Y4C A;  2XXQ A;  3CI8 A;  3TTK A;  4ELQ A;  2PX1 A;  2D5W A;  3GXA A;  4IGR A;  3CG3 A;  3D4C A;  4OZ9 A;  1B46 A;  2OLB A;  4F3B A;  3LSL A;  4TLM B;  3H6T A;  5TP9 A;  2HZK A;  1PB8 A;  4P0G A;  1O64 A;  3OEN A;  3FTO A;  1XS5 A;  2Z8E A;  4KPT A;  4KYE A;  3JYR A;  3U92 A;  2QMW A;  3QIM A;  2DE2 A;  2HEU A;  2Q2C A;  2B3B A;  4ZEB A;  2UVH A;  4U2R A;  1RYX A;  5CMB A;  4EQ7 A;  5EYF A;  1MH4 A;  5CMK A;  3LC8 A;  4RXL A;  5ITP A;  5AA2 B;  4R73 A;  1LB8 A;  1AL3 A;  1MXW A;  1SI0 A;  4X1D A;  1GVC A;  2KLF A;  2YJP A;  1EZ9 A;  1IQ7 A;  2B4L A;  4ZEF A;  4N07 A;  3QK6 A;  4HCY A;  1LBB A;  4X48 A;  2WOL A;  3C4M A;  3ZKK A;  3T66 A;  1LCF A;  1B1X A;  4PP0 A;  3SEU A;  5I58 B;  1XT8 A;  4ZE9 A;  3FD3 A;  1NNP A;  5FTI A;  3DP8 A;  3O29 A;  5DT6 A;  3TCG A;  2H5Y A;  2V93 A;  3EN3 A;  4GLI A;  4F18 A;  3ECR A;  3LSW A;  4QHQ A;  2AL5 A;  2ONS A;  4TLL B;  3TFL A;  3TZA A;  3KSX A;  3C35 A;  3I3V A;  1Q1K A;  2VD3 A;  4NF5 B;  1A7L A;  1MPB A;  2DWA A;  4LON B;  3TQL A;  1BTJ A;  4FIM A;  2B4M A;  1I6A A;  2E1S A;  2OZZ A;  2H9B A;  4IO5 A;  4YMA A;  1POY 1;  2I49 A;  4LP2 B;  2Q8J A;  4OFJ A;  3UA8 A;  3VDF A;  3VXC A;  1SW1 A;  3OEM A;  1POT A;  4NF6 A;  1MG1 A;  4E0X A;  1XOC A;  2ZMB A;  4LQ5 A;  1JW4 A;  1B5H A;  3EHS A;  1Y20 A;  2HAU A;  2FYI A;  1N3W A;  1B7U A;  3TUS A;  4IO4 A;  5ICQ A;  1QVS A;  2X7P A;  4GIZ A;  4ND9 A;  5DVJ A;  1UIV A;  4YU0 A;  3MVZ A;  5BUU A;  1B40 A;  4NWD A;  3V83 A;  3MBP A;  2XXP A;  4IB2 A;  3MW0 A;  1MPD A;  1GTK A;  2V25 A;  3KOT A;  4DIG A;  3PUZ E;  4XIG Q;  5CC2 A;  1B5J A;  2NXO A;  4ELO A;  3FV2 A;  4KYD A;  1URG A;  3IJX B;  4R9F A;  2WKY A;  3PD8 A;  4F3G A;  1O63 A;  3G3J A;  3E4R A;  2OK2 A;  3PAM A;  5DEX A;  3B6T A;  4EUO A;  3OSQ A;  3MP1 A;  4NF4 A;  2R9J A;  1SI1 A;  2FA7 A;  3G3F A;  4XKP A;  1H43 A;  3HCQ A;  2R71 A;  2GH9 A;  2Q9T A;  2XX8 A;  1P1U A;  3K02 A;  3KJT A;  4LZ5 A;  2O7I A;  2I58 A;  3PUV E;  3E13 X;  4I62 A;  3I5O A;  1MXU A;  3CSG A;  5H8H A;  3UN6 A;  2XD2 A;  2XD3 A;  4DZ1 A;  2B65 A;  2RC8 A;  4PFY A;  1UQW A;  4RPN A;  4GF8 A;  4NF8 B;  5ISU A;  3RTF B;  4ESW A;  1D9V A;  1CB6 A;  2P1S A;  3O6H A;  4JWY A;  3G3I A;  3RTW B;  1PBP A;  4UAC A;  1BKA A;  2XX9 A;  2O6A A;  3PUW E;  4Z7E