1OLMA

Supernatant protein factor in complex with rrr-alpha-tocopherylquinone: a link between oxidized vitamin e and cholesterol biosynthesis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
397
structure length
393
Chain Sequence
MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords SEC14-LIKE PROTEIN 2
total genus 134
structure length 393
sequence length 397
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.680 Mainly Beta Sandwich Jelly Rolls GOLD domain 1olmA02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 1olmA01
3B7QA 2E2XA 4J7PA 1O6UA 5LZ6A 1R5LA 2D4QA 4CIZA 3HY5A 3B7ZA 3Q8GA 4CJ6A 1OLMA 4J7QA 3W68A 4OMKA 3P7ZA 3W67A 1AUAA 1OIZA 3B7NA 4OMJA 4FMMA 1OLME 4M8ZA 3B74A 1OIPA 3HX3A 3PEGA 4TLGA 4UYBA 3PG7A
chains in the Genus database with same CATH superfamily
4RYDA 2V5DA 3L9JT 4IETA 3DV8A 4P5HA 5DXDA 3WINE 2R1DA 4CU6A 3M7AA 5FZ1A 4DUVA 4QGMA 2JB4A 5BY5A 1AL23 4FFGA 4PI0A 1IS4A 2WABA 5FZ6A 2XLFA 1I1EA 1AYM3 1HN1A 4XHBA 2RE9A 3WHUA 4N7UA 4RR3A 2DVDA 5JMCA 3ENRA 1Q56A 4AFAA 4WVMA 5T5OA 5E6HA 2DF7A 3PU3A 4XMAA 2A6YA 3I59A 5JOZA 4NPRA 3T30A 3O1UA 4WZCA 4P9LA 3R4UA 3QD6A 3ON7A 4GWNA 3UYJA 2W3JA 1URXA 5I8SA 5F6LB 2VZTA 5C3RA 2ZEYA 1S0EA 2FDKA 1TNFA 2RS12 3EXUA 4LNVA 4FAGA 4F7ZA 2RM21 1YFWA 1QOOA 4RHV3 2XPJA 1QWRA 1CVNA 4ZZ8A 4LXLA 1MZ5A 5EPAA 3GZTB 3VHRA 1NLRA 3NL1A 3IAQA 3O1RA 5J98B 3WQ7A 4EN8B 4Q27A 3AXDA 3P5BA 4LBQA 2BGPA 3ES1A 4H2AA 5IVYA 2QE3A 1F5JA 4IEQA 4HETA 3NKTA 2VZ1A 3DXTA 2W1SA 1Q8SA 2GC1A 4LLFA 5FJKA 3ILRA 2RMU3 2Q8DA 4L8QA 2HWE1 1VBA2 5FY1A 1FXZA 5FY4A 4Y1VA 3B7QA 4RS5A 1PGW1 3NAPC 2Y26A 5BNPA 4A3XA 2ZKNA 3WG1A 4W6YA 3W5NA 1GZTA 1CIYA 3OD4A 1PMHX 1UOGA 4HL0A 4RGAA 3UJOA 3VDDA 1OA2A 3ZFGC 5LRSA 3EQEA 3VZLA 4FFFA 1JZ4A 1VR3A 4B4QA 2QTWB 5FPAA 3AVRA 1IG3A 5FXVA 3GZEA 1JHNA 4HPKA 3U4SA 4BQ1A 1AR81 4M3CB 4BU2A 3RZJA 1JYTA 2GMEA 3SMHA 3O1SA 1BVP1 1ZYBA 4QM9A 5F6KA 2ZMNA 3ZN5A 2W92A 3BTYA 4AEJA 2EIDA 3IDBB 2OPKA 4ZKTB 3TN92 5A7QA 1YI9A 4PBPA 2ET7A 2V72A 4AWDA 2E32A 5JMOA 3SQOA 4MXVA 1J84A 2D98A 3N9NA 4Q4W3 5GLTA 1CJDA 1AYM1 1XQNA 1OQDA 5FAXA 5A7WA 2XH6A 3H7JA 4GA9A 2ENRA 3ACIA 2BNNA 1G6NA 2JICA 1AVBA 4QMAA 5FYYA 2VUAA 1X9PA 4INDA 3TN91 1ZBA2 1W90A 3SITA 1PK6B 1XU1A 2BVVA 3OUJA 4GMP0 5FZ0A 5C6CA 5JIUA 4XHXA 4OULA 4RN5A 2Q4SA 4N9IA 3N3HA 4KMQA 4Y5TA 4YW6A 4NE9A 4CDXB 4IEPA 1NXMA 4AFDA 3ZFEB 4TWTA 1OUXA 1NCQB 1S2KA 1O5LA 4NRMA 4NPLA 1DGRA 1NE6A 1R64A 1SHWB 5C7GA 3UGGA 5T55A 4FPKA 5LA1A 1H9PA 4OUEA 1PGW2 3UNPA 4CPBA 1FOD3 2ZX4A 2C24A 1FATA 2JIGA 1DP0A 2MPFA 4QX5A 1W2UA 1F9KA 1EPWA 1I5PA 4KL1A 4CRQA 2WSVA 3PVBB 5IK7A 1O3TA 4CEYB 1EY2A 5CU1A 1F8VA 5LEKA 5DZGA 2YPDA 2Z4FA 2Y8KA 4CUAA 3CZUA 1W06A 1S0IA 2WFF3 1X33A 4OHVA 2VNRA 3VKLA 3WHTA 3WP3A 5C8CA 2E7TA 2X5IB 2WQ8A 2PQSA 4XFHA 3DYMA 4EWDA 2ZOEB 3H8UA 3HT1A 3KV6A 3LPFA 3JZVA 1NCRC 2VZVA 5DZEA 5FZHA 2E9QA 3H50A 4QX7A 1UNBA 2ZGRA 4ZU7A 4EV0A 5FCCA 4XFBA 1VBC1 3ZFGB 4AXOA 5IYYA 5L9VA 4JAAA 2BNMA 3AZXA 3KM5A 5G05L 1IG0A 3CLPA 3I2HA 1VMHA 4CEWB 1COV3 5F3CA 2WNUA 4QDQA 1SQ4A 1W8NA 4B7KA 3NAPB 4K1YA 2A6WA 4KGGA 1JODA 4NAMA 3VLBB 1A8MA 4QX0A 1FX5A 1OT5A 2CSGA 3P1IA 2LRPA 1F15A 3D6EA 1UYYA 3IT8A 4K3UA 2VJXA 3K75B 1NZCA 4UF0B 2DFBA 3SKJE 4Q8KA 3OBRA 5K4LA 2MEV1 2CGPA 2WQZC 5GZFA 2WO3A 1LOFA 2PHUA 4LE4A 