1OLAA

The structural basis of multispecificity in the oligopeptide-binding protein oppa
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
517
structure length
517
Chain Sequence
b'ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OLIGO-PEPTIDE BINDING PROTEIN
publication title The structural basis of sequence-independent peptide binding by OppA protein.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Binding protein
total genus 181
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1994-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1olaA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1olaA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1olaA02
2F6GA 2Q88A 1CE2A 3O6GA 4IB2A 4ELQA 4R72A 3HHFA 2ABHA 3MQ9A 2O1MA 4OVJA 2AYSA 5H8SA 4GLIA 1VFEA 2ONRA 1D3KA 4H67A 4OYVA 3IB1A 3SEVA 1OLCA 1IIWA 3MW0A 3FXQA 2E0SA 1B1XA 4GRKA 1BP5A 2A5TA 1H76A 1RKMA 2NVUB 3ZKKA 3R7XA 4RYAA 3VE1B 4XXUA 4JDFA 3DRHA 4X1BA 4F1UA 2XXIA 3I3VA 1I6QA 2XXQA 3LSWA 4IGRA 4ZE9A 2F5XA 2B65A 4FORA 3ILTB 2RCBA 1MPBA 3RLFE 2QS4A 3DRGA 1LAHE 2DWAA 4R9FA 3DRKA 5ISUA 4FEBA 4IO4A 5BWJA 4NWCA 2O6AA 3TODA 1MH3A 4ZE8A 4OQOA 4YU0A 4LQ5A 1B0LA 1Y3QA 4M1VA 3TYHA 4NWDA 2Z8EA 4JBZA 4YB5A 3USDA 3H6UA 3EN3A 2UXAA 4EF2A 3VV5A 2HZLA 2DVCA 4WKMA 2CZLA 5AA4A 3W15C 2Y7PA 3RT8A 3LC8A 4R73A 4TQUQ 3HN0A 2RINA 4F22A 3IO4A 4EXLA 4ELRA 4TOZA 1MXWA 2NWJA 1SW2A 4UA8A 2WOPA 1NMUA 1JEVA 3CG3A 2R6GE 3Q28A 4GVOA 4IO2A 4QFPA 1UIVA 2HAVA 3R26A 3OO6A 3TTKA 1SW1A 1SI1A 1MXVA 2Y7RA 4O3AA 2PVUA 2E1SA 1MQIA 4OEVA 4OFJA 1N7WA 1JETA 4Q5TA 3HCQA 4GFRA 1DTGA 1SW5A 5CM6A 3O6PA 4P0IA 4U4XA 2Y7WA 2XXVA 5I59A 4LQ2A 4H5FA 1MDQA 4G68C 3H6VA 4K3FA 3OOAA 1BLFA 1R9LA 2NUVA 1P1OA 2GHBA 3IOWA 3MVXA 3PMVA 1MY1A 3VLVA 3K6UA 1OMPA 5J1DA 1A54A 1IEJA 5DVFA 2I48A 3LUYA 4C1TA 3DELB 1TFDA 5K2XA 1JEUA 4RK9A 5KZTA 5A5XB 5AA2D 1ELJA 3ONMA 4THIA 2GFEA 1PBQA 3FV2A 1LCTA 2XXWA 3S4UA 2X26A 4KCCA 2O68A 1NKXA 1H3DA 4ZEKA 5CMCA 4YKKA 3U94A 3MWBA 1XVYA 1B5HA 3MVZA 1BIYA 3TCFA 1VFDA 1XS5A 3EHUA 4QSEA 1H43A 2Q2CA 2H98A 4JB7A 3H6WA 1B0HA 1PC3A 3E3KA 1FQCA 4POWA 3OO9A 2OWTA 2F7BA 2WKYA 3FXRA 3GBBA 5F7VA 1Y4CA 2FA7A 4GIZA 3DM0A 1JNFA 1FQFA 4FE8A 3H03A 5H8FB 1HSJA 3TUSA 3IR1A 4BDOA 3U92A 3U93A 3EHSA 3JYRA 3VLUA 4U1ZA 3N94A 3H06B 4ZEIA 2QMXA 4GL8A 4LATA 1I69A 4RPNA 1LSTA 4G77A 1SBPA 2XX9A 4FIMA 4KQPA 1ATGA 4LZ7A 5LOMA 1O7TA 4JWOA 3K6XA 5TP9A 3OSQA 3SESA 1B5IA 2YLNA 3C35A 2RF1A 4R6HA 2D5WA 2DXRA 3V83A 5EYFA 2B3BA 3HSTA 2UYFA 2Z23A 2ZYKA 3H3GA 1TT1A 4PETA 1FQEA 4F1YA 3T66A 4DCYA 3SEWA 3PD9A 4IO5A 1EU8A 3OEMA 4WXJA 2F7CA 1FQAA 2ZNUA 3KG2A 1JW5A 4N13A 4ELOA 4X1DA 4QFNA 5A5XA 3CSGA 3DLNA 4U2RA 2PX1A 4YICA 4ZS9A 2QL3A 1MXZA 3O6HA 2PT2A 1MM7A 4YKPA 3WAFA 1LAGE 4ELPA 1B4ZA 3O28A 3RQTA 1EH3A 3M3KA 3MBPA 4UACA 2P1SA 1QKAA 1B2HA 3MZ1A 4LA9A 5ICQA 5DVIA 3K02A 1SDXA 1AMFA 3OO7A 4F29A 1B7ZA 4Z0IA 2I3VA 3UIFA 1SI0A 2H9BA 3TTLA 1B3FA 1TWYA 4FECA 3TMGA 1Y20A 3IJXB 3EF7A 4DCXA 2XX7A 1P1QA 1I6BA 4XIGQ 3C9HA 3SDFA 2W7YA 4KCDA 3C33A 3GZGA 1UIUA 2DP8A 4QF9A 4KYDA 3MAMA 2REGA 2ONSA 1XT8A 3E13X 1MQGA 3B6TA 3U8QA 3L6GA 3I6VA 4N6PA 1YPNA 2ALUA 2OLBA 1WVJA 1GVCA 4ND9A 1ZU0A 3OENA 1VE4A 2ZMBA 1MDP1 5I56B 4XKQA 2ZXTA 4PFUA 3LBSA 4F39A 3SETA 3C34A 4G8HA 3VFJA 4RXLA 3TAJA 3S9LC 3KOTA 1VSOA 1O64A 2X7PA 1M5DA 2Z22A 3MP8A 4FATA 4GF8A 1R1NA 2F97A 4F2OA 1R6ZA 2GHAA 4FAJA 3LSLA 2H4IA 4OERA 3HHGA 1QW0A 3U1OA 3N26A 1AL3A 3OO8A 3CG1A 1NH8A 4POXA 5EHSA 3OSRA 3K4UA 1PB9A 2PYYA 4LVQA 3QYTA 3RTFB 1MXUA 1PB7A 3G3KA 1M5EA 2VD2A 2F78A 3FVNA 4ZDMA 3TTRA 4RA1A 1B1HA 3DRIA 4OESA 5JK4A 3FTOA 4F1VA 1MQHA 1NH7A 2DYXA 5H8QA 3VVDA 1FTMA 4WEDA 4IY6A 3KSJA 5IAIA 4AB5A 3EHTA 3EQ1A 2XD2A 4RPOA 4NF6B 1POY1 3IB0A 1H45A 4MF3A 5B70A 4MFIA 1NNKA 3EPEA 1O63A 1QUKA 1M5FA 2DWJA 2XXHA 1DPEA 3KJ7A 2I0CA 2UVHA 1URGA 2O69A 1BTJA 5AA1A 1OQGA 1B51A 4OWDA 1ZKBA 3MPLA 4KYSA 4OFOA 3RTWB 1EZ9A 1LAXA 5CMBA 5FTIA 3IK6B 3N5LA 1M5CA 5CMMA 3THIA 3IOVA 1B6HA 2VGQA 3JZJA 4RY1A 1POTA 3OD7A 1ZTYA 1A99A 3ECRA 3Q29A 3E9XA 5IKBA 2I6EA 2XXRA 2F7AA 2V93A 1J1NA 2NXOA 3V5AA 4DLDA 1UQWA 1MQDA 3FJMA 3TKDA 2P2AA 4F3BA 4GXAA 2HZKA 5K2YA 3PAMA 2F36A 4NEDA 5EHMA 5ELVA 3WAEA 5AE4A 1OVBA 2OZZA 4YKJA 3UGWA 2O7UA 4H1XA 2HXWA 1UTHB 2OWSA 2UVGA 2F6PA 2ZYNA 3RN8A 3QAXA 3FIRA 4IO7A 3SEXA 4QSDA 1LLSA 4LONB 4NF6A 1MXYA 1Y1ZA 1DMBA 4HS7A 1Z7ME 1XC1A 1PDAA 3MPKA 2CMOA 1MPCA 1QVSA 4H6DA 4G8MA 1EZPA 2V84A 1M5BA 4G4PA 2DSFA 3DP6A 3SEUA 4IO6A 3FVKA 3GBAA 5KCJB 3S9EA 2XX8A 3F11A 3MJNA 2V3QA 3T9UA 1B32A 4ESWA 1AIVA 3H6TA 1FTLA 3VXBA 3T9HB 2PBWA 3T22A 4NF5B 3KZGA 4G2ZA 5I2NB 4H8IA 2AL5A 5HBCA 1A8EA 3PPPA 1IXIA 3RPWA 1FTJA 3TQLA 1N76A 4FJPA 1XOCA 1NNTA 3BBRA 3RY3A 5DVJA 3PPOA 5CBRA 1B4HA 1URDA 3S2VA 3RNNA 3IL1B 4ECFA 1B3LA 4N07A 4JSDA 4NF4B 4OXVA 3ZSFA 2R71A 3CHGA 2V3TA 2H25A 3N6TA 2HQ0A 3VLWA 3E4RA 1S50A 4DXUA 4G68B 2F8DA 1B52A 4Q8RA 1SYHA 4ZEDA 5ITPA 3DRJA 3MUQA 4QRZA 3MVYA 3TPAA 1UTHA 4GOTA 1JQFA 4GL0A 3W9VA 1ZIUA 4PFTA 2VD3A 4TLMB 2HEUA 1B7UA 2QJEA 5BUUA 3HPIA 5L9SA 3K01A 4XKRA 4FEDA 4OTEA 1LGBC 1HSEA 1Y4TA 3OEKA 3QIMA 2XXXA 1LFHA 1FCKA 3IJOB 2DWHA 5M2VA 1B5JA 4DXCA 2HFBA 3K6WA 4LP2B 1MY4A 4QHQA 4RNSA 4OFLA 3FUZA 3K2DA 4C1UA 1B7HA 1SW4A 5KCJA 1MPDA 2DS9A 4R75A 4I9DA 3L6HA 5DYHA 5DEXB 1B05A 2IEEA 3G3FA 3CFLA 1NNFA 4EQ9A 1I6AA 1IUDA 5FHOA 3RUMA 5AA2B 4AB6A 1NNPA 3I5OA 2ESNA 2DXYA 3IAZA 3S9NC 4U1OA 2THIA 4BDLA 1FTKA 2FYIA 2HAUA 5CMKA 3A3CA 1HSLA 1GGGA 3QUFA 3GLBA 2YPNA 2OJTA 4R2BA 2ZYMA 2ZYOA 3CFZA 2RC7A 3IOUA 3A3UA 5H8HB 2XXUA 3K00A 3Q26A 1YTVA 1DSNA 3G7WA 4DDDA 2Q9TA 1S7YA 3TFLA 3TELA 2A5SA 1A8FA 1GTKA 1AOVA 2RCAA 3O6IA 1QULA 2Z8DA 1USYH 1JVYA 2O1LA 4YB6A 4P11A 2DWIA 3C36A 4LUBA 3V8XB 4GQOA 2DOJA 5KDTB 3KEIA 2QMWA 3TTNA 5H8FA 3QXMA 5I58B 2Q89A 3OMBA 3PU5A 4U23A 2D3IA 2B4LA 4JSOA 4BDMA 4I8CA 4R6KA 1B3GA 4RK2A 4H8JA 3KGCA 2I4CA 4ISUA 3CRBA 4O3CA 4JXIA 4XTCQ 1AH5A 3ILUB 3LR1A 4U4SA 3MP1A 3KFMA 1FTOA 1B58A 3SEYA 1N3XA 1DOTA 2G29A 1TXFA 5TPAB 3MP6A 5DEXA 5I84A 1H44A 4PFWA 3VVFA 1ZBMA 2O7IA 4U21A 5AA2A 5FTHA 1CB6A 3IORA 4IO3A 1P1NA 1URSA 4JWXA 3KN3A 4NF8B 4HW8A 3ODBA 1IITA 4ZZAA 3G3GA 4EQ7A 5CI5A 1D9VA 4YB7A 4F18A 3D4GA 4KPTA 1N04A 1WODA 1YCJA 3PUYE 2BJJX 5TU0A 2PT1A 4BLAA 3UK4A 2I0BA 3B6WA 5H8HA 5CC2A 2D21A 3PV0E 3KN7A 1IXCA 2AL4A 2QS1A 3SERA 3IOTA 3T9XB 4EXKA 3V89B 3T96B 3K1NA 3FGSA 1SYIA 4R9GA 2AIXA 2UVJA 3ZKLA 2RKMA 1UTBB 2GRVA 1SQYA 3VVEA 1IXGA 5L8DA 3BKIB 3UORA 2DVZA 1US5A 3QSLA 2V3UA 5HPQA 5KDTA 2RC9A 3LSXA 1YAEA 3TQWA 5I58A 5I59B 3A09A 4YMBA 2UYEA 1A55A 4MH5A 4HTGA 4IGTA 5ICTA 2B4MA 4OEUA 1F9BA 2ONKE 2XXPA 5I56A 5H8NB 4MLQA 1USYE 2HCAA 2LAOA 1MS7A 2M8CA 4C0RA 4QFKA 1ZJLA 2WOLA 3PUXE 4PFYA 3CI8A 3DRFA 4KD5A 3CR9A 4ESXA 2ZNSA 2I49A 4EUOA 1Y3NA 1IXHA 3IX1A 1LFGA 5HM4B 1B3HA 3KSXA 5TPAA 4OENA 1DPPA 4U22A 1NFTA 1D9YA 3KJTA 1MY0A 2DQVA 2I3WA 1LB8A 3PPRA 5DT6A 1D4NA 1QKBA 4YZZA 3U72A 4F31B 4H65A 3UN6A 1LBBA 4NF8A 4X9TA 5JTYB 5ITOA 3BFTA 4HCYA 3OELA 3RT6B 1WDNA 1Y3PA 3FATA 3UP9A 4OHNA 3DP8A 1A40A 2DE4A 3DP4A 3CVGA 3D4CA 4F3SA 4R6YA 1T0KA 1ZMGA 1MY3A 3S9MC 1MG1A 3ZS6A 4BDQA 2XXYA 3OXNA 4R2FA 1N3WA 4MBPA 5FHNA 5B7DA 1NL5A 2OCUA 1ZLQA 1P1WA 4OZ9A 3LVUA 1L5TA 4LZ5A 3QUJA 1VR5A 3LSFB 1B9JA 1UTBA 1N7XA 5L9OA 3TDJA 1IZ1A 3HO7A 1TFAA 1S9TA 1II5A 5L9MA 1LCFA 2H5YA 1LAFE 4AQ4A 3HV1A 2Q2AA 4LZ8A 3CSBA 4NMYA 3C31A 2WOKA 3FV1A 3GXAA 2OK2A 1OLAA 3PMXA 1Q35A 4Z7EA 2I58A 4X48A 3UA8A 1A7LA 4DE8A 5I2KB 5TP9B 2O51A 3H4ZA 3FXUA 3O97A 5H8NA 3FASA 2H99A 2Y7KA 1Y9UA 3TZAA 4G8NA 2OBGA 2KLFA 1MM6A 3TEPA 2XHDA 4NTLA 5DTBA 3O2AA 2GH9A 3O66A 4WEPA 3JV9A 3K1MA 1B40A 4ZEBA 3SKPA 4DIGA 4ZECA 1PEBA 4I62A 2Q8JA 3M3LA 4QSCA 5F1QA 2O84X 1MQJA 3FJ7A 1IQ7A 4YKIA 1B46A 5I57B 4XKNA 3TTMA 3BFUA 1ANFA 1XHYA 2VHAA 5AA3A 2XD3A 4PE5B 5JTYA 3T93B 3B6QA 4JWYA 2I4BA 2ZNTA 4KFQA 1PBPA 3VDFA 2QRYA 2QPQA 2R9JA 3IO6A 3G3JA 2VOZA 3CFXA 4OETA 3FVOA 4ONYA 3W9WA 3Q27A 1KWHA 3PGFA 3RGYA 2Y84A 1B3EA 3RYAA 3H7MA 2PMSA 2REJA 3AXFA 4I1DA 3MZ9A 3PUZE 3KN8A 1EZOA 1Q1KA 1PB8A 1DTZA 1SD3A 4L17A 2ANJA 2VP1A 3PD8A 2UVIA 4KHZE 1QUIA 2FNCA 3C4MA 3PUWE 4DXBA 2B3FA 2F34A 1US4A 4YMAA 4E0WA 2P0SA 3FJGA 4M4GA 1P1UA 4GXSB 1FQDA 5JEIA 2XXTA 5I2KA 4R74A 2IA4A 4NF5A 2Y7IA 5I2NA 2X7QA 4P0GA 1Z7NE 4OMBA 2DE2A 1LB9A 1R9QA 1Y1MA 3B7DA 4PQJA 3T9VA 4KI0E 4BDRA 3PPNA 4YAHX 1FW0A 3PPQA 4EF1A 3MVWA 4EQBA 4XKPA 4NF4A 2QSXA 4IY5A 5I57A 3QK6A 3C32A 4TLLB 3PUVE 1XVXA 2YJPA 4PP0A 5H8QB 2G93A 1QUJA 2Z8FA 4G68A 1GV8A 4Q30B 4ZZEA 1MXXA 4H5GA 1LFIA 1OVTA 3O29A 4O3BA 3MZBA 1JVXA 3VXCA 3CIJA 3TCHA 4H0WA 1RYOA 2A5TB 2F35A 1QJMA 3G3IA 4KR5A 3KOSA 4GD5A 3K6VA 4F3PA 3PMWA 4ZEFA 3P7IA 2V25A 3K0VA 2QS3A 5CBSA 3K1PA 2NOOA 3Q25A 2QS2A 4KYEA 3G3HA 1MH4A 4MLVA 1N84A 5CRYA 4F19A 1MRPA 4F2QA 4QFOA 3FVGA 4HCWA 4GWOA 4DZ1A 3IB2A 4QFLA 4NE4A 1SVXB 3R6UA 3FZVA 3O9PA 1MY2A 4BDNA 3FD3A 4Q0CA 3KBRA 4RJZA 5FHMA 4F3GA 2RC8A 3N6UA 1BKAA 1FQBA 4EDPA 4E0XA 3TCGA 1LBCA 1JW1A 2DE3A 1P99A 5AA4B 3M3FA 3M8UA 3RYBA 1JW4A 3MC2A 1N0TA 1GR2A 1OIBA 1RYXA 1OQHA