A;  1LBC A;  4GFR A;  4H6D A;  5DTB A;  3SET A;  3BFU A;  1IIW A;  1FTM A;  1MY3 A;  4XTC Q;  5ELV A;  4KQP A;  1WVJ A;  1MQH A;  3RT8 A;  3CHG A;  2QS2 A;  2DWH A;  4JWX A;  4NWC A;  3GBB A;  2HCA A;  1RYO A;  4G8H A;  2A5T B;  3PPO A;  5IKB A;  5H8S A;  3KSJ A;  2DWI A;  3ODB A;  5K2Y A;  4K3F A;  2A5T A;  4QSD A;  1US5 A;  4X1B A;  2QMX A;  1B4Z A;  2O7U A;  3G3K A;  4GWO A;  5FHM A;  4ZDM A;  1FQD A;  3P7I A;  3VVE A;  1WOD A;  4R6K A;  3RPW A;  1LB9 A;  1M5C A;  1MXV A;  1P1O A;  4GOT A;  4IO2 A;  3IOW A;  2H99 A;  2Z23 A;  3QUF A;  1LAH E;  1LAG E;  2DXR A;  2QJE A;  3LR1 A;  1IXH A;  4JWO A;  4DE8 A;  2HXW A;  2WOP A;  3MWB A;  4TQU Q;  2QS4 A;  4RPO A;  2DP8 A;  4H65 A;  5H8Q A;  4QFL A;  2P2A A;  3R7X A;  4FAT A;  3IOU A;  3T96 B;  3SEY A;  3FUZ A;  5A5X B;  2Y7I A;  3TTR A;  1URS A;  3GBA A;  3OO8 A;  1PC3 A;  2NUV A;  4FJP A;  5CM6 A;  4F39 A;  3MVW A;  5I56 A;  1Y3P A;  2F36 A;  2DWJ A;  1N76 A;  2D21 A;  2IEE A;  4FEC A;  3SES A;  2GHA A;  1NL5 A;  1XHY A;  2V84 A;  1B9J A;  4UA8 A;  3T9H B;  1PBQ A;  5HBC A;  4F3S A;  4FAJ A;  3H6W A;  1FTL A;  4M1V A;  2XXI A;  3H4Z A;  4FOR A;  4KCC A;  4TOZ A;  1N84 A;  4ELR A;  3FVG A;  4FE8 A;  2GRV A;  2PT2 A;  3EHT A;  3VE1 B;  1AH5 A;  1N04 A;  4MLV A;  2O1L A;  2I4B A;  3DEL B;  4KFQ A;  4JB7 A;  3H3G A;  3IR1 A;  1Q35 A;  2DQV A;  5JTY B;  4IGT A;  2DOJ A;  1WDN A;  1AMF A;  2O69 A;  3A09 A;  2RC9 A;  3TDJ A;  4EDP A;  5B70 A;  5J1D A;  2ONK E;  1GV8 A;  3VXB A;  4E0W A;  1SBP A;  2F8D A;  3IL1 B;  1Y4T A;  1YPN A;  3JV9 A;  4JBZ A;  2F35 A;  3MJN A;  2I4C A;  3KFM A;  2H4I A;  1B3H A;  4PQJ A;  2FNC A;  4RJZ A;  1AOV A;  1R6Z A;  4FED A;  3FXU A;  1N3X A;  1M5E A;  4X9T A;  2VOZ A;  2UVI A;  4YZZ A;  2A5S A;  3ILT B;  4F31 B;  5L8D A;  4GL0 A;  3TYH A;  1AIV A;  5KCJ A;  5B7D A;  1US4 A;  1MQG A;  4JXI A;  2PVU A;  5M2V A;  1ZTY A;  2F6G A;  1B0H A;  1JQF A;  4OFL A;  1QJM A;  2DYX A;  1A8F A;  3IB1 A;  3QUJ A;  4LZ8 A;  4KD5 A;  3SER A;  1PB9 A;  4QSC A;  2DVZ A;  2QS1 A;  5CMM A;  3KEI A;  3FZV A;  4F19 A;  3RY3 A;  2REJ A;  4EQ9 A;  2YPN A;  3DRG A;  1A8E A;  2CZL A;  4G4P A;  4NED A;  4EXK A;  4IY6 A;  1JW1 A;  5A5X A;  1EZP A;  1H44 A;  3ILU B;  1NMU A;  4R6Y A;  1LAX A;  4OXV A;  1CE2 A;  4U23 A;  2O1M