3DEMA 4H55A 1UZWA 5FDBA 3GCWA 2G9ZA 3SCHA 1XC6A 5BNNB 3FC0A 1HXS2 1IS5A 2AUYA 5ISLA 2ZX3A 4P9GA 2W95A 2GC2A 4P9IA 1JU4A 2BBVA 4AG4A 1C5HA 4AQTA 3POYA 2VMGA 3UGHA 1WCDJ 2QDNA 1RINA 2QZ2A 4WVVA 5FYVA 1VB2A 5EYXA 3T0DA 2EXJA 4R8HA 1JXNA 1LR5A 1ZRDA 2GP5A 3TB0A 2ZEWA 1N1SA 2XHNA 1C8M3 1Y9QA 2P3KA 4Y4YA 3AZZA 2VQUA 3Q8AA 4RS5C 2YU1A 3PHMA 1XYNA 4EN7B 5DUXA 1RUF1 4I02A 1XE0A 1UOJA 1WZXA 1LHUA 3FWEA 4A45A 2E63A 4LKEA 4Q4W2 1NQDA 4Q1PA 3R4DB 3MIHA 4DXRA 2VMEA 4XJ9A 2JX9A 4RR3C 4FPHA 4ISQA 4Y24A 1T6BX 3I3DA 1IZ3A 2RMU1 2W5FA 4Q4Y1 2IXCA 1GANA 2VXRA 1NYWA 3Q9OA 3M8LA 3OPZA 2VW1A 2OVUA 1E5IA 4BLIA 2EA7A 2RDSA 4JHTA 1H1IA 1W05A 1RL3A 2X8KA 4UW6A 5FYMA 4DNYA 2WNVA 1UYPA 4LE3A 5JSRA 3GZAA 3F2ZA 3VL8A 3ZO0B 4PHZA 2B5HA 1M06G 2RVAA 3HIFA 5EJZB 5FXWA 2HYKA 1QOTA 4GMP3 4UAPA 4Y5SA 2GMMA 1W8ZA 1BQPA 4CXXA 1MS3A 2XDVA 5GKAC 4ZU4A 1Q5OA 3NNFA 5F5QA 3MYXA 2VVDA 3FMGA 3POJA 2YBSA 1PMJX 1R1A2 1ODNA 2BERA 3JBG1 1WUVA 3GM8A 2PELA 1W28A 3IB3A 4AFCA 2FHRA 4YYOA 1QJY3 2EIGA 3MFCA 1NAEA 2GAUA 1S4CA 1H1AA 4NHKA 3FX3A 3SKVA 1AYN3 4HLTA 3RWKX 5A3PA 1S0JA 2B9UA 3KQ4B 4BQ2A 2B4KA 2W46A 4OI4A 3IDAA 1W99A 1CAUB 1DLLA 1RVF1 4UFJA 2ARAA 3SEEA 5CFDC 4W6WA 2CTVA 4NRQA 4CIZA 1OBNA 1POV0 1QJU3 3ZXKA 4PJYA 1DQ5A 2Y64A 3HPNA 1RUC2 5GLVA 3I2OA 2Q5TA 1ND2C 5FRAA 2Q1MA 3MV01 4XABA 3AMPA 4EN6B 3AL5A 2JKBA 4YG0A 2BGOA 4QQOA 3VBUA 2YGMA 3LEMA 3VBFC 4AEDA 4CEWC 3OOXA 3FE5A 2DV9A 2UWBA 1CX4A 1DGRN 5JZGA 4JCKA 1RUI1 1D4M3 2VZSA 4YW2A 1OLME 2YGLA 2VBBA 1Z7S3 5KC6A 3B01A 1VALA 2RS31 1O91A 3VHPA 2EIEA 3QH7A 4U2AA 4R52A 4CSWA 2BDRA 4ONUA 2JENA 2Z5WA 4RA0A 3A7QA 2XJPA 4LBKA 4XW3A 3WOGA 4A7YA 1UKRA 2CGNA 2TUNA 3KV5A 2B9VA 4P9JA 4QX8A 3WNXA 3VBOA 2CNAA 2I45A 2X5IC 1PK6C 4IV1C 2RDQA 4LEJA 3AKTA 1CAVA 1AJKA 2FCTA 3GCXA 3OUHA 1W03A 3AM2A 4UXAA 3ZM8A 5FPBA 4COYA 4NIAA 1O7FA 1AR91 2OW4A 2FMDA 1HW5A 1CR7A 2D3RA 3WDXA 4BDVB 2FDJA 3EMRA 1IPKA 3PUSA 4PT6A 3MEPA 2GNDA 1GR3A 4CCOA 1ULCA 2P6CA 4Y20A 4XOGA 2EIBA 1CIWA 2A6ZA 5JAXA 1DQ4A 1YI7A 4QXBA 4YM1A 2AZ5A 1MQTA 1NKGA 1VBB3 2VTXJ 3AVSA 2Z2SB 1YO8A 3D0SA 1VBE2 3MIEA 5F5AA 1R093 5CYYA 2ZGSA 1KFUL 1LTEA 5L7OA 4WM8A 1JN2P 2P4EA 3KLSA 1RUD1 3ZYBA 4GH4C 3WLUA 2IXKA 1BVVA 3T08A 1SBDA 4L11A 3THDA 2NQYA 3HAGA 1LGBA 4O7XA 1DGWA 3RI8A 1RUNA 4HZFA 2O14A 3KB5A 4Q8LA 3NJVA 2DURA 1MPXA 5FPVA 4E4HA 4KWLA 5DMYA 3T2OA 2C1FA 1ULDA 4HG6B 4Y1YA 1VPHA 1KS4A 4PLNA 3EYPA 2LS6A 2OXBA 3IWZA 5F2WA 4BH9A 2D6OX 3ZR5A 4FPGA 4OUMA 1YQ6A 1PO23 4HXCA 3PVNA 3GDBA 2VCMA 4URAA 1COV1 4BQWA 4LK7A 4QGLA 5FTTC 1JU3A 3AYAA 1GQHA 4HPKB 2CAVA 2XWBB 1SFNA 1WCKA 2X29A 4LBQB 1PGSA 2JG9C 3O0WA 3LDKA 2FZ2A 1TQ5A 1AR92 5FO7B 4MGIE 4DOUA 1DFQA 4AK3A 1AXYA 3RYRA 1G9FA 2XBO2 3KGZA 2B7YA 3NNJA 2XONA 4Y1ZA 3FFZA 3J7LA 2GN7A 3RZMA 4ZXKA 2J1RA 2C9KA 1DCSA 4S2DA 2VMCA 3LB9A 2EXHA 4OMDA 3GNEA 4I2OA 4J25A 1FAYA 1JOJA 1ZX5A 1O3QA 2W68A 4BB3A 5A1LA 3I3BA 2FMYA 2UU8A 5LWBA 4ZPIA 2EVXA 4J1XA 1QXJA 4CP0A 5BNOB 4QT6A 1AR83 3UT0A 3OG2A 5C9AB 4XCAA 4MGZE 3VZKA 1JUHA 3LGRA 3JB4C 1RYYA 2QCSB 4AGVA 2K2SA 4LIUA 3K48A 4QAWA 4UFIA 4B7EA 1JYNA 3J26N 2DYCA 1SLLA 2E51A 3AXEA 1WKYA 4LKFA 3POEA 2DTWA 4YG6A 3BGAA 4NROA 1CAXB 3KD4A 2P5BA 4XTPA 2ZMLA 5BPXA 4CCJA 3OGGA 3WP5A 5IATA 1WMDA 4WVMB 2QFEA 5FFOC 2OUHA 1HN0A 4XJAA 4OYUA 4WV8A 1DF0A 3BODA 2BJSA 2Q0AA 