chains in the Genus database with same CATH superfamily
2F6GA 2Q88A 1CE2A 3O6GA 4IB2A 4ELQA 2HXRA 4R72A 3HHFA 4P1LA 2ABHA 3MQ9A 4HE1A 3B8BA 4NG7A 2O1MA 4OVJA 2AYSA 5H8SA 4GLIA 1VFEA 2ONRA 1D3KA 4H67A 4OYVA 3IB1A 3SEVA 1OLCA 2XWVA 1Q9DA 1IIWA 3MW0A 3FXQA 2E0SA 1B1XA 4GRKA 1BP5A 2A5TA 3A29A 1H76A 1RKMA 2NVUB 3ZKKA 3R7XA 4PBHA 4RYAA 3VE1B 4XXUA 4JDFA 1YZ0A 3DRHA 4X1BA 4F1UA 4PFRA 2XXIA 4N81A 3I3VA 1I6QA 2XXQA 3LSWA 4IGRA 4ZE9A 2PFZA 5LDZA 2F5XA 2B65A 4FORA 3RPLA 3ILTB 2RCBA 1MPBA 3RLFE 2QS4A 1K9ZA 2Q74A 3DRGA 1LAHE 2DWAA 5J16A 4R9FA 3DRKA 5ISUA 4FEBA 1KA1A 4IO4A 5BWJA 4NWCA 2O6AA 3TODA 1MH3A 4ZE8A 4OQOA 4YU0A 4LQ5A 4PC9A 1B0LA 4PGPA 1Y3QA 4M1VA 3TYHA 4NWDA 2Z8EA 4JBZA 4YB5A 3USDA 3H6UA 2CEYA 3EN3A 2WYKA 2UXAA 4EF2A 4O8MA 3VV5A 4GWUA 2HZLA 2DVCA 5IZ3A 3MSTA 4WKMA 1QGXA 2CZLA 5AA4A 3W15C 2Y7PA 4NQ8A 3LC8A 3RT8A 4R73A 1LBVA 4TQUQ 3HN0A 2RINA 4F22A 3IO4A 1FPFA 4GBWA 4EXLA 4ELRA 2DDKA 4TOZA 4P56A 5I7IA 1MXWA 2NWJA 1SW2A 4UA8A 2WOPA 1NMUA 1JEVA 3CG3A 2R6GE 3Q28A 4GVOA 4IO2A 4QFPA 1UIVA 2HAVA 1EYJA 3R26A 3OO6A 2WX9A 3TTKA 1SW1A 1SI1A 5T3JA 2VT5A 1MXVA 2Y7RA 4O3AA 2PVUA 2E1SA 1MQIA 4OEVA 3E79A 4OFJA 4OVSA 1N7WA 1JETA 1FBCA 4Q5TA 3HCQA 4GFRA 1DTGA 1SW5A 5CM6A 1IMEA 3O6PA 4P0IA 4U4XA 2Y7WA 2XXVA 5I59A 4LQ2A 4PAFA 4DI4B 4H5FA 1MDQA 1NUWA 4G68C 3H6VA 2CZIA 4K3FA 3OOAA 1BLFA 1R9LA 2NUVA 1P1OA 2GHBA 3IOWA 3MVXA 3PMVA 1MY1A 3VLVA 3K6UA 1OMPA 3U65A 5J1DA 1A54A 1IEJA 5DVFA 2I48A 3LUYA 4C1TA 3DELB 1TFDA 5K2XA 1JEUA 4RK9A 4OVTA 5KZTA 5A5XB 5AA2D 1ELJA 3ONMA 1FPBA 4THIA 2GFEA 1PBQA 3FV2A 1LCTA 2XXWA 5EYHA 1LBZA 5ET7A 3S4UA 2X26A 4KCCA 2O68A 1NKXA 1H3DA 4ZEKA 5CMCA 4YKKA 3U94A 3MWBA 1XVYA 1B5HA 1LEVA 4PAKA 5EQ7A 3MVZA 1BIYA 3TCFA 1VFDA 1XS5A 3EHUA 4QSEA 1H43A 2Q2CA 4PF8A 2H98A 4MHFA 4IR8A 4JB7A 3H6WA 1B0HA 4PFIA 1PC3A 3E3KA 1FQCA 4P9KA 4POWA 3OO9A 2OWTA 2F7BA 2WKYA 2BJIA 2WBBA 3FXRA 3GBBA 5F7VA 1Y4CA 2CEXA 2FA7A 4GIZA 3DM0A 1FBHA 1JNFA 1FQFA 4FE8A 3H03A 5H8FB 1HSJA 3TUSA 3IR1A 4BDOA 3U92A 3U93A 3EHSA 4MIJA 4NGUA 3JYRA 3VLUA 4U1ZA 3N94A 3H06B 4ZEIA 2QMXA 4GL8A 4LATA 1I69A 4RPNA 4GX6A 1LSTA 4G77A 1XI6A 1SBPA 2XX9A 4FIMA 4KQPA 1ATGA 4LZ7A 4N91A 5LOMA 1O7TA 2OWZA 4JWOA 3K6XA 5TP9A 3OSQA 3SESA 1NV3A 1B5IA 2YLNA 3C35A 3BIHA 2RF1A 4R6HA 2D5WA 2DXRA 3V83A 5EYFA 2B3BA 3HSTA 2UYFA 2Z23A 2ZYKA 3H3GA 1TT1A 5ESYA 4PETA 1FQEA 4F1YA 3T66A 4MCOA 4DCYA 3SEWA 3PD9A 4IO5A 1EU8A 3OEMA 4WXJA 2F7CA 1FQAA 2ZNUA 3KG2A 1JW5A 4GWYA 4N13A 1JP4A 2QVRA 4ELOA 4X1DA 4QFNA 5A5XA 3CSGA 3DLNA 4U2RA 2PX1A 4YICA 4ZS9A 2QL3A 1MXZA 3O6HA 2PT2A 3QMFA 1DBZA 1MM7A 5DW8A 4YKPA 3WAFA 1LAGE 4ELPA 1B4ZA 3O28A 3RQTA 1EH3A 3M3KA 3MBPA 4UACA 2P1SA 1QKAA 1B2HA 3MZ1A 4LA9A 5ICQA 2QFLA 5DVIA 3K02A 1SDXA 1AMFA 3OO7A 4F29A 1B7ZA 4Z0IA 2I3VA 3UIFA 1SI0A 2H9BA 4JVIA 3TTLA 1B3FA 1TWYA 4FECA 3TMGA 1Y20A 3IJXB 3EF7A 4XFEA 4DCXA 2XX7A 1P1QA 1I6BA 4GWSA 4XIGQ 3C9HA 3SDFA 2W7YA 4KCDA 3C33A 3GZGA 1UIUA 2DP8A 4QF9A 4KYDA 3MAMA 5F24A 2REGA 2ONSA 1XT8A 3E13X 1MQGA 3B6TA 4PF6A 3U8QA 3L6GA 3I6VA 4N6PA 1YPNA 2ALUA 2OLBA 1WVJA 1GVCA 5IZ1A 4ND9A 4GWZA 1ZU0A 3OENA 1VE4A 3HFUA 2ZMBA 1MDP1 3B50A 5I56B 4XKQA 2ZXTA 4PFUA 3LBSA 4F39A 3SETA 3C34A 4G8HA 3VFJA 4RXLA 3TAJA 3S9LC 3KOTA 1VSOA 1YXIA 1O64A 2X7PA 1M5DA 2Z22A 3MP8A 4FATA 4GF8A 1R1NA 2F97A 4F2OA 1R6ZA 2GHAA 4FAJA 1NUYA 3LSLA 2H4IA 4OERA 3HHGA 1QW0A 3U1OA 3N26A 1AL3A 3OO8A 3CG1A 4MNIA 1NH8A 4POXA 5EHSA 3OSRA 3K4UA 1PB9A 2PYYA 4LVQA 3QYTA 3RTFB 1MXUA 1PB7A 3G3KA 1M5EA 1FRPA 2VD2A 2Q8MA 2F78A 2XXKA 3FVNA 4ZDMA 1RDZA 3TTRA 5EYGA 4RA1A 1B1HA 3DRIA 4OESA 5JK4A 3FTOA 4F1VA 1MQHA 1NH7A 2DYXA 5H8QA 3VVDA 1FTMA 4WEDA 4IY6A 3KSJA 4O94A 5IAIA 4AB5A 3EHTA 3EQ1A 2XD2A 4RPOA 4NF6B 1POY1 3IB0A 1H45A 4MF3A 5B70A 4MFIA 1NNKA 4O7MA 3FXBA 3EPEA 1O63A 4N8GA 1QUKA 1M5FA 2DWJA 2XXHA 4I40A 1DPEA 3KJ7A 4PDHA 2I0CA 2UVHA 1URGA 2HHMA 2O69A 1BTJA 5AA1A 1OQGA 1B51A 4OWDA 1ZKBA 3MPLA 4KYSA 4OFOA 3RTWB 1EZ9A 1FPDA 4PCDA 1LAXA 4NAPA 5CMBA 5FTIA 3ISPA 3IK6B 1LBWA 3N5LA 1M5CA 5CMMA 3THIA 3IOVA 1B6HA 2VGQA 3JZJA 4P1EA 4OA4A 4RY1A 1POTA 3OD7A 1ZTYA 2QVVA 1A99A 3ECRA 3Q29A 2MKZA 3E9XA 5IKBA 2I6EA 2XXRA 2F7AA 1LBXA 2V93A 1J1NA 2NXOA 3V5AA 4DLDA 1UQWA 2L5VA 1MQDA 3FJMA 3TKDA 2P2AA 4N15A 4F3BA 4GXAA 2HZKA 5K2YA 3PAMA 2F36A 4NEDA 5EHMA 5ELVA 3WAEA 1FBFA 5AE4A 1OVBA 2OZZA 4YKJA 3UGWA 1SPIA 2O7UA 4H1XA 2HXWA 1FJ9A 1UTHB 2OWSA 2UVGA 2F6PA 2ZYNA 3RN8A 3QAXA 3FIRA 4IO7A 3SEXA 4QSDA 1LLSA 4LONB 4GX3A 4QBAA 4NF6A 1MXYA 1Y1ZA 1DMBA 4HS7A 1Z7ME 1XC1A 1PDAA 3MPKA 2CMOA 1MPCA 1QVSA 4H6DA 4G8MA 1EZPA 4OVPA 2V84A 1M5BA 4G4PA 2DSFA 3DP6A 1FPIA 3SEUA 4IO6A 3FVKA 3GBAA 5KCJB 3S9EA 2XX8A 3F11A 3MJNA 1VDWA 2V3QA 3T9UA 1B32A 3MYUA 4ESWA 1AIVA 3H6TA 1FTLA 3VXBA 2PBWA 3T22A 3KC0A 4NF5B 3T9HB 1FBGA 3KZGA 4G2ZA 4N17A 5I2NB 2QVUA 1IMBA 4H8IA 2AL5A 5HBCA 3EKIA 4UABA 1A8EA 3PPPA 5IZZA 1IXIA 3RPWA 1FTJA 3TQLA 1N76A 4FJPA 1XOCA 1NNTA 1RDYA 3BBRA 4PDDA 1IMFA 3RY3A 5DVJA 3PPOA 5ET8A 5CBRA 2WEFA 5LTCA 1B4HA 1URDA 3S2VA 3RNNA 3IL1B 4ECFA 1B3LA 4N07A 4JSDA 4NF4B 1G0IA 4OXVA 3ZSFA 2R71A 3CHGA 2V3TA 4NHBA 2H25A 3N6TA 2HQ0A 3VLWA 4PAIA 3E4RA 1S50A 2XA5A 4DXUA 1IMAA 4G68B 1EYKA 2F8DA 1B52A 2ZZVA 4Q8RA 1SYHA 4ZEDA 5ITPA 3DRJA 3MUQA 4QRZA 3MVYA 3TPAA 1UTHA 3ROJA 4GOTA 1JQFA 4GL0A 3W9VA 1ZIUA 4PFTA 2VD3A 4TLMB 4PFBA 2HEUA 1B7UA 2P3VA 2QJEA 5BUUA 3HPIA 5L9SA 3K01A 4XKRA 4FEDA 4OTEA 1FJ6A 1LGBC 1HSEA 3IFAA 1Y4TA 3OEKA 3QIMA 4OVQA 2XXXA 1LFHA 1FCKA 3IJOB 2DWHA 5M2VA 1B5JA 4DXCA 2HFBA 3K6WA 4LP2B 4DI3D 1MY4A 2CZHA 3GYYA 4QHQA 4RNSA 4OFLA 1DCUA 3FUZA 3K2DA 4C1UA 1B7HA 1SW4A 5KCJA 1MPDA 2DS9A 4R75A 1FSAA 4QXDA 4I9DA 1NUZA 1D9QA 3L6HA 2FBPA 3T0JA 4HE2A 2FVZA 5DYHA 5DEXB 1B05A 2IEEA 3G3FA 3CFLA 1NNFA 4EQ9A 1I6AA 1IUDA 5FHOA 3RUMA 5AA2B 4AB6A 1NNPA 2FHYA 3I5OA 2ESNA 2DXYA 3IAZA 3S9NC 4U1OA 2THIA 4BDLA 1FTKA 2FYIA 2HAUA 4I3EA 5CMKA 3A3CA 1HSLA 1GGGA 3QUFA 3GLBA 1NUXA 2YPNA 4NF0A 4X8RA 2OJTA 4R2BA 5FBPA 2ZYMA 2ZYOA 3CFZA 2RC7A 3IOUA 3A3UA 5H8HB 4MX6A 2XXUA 3K00A 3Q26A 1YTVA 1DSNA 3G7WA 4DDDA 1LBYA 2Q9TA 1S7YA 1NV0A 3TFLA 3TELA 2A5SA 1A8FA 3IFCA 1GTKA 1AOVA 2RCAA 3O6IA 1QULA 2Z8DA 1NV2A 1USYH 1JVYA 2O1LA 4YB6A 4GWWA 4P11A 2DWIA 4GBVA 3C36A 4P47A 4LUBA 3V8XB 5IGAA 4GQOA 2DOJA 2OX3A 5KDTB 3KEIA 2QMWA 3TTNA 5H8FA 3QXMA 5I58B 2Q89A 1BK4A 2VPOA 3OMBA 3PU5A 1NV7A 4U23A 2D3IA 2B4LA 4JSOA 4BDMA 4I8CA 4R6KA 1B3GA 5EQ8A 4RK2A 4H8JA 3KGCA 3D1RA 1NV4A 2I4CA 3RPLB 4ISUA 1FTAA 3CRBA 4O3CA 4KXPA 4JXIA 1G0HA 4P8BA 4XTCQ 1AH5A 3ILUB 3LR1A 4MNCA 4U4SA 3MP1A 3KFMA 3NOHA 1FTOA 1B58A 3SEYA 1N3XA 5ET5A 1DOTA 2G29A 1TXFA 5TPAB 3MP6A 5DEXA 5I84A 1H44A 4PFWA 2XWOA 3VVFA 1ZBMA 2O7IA 4U21A 4PE3A 5AA2A 5FTHA 1CB6A 3IORA 4IO3A 1P1NA 1URSA 4JWXA 3KN3A 4NF8B 5IZ3B 4HW8A 3ODBA 1IITA 4ZZAA 2KR0A 3G3GA 4EQ7A 5CI5A 1D9VA 4YB7A 4N6KA 4F18A 2CZKA 3D4GA 4KPTA 1N04A 1WODA 4X04A 4JVCA 1YCJA 3PUYE 2BJJX 5TU0A 2PT1A 4BLAA 3UK4A 2I0BA 3B6WA 5H8HA 5CC2A 2D21A 3PV0E 3KN7A 1IXCA 2AL4A 2V4CA 2QS1A 3SERA 1NV6A 3RYDA 3IOTA 3T9XB 4EXKA 3V89B 3T96B 3K1NA 3FGSA 5A5LA 1SYIA 4R9GA 2AIXA 2UVJA 3ZKLA 2RKMA 1UTBB 2GRVA 1SQYA 2XWKA 3VVEA 2VPNA 1IXGA 3KBZA 1EYIA 5L8DA 3BKIB 3UORA 2DVZA 1US5A 2PCRA 4LN5A 3QSLA 2V3UA 5HPQA 3T1BA 5KDTA 2RC9A 3LV0A 3LSXA 1YAEA 3TQWA 5I58A 5I59B 3A09A 4YMBA 2UYEA 1A55A 4MH5A 4HTGA 4IGTA 5ICTA 4JVDA 1FBDA 1CNQA 2B4MA 4OEUA 1F9BA 2ONKE 2XXPA 5I56A 5H8NB 4MLQA 1USYE 2HCAA 2LAOA 1MS7A 2M8CA 4C0RA 4QFKA 1ZJLA 2WOLA 3PUXE 4PFYA 3CI8A 3DRFA 4KD5A 4NX1A 3CR9A 4ESXA 2ZNSA 2I49A 4EUOA 1Y3NA 1IXHA 3KC1A 3IX1A 1LFGA 4P3LA 1FPGA 5HM4B 1B3HA 2FIXA 3KSXA 5TPAA 4OENA 1DPPA 4U22A 1NFTA 4N4UA 1D9YA 3KJTA 1MY0A 2HPGA 2DQVA 1K9YA 2I3WA 1LB8A 1YYZA 3PPRA 5DT6A 2WYPA 1D4NA 1QKBA 4YZZA 3U72A 4F31B 4H65A 3UN6A 2P3NA 1LBBA 4NF8A 4X9TA 5JTYB 5ITOA 3BFTA 4HCYA 3OELA 3RT6B 1WDNA 1Y3PA 1FPEA 3FATA 4PBQA 3UP9A 4OHNA 3DP8A 1NV1A 4HE0A 1A40A 2DE4A 3DP4A 3CVGA 3D4CA 4F3SA 4R6YA 1T0KA 2F3BA 1ZMGA 2JJKA 1MY3A 3S9MC 3FBPA 1MG1A 3ZS6A 4BDQA 4GWXA 2XXYA 3OXNA 4R2FA 1N3WA 4MBPA 