A;  3OMB A;  2LAO A;  1B3F A;  2O84 X;  2UXA A;  3GZG A;  5AA2 A;  2HQ0 A;  1B3E A;  2BJJ X;  5EHM A;  4YKJ A;  1TFA A;  1B3L A;  2UYE A;  3DRI A;  4QF9 A;  4RNS A;  3WAF A;  4MBP A;  3IOT A;  4F1U A;  3T9U A;  4YMB A;  4ZEC A;  5EHS A;  3T9X B;  4NF5 A;  4EF1 A;  1OLA A;  2G93 A;  2XXH A;  3MP6 A;  1DOT A;  4KYS A;  2XXT A;  1D4N A;  4O3B A;  1F9B A;  4YAH X;  1FCK A;  5KZT A;  3O97 A;  3O6I A;  4LAT A;  4Q8R A;  5KCJ B;  1VE4 A;  1H76 A;  1LAF E;  3KN8 A;  2VHA A;  2Y7R A;  1B7H A;  2F34 A;  2OJT A;  2RF1 A;  2Z8D A;  1OLC A;  4ZZA A;  3N94 A;  1DTG A;  1JNF A;  3TTN A;  3FVN A;  3S2V A;  5H8H B;  1JEU A;  3CVG A;  4GXS B;  4H67 A;  3BFT A;  2H98 A;  4ZS9 A;  4QFN A;  1II5 A;  4G68 C;  1PDA A;  1MM7 A;  3OO9 A;  5I59 B;  2X7Q A;  1ATG A;  3C9H A;  4MF3 A;  1B05 A;  5FHO A;  4U22 A;  3VVF A;  1MQI A;  4DXB A;  4QFP A;  1OQG A;  1NNK A;  1MRP A;  4WKM A;  4HW8 A;  1FQF A;  5JK4 A;  3ZKL A;  4YKP A;  3V5A A;  3R26 A;  1D9Y A;  1MXZ A;  1VFD A;  1N7X A;  3IB0 A;  1B3G A;  1S7Y A;  3MZB A;  4OES A;  1QUK A;  1OMP A;  3RQT A;  2VP1 A;  4FEB A;  2UVG A;  1SVX B;  2ZYK A;  3KBR A;  1UIU A;  1DPE A;  2Y7K A;  3M3K A;  3MQ9 A;  3PMV A;  4GQO A;  1MDP 1;  1B1H A;  3PPQ A;  4G77 A;  1XVY A;  1MM6 A;  3QAX A;  4LZ7 A;  1A40 A;  3MZ9 A;  3MAM A;  3TCF A;  4YB5 A;  3IX1 A;  5H8Q B;  3G3H A;  3QSL A;  3C31 A;  1HSJ A;  3K6W A;  3K6V A;  5DVI A;  4ZE8 A;  1IIT A;  1BP5 A;  5DYH A;  2I3V A;  4DDD A;  5I2N A;  3DRF A;  1N0T A;  2XXU A;  4P11 A;  3SEW A;  1SW2 A;  2DE4 A;  3H03 A;  4OET A;  2VD2 A;  4U4X A;  4OWD A;  3ZSF A;  5I56 B;  5I58 A;  3HV1 A;  4F3P A;  3KN7 A;  2UYF A;  2OBG A;  2I6E A;  2ZNU A;  4MH5 A;  3D4G A;  4BDL A;  4EF2 A;  4LVQ A;  4DCX A;  4WED A;  3CSB A;  3LSF B;  1VFE A;  1VSO A;  1NNT A;  5DEX B;  1B52 A;  4R9G A;  2AIX A;  3VLW A;  1BLF A;  1SW4 A;  1I6Q A;  1EH3 A;  2DVC A;  4NMY A;  2E0S A;  3Q25 A;  5I57 B;  4ZEI A;  3OO7 A;  3MP8 A;  4PFU A;  3IK6 B;  5CRY A;  3TOD A;  3SDF A;  4AB5 A;  2D3I A;  1USY H;  5F1Q A;  4BLA A;  1J1N A;  5TP9 B;  2QS3 A;  3M3L A;  3PUX E;  5K2X A;  3RNN A;  1QKB A;  3OXN A;  2I0B A;  2HZL A;  1M5B A;  1ANF A;  2XXY A;  4R6H A;  1SDX A;  3A3U A;  3VV5 A;  5HM4 B;  2PBW A;  3K4U A;  3IO6 A;  3K1M A;  3PU5 A;  4U1O A;  4RK9 A;  