4IEXA 3OUIA 3M3IA 3LPGA 3OYWA 2HH9A 3POWA 4AI0A 5FZFA 4AHWA 1LKNA 4MGQA 1NXD1 5AFEA 3K46A 4XE9A 2XR4A 2JEMA 5C9AC 2VW2A 1F31A 3BALA 4XF9A 4N7IA 3T4HB 4KWKA 4C0BA 3ZYIB 2CL2A 1NZIA 2VECA 2HBTA 5FP4A 1AJOA 2PLV3 3PUIA 3SNMA 2WLPA 3TOJA 1SDWA 2J1SA 1SACA 4ZS3A 3AFKA 2WZR3 4P9XA 2BFUS 2ORXA 4RSUA 1IKQA 1RUG1 3THTA 3H1MA 3KCCA 1ND3C 5L73A 1W8WA 5K0UA 2AEYA 4XQ4A 1OQ1A 1CN1A 3MW2A 3PEGA 4XCBA 5IVJA 4Q1RA 4XXAA 3E1F1 4HK9A 1R083 3AP5A 2LUWA 4LUKA 5HCFA 3WV6A 3JQXA 2JDNA 3W59A 2P3YA 3DPRC 4GKXA 1OOPB 1YYNA 1HB2A 3AMNA 1Q8VA 1VMFA 4B4PA 4DEQA 1SG3A 3CKHA 4R9CA 2Z69A 3URFA 4Q4V3 1BK0A 5C8CB 3LEGA 5FXZA 5JXHA 1RUG2 3OBAA 4IV1A 4MGSA 4QDRA 5K9YA 1PM4A 2VBPA 2RS33 1LODA 1RUC3 4BE3A 1HJGA 1KDKA 1QJU2 1AR82 3DKQA 4JDNA 3B02A 4XC9A 1GU3A 1WD3A 2IUWA 3T2PA 3D82A 3FHQA 3AMMA 1RUD2 3GBWA 3PUHA 3IDEA 5A7OA 5D2AA 3HN3A 3ZYGA 2A3YA 4A41A 4R9DA 4ASLA 2HWB2 4RFT0 4XFGA 4TXWA 3TAYA 3ZFFB 1ONAA 4C1XA 4CUCA 4KU7A 4TN7A 1VBA1 2J1VA 4XYXA 3LA7A 2JE7A 4GULA 1D7PM 2VE1A 5FO9B 3AKRA 3VKFC 4IE0A 3NRUA 5FOJB 1RUI2 2PTMA 3FLRA 4DY3A 4GH4A 2J22A 2EXIA 3VD9A 1BBT1 4YVWB 1LHOA 3OPWA 3ZYRA 1DG6A 2FDHA 3FBMA 4AVVA 1TMF1 3FJSA 4IGOA 3E6CC 4RGGA 4DIQA 2P3JA 1YRZA 2D3SA 1IS6A 1PVC3 1BXHA 3PNAA 5D8AC 3IPVA 4FXKB 4HOOA 2VNOA 2HWF3 1I6XA 2VOWA 3VDDC 4DMIA 1PIV3 4JGZB 2ZCWA 2V4AA 5DN2A 3JB8A 5SV5A 1YCIA 4BOWA 2P34A 3PTRB 2IFRA 5FY5A 4K9SA 3EO6A 5GALA 3ZKUA 3A22A 2JE8A 1J59A 2QQLA 3AK0A 5CVRA 4UI9L 3WF0A 4U36A 1F35A 4K6BA 2IZWA 1PK6A 3ZSJA 3J8F2 5LBFA 1VIWB 4KGQA 4Z8BA 1H4GA 3O7OA 1KITA 4MV2A 3BTAA 1WW6A 1XXNA 3ABZA 5D1IA 1ULEA 4ASMB 2D43A 4RD7A 2W08A 2NP0A 1CPNA 5FZEA 1C1LA 4NWWA 1V6NA 3J8F1 4BA6A 4GALA 3LF7A 2MEV3 4RQPA 1ZA4A 5A3WA 2YHJA 3RPQA 4QPIA 5A7NA 4QWNA 2WYSA 1QOSA 1VRBA 2WS93 3ZKYA 4ZHNA 2JB8A 1M4WA 1OQEA 1NX9A 3ACHA 1HB1A 2XLGA 3BYWA 2K9ZA 5CB7A 1VB4A 2BVBA 3CJIA 2J42A 1CJPA 1QNYA 4FPEA 5FBZA 4COUA 3I2IA 1VRH2 1NA1A 1PNGA 1ZZ6A 2QVSB 3UV9A 3RVHA 2VMIA 3KF5A 5HCBA 4G3YC 1W6OA 2VOXA 3OBZA 5LBCA 2R072 2VOVA 3ZSLA 1RUOA 1AYN1 4FPOB 1R092 3IIAA 4YVSA 5ACA3 5E8AA 3MLKA 3CQOA 3E6BA 1FYUA 5J3UA 4YW7A 1K5MC 2FQPA 1RHI2 1ULFA 1CAUA 4LBLA 2YZ4A 1Y9GA 3OPTA 4W4ZA 2GDFA 4LR4A 4ORFA 1DDLA 2A6XA 4NO4A 4QM8A 3LFIA 4UFHA 2WT1A 3FFQA 4Z2WA 5JDBA 1GP4A 3RYPA 2VXJA 4PF1A 3O1MA 4QQHA 4BPZA 5CKMA 5F9TA 4IEYA 2EALA 3SLIA 1OLMA 2PQQA 3CL1A 5JCTA 1IQDC 4OHWA 3RG0A 3W67A 2XOMA 1HIXA 3I2DA 3X29B 4NIGA 2VVFA 3ILNA 4ISRA 4V2WA 3AZYA 4BXSV 1QQP2 1LENA 4F3JA 3BPSA 4FMMA 3NV2A 1UN1A 1MS1A 5CEHA 1ZBA1 4LBQD 2UWCA 1ULOA 4YW5A 3HQXA 2D3PA 4JKLA 4Q4X2 4ATEA 5F5IA 5LA2A 3N9QA 5JPMB 2RDRA 1SLBA 5HBAA 3USSA 5IAXA 1P8JA 5FY9A 4YFZA 4F8AA 4JTOA 3LEKA 4IEWA 3ZYFA 2QDRA 1MVQA 3MBWA 5IW0A 1GLHA 2O1QA 4O61A 1D4M2 3CBNA 1B35C 1CZSA 1LOAA 5DG2A 2XXZA 5CAZA 1FOD1 2BP6A 3M1HA 1GNZA 3FLTA 1AL21 3FZ3A 4DS0A 1U0AA 4E2GA 2RM23 5B2GB 4LITA 4BQXA 3N9PA 1WBLA 5FWJA 5GM0A 5A1AA 1XOYA 3POSA 5A6XA 2H0BA 2JD9A 2W39A 2O8OA 4IE7A 5D21A 1G9DA 3BTZA 1N47A 1Y3TA 4HVRA 2NLRA 1VBC2 1QNWA 3SCFA 3KF3A 2C0ZA 5FPZA 4RFRB 1IGOA 5FUNA 2VNGA 5BNPC 1XNBA 5EZWA 1CZTA 2JXAA 1R5LA 5CBLA 1J3RA 1QJY2 2WKKA 2R062 3N36A 3WEZA 1GYKA 3MIDA 2WZPP 1ZM1A 4PLMA 4A3ZA 2H6CA 1JW6A 1HJFA 4C1WA 2VULA 4M4PA 4LHNA 1L3JA 2ZX0A 1PZ8A 1OMIA 3J4UH 4N43C 4QB2A 3VBHA 4CDXA 3C3VA 1HKDA 4AE2A 