2XWIA 5FHNA 5B7DA 1NL5A 2OCUA 1ZLQA 1P1WA 4OZ9A 3LVUA 1L5TA 4LZ5A 3QUJA 1VR5A 3LSFB 1B9JA 1UTBA 1N7XA 5L9OA 3TDJA 5EQ9A 1IZ1A 3HO7A 1TFAA 1S9TA 1II5A 5L9MA 1LCFA 2H5YA 1LAFE 1IMCA 4AQ4A 3HV1A 2Q2AA 4LZ8A 3CSBA 4NMYA 3C31A 2WOKA 3FV1A 3GXAA 4H46A 2OK2A 1OLAA 3PMXA 1Q35A 4Z7EA 2I58A 4X48A 3UA8A 1A7LA 5EQAA 4DE8A 5I2KB 5TP9B 2O51A 3H4ZA 3FXUA 3O97A 5H8NA 3FASA 2H99A 2Y7KA 2WBDA 1Y9UA 3TZAA 4G8NA 2OBGA 5I5PA 2KLFA 1MM6A 3TEPA 2XHDA 4GX4A 4NTLA 5DTBA 3O2AA 2GH9A 4MAGA 3O66A 4WEPA 4N8YA 3JV9A 3K1MA 4MMPA 1B40A 4ZEBA 3SKPA 4DIGA 4ZECA 1PEBA 4I62A 2Q8JA 3M3LA 4QSCA 5F1QA 2O84X 2FIEA 1MQJA 3FJ7A 1IQ7A 4YKIA 1B46A 5I57B 4XKNA 3TTMA 3BFUA 1ANFA 1XHYA 4FBPA 2VHAA 5AA3A 2XD3A 4PE5B 5JTYA 2KQZA 3T93B 3B6QA 4JWYA 2I4BA 2ZNTA 4KFQA 1PBPA 3VDFA 2QRYA 2QPQA 2R9JA 3IO6A 3G3JA 2VOZA 3CFXA 2ZZWA 4OETA 3FVOA 4ONYA 3W9WA 3Q27A 4OVRA 1KWHA 4MEVA 3PGFA 3RGYA 2Y84A 1B3EA 2R8TA 3LUZA 3RYAA 3H7MA 2PMSA 2REJA 3AXFA 1FPJA 4I1DA 3MZ9A 3PUZE 2ZZXA 3KN8A 1EZOA 1Q1KA 1PB8A 1DTZA 1INPA 1SD3A 4L17A 2ANJA 2VP1A 3PD8A 2UVIA 4KHZE 1QUIA 2FNCA 3C4MA 3PUWE 4DXBA 2B3FA 2F34A 1US4A 4YMAA 4E0WA 3SZPA 2P0SA 3FJGA 4M4GA 1P1UA 4GXSB 1FQDA 5JEIA 2XXTA 5I2KA 4R74A 2GQ1A 2IA4A 4NF5A 2Y7IA 5I2NA 2X7QA 4P0GA 1Z7NE 4XF5A 2PFYA 4OMBA 4MJOA 2DE2A 1LB9A 1R9QA 2F3DA 1Y1MA 1DK4A 3B7DA 4PQJA 3T9VA 4KI0E 4BDRA 3PPNA 4YAHX 1FW0A 3PPQA 4EF1A 1KA0A 3MVWA 4EQBA 4XKPA 4NF4A 2QSXA 4N6DA 4IY5A 1KZ8A 4O7IA 5I57A 3QK6A 3C32A 5ET6A 4TLLB 2Y5LA 3PUVE 1XVXA 3PTYA 2YJPA 4PP0A 5H8QB 2G93A 1QUJA 2Z8FA 4G68A 1GV8A 4Q30B 4AS5A 4I3YA 4ZZEA 1MXXA 4H5GA 1LFIA 1OVTA 3O29A 4O3BA 1IMDA 3MZBA 1JVXA 3VXCA 3CIJA 3TCHA 1NV5A 4H0WA 5I3SA 1RYOA 2A5TB 2F35A 1QJMA 4AS4A 3G3IA 4KR5A 3KOSA 5IM2A 4GD5A 1FBPA 3K6VA 4F3PA 3PMWA 4ZEFA 3P7IA 1FBEA 2V25A 1FPLA 3K0VA 2QS3A 5CBSA 1FPKA 4PTKA 3K1PA 2NOOA 3Q25A 2QS2A 4KYEA 3G3HA 1MH4A 1AWBA 4MLVA 1N84A 4NN3A 5CRYA 4F19A 1MRPA 4F2QA 4QFOA 3FVGA 4HCWA 4GWOA 4DZ1A 3IB2A 4QFLA 4NE4A 1SVXB 3R6UA 3FZVA 3O9PA 3BIGA 1MY2A 4PGNA 4BDNA 1RDXA 3FD3A 1NI9A 4Q0CA 3KBRA 4RJZA 5FHMA 4G61A 4F3GA 4XEQA 2RC8A 3N6UA 1BKAA 3E78A 1FQBA 4EDPA 4E0XA 3TCGA 1LBCA 4H45A 1JW1A 2DE3A 1P99A 4OANA 5AA4B 3M3FA 3M8UA 2Y5KA 3RYBA 1JW4A 3MC2A 1N0TA 4MNPA 1GR2A 1OIBA 1RYXA 4HXVA 1OQHA
chains in the Genus database with same CATH topology
2F6GA 2Q88A 1CE2A 3O6GA 4IB2A 4ELQA 4R72A 3HHFA 2ABHA 3MQ9A 2O1MA 4OVJA 2AYSA 5H8SA 4GLIA 1VFEA 2ONRA 1D3KA 4H67A 4OYVA 3IB1A 3SEVA 1OLCA 1IIWA 3MW0A 3FXQA 2E0SA 1B1XA 4GRKA 1BP5A 2A5TA 1H76A 1RKMA 2NVUB 3ZKKA 3R7XA 4RYAA 3VE1B 4XXUA 4JDFA 3DRHA 4X1BA 4F1UA 2XXIA 3I3VA 1I6QA 2XXQA 3LSWA 4IGRA 4ZE9A 2F5XA 2B65A 4FORA 3ILTB 2RCBA 1MPBA 3RLFE 2QS4A 3DRGA 1LAHE 2DWAA 4R9FA 3DRKA 5ISUA 4FEBA 4IO4A 5BWJA 4NWCA 2O6AA 3TODA 1MH3A 4ZE8A 4OQOA 4YU0A 4LQ5A 1B0LA 1Y3QA 4M1VA 3TYHA 4NWDA 2Z8EA 4JBZA 4YB5A 3USDA 3H6UA 3EN3A 2UXAA 4EF2A 3VV5A 2HZLA 2DVCA 4WKMA 2CZLA 5AA4A 3W15C 2Y7PA 3RT8A 3LC8A 4R73A 4TQUQ 3HN0A 2RINA 4F22A 3IO4A 4EXLA 4ELRA 4TOZA 1MXWA 2NWJA 1SW2A 4UA8A 2WOPA 1NMUA 1JEVA 3CG3A 2R6GE 3Q28A 4GVOA 4IO2A 4QFPA 1UIVA 2HAVA 3R26A 3OO6A 3TTKA 1SW1A 1SI1A 1MXVA 2Y7RA 4O3AA 2PVUA 2E1SA 1MQIA 4OEVA 4OFJA 1N7WA 1JETA 4Q5TA 3HCQA 4GFRA 1DTGA 1SW5A 5CM6A 3O6PA 4P0IA 4U4XA 2Y7WA 2XXVA 5I59A 4LQ2A 4H5FA 1MDQA 4G68C 3H6VA 4K3FA 3OOAA 1BLFA 1R9LA 2NUVA 1P1OA 2GHBA 3IOWA 3MVXA 3PMVA 1MY1A 3VLVA 3K6UA 1OMPA 5J1DA 1A54A 1IEJA 5DVFA 2I48A 3LUYA 4C1TA 3DELB 1TFDA 5K2XA 1JEUA 4RK9A 5KZTA 5A5XB 5AA2D 1ELJA 3ONMA 4THIA 2GFEA 1PBQA 3FV2A 1LCTA 2XXWA 3S4UA 2X26A 4KCCA 2O68A 1NKXA 1H3DA 4ZEKA 5CMCA 4YKKA 3U94A 3MWBA 1XVYA 1B5HA 3MVZA 1BIYA 3TCFA 1VFDA 1XS5A 3EHUA 4QSEA 1H43A 2Q2CA 2H98A 4JB7A 3H6WA 1B0HA 1PC3A 3E3KA 1FQCA 4POWA 3OO9A 2OWTA 2F7BA 2WKYA 3FXRA 3GBBA 5F7VA 1Y4CA 2FA7A 4GIZA 3DM0A 1JNFA 1FQFA 4FE8A 3H03A 5H8FB 1HSJA 3TUSA 3IR1A 4BDOA 3U92A 3U93A 3EHSA 3JYRA 3VLUA 4U1ZA 3N94A 3H06B 4ZEIA 2QMXA 4GL8A 4LATA 1I69A 4RPNA 1LSTA 4G77A 1SBPA 2XX9A 4FIMA 4KQPA 1ATGA 4LZ7A 5LOMA 1O7TA 4JWOA 3K6XA 5TP9A 3OSQA 3SESA 1B5IA 2YLNA 3C35A 2RF1A 4R6HA 2D5WA 2DXRA 3V83A 5EYFA 2B3BA 3HSTA 2UYFA 2Z23A 2ZYKA 3H3GA 1TT1A 4PETA 1FQEA 4F1YA 3T66A 4DCYA 3SEWA 3PD9A 4IO5A 1EU8A 3OEMA 4WXJA 2F7CA 1FQAA 2ZNUA 3KG2A 1JW5A 4N13A 4ELOA 4X1DA 4QFNA 5A5XA 3CSGA 3DLNA 4U2RA 2PX1A 4YICA 4ZS9A 2QL3A 1MXZA 3O6HA 2PT2A 1MM7A 4YKPA 3WAFA 1LAGE 4ELPA 1B4ZA 3O28A 3RQTA 1EH3A 3M3KA 3MBPA 4UACA 2P1SA 1QKAA 1B2HA 3MZ1A 4LA9A 5ICQA 5DVIA 3K02A 1SDXA 1AMFA 3OO7A 4F29A 1B7ZA 4Z0IA 2I3VA 3UIFA 1SI0A 2H9BA 3TTLA 1B3FA 1TWYA 4FECA 3TMGA 1Y20A 3IJXB 3EF7A 4DCXA 2XX7A 1P1QA 1I6BA 4XIGQ 3C9HA 3SDFA 2W7YA 4KCDA 3C33A 3GZGA 1UIUA 2DP8A 4QF9A 4KYDA 3MAMA 2REGA 2ONSA 1XT8A 3E13X 1MQGA 3B6TA 3U8QA 3L6GA 3I6VA 4N6PA 1YPNA 2ALUA 2OLBA 1WVJA 1GVCA 4ND9A 1ZU0A 3OENA 1VE4A 2ZMBA 1MDP1 5I56B 4XKQA 2ZXTA 4PFUA 3LBSA 4F39A 3SETA 3C34A 4G8HA 3VFJA 4RXLA 3TAJA 3S9LC 3KOTA 1VSOA 1O64A 2X7PA 1M5DA 2Z22A 3MP8A 4FATA 4GF8A 1R1NA 2F97A 4F2OA 1R6ZA 2GHAA 4FAJA 3LSLA 2H4IA 4OERA 3HHGA 1QW0A 3U1OA 3N26A 1AL3A 3OO8A 3CG1A 1NH8A 4POXA 5EHSA 3OSRA 3K4UA 1PB9A 2PYYA 4LVQA 3QYTA 3RTFB 1MXUA 1PB7A 3G3KA 1M5EA 2VD2A 2F78A 3FVNA 4ZDMA 3TTRA 4RA1A 1B1HA 3DRIA 4OESA 5JK4A 3FTOA 4F1VA 1MQHA 1NH7A 2DYXA 5H8QA 3VVDA 1FTMA 4WEDA 4IY6A 3KSJA 5IAIA 4AB5A 3EHTA 3EQ1A 2XD2A 4RPOA 4NF6B 1POY1 3IB0A 1H45A 4MF3A 5B70A 4MFIA 1NNKA 3EPEA 1O63A 1QUKA 1M5FA 2DWJA 2XXHA 1DPEA 3KJ7A 2I0CA 2UVHA 1URGA 2O69A 1BTJA 5AA1A 1OQGA 1B51A 4OWDA 1ZKBA 3MPLA 4KYSA 4OFOA 3RTWB 1EZ9A 1LAXA 5CMBA 5FTIA 3IK6B 3N5LA 1M5CA 5CMMA 3THIA 3IOVA 1B6HA 2VGQA 3JZJA 4RY1A 1POTA 3OD7A 1ZTYA 1A99A 3ECRA 3Q29A 3E9XA 5IKBA 2I6EA 2XXRA 2F7AA 2V93A 1J1NA 2NXOA 3V5AA 4DLDA 1UQWA 1MQDA 3FJMA 3TKDA 2P2AA 4F3BA 4GXAA 2HZKA 5K2YA 3PAMA 2F36A 4NEDA 5EHMA 5ELVA 3WAEA 5AE4A 1OVBA 2OZZA 4YKJA 3UGWA 2O7UA 4H1XA 2HXWA 1UTHB 2OWSA 2UVGA 2F6PA 2ZYNA 3RN8A 3QAXA 3FIRA 4IO7A 3SEXA 4QSDA 1LLSA 4LONB 4NF6A 1MXYA 1Y1ZA 1DMBA 4HS7A 1Z7ME 1XC1A 1PDAA 3MPKA 2CMOA 1MPCA 1QVSA 4H6DA 4G8MA 1EZPA 2V84A 1M5BA 4G4PA 2DSFA 3DP6A 3SEUA 4IO6A 3FVKA 3GBAA 5KCJB 3S9EA 2XX8A 3F11A 3MJNA 2V3QA 3T9UA 1B32A 4ESWA 1AIVA 3H6TA 1FTLA 3VXBA 3T9HB 2PBWA 3T22A 4NF5B 3KZGA 4G2ZA 5I2NB 4H8IA 2AL5A 5HBCA 1A8EA 3PPPA 1IXIA 3RPWA 1FTJA 3TQLA 1N76A 4FJPA 1XOCA 1NNTA 3BBRA 3RY3A 5DVJA 3PPOA 5CBRA 1B4HA 1URDA 3S2VA 3RNNA 3IL1B 4ECFA 1B3LA 4N07A 4JSDA 4NF4B 4OXVA 3ZSFA 2R71A 3CHGA 2V3TA 2H25A 3N6TA 2HQ0A 3VLWA 3E4RA 1S50A 4DXUA 4G68B 2F8DA 1B52A 4Q8RA 1SYHA 4ZEDA 5ITPA 3DRJA 3MUQA 4QRZA 3MVYA 3TPAA 1UTHA 4GOTA 1JQFA 4GL0A 3W9VA 1ZIUA 4PFTA 2VD3A 4TLMB 2HEUA 1B7UA 2QJEA 5BUUA 3HPIA 5L9SA 3K01A 4XKRA 4FEDA 4OTEA 1LGBC 1HSEA 1Y4TA 3OEKA 3QIMA 2XXXA 1LFHA 1FCKA 3IJOB 2DWHA 5M2VA 1B5JA 4DXCA 2HFBA 3K6WA 4LP2B 1MY4A 4QHQA 4RNSA 4OFLA 3FUZA 3K2DA 4C1UA 1B7HA 1SW4A 5KCJA 1MPDA 2DS9A 4R75A 4I9DA 3L6HA 5DYHA 5DEXB 1B05A 2IEEA 3G3FA 3CFLA 1NNFA 4EQ9A 1I6AA 1IUDA 5FHOA 3RUMA 5AA2B 4AB6A 1NNPA 3I5OA 2ESNA 2DXYA 3IAZA 3S9NC 4U1OA 2THIA 4BDLA 1FTKA 2FYIA 2HAUA 5CMKA 3A3CA 1HSLA 1GGGA 3QUFA 3GLBA 2YPNA 2OJTA 4R2BA 2ZYMA 2ZYOA 3CFZA 2RC7A 3IOUA 3A3UA 5H8HB 2XXUA 3K00A 3Q26A 1YTVA 1DSNA 3G7WA 4DDDA 2Q9TA 1S7YA 3TFLA 3TELA 2A5SA 1A8FA 1GTKA 1AOVA 2RCAA 3O6IA 1QULA 2Z8DA 1USYH 1JVYA 2O1LA 4YB6A 4P11A 2DWIA 3C36A 4LUBA 3V8XB 4GQOA 2DOJA 5KDTB 3KEIA 2QMWA 3TTNA 5H8FA 3QXMA 5I58B 2Q89A 3OMBA 3PU5A 4U23A 2D3IA 2B4LA 4JSOA 4BDMA 4I8CA 4R6KA 1B3GA 4RK2A 4H8JA 3KGCA 2I4CA 4ISUA 3CRBA 4O3CA 4JXIA 4XTCQ 1AH5A 3ILUB 3LR1A 4U4SA 3MP1A 3KFMA 1FTOA 1B58A 3SEYA 1N3XA 1DOTA 2G29A 1TXFA 5TPAB 3MP6A 5DEXA 5I84A 1H44A 4PFWA 3VVFA 1ZBMA 2O7IA 4U21A 5AA2A 5FTHA 1CB6A 3IORA 4IO3A 1P1NA 1URSA 4JWXA 3KN3A 4NF8B 4HW8A 3ODBA 1IITA 4ZZAA 3G3GA 4EQ7A 5CI5A 1D9VA 4YB7A 4F18A 3D4GA 4KPTA 1N04A 1WODA 1YCJA 3PUYE 2BJJX 5TU0A 2PT1A 4BLAA 3UK4A 2I0BA 3B6WA 5H8HA 5CC2A 2D21A 3PV0E 3KN7A 1IXCA 2AL4A 2QS1A 3SERA 3IOTA 3T9XB 4EXKA 3V89B 3T96B 3K1NA 3FGSA 1SYIA 4R9GA 2AIXA 2UVJA 3ZKLA 2RKMA 1UTBB 2GRVA 1SQYA 3VVEA 1IXGA 5L8DA 3BKIB 3UORA 2DVZA 1US5A 3QSLA 2V3UA 5HPQA 5KDTA 2RC9A 3LSXA 1YAEA 3TQWA 5I58A 5I59B 3A09A 4YMBA 2UYEA 1A55A 4MH5A 4HTGA 4IGTA 5ICTA 2B4MA 4OEUA 1F9BA 2ONKE 2XXPA 5I56A 5H8NB 4MLQA 1USYE 2HCAA 2LAOA 1MS7A 2M8CA 4C0RA 4QFKA 1ZJLA 2WOLA 3PUXE 4PFYA 3CI8A 3DRFA 4KD5A 3CR9A 4ESXA 2ZNSA 2I49A 4EUOA 1Y3NA 1IXHA 3IX1A 1LFGA 5HM4B 1B3HA 3KSXA 5TPAA 4OENA 1DPPA 4U22A 1NFTA 1D9YA 3KJTA 1MY0A 2DQVA 2I3WA 1LB8A 3PPRA 5DT6A 1D4NA 1QKBA 4YZZA 