1JEV A;  3K1N A;  5JEI A;  2F7C A;  2G29 A;  4RA1 A;  2VGQ A;  5F7V A;  4ONY A;  2V3T A;  4Z0I A;  3KZG A;  2ZNT A;  4NTL A;  5CMC A;  3DP4 A;  5H8F A;  1LLS A;  4G68 B;  1LFI A;  1O7T A;  2THI A;  3K00 A;  4R2B A;  2Z22 A;  4G2Z A;  1R1N A;  4IY5 A;  4LUB A;  4OMB A;  4ZZE A;  3USD A;  5AA4 A;  1ZLQ A;  1ZU0 A;  3FVK A;  4GXA A;  3U72 A;  4YKI A;  3HO7 A;  4PE5 B;  1ZKB A;  2RIN A;  3LVU A;  1PEB A;  1YCJ A;  3M8U A;  1H3D A;  2F78 A;  2F5X A;  1YTV A;  4OEU A;  2Q2A A;  3C34 A;  2NOO A;  3L6H A;  2RKM A;  4C0R A;  4OQO A;  1BIY A;  5HPQ A;  2ALU A;  4THI A;  3LBS A;  3M3F A;  1UTH A;  3EHU A;  4IO7 A;  3PMW A;  3Q28 A;  2DSF A;  1RKM A;  3IAZ A;  1FTO A;  1URD A;  3FXR A;  3UGW A;  3PUY E;  2Y7P A;  5I84 A;  1B58 A;  2Y84 A;  3FGS A;  4YB6 A;  3CFX A;  3FIR A;  2I48 A;  4KCD A;  2I3W A;  3DRH A;  1NH8 A;  2I0C A;  3H7M A;  4U21 A;  2ZYN A;  3PMX A;  3MVY A;  3CG1 A;  1ZIU A;  1VR5 A;  1B7Z A;  2CMO A;  3Q29 A;  3Q27 A;  1USY E;  3SEV A;  1I6B A;  4IO3 A;  4POW A;  3O6P A;  4C1U A;  1DTZ A;  4R72 A;  4BDQ A;  5DVF A;  3H6U A;  1TWY A;  4M4G A;  4JSO A;  4AB6 A;  3O66 A;  4O3A A;  4XKQ A;  4JDF A;  2XXX A;  1OIB A;  3CFL A;  3PGF A;  4BDM A;  1Z7N E;  3K1P A;  4QSE A;  2QRY A;  3ONM A;  4G8N A;  1SQY A;  3DM0 A;  1PB7 A;  3MZ1 A;  4RK2 A;  3TAJ A;  1S50 A;  2W7Y A;  1FQB A;  2F6P A;  1FQA A;  3LUY A;  3TPA A;  4H1X A;  3S9L C;  1MQJ A;  1MY1 A;  3O6G A;  4DLD A;  5H8N A;  3FAS A;  1MS7 A;  1UTB B;  1SW5 A;  3E9X A;  3N6T A;  5ICT A;  3UP9 A;  3OO6 A;  4NF8 A;  2PT1 A;  2XXV A;  3RLF E;  1MY2 A;  4Q30 B;  1R9L A;  5L9O A;  1QUJ A;  4KR5 A;  4R2F A;  5I2N B;  1XVX A;  2QPQ A;  3O28 A;  3AXF A;  4HS7 A;  3QXM A;  3SEX A;  4F29 A;  5AA2 D;  1JVY A;  3DRJ A;  3F11 A;  4GVO A;  1EZO A;  3TTL A;  1H45 A;  5JTY A;  4QFK A;  1Y3N A;  4F2O A;  1QUL A;  2XHD A;  1JW5 A;  1NKX A;  1NNF A;  4GRK A;  1B6H A;  3H6V A;  2XXR A;  3RYA A;  4N6P A;  2HFB A;  1QKA A;  4XKR A;  1YAE A;  4H8I A;  1B4H A;  3FJG A;  4F2Q A;  3MPL A;  3PPP A;  3C36 A;  2YLN A;  3EQ1 A;  5TU0 A;  3VLV A;  4AQ4 A;  3O9P A;  2ZXT A;  1Y1Z A;  3MC2 A;  5TPA A;  3TEL A;  4ZED A;  3W9V A;  3OD7 A;  1R9Q A;  4PFW A;  2ABH A;  3DRK A;  1QUI A;  3CRB A;  4IO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...