3SH5A 2K46A 3O0XA 1C8M2 1G9AA 1ENRA 4JGYA 4QXKA 3NQHA 4UFKA 1WMEA 4TYSA 1N3QA 1W6OB 2W52A 3S7IA 5L7OB 5F37A 4A7ZA 2XQRA 4J7PA 4AHYA 4LBNA 3ACGA 4ZONA 1GQGA 2YMZA 2WZR2 2XVGA 4YRDA 3WQ1A 4XFFA 3P3NA 3RSJA 2XHKA 1WMXA 5BYNA 5IK5A 1MS5A 2BZDA 2LALA 3DN7A 3U75A 3ZXLA 1OPOA 1W9WA 4LOTA 2PHTA 1F4AA 1Z78A 4IV3C 3RMYA 2HWD2 3U14A 4COWA 4CDQB 5C3OA 4META 5FREA 1UIKA 3WDYA 1IKPA 1O4TA 3AP6A 5KR7A 4ZS2A 4CCDA 2C5DA 3C2UA 3OF1A 1KJLA 1YHFA 4BQ4A 5CG8A 4OI2A 4CU7A 5K7PA 5JOWA 2HWC3 1H8TC 1V6LA 1XRUA 1W8OA 5DZFA 5CFDB 1GZWA 2Y6LA 3OEBA 1WW4A 3ZXJA 2QQMA 3UKTA 1UQXA 2Q8CA 3VV1A 3HY5A 3B7ZA 4CCNA 1FMD3 5I8TA 2ADEA 4UW3A 3BB6A 4FQZA 3WNPA 4HKWA 1FT9A 4Q4X3 2D6LX 1UU6A 5BNQA 3IZOA 3M70A 4COZA 1LEDA 3R05A 2C6SA 3KT1A 5CFDA 1A3KA 1OVSA 2CGOA 3H42B 2E6VA 2XGXA 4MHRA 2QUOA 4NR1A 4LHLA 1LNSA 5K0UB 1SFYA 1AR61 2NMOA 2JDAA 3AYCA 2XJVA 1C57A 5CNAA 1H8TB 4HK8A 2MEV2 2HEYF 4N8MA 4QDSA 2IXJA 2DVFA 1V6JA 3FUOA 3ETPA 4K8RB 4PIXA 2WSUA 1YXWA 3CHXA 2DFCA 4XDPA 3ZFEA 3L2HA 5A1FA 2AGSA 5T3NA 5LCWL 5LEJA 2VCAA 1GZCA 1RHI3 3K3NA 4GMP1 4AI8A 4ES9A 4LIVA 1XPWA 4MO3M 5DDJ3 4AI9A 3OSDA 3NNLA 4JGYB 4N53B 1GQPA 4AAPA 4PQ9A 4QPGC 2DTYA 3ZLIA 5FUPA 3GF6A 4FQ4A 4PBOA 5GLUA 1YFYA 3THCA 5FLJA 4LO4B 5BNNA 3I4IA 1OKQA 5FY0A 4C91A 4DQAA 1LOFC 2GN3A 1MS4A 4FOVA 3N9OA 3IIIA 1XNCA 2ZGTA 3CJIC 4M0HA 4O9EA 5E88A 1VJ2A 2RS32 1DYOA 4R9AA 5T5LA 4XUTA 4A44A 2JDUA 1WMFA 5FZ9A 2HWC2 4PDWB 4XF1A 1RUF3 3MFAA 1DIWA 4AVAA 1XNDA 2Y6HA 4QD2A 1DBNA 3U37A 4TTGA 3WUCA 1MQTC 3OCPA 4D8MA 2HWD3 1KJRA 1TME3 5DPNA 1SPPB 2BOIA 3VKMA 5HV4A 3CF6E 3NNGA 1RMU3 2O8QA 4KG0A 4QKBA 1UPSA 1QH6A 4QHBA 3TYJA 4BZ4A 1X82A 1ZZCA 1WCQA 4V2VA 1GOFA 1POV1 2XKOA 3LKJA 4BLJA 4Z92B 4IEZA 1FPN1 3AC0A 3RNSA 5C4WC 4RHV1 2XL7A 4QXCA 2R1BA 1T6GC 2WS92 2A7AA 2G9FA 2JWPA 4HSJA 1PVC2 3MIGA 4JHZA 4UBHA 4XQDA 3DYOA 2D6KA 2YC4A 1ACCA 1W0PA 1ZBA3 3U07A 4E2QA 4EN0A 1LHWA 1NLSA 5ABJC 1Q8PA 1YFXA 3HR9A 3K77A 1DYKA 1H6XA 1RUI3 1D4M1 2VPVA 3HWJA 1VBE1 4LULA 4CPBD 2C26A 2VMDA 1K5MB 4IXLA 5A3TA 2OT7A 4W8JA 1EPZA 4LKDA 1BHGA 3SH4A 2QQOA 4OVEA 2F6BA 5T50A 4JKMA 1W2NA 1K5JA 3V0AB 4YVSB 3A21A 3SXWA 2FDFA 2HWB3 4D69A 3NKGA 2UYAA 3NAPA 3B3QE 3JQWA 2OPWA 4FOYA 5KHJA 4Z82A 1PZ9A 2BYVE 1LECA 4L92A 5FJHA 4FVVA 3TNQA 2D5FA 4UOJA 5FZLA 4NJ4A 5IK8A 3VD3A 3WDWA 1H8VA 2X10A 4CCLA 2DUPA 1J3PA 5CFCC 2WL1A 1GSLA 3OY8B 4CP9A 5C3QA 1W6NB 1S0FA 3BCWA 3HMYA 5FMCA 1ZBE1 4CUGA 4XZUG 2QNKA 1J83A 5EJ1B 2DU0A 4PIYA 1XNTA 4YPJA 4QPGB 3NNMA 1NUKA 2GZWA 4GIQA 5FPLA 4Q0QA 4Z2AA 1QH7A 3T1LA 4AAXA 4GWIA 4KI5M 4H7MA 4JGZC 1A78A 3VBFA 4NWVA 2PHRA 1RJ7A 2VQAA 3H1WA 5JZGC 3BN6A 4Q26A 1VRH1 3T1MA 1RMU1 1J1TA 1TVGA 2YFZA 4XUNA 2RS13 5IVBA 1V6KA 4YSFA 1WLDA 2VBDA 4YGDA 3VBOB 2QKDA 3OBTA 3BOPA 2VZRA 3T3YA 1OD3A 5LZ6A 3WNKA 2GC0A 5SV8A 1U5IA 1W2TA 1NY71 3VBUB 1GOGA 4ES8A 2R32A 1QKQA 4XDOA 5DAVA 1IOAA 1YQ2A 3ZSKA 3C7HA 1VBD3 5A7WB 1ND3A 5J96B 1WWYA 1G86A 3CDZB 4HT1T 4EZ4A 3D3AA 3EJKA 3K3OA 3WW3A 1UMZA 4OMKA 5FPXA 5I0UA 2WINB 4KBBA 2A3WA 4FPJA 1UZ0A 2R7EB 1S2EA 4Y20B 2HWF1 2HWC1 1O59A 1IPSA 5KXDA 1AL22 3SHRA 2BQPA 4MZUA 4EROA 4EWEA 4NUBA 1OF3A 4AL9A 3VD5A 3PIJA 1PO22 2XVLA 4YGCA 5FZOB 4BXFA 3RQ0A 2WAOA 2DVAA 3ZFFA 4AGGA 5HCHA 4MGYE 3WG2A 1CAWB 4B8EA 2E7QA 1ZBE2 2QQKA 4FP2A 2LROA 4LO6B 4XETA 5GZDA 3RMXA 4D7SA 4CVUA 