3U72A 4F31B 4H65A 3UN6A 1LBBA 4NF8A 4X9TA 5JTYB 5ITOA 3BFTA 4HCYA 3OELA 3RT6B 1WDNA 1Y3PA 3FATA 3UP9A 4OHNA 3DP8A 1A40A 2DE4A 3DP4A 3CVGA 3D4CA 4F3SA 4R6YA 1T0KA 1ZMGA 1MY3A 3S9MC 1MG1A 3ZS6A 4BDQA 2XXYA 3OXNA 4R2FA 1N3WA 4MBPA 5FHNA 5B7DA 1NL5A 2OCUA 1ZLQA 1P1WA 4OZ9A 3LVUA 1L5TA 4LZ5A 3QUJA 1VR5A 3LSFB 1B9JA 1UTBA 1N7XA 5L9OA 3TDJA 1IZ1A 3HO7A 1TFAA 1S9TA 1II5A 5L9MA 1LCFA 2H5YA 1LAFE 4AQ4A 3HV1A 2Q2AA 4LZ8A 3CSBA 4NMYA 3C31A 2WOKA 3FV1A 3GXAA 2OK2A 1OLAA 3PMXA 1Q35A 4Z7EA 2I58A 4X48A 3UA8A 1A7LA 4DE8A 5I2KB 5TP9B 2O51A 3H4ZA 3FXUA 3O97A 5H8NA 3FASA 2H99A 2Y7KA 1Y9UA 3TZAA 4G8NA 2OBGA 2KLFA 1MM6A 3TEPA 2XHDA 4NTLA 5DTBA 3O2AA 2GH9A 3O66A 4WEPA 3JV9A 3K1MA 1B40A 4ZEBA 3SKPA 4DIGA 4ZECA 1PEBA 4I62A 2Q8JA 3M3LA 4QSCA 5F1QA 2O84X 1MQJA 3FJ7A 1IQ7A 4YKIA 1B46A 5I57B 4XKNA 3TTMA 3BFUA 1ANFA 1XHYA 2VHAA 5AA3A 2XD3A 4PE5B 5JTYA 3T93B 3B6QA 4JWYA 2I4BA 2ZNTA 4KFQA 1PBPA 3VDFA 2QRYA 2QPQA 2R9JA 3IO6A 3G3JA 2VOZA 3CFXA 4OETA 3FVOA 4ONYA 3W9WA 3Q27A 1KWHA 3PGFA 3RGYA 2Y84A 1B3EA 3RYAA 3H7MA 2PMSA 2REJA 3AXFA 4I1DA 3MZ9A 3PUZE 3KN8A 1EZOA 1Q1KA 1PB8A 1DTZA 1SD3A 4L17A 2ANJA 2VP1A 3PD8A 2UVIA 4KHZE 1QUIA 2FNCA 3C4MA 3PUWE 4DXBA 2B3FA 2F34A 1US4A 4YMAA 4E0WA 2P0SA 3FJGA 4M4GA 1P1UA 4GXSB 1FQDA 5JEIA 2XXTA 5I2KA 4R74A 2IA4A 4NF5A 2Y7IA 5I2NA 2X7QA 4P0GA 1Z7NE 4OMBA 2DE2A 1LB9A 1R9QA 1Y1MA 3B7DA 4PQJA 3T9VA 4KI0E 4BDRA 3PPNA 4YAHX 1FW0A 3PPQA 4EF1A 3MVWA 4EQBA 4XKPA 4NF4A 2QSXA 4IY5A 5I57A 3QK6A 3C32A 4TLLB 3PUVE 1XVXA 2YJPA 4PP0A 5H8QB 2G93A 1QUJA 2Z8FA 4G68A 1GV8A 4Q30B 4ZZEA 1MXXA 4H5GA 1LFIA 1OVTA 3O29A 4O3BA 3MZBA 1JVXA 3VXCA 3CIJA 3TCHA 4H0WA 1RYOA 2A5TB 2F35A 1QJMA 3G3IA 4KR5A 3KOSA 4GD5A 3K6VA 4F3PA 3PMWA 4ZEFA 3P7IA 2V25A 3K0VA 2QS3A 5CBSA 3K1PA 2NOOA 3Q25A 2QS2A 4KYEA 3G3HA 1MH4A 4MLVA 1N84A 5CRYA 4F19A 1MRPA 4F2QA 4QFOA 3FVGA 4HCWA 4GWOA 4DZ1A 3IB2A 4QFLA 4NE4A 1SVXB 3R6UA 3FZVA 3O9PA 1MY2A 4BDNA 3FD3A 4Q0CA 3KBRA 4RJZA 5FHMA 4F3GA 2RC8A 3N6UA 1BKAA 1FQBA 4EDPA 4E0XA 3TCGA 1LBCA 1JW1A 2DE3A 1P99A 5AA4B 3M3FA 3M8UA 3RYBA 1JW4A 3MC2A 1N0TA 1GR2A 1OIBA 1RYXA 1OQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F6G A;  2Q88 A;  1CE2 A;  3O6G A;  4IB2 A;  4ELQ A;  4R72 A;  3HHF A;  2ABH A;  3MQ9 A;  2O1M A;  4OVJ A;  2AYS A;  5H8S A;  4GLI A;  1VFE A;  2ONR A;  1D3K A;  4H67 A;  4OYV A;  3IB1 A;  3SEV A;  1OLC A;  1IIW A;  3MW0 A;  3FXQ A;  2E0S A;  1B1X A;  4GRK A;  1BP5 A;  2A5T A;  1H76 A;  1RKM A;  2NVU B;  3ZKK A;  3R7X A;  4RYA A;  3VE1 B;  4XXU A;  4JDF A;  3DRH A;  4X1B A;  4F1U A;  2XXI A;  3I3V A;  1I6Q A;  2XXQ A;  3LSW A;  4IGR A;  4ZE9 A;  2F5X A;  2B65 A;  4FOR A;  3ILT B;  2RCB A;  1MPB A;  3RLF E;  2QS4 A;  3DRG A;  1LAH E;  2DWA A;  4R9F A;  3DRK A;  5ISU A;  4FEB A;  4IO4 A;  5BWJ A;  4NWC A;  2O6A A;  3TOD A;  1MH3 A;  4ZE8 A;  4OQO A;  4YU0 A;  4LQ5 A;  1B0L A;  1Y3Q A;  4M1V A;  3TYH A;  4NWD A;  2Z8E A;  4JBZ A;  4YB5 A;  3USD A;  3H6U A;  3EN3 A;  2UXA A;  4EF2 A;  3VV5 A;  2HZL A;  2DVC A;  4WKM A;  2CZL A;  5AA4 A;  3W15 C;  2Y7P A;  3RT8 A;  3LC8 A;  4R73 A;  4TQU Q;  3HN0 A;  2RIN A;  4F22 A;  3IO4 A;  4EXL A;  4ELR A;  4TOZ A;  1MXW A;  2NWJ A;  1SW2 A;  4UA8 A;  2WOP A;  1NMU A;  1JEV A;  3CG3 A;  2R6G E;  3Q28 A;  4GVO A;  4IO2 A;  4QFP A;  1UIV A;  2HAV A;  3R26 A;  3OO6 A;  3TTK A;  1SW1 A;  1SI1 A;  1MXV A;  2Y7R A;  4O3A A;  2PVU A;  2E1S A;  1MQI A;  4OEV A;  4OFJ A;  1N7W A;  1JET A;  4Q5T A;  3HCQ A;  4GFR A;  1DTG A;  1SW5 A;  5CM6 A;  3O6P A;  4P0I A;  4U4X A;  2Y7W A;  2XXV A;  5I59 A;  4LQ2 A;  4H5F A;  1MDQ A;  4G68 C;  3H6V A;  4K3F A;  3OOA A;  1BLF A;  1R9L A;  2NUV A;  1P1O A;  2GHB A;  3IOW A;  3MVX A;  3PMV A;  1MY1 A;  3VLV A;  3K6U A;  1OMP A;  5J1D A;  1A54 A;  1IEJ A;  5DVF A;  2I48 A;  3LUY A;  4C1T A;  3DEL B;  1TFD A;  5K2X A;  1JEU A;  4RK9 A;  5KZT A;  5A5X B;  5AA2 D;  1ELJ A;  3ONM A;  4THI A;  2GFE A;  1PBQ A;  3FV2 A;  1LCT A;  2XXW A;  3S4U A;  2X26 A;  4KCC A;  2O68 A;  1NKX A;  1H3D A;  4ZEK A;  5CMC A;  4YKK A;  3U94 A;  3MWB A;  1XVY A;  1B5H A;  3MVZ A;  1BIY A;  3TCF A;  1VFD A;  1XS5 A;  3EHU A;  4QSE A;  1H43 A;  2Q2C A;  2H98 A;  4JB7 A;  3H6W A;  1B0H A;  1PC3 A;  3E3K A;  1FQC A;  4POW A;  3OO9 A;  2OWT A;  2F7B A;  2WKY A;  3FXR A;  3GBB A;  5F7V A;  1Y4C A;  2FA7 A;  4GIZ A;  3DM0 A;  1JNF A;  1FQF A;  4FE8 A;  3H03 A;  5H8F B;  1HSJ A;  3TUS A;  3IR1 A;  4BDO A;  3U92 A;  3U93 A;  3EHS A;  3JYR A;  3VLU A;  4U1Z A;  3N94 A;  3H06 B;  4ZEI A;  2QMX A;  4GL8 A;  4LAT A;  1I69 A;  4RPN A;  1LST A;  4G77 A;  1SBP A;  2XX9 A;  4FIM A;  4KQP A;  1ATG A;  4LZ7 A;  5LOM A;  1O7T A;  4JWO A;  3K6X A;  5TP9 A;  3OSQ A;  3SES A;  1B5I A;  2YLN A;  3C35 A;  2RF1 A;  4R6H A;  2D5W A;  2DXR A;  3V83 A;  5EYF A;  2B3B A;  3HST A;  2UYF A;  2Z23 A;  2ZYK A;  3H3G A;  1TT1 A;  4PET A;  1FQE A;  4F1Y A;  3T66 A;  4DCY A;  3SEW A;  3PD9 A;  4IO5 A;  1EU8 A;  3OEM A;  4WXJ A;  2F7C A;  1FQA A;  2ZNU A;  3KG2 A;  1JW5 A;  4N13 A;  4ELO A;  4X1D A;  4QFN A;  5A5X A;  3CSG A;  3DLN A;  4U2R A;  2PX1 A;  4YIC A;  4ZS9 A;  2QL3 A;  1MXZ A;  3O6H A;  2PT2 A;  1MM7 A;  4YKP A;  3WAF A;  1LAG E;  4ELP A;  1B4Z A;  3O28 A;  3RQT A;  1EH3 A;  3M3K A;  3MBP A;  4UAC A;  2P1S A;  1QKA A;  1B2H A;  3MZ1 A;  4LA9 A;  5ICQ A;  5DVI A;  3K02 A;  1SDX A;  1AMF A;  3OO7 A;  4F29 A;  1B7Z A;  4Z0I A;  2I3V A;  3UIF A;  1SI0 A;  2H9B A;  3TTL A;  1B3F A;  1TWY A;  4FEC A;  3TMG A;  1Y20 A;  3IJX B;  3EF7 A;  4DCX A;  2XX7 A;  1P1Q A;  1I6B A;  4XIG Q;  3C9H A;  3SDF A;  2W7Y A;  4KCD A;  3C33 A;  3GZG A;  1UIU A;  2DP8 A;  4QF9 A;  4KYD A;  3MAM A;  2REG A;  2ONS A;  1XT8 A;  3E13 X;  1MQG A;  3B6T A;  3U8Q A;  3L6G A;  3I6V A;  4N6P A;  1YPN A;  2ALU A;  2OLB A;  1WVJ A;  1GVC A;  4ND9 A;  1ZU0 A;  3OEN A;  1VE4 A;  2ZMB A;  1MDP 1;  5I56 B;  4XKQ A;  2ZXT A;  4PFU A;  3LBS A;  4F39 A;  3SET A;  3C34 A;  4G8H A;  3VFJ A;  4RXL A;  3TAJ A;  3S9L C;  3KOT A;  1VSO A;  1O64 A;  2X7P A;  1M5D A;  2Z22 A;  3MP8 A;  4FAT A;  4GF8 A;  1R1N A;  2F97 A;  4F2O A;  1R6Z A;  2GHA A;  4FAJ A;  3LSL A;  2H4I A;  4OER A;  3HHG A;  1QW0 A;  3U1O A;  3N26 A;  1AL3 A;  3OO8 A;  3CG1 A;  1NH8 A;  4POX A;  5EHS A;  3OSR A;  3K4U A;  1PB9 A;  2PYY A;  4LVQ A;  3QYT A;  3RTF B;  1MXU A;  1PB7 A;  3G3K A;  1M5E A;  2VD2 A;  2F78 A;  3FVN A;  4ZDM A;  3TTR A;  4RA1 A;  1B1H A;  3DRI A;  4OES A;  5JK4 A;  3FTO A;  4F1V A;  1MQH A;  1NH7 A;  2DYX A;  5H8Q A;  3VVD A;  1FTM A;  4WED A;  4IY6 A;  3KSJ A;  5IAI A;  4AB5 A;  3EHT A;  3EQ1 A;  2XD2 A;  4RPO A;  4NF6 B;  1POY 1;  3IB0 A;  1H45 A;  4MF3 A;  5B70 A;  4MFI A;  1NNK A;  3EPE A;  1O63 A;  1QUK A;  1M5F A;  2DWJ A;  2XXH A;  1DPE A;  3KJ7 A;  2I0C A;  2UVH A;  1URG A;  2O69 A;  1BTJ A;  5AA1 A;  1OQG A;  1B51 A;  4OWD A;  1ZKB A;  3MPL A;  4KYS A;  4OFO A;  3RTW B;  1EZ9 A;  1LAX A;  5CMB A;  5FTI A;  3IK6 B;  3N5L A;  1M5C A;  5CMM A;  3THI A;  3IOV A;  1B6H A;  2VGQ A;  3JZJ A;  4RY1 A;  1POT A;  3OD7 A;  1ZTY A;  1A99 A;  3ECR A;  3Q29 A;  3E9X A;  5IKB A;  2I6E A;  2XXR A;  2F7A A;  2V93 A;  1J1N A;  2NXO A;  3V5A A;  4DLD A;  1UQW A;  1MQD A;  3FJM A;  3TKD A;  2P2A A;  4F3B A;  4GXA A;  2HZK A;  5K2Y A;  3PAM A;  2F36 A;  4NED A;  5EHM A;  5ELV A;  3WAE A;  5AE4 A;  1OVB A;  2OZZ A;  4YKJ A;  3UGW A;  2O7U A;  4H1X A;  2HXW A;  1UTH B;  2OWS A;  2UVG A;  2F6P A;  2ZYN A;  3RN8 A;  3QAX A;  3FIR A;  4IO7 A;  3SEX A;  4QSD A;  1LLS A;  4LON B;  4NF6 A;  1MXY A;  1Y1Z A;  1DMB A;  4HS7 A;  1Z7M E;  1XC1 A;  1PDA A;  3MPK A;  2CMO A;  1MPC A;  1QVS A;  4H6D A;  4G8M A;  1EZP A;  2V84 A;  1M5B A;  4G4P A;  2DSF A;  3DP6 A;  3SEU A;  4IO6 A;  3FVK A;  3GBA A;  5KCJ B;  3S9E A;  2XX8 A;  3F11 A;  3MJN A;  2V3Q A;  3T9U A;  1B32 A;  4ESW A;  1AIV A;  3H6T A;  1FTL A;  3VXB A;  3T9H B;  2PBW A;  3T22 A;  4NF5 B;  3KZG A;  4G2Z A;  5I2N B;  4H8I A;  2AL5 A;  5HBC A;  1A8E A;  3PPP A;  1IXI A;  3RPW A;  1FTJ A;  3TQL A;  1N76 A;  4FJP A;  1XOC A;  1NNT A;  3BBR A;  3RY3 A;  5DVJ A;  3PPO A;  5CBR A;  1B4H A;  1URD A;  3S2V A;  3RNN A;  3IL1 B;  4ECF A;  1B3L A;  4N07 A;  4JSD A;  4NF4 B;  4OXV A;  3ZSF A;  2R71 A;  3CHG A;  2V3T A;  2H25 A;  3N6T A;  2HQ0 A;  3VLW A;  3E4R A;  1S50 A;  4DXU A;  4G68 B;  2F8D A;  1B52 A;  4Q8R A;  1SYH A;  4ZED A;  5ITP A;  3DRJ A;  3MUQ A;  4QRZ A;  3MVY A;  3TPA A;  1UTH A;  4GOT A;  1JQF A;  4GL0 A;  3W9V A;  1ZIU A;  4PFT A;  2VD3 A;  4TLM B;  2HEU A;  1B7U A;  2QJE A;  5BUU A;  3HPI A;  5L9S A;  3K01 A;  4XKR A;  4FED A;  4OTE A;  1LGB C;  1HSE A;  1Y4T A;  3OEK A;  3QIM A;  2XXX A;  1LFH A;  1FCK A;  3IJO B;  2DWH A;  5M2V A;  1B5J A;  4DXC A;  2HFB A;  3K6W A;  4LP2 B;  1MY4 A;  4QHQ A;  4RNS A;  4OFL A;  3FUZ A;  3K2D A;  4C1U A;  1B7H A;  1SW4 A;  5KCJ A;  1MPD A;  2DS9 A;  4R75 A;  4I9D A;  3L6H A;  5DYH A;  5DEX B;  1B05 A;  2IEE A;  3G3F A;  3CFL A;  1NNF A;  4EQ9 A;  1I6A A;  1IUD A;  5FHO A;  3RUM A;  5AA2 B;  4AB6 A;  1NNP A;  3I5O A;  2ESN A;  2DXY A;  3IAZ A;  3S9N C;  4U1O A;  2THI A;  4BDL A;  1FTK A;  2FYI A;  2HAU A;  5CMK A;  3A3C A;  1HSL A;  1GGG A;  3QUF A;  3GLB A;  2YPN A;  2OJT A;  4R2B A;  2ZYM A;  2ZYO A;  3CFZ A;  2RC7 A;  3IOU A;  3A3U A;  5H8H B;  2XXU A;  3K00 A;  3Q26 A;  1YTV A;  1DSN A;  3G7W A;  4DDD A;  2Q9T A;  1S7Y A;  3TFL A;  3TEL A;  2A5S A;  1A8F A;  1GTK A;  1AOV A;  2RCA A;  3O6I A;  1QUL A;  2Z8D A;  1USY H;  1JVY A;  2O1L A;  4YB6 A;  4P11 A;  2DWI A;  3C36 A;  4LUB A;  3V8X B;  4GQO A;  2DOJ A;  5KDT B;  3KEI A;  2QMW A;  3TTN A;  5H8F A;  3QXM A;  5I58 B;  2Q89 A;  3OMB A;  3PU5 A;  4U23 A;  2D3I A;  2B4L A;  4JSO A;  4BDM A;  4I8C A;  4R6K A;  1B3G A;  4RK2 A;  4H8J A;  3KGC A;  2I4C A;  4ISU A;  3CRB A;  4O3C A;  4JXI A;  4XTC Q;  1AH5 A;  3ILU B;  3LR1 A;  4U4S A;  3MP1 A;  3KFM A;  1FTO A;  1B58 A;  3SEY A;  1N3X A;  1DOT A;  2G29 A;  1TXF A;  5TPA B;  3MP6 A;  5DEX A;  5I84 A;  1H44 A;  4PFW A;  3VVF A;  1ZBM A;  2O7I A;  4U21 A;  5AA2 A;  5FTH A;  1CB6 A;  3IOR A;  4IO3 A;  1P1N A;  1URS A;  4JWX A;  3KN3 A;  4NF8 B;  4HW8 A;  3ODB A;  1IIT A;  4ZZA A;  3G3G A;  4EQ7 A;  5CI5 A;  1D9V A;  4YB7 A;  4F18 A;  3D4G A;  4KPT A;  1N04 A;  1WOD A;  1YCJ A;  3PUY E;  2BJJ X;  5TU0 A;  2PT1 A;  4BLA A;  3UK4 A;  2I0B A;  3B6W A;  5H8H A;  5CC2 A;  2D21 A;  3PV0 E;  3KN7 A;  1IXC A;  2AL4 A;  2QS1 A;  3SER A;  3IOT A;  3T9X B;  4EXK A;  3V89 B;  3T96 B;  3K1N A;  3FGS A;  1SYI A;  4R9G A;  2AIX A;  2UVJ A;  3ZKL A;  2RKM A;  1UTB B;  2GRV A;  1SQY A;  3VVE A;  1IXG A;  5L8D A;  3BKI B;  3UOR A;  2DVZ A;  1US5 A;  3QSL A;  2V3U A;  5HPQ A;  5KDT A;  2RC9 A;  3LSX A;  1YAE A;  3TQW A;  5I58 A;  5I59 B;  3A09 A;  4YMB A;  2UYE A;  1A55 A;  4MH5 A;  4HTG A;  4IGT A;  5ICT A;  2B4M A;  4OEU A;  1F9B A;  2ONK E;  2XXP A;  5I56 A;  5H8N B;  4MLQ A;  1USY E;  2HCA A;  2LAO A;  1MS7 A;  2M8C A;  4C0R A;  4QFK A;  1ZJL A;  2WOL A;  3PUX E;  4PFY A;  3CI8 A;  3DRF A;  4KD5 A;  3CR9 A;  4ESX A;  2ZNS A;  2I49 A;  4EUO A;  1Y3N A;  1IXH A;  3IX1 A;  1LFG A;  5HM4 B;  1B3H A;  3KSX A;  5TPA A;  4OEN A;  1DPP A;  4U22 A;  1NFT A;  1D9Y A;  3KJT A;  1MY0 A;  2DQV A;  2I3W A;  1LB8 A;  3PPR A;  5DT6 A;  1D4N A;  1QKB A;  4YZZ A;  3U72 A;  4F31 B;  4H65 A;  3UN6 A;  1LBB A;  4NF8 A;  4X9T A;  5JTY B;  5ITO A;  3BFT A;  4HCY A;  3OEL A;  3RT6 B;  1WDN A;  1Y3P A;  3FAT A;  3UP9 A;  4OHN A;  3DP8 A;  1A40 A;  2DE4 A;  3DP4 A;  3CVG A;  3D4C A;  4F3S A;  4R6Y A;  1T0K A;  1ZMG A;  1MY3 A;  3S9M C;  1MG1 A;  3ZS6 A;  4BDQ A;  2XXY A;  3OXN A;  4R2F A;  1N3W A;  4MBP A;  5FHN A;  5B7D A;  1NL5 A;  2OCU A;  1ZLQ A;  1P1W A;  4OZ9 A;  3LVU A;  1L5T A;  4LZ5 A;  3QUJ A;  1VR5 A;  3LSF B;  1B9J A;  1UTB A;  1N7X A;  5L9O A;  3TDJ A;  1IZ1 A;  3HO7 A;  1TFA A;  1S9T A;  1II5 A;  5L9M A;  1LCF A;  2H5Y A;  1LAF E;  4AQ4 A;  3HV1 A;  2Q2A A;  4LZ8 A;  3CSB A;  4NMY A;  3C31 A;  2WOK A;  3FV1 A;  3GXA A;  2OK2 A;  1OLA A;  3PMX A;  1Q35 A;  4Z7E A;  2I58 A;  4X48 A;  3UA8 A;  1A7L A;  4DE8 A;  5I2K B;  5TP9 B;  2O51 A;  3H4Z A;  3FXU A;  3O97 A;  5H8N A;  3FAS A;  2H99 A;  2Y7K A;  1Y9U A;  3TZA A;  4G8N A;  2OBG A;  2KLF A;  1MM6 A;  3TEP A;  2XHD A;  4NTL A;  5DTB A;  3O2A A;  2GH9 A;  3O66 A;  4WEP A;  3JV9 A;  3K1M A;  1B40 A;  4ZEB A;  3SKP A;  4DIG A;  4ZEC A;  1PEB A;  4I62 A;  2Q8J A;  3M3L A;  4QSC A;  5F1Q A;  2O84 X;  1MQJ A;  3FJ7 A;  1IQ7 A;  4YKI A;  1B46 A;  5I57 B;  4XKN A;  3TTM A;  3BFU A;  1ANF A;  1XHY A;  2VHA A;  5AA3 A;  2XD3 A;  4PE5 B;  5JTY A;  3T93 B;  3B6Q A;  4JWY A;  2I4B A;  2ZNT A;  4KFQ A;  1PBP A;  3VDF A;  2QRY A;  2QPQ A;  2R9J A;  3IO6 A;  3G3J A;  2VOZ A;  3CFX A;  4OET A;  3FVO A;  4ONY A;  3W9W A;  3Q27 A;  1KWH A;  3PGF A;  3RGY A;  2Y84 A;  1B3E A;  3RYA A;  3H7M A;  2PMS A;  2REJ A;  3AXF A;  4I1D A;  3MZ9 A;  3PUZ E;  3KN8 A;  1EZO A;  1Q1K A;  1PB8 A;  1DTZ A;  1SD3 A;  4L17 A;  2ANJ A;  2VP1 A;  3PD8 A;  2UVI A;  4KHZ E;  1QUI A;  2FNC A;  3C4M A;  3PUW E;  4DXB A;  2B3F A;  2F34 A;  1US4 A;  4YMA A;  4E0W A;  2P0S A;  3FJG A;  4M4G A;  1P1U A;  4GXS B;  1FQD A;  5JEI A;  2XXT A;  5I2K A;  4R74 A;  2IA4 A;  4NF5 A;  2Y7I A;  5I2N A;  2X7Q A;  4P0G A;  1Z7N E;  4OMB A;  2DE2 A;  1LB9 A;  1R9Q A;  1Y1M A;  3B7D A;  4PQJ A;  3T9V A;  4KI0 E;  4BDR A;  3PPN A;  4YAH X;  1FW0 A;  3PPQ A;  4EF1 A;  3MVW A;  4EQB A;  4XKP A;  4NF4 A;  2QSX A;  4IY5 A;  5I57 A;  3QK6 A;  3C32 A;  4TLL B;  3PUV E;  1XVX A;  2YJP A;  4PP0 A;  5H8Q B;  2G93 A;  1QUJ A;  2Z8F A;  4G68 A;  1GV8 A;  4Q30 B;  4ZZE A;  1MXX A;  4H5G A;  1LFI A;  1OVT A;  3O29 A;  4O3B A;  3MZB A;  1JVX A;  3VXC A;  3CIJ A;  3TCH A;  4H0W A;  1RYO A;  2A5T B;  2F35 A;  1QJM A;  3G3I A;  4KR5 A;  3KOS A;  4GD5 A;  3K6V A;  4F3P A;  3PMW A;  4ZEF A;  3P7I A;  2V25 A;  3K0V A;  2QS3 A;  5CBS A;  3K1P A;  2NOO A;  3Q25 A;  2QS2 A;  4KYE A;  3G3H A;  1MH4 A;  4MLV A;  1N84 A;  5CRY A;  4F19 A;  1MRP A;  4F2Q A;  4QFO A;  3FVG A;  4HCW A;  4GWO A;  4DZ1 A;  3IB2 A;  4QFL A;  4NE4 A;  1SVX B;  3R6U A;  3FZV A;  3O9P A;  1MY2 A;  4BDN A;  3FD3 A;  4Q0C A;  3KBR A;  4RJZ A;  5FHM A;  4F3G A;  2RC8 A;  3N6U A;  1BKA A;  1FQB A;  4EDP A;  4E0X A;  3TCG A;  1LBC A;  1JW1 A;  2DE3 A;  1P99 A;  5AA4 B;  3M3F A;  3M8U A;  3RYB A;  1JW4 A;  3MC2 A;  1N0T A;  1GR2 A;  1OIB A;  1RYX A;  1OQH A; 
#chains in the Genus database with same CATH topology
 2F6G A;  2Q88 A;  1CE2 A;  3O6G A;  4IB2 A;  4ELQ A;  2HXR A;  4R72 A;  3HHF A;  4P1L A;  2ABH A;  3MQ9 A;  4HE1 A;  3B8B A;  4NG7 A;  2O1M A;  4OVJ A;  2AYS A;  5H8S A;  4GLI A;  1VFE A;  2ONR A;  1D3K A;  4H67 A;  4OYV A;  3IB1 A;  3SEV A;  1OLC A;  2XWV A;  1Q9D A;  1IIW A;  3MW0 A;  3FXQ A;  2E0S A;  1B1X A;  4GRK A;  1BP5 A;  2A5T A;  3A29 A;  1H76 A;  1RKM A;  2NVU B;  3ZKK A;  3R7X A;  4PBH A;  4RYA A;  3VE1 B;  4XXU A;  4JDF A;  1YZ0 A;  3DRH A;  4X1B A;  4F1U A;  4PFR A;  2XXI A;  4N81 A;  3I3V A;  1I6Q A;  2XXQ A;  3LSW A;  4IGR A;  4ZE9 A;  2PFZ A;  5LDZ A;  2F5X A;  2B65 A;  4FOR A;  3RPL A;  3ILT B;  2RCB A;  1MPB A;  3RLF E;  2QS4 A;  1K9Z A;  2Q74 A;  3DRG A;  1LAH E;  2DWA A;  5J16 A;  4R9F A;  3DRK A;  5ISU A;  4FEB A;  1KA1 A;  4IO4 A;  5BWJ A;  4NWC A;  2O6A A;  3TOD A;  1MH3 A;  4ZE8 A;  4OQO A;  4YU0 A;  4LQ5 A;  4PC9 A;  1B0L A;  4PGP A;  1Y3Q A;  4M1V A;  3TYH A;  4NWD A;  2Z8E A;  4JBZ A;  4YB5 A;  3USD A;  3H6U A;  2CEY A;  3EN3 A;  2WYK A;  2UXA A;  4EF2 A;  4O8M A;  3VV5 A;  4GWU A;  2HZL A;  2DVC A;  5IZ3 A;  3MST A;  4WKM A;  1QGX A;  2CZL A;  5AA4 A;  3W15 C;  2Y7P A;  4NQ8 A;  3LC8 A;  3RT8 A;  4R73 A;  1LBV A;  4TQU Q;  3HN0 A;  2RIN A;  4F22 A;  3IO4 A;  1FPF A;  4GBW A;  4EXL A;  4ELR A;  2DDK A;  4TOZ A;  4P56 A;  5I7I A;  1MXW A;  2NWJ A;  1SW2 A;  4UA8 A;  2WOP A;  1NMU A;  1JEV A;  3CG3 A;  2R6G E;  3Q28 A;  4GVO A;  4IO2 A;  4QFP A;  1UIV A;  2HAV A;  1EYJ A;  3R26 A;  3OO6 A;  2WX9 A;  3TTK A;  1SW1 A;  1SI1 A;  5T3J A;  2VT5 A;  1MXV A;  2Y7R A;  4O3A A;  2PVU A;  2E1S A;  1MQI A;  4OEV A;  3E79 A;  4OFJ A;  4OVS A;  1N7W A;  1JET A;  1FBC A;  4Q5T A;  3HCQ A;  4GFR A;  1DTG A;  1SW5 A;  5CM6 A;  1IME A;  3O6P A;  4P0I A;  4U4X A;  2Y7W A;  2XXV A;  5I59 A;  4LQ2 A;  4PAF A;  4DI4 B;  4H5F A;  1MDQ A;  1NUW A;  4G68 C;  3H6V A;  2CZI A;  4K3F A;  3OOA A;  1BLF A;  1R9L A;  2NUV A;  1P1O A;  2GHB A;  3IOW A;  3MVX A;  3PMV A;  1MY1 A;  3VLV A;  3K6U A;  1OMP A;  3U65 A;  5J1D A;  1A54 A;  1IEJ A;  5DVF A;  2I48 A;  3LUY A;  4C1T A;  3DEL B;  1TFD A;  5K2X A;  1JEU A;  4RK9 A;  4OVT A;  5KZT A;  5A5X B;  5AA2 D;  1ELJ A;  3ONM A;  1FPB A;  4THI A;  2GFE A;  1PBQ A;  3FV2 A;  1LCT A;  2XXW A;  5EYH A;  1LBZ A;  5ET7 A;  3S4U A;  