2EAKA 5I8YA 1EUUA 4D7TA 3ZMOA 2A75A 4L9BA 3HT2A 5I91A 4FTSA 4AGRA 5B4XA 3NW4A 4BIOA 2VG9A 4KG8A 2HYXA 3M3CA 1RMU2 1X8EA 2R042 4R4ZA 4FI9A 2RR11 2WNVB 1HLCA 3UETA 2WQ4A 2PAEA 1VAMA 1K12A 2AENA 1GKBA 1AR73 1V9U3 3AMHA 3AP7A 4D94A 1JZ6A 1S0GA 2ZGNA 1BBT2 3WUDA 4Y33A 3W20A 4A7KA 1BYHA 3A0NA 3QLQA 2VCBA 1PX4A 4WM7A 4BK5A 1UD1A 1VBB2 1PVXA 4FCAA 5JVVA 1HDKA 3T0AA 1SBEA 4XFAA 4CTEA 1RUF2 2W94A 3VBSA 2H0VA 3OGVA 3KCYA 4YM0A 4CCEA 1VBD2 1VMJA 5BNPB 4LQRA 2CDOA 5FYTA 5JOYA 5HXVA 1EUTA 5FK7A 1JBCA 4XTMA 1E5SA 2HWB1 1I3HA 2J1UA 2VUJA 2VQTA 1VBB1 2WBKA 5AC91 4LT5A 1ODMA 1R091 2BV4A 3C7FA 4P5YA 3ZIWA 3N7KA 1SCRA 4V1PA 2BFUL 4P9WA 3H9AA 4N43B 2ZBJA 4OLLA 1F2NA 1GFF2 3WCRA 3VUOA 4XIKA 1UYZA 1OUSA 1RUE1 1U5YA 5FYIA 2CV6A 1PIV1 2WZEA 5EQUA 5JLVA 1NQJA 1L7QA 2XBO3 4H7LA 2Q8EA 1LOCA 4XAEA 1X9TA 3NV3A 2GSYA 1AR93 1GP5A 1L7LA 4FT8A 5AVPA 2Y6JA 3WDTA 2WNUC 5LBEA 1BEV1 1OPMA 5IK4A 4A2UA 2VC9A 4FSJA 1BBT3 1S55A 3R4SA 3THPA 5CG9A 1BK1A 1JI6A 5A6ZA 3I59B 4HKLA 2AACA 4LBMA 2WWJA 2TNFA 1EV11 2PHWA 1JZ7A 4BQ5A 2ID4A 1ULGA 1LRHA 5FZ4A 4GWMA 2YV8A 3V0AA 2VUCA 3U1XA 4BCUA 5FPUA 1S1AA 3FHIB 4UYBA 3WY6A 3I2FA 1Q43A 3GBGA 4LKSA 2RS51 1S0BA 4Q4V2 2BWAA 4EE2A 5DUWA 5J48A 1EYBA 4HVQA 5LK7B 3CU7A 1AF9A 1RVF3 4XACA 1BLZA 3B69A 2WZ8A 4H3WA 1F4HA 4N90A 2JG9B 1ZRCA 1TMF2 1QXRA 4AZZA 5GZGA 4RGKA 4PDWC 1LGCA 1QEXA 3S6PA 4KU8A 3TNPB 3IN9A 1NT0A 1SMVA 3VHNA 3WW2A 3FBYA 4P02B 4O9GA 1CX1A 4DO0A 5C5UA 1DQ0A 2XJRA 3MW4A 1DQ1A 1DHKB 3VDAA 3PTYA 5DAQA 3RJRA 2B46X 2QQNA 2EXKA 2R063 2YROA 4XBQA 2O0OA 1S0CA 2WWSA 1D2QA 1KXGA 3KS7A 4B1MA 2FCVA 2CWSA 4XEZA 4Y5Z0 1YQ8A 4W65A 3OD0A 4CA9A 5IWFA 1HX6A 1H2KA 4AHZA 2TBVA 3HQRA 2VOKA 3KV4A 2DCJA 2QQVA 3WQ0A 3PL0A 1FI2A 3P6BA 1LOEA 1TZOA 3TBDA 1UIJA 3FUQA 4NHMA 3IKWA 1XE7A 2GNMA 5H9PA 2XJUA 1BKZA 2WNVC 4I0BA 1ZZ9A 5LY1A 2ETEA 3D8CA 1F5FA 5FZIA 4FFHA 4YZ1A 3T4VA 4XXPA 2I2SA 4UWDA 3NSTA 1GMMA 1PMIA 5A3NA 1W6QA 1SLTA 2E26A 2YU2A 4GJYA 4BQYA 5JUVA 2DCKA 1KEXA 4AVTA 3NJZA 4NIHA 3Q8BA 1O6UA 1GNYA 2UWAA 2ZXQA 2AH2A 4Q4X1 5HCAA 1MZFA 4AQ6A 1LHVA 3I54A 1AR71 1V9U1 2JDHA 3ZX7A 4CP9B 1NCQA 4XBLA 2Q30A 4RL7A 5FZ8A 4PI2A 2KD7A 3SEPA 3VGIA 2HWD1 1W9TA 4S2HA 5FZBA 5H9QA 4FPLA 1OI6A 1OA4A 2D6NA 4IESA 5D8AA 2DVGA 1C5IA 1UY4A 1V6OA 3DUIA 4LBJA 4M0NA 3BIWE 4LA2A 3WT3A 4D6RA 4Y26A 1OIPA 3LSEA 3PJYA 4YARA 2EICA 2DCTA 5GJ6A 3WDVA 3LZZA 4EWAA 3KT4A 3W21A 3WNLA 1W6PA 4KNCA 3JXSA 4FTEA 1CD3G 1LJ7A 4AFMA 1W6QB 4YZ2A 1CAVB 2IXHA 4BQ3A 4BHPA 2DBNA 2WN2A 3MF6A 4URTA 1QXPA 4CDUC 3CMGA 2YBKA 4QU2A 5F5CA 3ES4A 4JTNA 1TE1B 4H14A 5ACA2 1RGSA 2ORZA 4HKOA 3AKSA 5A3OA 1RXFA 1H2MA 2QBXA 3MPBA 1BZWA 3TEYA 1ENQA 5FYUA 1MR5A 5L9BA 5JZGB 1AR63 1W8HA 2YDEA 4K21A 4LMFA 4AEDB 3AZVA 3ZSMA 4MX3A 5FV3A 2GMPA 1CQ9A 1YWKA 1VAVA 2ZAAA 4CCMA 4I0WB 1W0NA 1MS0A 1OLQA 2HEVF 3DPRB 1GBGA 1W8UA 3WQBA 3MIFA 2GC3A 3ZN4A 3C7GA 4UFLA 5GZEA 3BU7A 2BWCA 4JRLA 3TEXA 3ZPYA 1GWKA 3KV9A 3VDCA 3VDBA 3M2MA 1GUIA 1BMV2 2XJTA 2XB6C 1GV9A 1W8TA 5FY8A 1QHDA 5CISA 2Q1FA 2J1EA 2UURA 4NIDA 5EJ3A 2R073 4XF0A 2R061 5EWSA 3KMHA 1UCXA 1N1TA 4AOCA 4R9BA 5J1XA 3E97A 3RJ2X 3U4XA 2F4LA 4BMEA 2EF6A 3IMNA 2ET1A 1YJKA 1AR62 5CA6A 1W2AX 3M3OA 2WFF1 3ZSEA 5C8WA 1MZ6A 4ZXEA 5ABJB 2PHLA 2ZX1A 3ELNA 3G7DA 1PIV2 1AXKA 2D97A 4JZRA 3TEWA 4XJUA 3ZXFA 3NV4A 1JH5A 1RC6A 