2X26 A;  4KCC A;  2O68 A;  1NKX A;  1H3D A;  4ZEK A;  5CMC A;  4YKK A;  3U94 A;  3MWB A;  1XVY A;  1B5H A;  1LEV A;  4PAK A;  5EQ7 A;  3MVZ A;  1BIY A;  3TCF A;  1VFD A;  1XS5 A;  3EHU A;  4QSE A;  1H43 A;  2Q2C A;  4PF8 A;  2H98 A;  4MHF A;  4IR8 A;  4JB7 A;  3H6W A;  1B0H A;  4PFI A;  1PC3 A;  3E3K A;  1FQC A;  4P9K A;  4POW A;  3OO9 A;  2OWT A;  2F7B A;  2WKY A;  2BJI A;  2WBB A;  3FXR A;  3GBB A;  5F7V A;  1Y4C A;  2CEX A;  2FA7 A;  4GIZ A;  3DM0 A;  1FBH A;  1JNF A;  1FQF A;  4FE8 A;  3H03 A;  5H8F B;  1HSJ A;  3TUS A;  3IR1 A;  4BDO A;  3U92 A;  3U93 A;  3EHS A;  4MIJ A;  4NGU A;  3JYR A;  3VLU A;  4U1Z A;  3N94 A;  3H06 B;  4ZEI A;  2QMX A;  4GL8 A;  4LAT A;  1I69 A;  4RPN A;  4GX6 A;  1LST A;  4G77 A;  1XI6 A;  1SBP A;  2XX9 A;  4FIM A;  4KQP A;  1ATG A;  4LZ7 A;  4N91 A;  5LOM A;  1O7T A;  2OWZ A;  4JWO A;  3K6X A;  5TP9 A;  3OSQ A;  3SES A;  1NV3 A;  1B5I A;  2YLN A;  3C35 A;  3BIH A;  2RF1 A;  4R6H A;  2D5W A;  2DXR A;  3V83 A;  5EYF A;  2B3B A;  3HST A;  2UYF A;  2Z23 A;  2ZYK A;  3H3G A;  1TT1 A;  5ESY A;  4PET A;  1FQE A;  4F1Y A;  3T66 A;  4MCO A;  4DCY A;  3SEW A;  3PD9 A;  4IO5 A;  1EU8 A;  3OEM A;  4WXJ A;  2F7C A;  1FQA A;  2ZNU A;  3KG2 A;  1JW5 A;  4GWY A;  4N13 A;  1JP4 A;  2QVR A;  4ELO A;  4X1D A;  4QFN A;  5A5X A;  3CSG A;  3DLN A;  4U2R A;  2PX1 A;  4YIC A;  4ZS9 A;  2QL3 A;  1MXZ A;  3O6H A;  2PT2 A;  3QMF A;  1DBZ A;  1MM7 A;  5DW8 A;  4YKP A;  3WAF A;  1LAG E;  4ELP A;  1B4Z A;  3O28 A;  3RQT A;  1EH3 A;  3M3K A;  3MBP A;  4UAC A;  2P1S A;  1QKA A;  1B2H A;  3MZ1 A;  4LA9 A;  5ICQ A;  2QFL A;  5DVI A;  3K02 A;  1SDX A;  1AMF A;  3OO7 A;  4F29 A;  1B7Z A;  4Z0I A;  2I3V A;  3UIF A;  1SI0 A;  2H9B A;  4JVI A;  3TTL A;  1B3F A;  1TWY A;  4FEC A;  3TMG A;  1Y20 A;  3IJX B;  3EF7 A;  4XFE A;  4DCX A;  2XX7 A;  1P1Q A;  1I6B A;  4GWS A;  4XIG Q;  3C9H A;  3SDF A;  2W7Y A;  4KCD A;  3C33 A;  3GZG A;  1UIU A;  2DP8 A;  4QF9 A;  4KYD A;  3MAM A;  5F24 A;  2REG A;  2ONS A;  1XT8 A;  3E13 X;  1MQG A;  3B6T A;  4PF6 A;  3U8Q A;  3L6G A;  3I6V A;  4N6P A;  1YPN A;  2ALU A;  2OLB A;  1WVJ A;  1GVC A;  5IZ1 A;  4ND9 A;  4GWZ A;  1ZU0 A;  3OEN A;  1VE4 A;  3HFU A;  2ZMB A;  1MDP 1;  3B50 A;  5I56 B;  4XKQ A;  2ZXT A;  4PFU A;  3LBS A;  4F39 A;  3SET A;  3C34 A;  4G8H A;  3VFJ A;  4RXL A;  3TAJ A;  3S9L C;  3KOT A;  1VSO A;  1YXI A;  1O64 A;  2X7P A;  1M5D A;  2Z22 A;  3MP8 A;  4FAT A;  4GF8 A;  1R1N A;  2F97 A;  4F2O A;  1R6Z A;  2GHA A;  4FAJ A;  1NUY A;  3LSL A;  2H4I A;  4OER A;  3HHG A;  1QW0 A;  3U1O A;  3N26 A;  1AL3 A;  3OO8 A;  3CG1 A;  4MNI A;  1NH8 A;  4POX A;  5EHS A;  3OSR A;  3K4U A;  1PB9 A;  2PYY A;  4LVQ A;  3QYT A;  3RTF B;  1MXU A;  1PB7 A;  3G3K A;  1M5E A;  1FRP A;  2VD2 A;  2Q8M A;  2F78 A;  2XXK A;  3FVN A;  4ZDM A;  1RDZ A;  3TTR A;  5EYG A;  4RA1 A;  1B1H A;  3DRI A;  4OES A;  5JK4 A;  3FTO A;  4F1V A;  1MQH A;  1NH7 A;  2DYX A;  5H8Q A;  3VVD A;  1FTM A;  4WED A;  4IY6 A;  3KSJ A;  4O94 A;  5IAI A;  4AB5 A;  3EHT A;  3EQ1 A;  2XD2 A;  4RPO A;  4NF6 B;  1POY 1;  3IB0 A;  1H45 A;  4MF3 A;  5B70 A;  4MFI A;  1NNK A;  4O7M A;  3FXB A;  3EPE A;  1O63 A;  4N8G A;  1QUK A;  1M5F A;  2DWJ A;  2XXH A;  4I40 A;  1DPE A;  3KJ7 A;  4PDH A;  2I0C A;  2UVH A;  1URG A;  2HHM A;  2O69 A;  1BTJ A;  5AA1 A;  1OQG A;  1B51 A;  4OWD A;  1ZKB A;  3MPL A;  4KYS A;  4OFO A;  3RTW B;  1EZ9 A;  1FPD A;  4PCD A;  1LAX A;  4NAP A;  5CMB A;  5FTI A;  3ISP A;  3IK6 B;  1LBW A;  3N5L A;  1M5C A;  5CMM A;  3THI A;  3IOV A;  1B6H A;  2VGQ A;  3JZJ A;  4P1E A;  4OA4 A;  4RY1 A;  1POT A;  3OD7 A;  1ZTY A;  2QVV A;  1A99 A;  3ECR A;  3Q29 A;  2MKZ A;  3E9X A;  5IKB A;  2I6E A;  2XXR A;  2F7A A;  1LBX A;  2V93 A;  1J1N A;  2NXO A;  3V5A A;  4DLD A;  1UQW A;  2L5V A;  1MQD A;  3FJM A;  3TKD A;  2P2A A;  4N15 A;  4F3B A;  4GXA A;  2HZK A;  5K2Y A;  3PAM A;  2F36 A;  4NED A;  5EHM A;  5ELV A;  3WAE A;  1FBF A;  5AE4 A;  1OVB A;  2OZZ A;  4YKJ A;  3UGW A;  1SPI A;  2O7U A;  4H1X A;  2HXW A;  1FJ9 A;  1UTH B;  2OWS A;  2UVG A;  2F6P A;  2ZYN A;  3RN8 A;  3QAX A;  3FIR A;  4IO7 A;  3SEX A;  4QSD A;  1LLS A;  4LON B;  4GX3 A;  4QBA A;  4NF6 A;  1MXY A;  1Y1Z A;  1DMB A;  4HS7 A;  1Z7M E;  1XC1 A;  1PDA A;  3MPK A;  2CMO A;  1MPC A;  1QVS A;  4H6D A;  4G8M A;  1EZP A;  4OVP A;  2V84 A;  1M5B A;  4G4P A;  2DSF A;  3DP6 A;  1FPI A;  3SEU A;  4IO6 A;  3FVK A;  3GBA A;  5KCJ B;  3S9E A;  2XX8 A;  3F11 A;  3MJN A;  1VDW A;  2V3Q A;  3T9U A;  1B32 A;  3MYU A;  4ESW A;  1AIV A;  3H6T A;  1FTL A;  3VXB A;  2PBW A;  3T22 A;  3KC0 A;  4NF5 B;  3T9H B;  1FBG A;  3KZG A;  4G2Z A;  4N17 A;  5I2N B;  2QVU A;  1IMB A;  4H8I A;  2AL5 A;  5HBC A;  3EKI A;  4UAB A;  1A8E A;  3PPP A;  5IZZ A;  1IXI A;  3RPW A;  1FTJ A;  3TQL A;  1N76 A;  4FJP A;  1XOC A;  1NNT A;  1RDY A;  3BBR A;  4PDD A;  1IMF A;  3RY3 A;  5DVJ A;  3PPO A;  5ET8 A;  5CBR A;  2WEF A;  5LTC A;  1B4H A;  1URD A;  3S2V A;  3RNN A;  3IL1 B;  4ECF A;  1B3L A;  4N07 A;  4JSD A;  4NF4 B;  1G0I A;  4OXV A;  3ZSF A;  2R71 A;  3CHG A;  2V3T A;  4NHB A;  2H25 A;  3N6T A;  2HQ0 A;  3VLW A;  4PAI A;  3E4R A;  1S50 A;  2XA5 A;  4DXU A;  1IMA A;  4G68 B;  1EYK A;  2F8D A;  1B52 A;  2ZZV A;  4Q8R A;  1SYH A;  4ZED A;  5ITP A;  3DRJ A;  3MUQ A;  4QRZ A;  3MVY A;  3TPA A;  1UTH A;  3ROJ A;  4GOT A;  1JQF A;  4GL0 A;  3W9V A;  1ZIU A;  4PFT A;  2VD3 A;  4TLM B;  4PFB A;  2HEU A;  1B7U A;  2P3V A;  2QJE A;  5BUU A;  3HPI A;  5L9S A;  3K01 A;  4XKR A;  4FED A;  4OTE A;  1FJ6 A;  1LGB C;  1HSE A;  3IFA A;  1Y4T A;  3OEK A;  3QIM A;  4OVQ A;  2XXX A;  1LFH A;  1FCK A;  3IJO B;  2DWH A;  5M2V A;  1B5J A;  4DXC A;  2HFB A;  3K6W A;  4LP2 B;  4DI3 D;  1MY4 A;  2CZH A;  3GYY A;  4QHQ A;  4RNS A;  4OFL A;  1DCU A;  3FUZ A;  3K2D A;  4C1U A;  1B7H A;  1SW4 A;  5KCJ A;  1MPD A;  2DS9 A;  4R75 A;  1FSA A;  4QXD A;  4I9D A;  1NUZ A;  1D9Q A;  3L6H A;  2FBP A;  3T0J A;  4HE2 A;  2FVZ A;  5DYH A;  5DEX B;  1B05 A;  2IEE A;  3G3F A;  3CFL A;  1NNF A;  4EQ9 A;  1I6A A;  1IUD A;  5FHO A;  3RUM A;  5AA2 B;  4AB6 A;  1NNP A;  2FHY A;  3I5O A;  2ESN A;  2DXY A;  3IAZ A;  3S9N C;  4U1O A;  2THI A;  4BDL A;  1FTK A;  2FYI A;  2HAU A;  4I3E A;  5CMK A;  3A3C A;  1HSL A;  1GGG A;  3QUF A;  3GLB A;  1NUX A;  2YPN A;  4NF0 A;  4X8R A;  2OJT A;  4R2B A;  5FBP A;  2ZYM A;  2ZYO A;  3CFZ A;  2RC7 A;  3IOU A;  3A3U A;  5H8H B;  4MX6 A;  2XXU A;  3K00 A;  3Q26 A;  1YTV A;  1DSN A;  3G7W A;  4DDD A;  1LBY A;  2Q9T A;  1S7Y A;  1NV0 A;  3TFL A;  3TEL A;  2A5S A;  1A8F A;  3IFC A;  1GTK A;  1AOV A;  2RCA A;  3O6I A;  1QUL A;  2Z8D A;  1NV2 A;  1USY H;  1JVY A;  2O1L A;  4YB6 A;  4GWW A;  4P11 A;  2DWI A;  4GBV A;  3C36 A;  4P47 A;  4LUB A;  3V8X B;  5IGA A;  4GQO A;  2DOJ A;  2OX3 A;  5KDT B;  3KEI A;  2QMW A;  3TTN A;  5H8F A;  3QXM A;  5I58 B;  2Q89 A;  1BK4 A;  2VPO A;  3OMB A;  3PU5 A;  1NV7 A;  4U23 A;  2D3I A;  2B4L A;  4JSO A;  4BDM A;  4I8C A;  4R6K A;  1B3G A;  5EQ8 A;  4RK2 A;  4H8J A;  3KGC A;  3D1R A;  1NV4 A;  2I4C A;  3RPL B;  4ISU A;  1FTA A;  3CRB A;  4O3C A;  4KXP A;  4JXI A;  1G0H A;  4P8B A;  4XTC Q;  1AH5 A;  3ILU B;  3LR1 A;  4MNC A;  4U4S A;  3MP1 A;  3KFM A;  3NOH A;  1FTO A;  1B58 A;  3SEY A;  1N3X A;  5ET5 A;  1DOT A;  2G29 A;  1TXF A;  5TPA B;  3MP6 A;  5DEX A;  5I84 A;  1H44 A;  4PFW A;  2XWO A;  3VVF A;  1ZBM A;  2O7I A;  4U21 A;  4PE3 A;  5AA2 A;  5FTH A;  1CB6 A;  3IOR A;  4IO3 A;  1P1N A;  1URS A;  4JWX A;  3KN3 A;  4NF8 B;  5IZ3 B;  4HW8 A;  3ODB A;  1IIT A;  4ZZA A;  2KR0 A;  3G3G A;  4EQ7 A;  5CI5 A;  1D9V A;  4YB7 A;  4N6K A;  4F18 A;  2CZK A;  3D4G A;  4KPT A;  1N04 A;  1WOD A;  4X04 A;  4JVC A;  1YCJ A;  3PUY E;  2BJJ X;  5TU0 A;  2PT1 A;  4BLA A;  3UK4 A;  2I0B A;  3B6W A;  5H8H A;  5CC2 A;  2D21 A;  3PV0 E;  3KN7 A;  1IXC A;  2AL4 A;  2V4C A;  2QS1 A;  3SER A;  1NV6 A;  3RYD A;  3IOT A;  3T9X B;  4EXK A;  3V89 B;  3T96 B;  3K1N A;  3FGS A;  5A5L A;  1SYI A;  4R9G A;  2AIX A;  2UVJ A;  3ZKL A;  2RKM A;  1UTB B;  2GRV A;  1SQY A;  2XWK A;  3VVE A;  2VPN A;  1IXG A;  3KBZ A;  1EYI A;  5L8D A;  3BKI B;  3UOR A;  2DVZ A;  1US5 A;  2PCR A;  4LN5 A;  3QSL A;  2V3U A;  5HPQ A;  3T1B A;  5KDT A;  2RC9 A;  3LV0 A;  3LSX A;  1YAE A;  3TQW A;  5I58 A;  5I59 B;  3A09 A;  4YMB A;  2UYE A;  1A55 A;  4MH5 A;  4HTG A;  4IGT A;  5ICT A;  4JVD A;  1FBD A;  1CNQ A;  2B4M A;  4OEU A;  1F9B A;  2ONK E;  2XXP A;  5I56 A;  5H8N B;  4MLQ A;  1USY E;  2HCA A;  2LAO A;  1MS7 A;  2M8C A;  4C0R A;  4QFK A;  1ZJL A;  2WOL A;  3PUX E;  4PFY A;  3CI8 A;  3DRF A;  4KD5 A;  4NX1 A;  3CR9 A;  4ESX A;  2ZNS A;  2I49 A;  4EUO A;  1Y3N A;  1IXH A;  3KC1 A;  3IX1 A;  1LFG A;  4P3L A;  1FPG A;  5HM4 B;  1B3H A;  2FIX A;  3KSX A;  5TPA A;  4OEN A;  1DPP A;  4U22 A;  1NFT A;  4N4U A;  1D9Y A;  3KJT A;  1MY0 A;  2HPG A;  2DQV A;  1K9Y A;  2I3W A;  1LB8 A;  1YYZ A;  3PPR A;  5DT6 A;  2WYP A;  1D4N A;  1QKB A;  4YZZ A;  3U72 A;  4F31 B;  4H65 A;  3UN6 A;  2P3N A;  1LBB A;  4NF8 A;  4X9T A;  5JTY B;  5ITO A;  3BFT A;  4HCY A;  3OEL A;  3RT6 B;  1WDN A;  1Y3P A;  1FPE A;  3FAT A;  4PBQ A;  3UP9 A;  4OHN A;  3DP8 A;  1NV1 A;  4HE0 A;  1A40 A;  2DE4 A;  3DP4 A;  3CVG A;  3D4C A;  4F3S A;  4R6Y A;  1T0K A;  2F3B A;  1ZMG A;  2JJK A;  1MY3 A;  3S9M C;  3FBP A;  1MG1 A;  3ZS6 A;  4BDQ A;  4GWX A;  2XXY A;  3OXN A;  4R2F A;  1N3W A;  4MBP A;  2XWI A;  5FHN A;  5B7D A;  1NL5 A;  2OCU A;  1ZLQ A;  1P1W A;  4OZ9 A;  3LVU A;  1L5T A;  4LZ5 A;  3QUJ A;  1VR5 A;  3LSF B;  1B9J A;  1UTB A;  1N7X A;  5L9O A;  3TDJ A;  5EQ9 A;  1IZ1 A;  3HO7 A;  1TFA A;  1S9T A;  1II5 A;  5L9M A;  1LCF A;  2H5Y A;  1LAF E;  1IMC A;  4AQ4 A;  3HV1 A;  2Q2A A;  4LZ8 A;  3CSB A;  4NMY A;  3C31 A;  2WOK A;  3FV1 A;  3GXA A;  4H46 A;  2OK2 A;  1OLA A;  3PMX A;  1Q35 A;  4Z7E A;  2I58 A;  4X48 A;  3UA8 A;  1A7L A;  5EQA A;  4DE8 A;  5I2K B;  5TP9 B;  2O51 A;  3H4Z A;  3FXU A;  3O97 A;  5H8N A;  3FAS A;  2H99 A;  2Y7K A;  2WBD A;  1Y9U A;  3TZA A;  4G8N A;  2OBG A;  5I5P A;  2KLF A;  1MM6 A;  3TEP A;  2XHD A;  4GX4 A;  4NTL A;  5DTB A;  3O2A A;  2GH9 A;  4MAG A;  3O66 A;  4WEP A;  4N8Y A;  3JV9 A;  3K1M A;  4MMP A;  1B40 A;  4ZEB A;  3SKP A;  4DIG A;  4ZEC A;  1PEB A;  4I62 A;  2Q8J A;  3M3L A;  4QSC A;  5F1Q A;  2O84 X;  2FIE A;  1MQJ A;  3FJ7 A;  1IQ7 A;  4YKI A;  1B46 A;  5I57 B;  4XKN A;  3TTM A;  3BFU A;  1ANF A;  1XHY A;  4FBP A;  2VHA A;  5AA3 A;  2XD3 A;  4PE5 B;  5JTY A;  2KQZ A;  3T93 B;  3B6Q A;  4JWY A;  2I4B A;  2ZNT A;  4KFQ A;  1PBP A;  3VDF A;  2QRY A;  2QPQ A;  2R9J A;  3IO6 A;  3G3J A;  2VOZ A;  3CFX A;  2ZZW A;  4OET A;  3FVO A;  4ONY A;  3W9W A;  3Q27 A;  4OVR A;  1KWH A;  4MEV A;  3PGF A;  3RGY A;  2Y84 A;  1B3E A;  2R8T A;  3LUZ A;  3RYA A;  3H7M A;  2PMS A;  2REJ A;  3AXF A;  1FPJ A;  4I1D A;  3MZ9 A;  3PUZ E;  2ZZX A;  3KN8 A;  1EZO A;  1Q1K A;  1PB8 A;  1DTZ A;  1INP A;  1SD3 A;  4L17 A;  2ANJ A;  2VP1 A;  3PD8 A;  2UVI A;  4KHZ E;  1QUI A;  2FNC A;  3C4M A;  3PUW E;  4DXB A;  2B3F A;  2F34 A;  1US4 A;  4YMA A;  4E0W A;  3SZP A;  2P0S A;  3FJG A;  4M4G A;  1P1U A;  4GXS B;  1FQD A;  5JEI A;  2XXT A;  5I2K A;  4R74 A;  2GQ1 A;  2IA4 A;  4NF5 A;  2Y7I A;  5I2N A;  2X7Q A;  4P0G A;  1Z7N E;  4XF5 A;  2PFY A;  4OMB A;  4MJO A;  2DE2 A;  1LB9 A;  1R9Q A;  2F3D A;  1Y1M A;  1DK4 A;  3B7D A;  4PQJ A;  3T9V A;  4KI0 E;  4BDR A;  3PPN A;  4YAH X;  1FW0 A;  3PPQ A;  4EF1 A;  1KA0 A;  3MVW A;  4EQB A;  4XKP A;  4NF4 A;  2QSX A;  4N6D A;  4IY5 A;  1KZ8 A;  4O7I A;  5I57 A;  3QK6 A;  3C32 A;  5ET6 A;  4TLL B;  2Y5L A;  3PUV E;  1XVX A;  3PTY A;  2YJP A;  4PP0 A;  5H8Q B;  2G93 A;  1QUJ A;  2Z8F A;  4G68 A;  1GV8 A;  4Q30 B;  4AS5 A;  4I3Y A;  4ZZE A;  1MXX A;  4H5G A;  1LFI A;  1OVT A;  3O29 A;  4O3B A;  1IMD A;  3MZB A;  1JVX A;  3VXC A;  3CIJ A;  3TCH A;  1NV5 A;  4H0W A;  5I3S A;  1RYO A;  2A5T B;  2F35 A;  1QJM A;  4AS4 A;  3G3I A;  4KR5 A;  3KOS A;  5IM2 A;  4GD5 A;  1FBP A;  3K6V A;  4F3P A;  3PMW A;  4ZEF A;  3P7I A;  1FBE A;  2V25 A;  1FPL A;  3K0V A;  2QS3 A;  5CBS A;  1FPK A;  4PTK A;  3K1P A;  2NOO A;  3Q25 A;  2QS2 A;  4KYE A;  3G3H A;  1MH4 A;  1AWB A;  4MLV A;  1N84 A;  4NN3 A;  5CRY A;  4F19 A;  1MRP A;  4F2Q A;  4QFO A;  3FVG A;  4HCW A;  4GWO A;  4DZ1 A;  3IB2 A;  4QFL A;  4NE4 A;  1SVX B;  3R6U A;  3FZV A;  3O9P A;  3BIG A;  1MY2 A;  4PGN A;  4BDN A;  1RDX A;  3FD3 A;  1NI9 A;  4Q0C A;  3KBR A;  4RJZ A;  5FHM A;  4G61 A;  4F3G A;  4XEQ A;  2RC8 A;  3N6U A;  1BKA A;  3E78 A;  1FQB A;  4EDP A;  4E0X A;  3TCG A;  1LBC A;  4H45 A;  1JW1 A;  2DE3 A;  1P99 A;  4OAN A;  5AA4 B;  3M3F A;  3M8U A;  2Y5K A;  3RYB A;  1JW4 A;  3MC2 A;  1N0T A;  4MNP A;  1GR2 A;  1OIB A;  1RYX A;  4HXV A;  1OQH A; 
#chains in the Genus database with same CATH homology
 2F6G A;  2Q88 A;  1CE2 A;  3O6G A;  4IB2 A;  4ELQ A;  4R72 A;  3HHF A;  2ABH A;  3MQ9 A;  2O1M A;  4OVJ A;  2AYS A;  5H8S A;  4GLI A;  1VFE A;  2ONR A;  1D3K A;  4H67 A;  4OYV A;  3IB1 A;  3SEV A;  1OLC A;  1IIW A;  3MW0 A;  3FXQ A;  2E0S A;  1B1X A;  4GRK A;  1BP5 A;  2A5T A;  1H76 A;  1RKM A;  2NVU B;  3ZKK A;  3R7X A;  4RYA A;  3VE1 B;  4XXU A;  4JDF A;  3DRH A;  4X1B A;  4F1U A;  2XXI A;  3I3V A;  1I6Q A;  2XXQ A;  3LSW A;  4IGR A;  4ZE9 A;  2F5X A;  2B65 A;  4FOR A;  3ILT B;  2RCB A;  1MPB A;  3RLF E;  2QS4 A;  3DRG A;  1LAH E;  2DWA A;  4R9F A;  3DRK A;  5ISU A;  4FEB A;  4IO4 A;  5BWJ A;  4NWC A;  2O6A A;  3TOD A;  1MH3 A;  4ZE8 A;  4OQO A;  4YU0 A;  4LQ5 A;  1B0L A;  1Y3Q A;  4M1V A;  3TYH A;  4NWD A;  2Z8E A;  4JBZ A;  4YB5 A;  3USD A;  3H6U A;  3EN3 A;  2UXA A;  4EF2 A;  3VV5 A;  2HZL A;  2DVC A;  4WKM A;  2CZL A;  5AA4 A;  3W15 C;  2Y7P A;  3RT8 A;  3LC8 A;  4R73 A;  4TQU Q;  3HN0 A;  2RIN A;  4F22 A;  3IO4 A;  4EXL A;  4ELR A;  4TOZ A;  1MXW A;  2NWJ A;  1SW2 A;  4UA8 A;  2WOP A;  1NMU A;  1JEV A;  3CG3 A;  2R6G E;  3Q28 A;  4GVO A;  4IO2 A;  4QFP A;  1UIV A;  2HAV A;  3R26 A;  3OO6 A;  3TTK A;  1SW1 A;  1SI1 A;  1MXV A;  2Y7R A;  4O3A A;  2PVU A;  2E1S A;  1MQI A;  4OEV A;  4OFJ A;  1N7W A;  1JET A;  4Q5T A;  3HCQ A;  4GFR A;  1DTG A;  1SW5 A;  5CM6 A;  3O6P A;  4P0I A;  4U4X A;  2Y7W A;  2XXV A;  5I59 A;  4LQ2 A;  4H5F A;  1MDQ A;  4G68 C;  3H6V A;  4K3F A;  3OOA A;  1BLF A;  1R9L A;  2NUV A;  1P1O A;  2GHB A;  3IOW A;  3MVX A;  3PMV A;  1MY1 A;  3VLV A;  3K6U A;  1OMP A;  5J1D A;  1A54 A;  1IEJ A;  5DVF A;  2I48 A;  3LUY A;  4C1T A;  3DEL B;  1TFD A;  5K2X A;  1JEU A;  4RK9 A;  5KZT A;  5A5X B;  5AA2 D;  1ELJ A;  3ONM A;  4THI A;  2GFE A;  1PBQ A;  3FV2 A;  1LCT A;  2XXW A;  3S4U A;  2X26 A;  4KCC A;  2O68 A;  1NKX A;  1H3D A;  4ZEK A;  5CMC A;  4YKK A;  3U94 A;  3MWB A;  1XVY A;  1B5H A;  3MVZ A;  1BIY A;  3TCF A;  1VFD A;  1XS5 A;  3EHU A;  4QSE A;  1H43 A;  2Q2C A;  2H98 A;  4JB7 A;  3H6W A;  1B0H A;  1PC3 A;  3E3K A;  1FQC A;  4POW A;  3OO9 A;  2OWT A;  2F7B A;  2WKY A;  3FXR A;  3GBB A;  5F7V A;  1Y4C A;  2FA7 A;  4GIZ A;  3DM0 A;  1JNF A;  1FQF A;  4FE8 A;  3H03 A;  5H8F B;  1HSJ A;  3TUS A;  3IR1 A;  4BDO A;  3U92 A;  3U93 A;  3EHS A;  3JYR A;  3VLU A;  4U1Z A;  3N94 A;  3H06 B;  4ZEI A;  2QMX A;  4GL8 A;  4LAT A;  1I69 A;  4RPN A;  1LST A;  4G77 A;  1SBP A;  2XX9 A;  4FIM A;  4KQP A;  1ATG A;  4LZ7 A;  5LOM A;  1O7T A;  4JWO A;  3K6X A;  5TP9 A;  3OSQ A;  3SES A;  1B5I A;  2YLN A;  3C35 A;  2RF1 A;  4R6H A;  2D5W A;  2DXR A;  3V83 A;  5EYF A;  2B3B A;  3HST A;  2UYF A;  2Z23 A;  2ZYK A;  3H3G A;  1TT1 A;  4PET A;  1FQE A;  4F1Y A;  3T66 A;  4DCY A;  3SEW A;  3PD9 A;  4IO5 A;  1EU8 A;  3OEM A;  4WXJ A;  2F7C A;  1FQA A;  2ZNU A;  3KG2 A;  1JW5 A;  4N13 A;  4ELO A;  4X1D A;  4QFN A;  5A5X A;  3CSG A;  3DLN A;  4U2R A;  2PX1 A;  4YIC A;  4ZS9 A;  2QL3 A;  1MXZ A;  3O6H A;  2PT2 A;  1MM7 A;  4YKP A;  3WAF A;  1LAG E;  4ELP A;  1B4Z A;  3O28 A;  3RQT A;  1EH3 A;  3M3K A;  3MBP A;  4UAC A;  2P1S A;  1QKA A;  1B2H A;  3MZ1 A;  4LA9 A;  5ICQ A;  5DVI A;  3K02 A;  1SDX A;  1AMF A;  3OO7 A;  4F29 A;  1B7Z A;  4Z0I A;  2I3V A;  3UIF A;  1SI0 A;  2H9B A;  3TTL A;  1B3F A;  1TWY A;  4FEC A;  3TMG A;  1Y20 A;  3IJX B;  3EF7 A;  4DCX A;  2XX7 A;  1P1Q A;  1I6B A;  4XIG Q;  3C9H A;  3SDF A;  2W7Y A;  4KCD A;  3C33 A;  3GZG A;  1UIU A;  2DP8 A;  4QF9 A;  4KYD A;  3MAM A;  2REG A;  2ONS A;  1XT8 A;  3E13 X;  1MQG A;  3B6T A;  3U8Q A;  3L6G A;  3I6V A;  4N6P A;  1YPN A;  2ALU A;  2OLB A;  1WVJ A;  1GVC A;  4ND9 A;  1ZU0 A;  3OEN A;  1VE4 A;  2ZMB A;  1MDP 1;  5I56 B;  4XKQ A;  2ZXT A;  4PFU A;  3LBS A;  4F39 A;  3SET A;  3C34 A;  4G8H A;  3VFJ A;  4RXL A;  3TAJ A;  3S9L C;  3KOT A;  1VSO A;  1O64 A;  2X7P A;  1M5D A;  2Z22 A;  3MP8 A;  4FAT A;  4GF8 A;  1R1N A;  2F97 A;  4F2O