5CADA 2JD4A 3ILFA 4N53A 5ERLA 2ZGQA 3VBRC 1C28A 5C4WB 3RZZA 5EP9A 4R4XA 3D4KA 1UZZA 1ENSA 3H3UA 2JDZA 3ZYHA 4YZ5A 3J7HA 1YIPA 4AEMA 3BPZA 3NV1A 2NMNA 2VL4A 3RWNA 2ZABA 5JR7B 4K8FA 1EAH3 4ATFA 1DU3D 2PHXA 4NAOA 4XJ8A 4C8DA 1LU2A 2WNOA 3TN93 1HRV1 3AKPA 2WN3A 5FYCA 4HN0A 1ZRRA 1HQNA 1JYCA 1Y43B 4LO5B 1EV13 1CGPA 4D6SA 2W47A 5FZCA 2ZAHA 5FMOS 5BNNC 3VBSB 5KHHA 3NJYA 2D5HA 1QJU1 4GAZA 1A8DA 2ES3A 5LB6A 1ZRFA 4XQWA 1CZVA 2B39A 2VZPA 5LRRA 4MXWB 3WF1A 4WM7B 1D0GA 4HBNA 4XF3A 5LY2A 1PZ7A 2XVKA 5ANNA 3ST7A 1WGPA 2WT2A 4IUGA 3VD7A 5IUQA 1RUG3 4CUBA 5F3EA 5IVFA 4YW3A 2WZR1 4B1LA 3PG7A 2FDGA 3MGUA 1XSQA 2WYFA 4E4DX 1GZ9A 5F39A 5GZCA 3O1TA 2DU1A 2KA3A 1G8WA 4CE8A 1EP0A 2RV9A 2RR13 3AZWA 5ABJA 1VAKA 5CKNA 1LULA 1R1ZA 1EAH1 3G6JB 5F8PA 2XMLA 1QMJA 2J1AA 1VLNA 4MUVA 2Q8OA 1XYOA 4DPNA 2WT0A 3MF9A 4L0PA 4NOTA 4UF0A 4AQ2A 3AP9A 4JDOA 5I0RA 2HWE3 4JV4A 4RHV2 1S2BA 4XMIA 1WBFA 1CAWA 4GH4B 4M8ZA 1FPN2 5BUVA 3ZFGA 3BKZA 4TZDA 2VH9A 1UX6A 2AC1A 1TMF3 1DGLA 4NHLA 3O1VA 4AVBA 4BK4A 3B7MA 2JDYA 4ARYA 1V6MA 3PVOA 3QH6A 1LHNA 3POBA 2MNGA 2WRAA 1QIQA 3T0BA 3VBOC 3B9CA 2H6BA 1RUJ1 2ZGUA 3I2JA 3KGLA 4YZ3A 5KXCA 2R0FA 4IL7A 2W87A 2A73B 3LIGA 3K51A 3PJQA 1R082 2IVIB 3JBG2 5KHIA 4UW5A 3S0MA 4YLZA 5J37A 4BMBA 3DPRA 4XURA 1W39A 1XSRA 1YFUA 4TLFA 4OHZA 1NE4A 4MH0E 4O65A 1JYXA 4LO8A 5M0TA 1REFA 2VY0A 3WNNA 5JSPA 2W1UA 4FP3A 4FO9A 4J1WA 5EIYB 5EV7A 3I2KA 4IDZA 1HV0A 3VZJA 3APBA 2ZKLA 4K20A 3POFA 3WZ1A 5HPOA 3F95A 3Q8CA 4RQPB 3VZNA 5C33A 4MG2A 5LASA 4CDWC 1JTZX 4Y22A 4EZHA 3UKVA 2GALA 1DQ2A 2Z79A 1XJAA 5FP9A 3AP4A 3RYKA 5FMBA 1OFSA 2IXIA 1J3QA 2WWUA 2ZZJA 4FFIA 4XZPA 1VBA3 2D93A 5EHDA 4CDQC 3BUCA 2RMU2 4YVWC 4M01A 2L9LA 3AFGA 2JKXA 2JDPA 1PO11 2AR6A 2UY9A 3VBUC 1ZVFA 2X05A 4MVTA 1OHFA 1AZDA 2RS53 4QQ2A 2BOJA 3VHOA 4LO7A 2V09A 4Y3OA 5FZ7A 2ZEXA 4QQPA 3W58A 2A5ZA 1N3PA 4FPYA 1NG0A 3H1YA 4B4RA 3PLQA 3LDBA 3J8F3 4LHKA 5IVEA 4IERA 5T54A 4JGZA 1UMIA 1UY1A 2VZOA 2Q1ZB 2DCYA 2AEZA 1WW7A 2NZ9A 5DUVA 5KBFA 3AMQA 5I93A 3ETQA 1ZRIA 5A3UA 4HN1A 5A6QA 4SLIA 5T5JA 1POV3 5DAWA 5JXJA 4Q2FA 5IVVA 5DUUA 3B7NA 2XUMA 4UFMA 3OGSA 3LA2A 3VBRA 5FZGA 3O1OA 3HQUA 1UOBA 1OXCA 5F32A 4DY5A 2BGCA 1YEWA 3VZMA 2WFF2 5FIXA 3FHAA 2PFWA 4IE6A 2R043 4M3CA 1O4YA 2G19A 4I3PA 3HNYM 1AYM2 2WJSA 4AVCA 1QJEA 5DABA 5FZDA 4FBFA 2LW8A 5FK8A 3BI3A 3WVJA 1YC61 4XAAA 2D4QA 3O12A 3B00A 4QHOA 4M4RA 3VD4A 2RJKA 1K5MA 2OS2A 1WLTA 4EYUA 1O8PA 3N7LA 4Q0UA 1Z0HA 3HJRA 4IEUA 5A33A 4AR2A 1TG7A 3NMBA 3C7EA 1IPJA 1UF2C 2YFUA 3IAPA 4CP1A 5FZKA 4MADA 3SH3A 4ITCA 3HNBM 4DXTA 1BMV1 4NPMA 4PIZA 3IMMA 2PYTA 2JJ6A 3D0JA 4AF9A 3O5SA 3DF0A 1ASJ3 1UPIA 3MHZA 5AVAA 2CU5A 1UZVA 3WNOA 1UWWA 5LATA 1WW5A 3HOBA 3RZGA 4AQSA 1S0DA 3K2OA 3QOPA 4F83A 2FCUA 4M3CF 4DUWA 3UJQA 1L7RA 1PO13 3Q8GA 3N4MA 3NWKA 5IJRA 5C4WA 4WM7C 1LGNA 4J7QA 2SLIA 4DRRA 1SBFA 3NVCA 1N1VA 4IQPA 1CESA 1Z7S2 4A42A 4A6SA 1UU5A 2XBO1 1JUIA 3OJBA 1FPN3 3VBRB 3VBSC 2HEWF 2VNVA 2WIIB 2ZHKA 1PGL2 1K42A 2J1TA 3K4ZA 4OZOA 4YG3A 4XUPA 3VZOA 5FXXA 4Q0SA 1OF4A 1RUC1 3ACLA 2GNTA 5E89A 1K3IA 1RITA 3GXUA 4QB1A 3ACFA 3RS6A 1MEC1 1OKOA 4Q4V1 2VGDA 1U12A 1JZ2A 1UYXA 2ILMA 5C8CC 3ZN6B 3V56A 3CJIB 1JMUB 1LCLA 5KXEA 3RRDA 5BNOC 2P3IA 3N9MA 5HXMA 1C3HA 4WBBA 4Z07A 3ATGA 2HLEA 2OX0A 5IFTA 5LBBA 2A70A 1YJLA 3ZXGA 3OTFA 