A;  1R6Z A;  2GHA A;  4FAJ A;  3LSL A;  2H4I A;  4OER A;  3HHG A;  1QW0 A;  3U1O A;  3N26 A;  1AL3 A;  3OO8 A;  3CG1 A;  1NH8 A;  4POX A;  5EHS A;  3OSR A;  3K4U A;  1PB9 A;  2PYY A;  4LVQ A;  3QYT A;  3RTF B;  1MXU A;  1PB7 A;  3G3K A;  1M5E A;  2VD2 A;  2F78 A;  3FVN A;  4ZDM A;  3TTR A;  4RA1 A;  1B1H A;  3DRI A;  4OES A;  5JK4 A;  3FTO A;  4F1V A;  1MQH A;  1NH7 A;  2DYX A;  5H8Q A;  3VVD A;  1FTM A;  4WED A;  4IY6 A;  3KSJ A;  5IAI A;  4AB5 A;  3EHT A;  3EQ1 A;  2XD2 A;  4RPO A;  4NF6 B;  1POY 1;  3IB0 A;  1H45 A;  4MF3 A;  5B70 A;  4MFI A;  1NNK A;  3EPE A;  1O63 A;  1QUK A;  1M5F A;  2DWJ A;  2XXH A;  1DPE A;  3KJ7 A;  2I0C A;  2UVH A;  1URG A;  2O69 A;  1BTJ A;  5AA1 A;  1OQG A;  1B51 A;  4OWD A;  1ZKB A;  3MPL A;  4KYS A;  4OFO A;  3RTW B;  1EZ9 A;  1LAX A;  5CMB A;  5FTI A;  3IK6 B;  3N5L A;  1M5C A;  5CMM A;  3THI A;  3IOV A;  1B6H A;  2VGQ A;  3JZJ A;  4RY1 A;  1POT A;  3OD7 A;  1ZTY A;  1A99 A;  3ECR A;  3Q29 A;  3E9X A;  5IKB A;  2I6E A;  2XXR A;  2F7A A;  2V93 A;  1J1N A;  2NXO A;  3V5A A;  4DLD A;  1UQW A;  1MQD A;  3FJM A;  3TKD A;  2P2A A;  4F3B A;  4GXA A;  2HZK A;  5K2Y A;  3PAM A;  2F36 A;  4NED A;  5EHM A;  5ELV A;  3WAE A;  5AE4 A;  1OVB A;  2OZZ A;  4YKJ A;  3UGW A;  2O7U A;  4H1X A;  2HXW A;  1UTH B;  2OWS A;  2UVG A;  2F6P A;  2ZYN A;  3RN8 A;  3QAX A;  3FIR A;  4IO7 A;  3SEX A;  4QSD A;  1LLS A;  4LON B;  4NF6 A;  1MXY A;  1Y1Z A;  1DMB A;  4HS7 A;  1Z7M E;  1XC1 A;  1PDA A;  3MPK A;  2CMO A;  1MPC A;  1QVS A;  4H6D A;  4G8M A;  1EZP A;  2V84 A;  1M5B A;  4G4P A;  2DSF A;  3DP6 A;  3SEU A;  4IO6 A;  3FVK A;  3GBA A;  5KCJ B;  3S9E A;  2XX8 A;  3F11 A;  3MJN A;  2V3Q A;  3T9U A;  1B32 A;  4ESW A;  1AIV A;  3H6T A;  1FTL A;  3VXB A;  3T9H B;  2PBW A;  3T22 A;  4NF5 B;  3KZG A;  4G2Z A;  5I2N B;  4H8I A;  2AL5 A;  5HBC A;  1A8E A;  3PPP A;  1IXI A;  3RPW A;  1FTJ A;  3TQL A;  1N76 A;  4FJP A;  1XOC A;  1NNT A;  3BBR A;  3RY3 A;  5DVJ A;  3PPO A;  5CBR A;  1B4H A;  1URD A;  3S2V A;  3RNN A;  3IL1 B;  4ECF A;  1B3L A;  4N07 A;  4JSD A;  4NF4 B;  4OXV A;  3ZSF A;  2R71 A;  3CHG A;  2V3T A;  2H25 A;  3N6T A;  2HQ0 A;  3VLW A;  3E4R A;  1S50 A;  4DXU A;  4G68 B;  2F8D A;  1B52 A;  4Q8R A;  1SYH A;  4ZED A;  5ITP A;  3DRJ A;  3MUQ A;  4QRZ A;  3MVY A;  3TPA A;  1UTH A;  4GOT A;  1JQF A;  4GL0 A;  3W9V A;  1ZIU A;  4PFT A;  2VD3 A;  4TLM B;  2HEU A;  1B7U A;  2QJE A;  5BUU A;  3HPI A;  5L9S A;  3K01 A;  4XKR A;  4FED A;  4OTE A;  1LGB C;  1HSE A;  1Y4T A;  3OEK A;  3QIM A;  2XXX A;  1LFH A;  1FCK A;  3IJO B;  2DWH A;  5M2V A;  1B5J A;  4DXC A;  2HFB A;  3K6W A;  4LP2 B;  1MY4 A;  4QHQ A;  4RNS A;  4OFL A;  3FUZ A;  3K2D A;  4C1U A;  1B7H A;  1SW4 A;  5KCJ A;  1MPD A;  2DS9 A;  4R75 A;  4I9D A;  3L6H A;  5DYH A;  5DEX B;  1B05 A;  2IEE A;  3G3F A;  3CFL A;  1NNF A;  4EQ9 A;  1I6A A;  1IUD A;  5FHO A;  3RUM A;  5AA2 B;  4AB6 A;  1NNP A;  3I5O A;  2ESN A;  2DXY A;  3IAZ A;  3S9N C;  4U1O A;  2THI A;  4BDL A;  1FTK A;  2FYI A;  2HAU A;  5CMK A;  3A3C A;  1HSL A;  1GGG A;  3QUF A;  3GLB A;  2YPN A;  2OJT A;  4R2B A;  2ZYM A;  2ZYO A;  3CFZ A;  2RC7 A;  3IOU A;  3A3U A;  5H8H B;  2XXU A;  3K00 A;  3Q26 A;  1YTV A;  1DSN A;  3G7W A;  4DDD A;  2Q9T A;  1S7Y A;  3TFL A;  3TEL A;  2A5S A;  1A8F A;  1GTK A;  1AOV A;  2RCA A;  3O6I A;  1QUL A;  2Z8D A;  1USY H;  1JVY A;  2O1L A;  4YB6 A;  4P11 A;  2DWI A;  3C36 A;  4LUB A;  3V8X B;  4GQO A;  2DOJ A;  5KDT B;  3KEI A;  2QMW A;  3TTN A;  5H8F A;  3QXM A;  5I58 B;  2Q89 A;  3OMB A;  3PU5 A;  4U23 A;  2D3I A;  2B4L A;  4JSO A;  4BDM A;  4I8C A;  4R6K A;  1B3G A;  4RK2 A;  4H8J A;  3KGC A;  2I4C A;  4ISU A;  3CRB A;  4O3C A;  4JXI A;  4XTC Q;  1AH5 A;  3ILU B;  3LR1 A;  4U4S A;  3MP1 A;  3KFM A;  1FTO A;  1B58 A;  3SEY A;  1N3X A;  1DOT A;  2G29 A;  1TXF A;  5TPA B;  3MP6 A;  5DEX A;  5I84 A;  1H44 A;  4PFW A;  3VVF A;  1ZBM A;  2O7I A;  4U21 A;  5AA2 A;  5FTH A;  1CB6 A;  3IOR A;  4IO3 A;  1P1N A;  1URS A;  4JWX A;  3KN3 A;  4NF8 B;  4HW8 A;  3ODB A;  1IIT A;  4ZZA A;  3G3G A;  4EQ7 A;  5CI5 A;  1D9V A;  4YB7 A;  4F18 A;  3D4G A;  4KPT A;  1N04 A;  1WOD A;  1YCJ A;  3PUY E;  2BJJ X;  5TU0 A;  2PT1 A;  4BLA A;  3UK4 A;  2I0B A;  3B6W A;  5H8H A;  5CC2 A;  2D21 A;  3PV0 E;  3KN7 A;  1IXC A;  2AL4 A;  2QS1 A;  3SER A;  3IOT A;  3T9X B;  4EXK A;  3V89 B;  3T96 B;  3K1N A;  3FGS A;  1SYI A;  4R9G A;  2AIX A;  2UVJ A;  3ZKL A;  2RKM A;  1UTB B;  2GRV A;  1SQY A;  3VVE A;  1IXG A;  5L8D A;  3BKI B;  3UOR A;  2DVZ A;  1US5 A;  3QSL A;  2V3U A;  5HPQ A;  5KDT A;  2RC9 A;  3LSX A;  1YAE A;  3TQW A;  5I58 A;  5I59 B;  3A09 A;  4YMB A;  2UYE A;  1A55 A;  4MH5 A;  4HTG A;  4IGT A;  5ICT A;  2B4M A;  4OEU A;  1F9B A;  2ONK E;  2XXP A;  5I56 A;  5H8N B;  4MLQ A;  1USY E;  2HCA A;  2LAO A;  1MS7 A;  2M8C A;  4C0R A;  4QFK A;  1ZJL A;  2WOL A;  3PUX E;  4PFY A;  3CI8 A;  3DRF A;  4KD5 A;  3CR9 A;  4ESX A;  2ZNS A;  2I49 A;  4EUO A;  1Y3N A;  1IXH A;  3IX1 A;  1LFG A;  5HM4 B;  1B3H A;  3KSX A;  5TPA A;  4OEN A;  1DPP A;  4U22 A;  1NFT A;  1D9Y A;  3KJT A;  1MY0 A;  2DQV A;  2I3W A;  1LB8 A;  3PPR A;  5DT6 A;  1D4N A;  1QKB A;  4YZZ A;  3U72 A;  4F31 B;  4H65 A;  3UN6 A;  1LBB A;  4NF8 A;  4X9T A;  5JTY B;  5ITO A;  3BFT A;  4HCY A;  3OEL A;  3RT6 B;  1WDN A;  1Y3P A;  3FAT A;  3UP9 A;  4OHN A;  3DP8 A;  1A40 A;  2DE4 A;  3DP4 A;  3CVG A;  3D4C A;  4F3S A;  4R6Y A;  1T0K A;  1ZMG A;  1MY3 A;  3S9M C;  1MG1 A;  3ZS6 A;  4BDQ A;  2XXY A;  3OXN A;  4R2F A;  1N3W A;  4MBP A;  5FHN A;  5B7D A;  1NL5 A;  2OCU A;  1ZLQ A;  1P1W A;  4OZ9 A;  3LVU A;  1L5T A;  4LZ5 A;  3QUJ A;  1VR5 A;  3LSF B;  1B9J A;  1UTB A;  1N7X A;  5L9O A;  3TDJ A;  1IZ1 A;  3HO7 A;  1TFA A;  1S9T A;  1II5 A;  5L9M A;  1LCF A;  2H5Y A;  1LAF E;  4AQ4 A;  3HV1 A;  2Q2A A;  4LZ8 A;  3CSB A;  4NMY A;  3C31 A;  2WOK A;  3FV1 A;  3GXA A;  2OK2 A;  1OLA A;  3PMX A;  1Q35 A;  4Z7E A;  2I58 A;  4X48 A;  3UA8 A;  1A7L A;  4DE8 A;  5I2K B;  5TP9 B;  2O51 A;  3H4Z A;  3FXU A;  3O97 A;  5H8N A;  3FAS A;  2H99 A;  2Y7K A;  1Y9U A;  3TZA A;  4G8N A;  2OBG A;  2KLF A;  1MM6 A;  3TEP A;  2XHD A;  4NTL A;  5DTB A;  3O2A A;  2GH9 A;  3O66 A;  4WEP A;  3JV9 A;  3K1M A;  1B40 A;  4ZEB A;  3SKP A;  4DIG A;  4ZEC A;  1PEB A;  4I62 A;  2Q8J A;  3M3L A;  4QSC A;  5F1Q A;  2O84 X;  1MQJ A;  3FJ7 A;  1IQ7 A;  4YKI A;  1B46 A;  5I57 B;  4XKN A;  3TTM A;  3BFU A;  1ANF A;  1XHY A;  2VHA A;  5AA3 A;  2XD3 A;  4PE5 B;  5JTY A;  3T93 B;  3B6Q A;  4JWY A;  2I4B A;  2ZNT A;  4KFQ A;  1PBP A;  3VDF A;  2QRY A;  2QPQ A;  2R9J A;  3IO6 A;  3G3J A;  2VOZ A;  3CFX A;  4OET A;  3FVO A;  4ONY A;  3W9W A;  3Q27 A;  1KWH A;  3PGF A;  3RGY A;  2Y84 A;  1B3E A;  3RYA A;  3H7M A;  2PMS A;  2REJ A;  3AXF A;  4I1D A;  3MZ9 A;  3PUZ E;  3KN8 A;  1EZO A;  1Q1K A;  1PB8 A;  1DTZ A;  1SD3 A;  4L17 A;  2ANJ A;  2VP1 A;  3PD8 A;  2UVI A;  4KHZ E;  1QUI A;  2FNC A;  3C4M A;  3PUW E;  4DXB A;  2B3F A;  2F34 A;  1US4 A;  4YMA A;  4E0W A;  2P0S A;  3FJG A;  4M4G A;  1P1U A;  4GXS B;  1FQD A;  5JEI A;  2XXT A;  5I2K A;  4R74 A;  2IA4 A;  4NF5 A;  2Y7I A;  5I2N A;  2X7Q A;  4P0G A;  1Z7N E;  4OMB A;  2DE2 A;  1LB9 A;  1R9Q A;  1Y1M A;  3B7D A;  4PQJ A;  3T9V A;  4KI0 E;  4BDR A;  3PPN A;  4YAH X;  1FW0 A;  3PPQ A;  4EF1 A;  3MVW A;  4EQB A;  4XKP A;  4NF4 A;  2QSX A;  4IY5 A;  5I57 A;  3QK6 A;  3C32 A;  4TLL B;  3PUV E;  1XVX A;  2YJP A;  4PP0 A;  5H8Q B;  2G93 A;  1QUJ A;  2Z8F A;  4G68 A;  1GV8 A;  4Q30 B;  4ZZE A;  1MXX A;  4H5G A;  1LFI A;  1OVT A;  3O29 A;  4O3B A;  3MZB A;  1JVX A;  3VXC A;  3CIJ A;  3TCH A;  4H0W A;  1RYO A;  2A5T B;  2F35 A;  1QJM A;  3G3I A;  4KR5 A;  3KOS A;  4GD5 A;  3K6V A;  4F3P A;  3PMW A;  4ZEF A;  3P7I A;  2V25 A;  3K0V A;  2QS3 A;  5CBS A;  3K1P A;  2NOO A;  3Q25 A;  2QS2 A;  4KYE A;  3G3H A;  1MH4 A;  4MLV A;  1N84 A;  5CRY A;  4F19 A;  1MRP A;  4F2Q A;  4QFO A;  3FVG A;  4HCW A;  4GWO A;  4DZ1 A;  3IB2 A;  4QFL A;  4NE4 A;  1SVX B;  3R6U A;  3FZV A;  3O9P A;  1MY2 A;  4BDN A;  3FD3 A;  4Q0C A;  3KBR A;  4RJZ A;  5FHM A;  4F3G A;  2RC8 A;  3N6U A;  1BKA A;  1FQB A;  4EDP A;  4E0X A;  3TCG A;  1LBC A;  1JW1 A;  2DE3 A;  1P99 A;  5AA4 B;  3M3F A;  3M8U A;  3RYB A;  1JW4 A;  3MC2 A;  1N0T A;  1GR2 A;  1OIB A;  1RYX A;  1OQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...