3FL7A 5C70A 3ZPOA 2ZEZA 2BNOA 4DFSA 4PLOA 1XYPA 4I3GA 2VMFA 1TEIA 3USUB 3WDUA 3OGRA 3R6SA 5A7PA 3PVEA 4GQ7A 1NA1B 1R1A3 4MHUA 1PNFA 2WNEA 4W50A 3U11A 1ST8A 4AEDC 4N43A 3VBHC 3J7NA 1AX2A 4DINB 3A0KA 3WP4A 2XJSA 4GD4A 4HONA 4OI0A 3AB0A 3ITQA 1H9WA 2VD7A 5C3SA 1QDOA 2G9GA 1SDDB 2TEPA 3IM0A 1MS9A 4YWAA 1GZWB 5FO8B 1D2SA 3GHMA 2BU9A 1O8SA 2VM9A 2CDPA 1AUAA 1QQP1 4OZXA 3WG3A 1Q3EA 4CDWB 4QPWA 4GJZA 4K40A 5LA0A 4DZGA 5A33B 4XUQA 3WX5A 5F2SA 4COVA 4IV1B 4YW4A 5AC92 5IVCA 1W04A 1JYVA 3MLJA 1REEA 5T5PA 5JPNB 3KHCA 2KR2A 4IV3A 1O3RA 1OSGA 1RUJ3 2YUEA 1WA4A 1FV2A 3JD73 5ANQA 4E4SA 1G7YA 4CDXC 2WO1A 3WF2A 3DXUA 2K0GA 2D6PA 4P08A 4QHZA 3GHNA 3WF4A 4AI2A 3LOBA 3KSCA 5D8AB 1UAIA 4CJ6A 2PLV2 2ZHLA 3AX4A 3UKNA 3J9SA 2PXJA 1TME2 1UY2A 4CXYA 4X6QB 3S57A 1RIRA 2PN5A 3KHBA 1HQLA 1OA3A 3C8XA 2QQPA 1Z7S1 4Q0PA 2GNBA 2XL9A 4UBGA 3O1PA 4LPLA 4M00A 5DDJ1 1H6YA 3BIEA 1ND2B 1W6NA 2RDNA 1HXS3 2NPIA 3FLPA 5FMOL 4IE4A 2UY8A 1GWMA 5A7SA 1V6IA 2E7AA 3UK9A 2P6HA 2CHHA 3LCPA 1OOPC 2A71A 4GZ9A 4DEVA 2OZJA 4QKDA 1KS5A 4PQQA 5FOBB 1JYIA 3T2QA 1NA1C 4FXGB 2WA3A 1FNZA 2WO2A 1ND3B 2JECA 2Y6GA 1UO9A 3B9IA 3IBMA 3NJXA 5DAXA 4WZFA 5JIAA 3VBFB 3BTXA 3H3ZA 2BBAA 1UW8A 4XIOA 4PCRA 4XUOA 2W91A 4FTBA 1R081 4MYEA 3PUAA 1LOGA 1GNHA 2JE9A 3E5UA 1OFNA 3DCQA 3BOWA 1D0HA 3FN9A 4GB31 3MV11 4NN0A 4XPVA 4Y1XA 4Y22B 4YGEA 4QU1A 4YM3A 4WM8C 3GZUC 1NCRA 1B35B 1BEV2 2XKPA 3NO8A 3KVBA 4GKYA 3VB9A 2E2XA 1ULPA 2F17A 5JI7A 4IE5A 1YQCA 4QPGA 1PX3A 3ZXEA 3I3QA 3ROUA 1TNRA 3V64A 2AYHA 2A6VA 4KWJA 3ZN6A 3WSOA 3MW3A 1W8FA 5DDJ2 3UGFA 5JXIA 3U0ZA 2YG0A 5L36A 4CP2A 5EFUA 4QXHA 3CNAA 2JG8A 4E2SA 2DUOA 2ZACA 3HNMA 2GU9A 1CPMA 3MICA 3QACA 4W6XA 3N9LA 5IAVA 4FPCA 2BW8A 4Q0VA 1OURA 2PAKA 2ZGKA 5IT6A 3ZYJB 4Q4W1 4N9HA 4OMCA 2R30A 5FLHA 3OY8A 3H7YA 4TLGA 4AI1A 1JZ8A 2VOTA 4QPIC 3P7ZA 4GB33 1RB8G 3RI9A 1FMD2 1LESA 1ZZ8A 4ZU5A 3TRSB 3N7JA 1UXXX 1H1MA 1J58A 5BXXA 4WVZA 5JOXA 5T52A 3E6DA 3JBG3 3O14A 1ALYA 4K7JA 3B94A 3GJAA 5BNOA 1X50A 1AYN2 5FBJA 3WG4A 1QJX3 3LD8A 3PDQA 4L97A 2R071 3RGBA 1GP6A 3PURA 3ZIXA 1REDA 1OH3A 2VZQA 2WNUB 1MEC3 4OHXA 4XVHA 4CYDA 4AVSA 2VU9A 2ZZQA 5AFBA 4YVSC 1MZEA 3PU8A 3I3MA 3B74A 2R6QA 2ZHMA 4CCCA 1UXZA 2JG8B 2B8MA 2ZGMA 4D0QA 4ET7A 3D5OA 3CJXA 3AL6A 2IC1A 1W9SA 3IDCB 1QJFA 3C7OA 4K1ZA 3DGTA 1A6CA 1ENXA 1WA6X 4G4FA 1U5ZA 3S30A 2QQIA 3DECA 5FMDA 2FDIA 1AL0G 1ZZ7A 2YC0A 5FKBA 4IEOA 5F7UA 2PAMA 2GH2A 1OLRA 4I09A 1T2XA 1V70A 2Y6FA 5CZKA 3LQCA 4HVOA 3KWVA 3GGLA 1KD7A 4JX0A 3W68A 4AW7A 4UT5A 3MO4A 1MVEA 5FZ3A 3LWCA 3WD5A 4PDWA 2BPA2 2JDMA 2OKXA 5I0DA 4YNIA 1ZREA 1H2LA 2VW0A 3MIBA 4UW4A 4AYUA 3MI8A 5EYYA 2Y33A 3I97A 3ALQA 4BM8A 1OH4A 1RUJ2 2D40A 4JGYC 4L2NA 5FZMA 2SBAA 2X09A 5B4NA 1CWPA 2ZGPA 3WR0A 2V73A 3Q8FA 4YFWA 1RVF2 4BIFA 4L99A 2C9AA 2E31A 1MEC2 2R16A 4LOSA 1HQWA 4N53C 3PIGA 2NYYA 3H8RA 2A3XA 2P17A 1SLAA 4XBNA 1NCRB 4NHXA 2VCCA 1MQTB 1WCUA 4E9KA 2OQ6A 2FZ1A 2P2KA 2XJQA 1VBC3 5LK5A 4I30A 5DG1A 3DYPA 3DL3A 3WCSA 1PGL1 1H30A 2ZPXA 1UKGA 2RHPA 1X8MA 3A23A 3HN1A 3L2YA 5K8SA 5LW9A 5I0SA 3BU0A 1R1A1 5F3GA 3I8TA 3I7DA 3IPVB 2XQXA 3POIA 1W6MA 2ZX2A 3DKWA 3AJZA 4DUXA 4CDUB 2DDUA 2F4PA 5A32A 4GXLA 3HX3A 4D3WA 2RM22 2Y0IA 4OCTA 4S2GA 2KXLA 5JSOA 1H8TA 1WLCA 2CAUA 2Y6KA 2VAUA 1RUE3 2XWJB 1X7NA 1N1YA 1OVPA 1DZRA 2YY1A 3HVDA 4OQ8A 4ZY9A 3AJYA 3LSDA 5HV0A 1SZBA 4E27A 2VVEA 1H0BA 2P37A 3K4AA 3ASIA 2WDBA 1HB3A 1Q8OA 2RG4A 4NRPA 4AFBA 1JZ5A 4MSVA 4I01A 2DWRA 1NCQC 1POQA 2VO5A 3LOIA 5CIRA 5CFCA 1VP6A 4YM2A 5JR2A 5KC5A 3E5QA 3JUUA 1B09A 2ADDA 2WC2A 5ACA1 4HSLA 1YQ5A 3N7MA 4KBZA 5GLZA 3ZYPA 5J36A 4X8PA 1AX1A 1JHJA 4YGBA 5FKCA 3RDIA 3TWIA 5TSWA 3RZLA 4LJHA 2NM1A 2VQ0A 2D7FA 4QX3A 1COV2 2BRTA 5FQ0A 1RUH3 3AYDA 4P9YA 1U5XA 4J6GA 5KWRA 2ATFA 3LDRA 2YXSA 4BJ0A 1W6MB 2QZ3A 3A4UA 4QPYA 2EAAA 4LHSA 4LUMA 2R49A 3T2TA 5A70A 2ZS6B 1ZNPA 4FAHA 4XDQA 4RQPC 2W0XA 1QQP3 1QJX1 1UZYA 3WW1A 4A4AA 1KDMA 1HRI2 3ZDVA 2ZGLA 1H4HA 2DVBA 4EJRA 2C4XA 4OQ9A 5FQ0B 2YBPA 5HI0A 3WW4A 1AXZA 5I0TA 4CDWA 3GALA 5FY7A 5G04L 4P14A 4CEYA 3OEAA 1D4VB 1HRI1 5IFPA 1AR72 1V9U2 2BEOA 1N3OA 1QJX2 2G4IA 4ZZ5A 1Y9MA 2IXLA 2W9XA 1VRH3 3HBZA 1KRIA 4OHYA 5J09A 3POGA 3VL9A 3KCXA 3MDPA 3KQRA 2YB7A 3RFRA 3ZXAC 5BV6A 2ZGOA 5C3PA 3Q8EA 2I07B 4QB6A 3QBQA 3ZMNA 2E33A 5FR3A 4C0HA 1AUYA 3I49A 1WCSA 1XE8A 4BYYA 4XFIA 5CFCB 1NLQA 1KGYA 4DRVA 2OQ7A 3P3PA 5JXGA 3W5MA 3HEIA 2FD8A 1I9RA 2VTXA 3KT7A 3H8XA 3MPPG 4IV3B 3JU9A 4XJZA 1I5ZA 5FYBA 3V0BB 2QJVA 2V5YA 5E1RA 2BTVC 2R041 1G9BA 1UX7A 2XUEA 2YPJA 5FWEA 4BISA 2OIIA 1W9FA 4P00B 1RJ8A 4JKKA 5JI9A 2RS11 5F1RA 2HBUA 1J1LA 4B29A 3WXPA 1HRI3 1SCSA 2OYZA 2PHFA 4KWUA 4QKNA 3ZOIA 1WLWA 3OYWB 3K4DA 2YYOA 1DZQA 1JZ3A 1W9YA 4NHYA 3M3QA 1UY0A 2G1MA 4CZSA 5FP7A 1QU0A 1JYWA 1CONA 4AI3A 1RUH2 5KHKA 1HRV3 3CIHA 2HWF2 3CO2A 3T09A 1LB2A 1OIZA 2JG8C 4MXWA 1CAXA 4MGKE 4IEVA 4D6QA 4IGPA 1LEMA 3R0RA 2VZ3A 1APNA 3OB8A 1DZTA 1OC1A 4FOWA 4JRAA 5A80A 2AREA 5FUIA 4BWOA 3ORJA 5L9RA 1W3VA 3EHKA 4X6RB 4NMIA 1YLLA 4EN9B 5J7MA 4RS5B 4KH9A 4LLOA 3S7EA 2XLAA 2RS52 2RJLA 1DGWX 2QQJA 3V65A 3B93A 3SCGA 3WF3A 4IGQA 2Z42A 2OUJA 1US2A 3H8OA 2YC2A 5LA9A 1G9CA 2E53A 2WFPA 4YZ4A 1RUE2 3B5LB 1IS3A 4EQVA 4HANA 1UU4A 3M4FA 3VKOA 5L19A 2ZJCA 1OD5A 1MACA 2OZ6A 2WA4A 1JS9A 4Q29A 4OMJA 3JD71 4ARXA 1FOD2 3EBRA 3MUY1 4XILA 1B35A 2LM3A 4QQLA 3ZVXA 3AKQA 5C5TA 3LE0A 2CYFA 5FP3A 5IHRA 1QJZA 4CEWA 2W2IA 4B3NA 1O5UA 3WP6A 1SLCA 1BJQA 4OI1A 4MOAA 2MHFA 4E8CA 1DQ6A 1RUD3 2WLQA 3I2GA 5FZAA 1GWLA 3SC7X 3J7MA 5C9AA 3LA3A 1US3A 4QX1A 5FZOA 3RZHA 1DLCA 2LTNA 1SLIA 2IVJA 3V0BA 3VN4A 3RZKA 5AC93 1PO12 3O0VA 2HJIA 4SBVA 4CCKA 1ASJ1 1E5RA 3S5QA 4X8NA 1XNAA 5FP8A 4DB5A 1PHMA 1BCXA 1YNAA 2X5IA 5K0UC 3ZR6A 4FPFA 1LOBA 1QDCA 3BVCA 3MZHA 3CZJA 1C1FA 4WM8B 1ND2A 4A6OA 4YW1A 1C8NA 1SFPA 1IHMA 2V4VA 1VBD1 4JQTA 3ZDSA 2WUHA 1FMD1 3MLLA 4LA3A 3LFMA 4QPIB 3INAA 5FYHA 1IQAA 2HWE2 1Q8QA 1VE0A 2X53S 1X36A 5DQ0A 1RHI1 3M3EA 2KM2A 1C8M1 1XB9A 2A1XA 2WR9A 4AEKA 2P1BA 2B45X 2VMHA 3HBKA 3JD72 4E8DA 2GH8A 4OFGA 4NIIA 3UL2A 3H0OA 3QCWA 5A6YA 5KHGA 3UESA 2DCZA 2Y0OA 4ASKA 4C90A 3CEWA 1PVC1 5A3LA 1V0AA 2WS91 4KQ7A 2RR12 3GBFA 1V00A 4XJWA 4CEYC 3ECQA 4JDMA 1FNYA 1KQRA 3WNMA 1WD4A 2W1QA 1W0OA 1NY72 1QJY1 3KZ4C 5A3MA 4MGTA 3OGJA 1ZA7A 1RTVA 2ARCA 3W9AA 3LAGA 1QY4A 1W6PB 2QQUA 2Y38A 4D7YA 1STMA 1UOFA 4FOQA 1PO21 2CY6A 2ERFA 4LTAA 4CXWA 4WVWA 2FBEA 5KXBA 4XFCA 3HD8B 3JCIA 3MUZ1 4CDQA 4E4ZA 1FV3A 4GB32 2PMWB 2PA7A 2VUDA 2WAAA 3ME2A 4YVWA 4DXZA 1EV12 1PM7A 4LK6A 1O3SA 4I0AA 3GJBA 4CU9A 1LU1A 1RUH1 4M3CE 5APAA 3ZFEC 2ARBA 3LEIA 3TEZA 4DXSA 1EAH2 2JG9A 3PMSA 2R0HA 5L7OC 4GWJA 2HKXA 2Y60A 4Q4Y3 5DAPA 1H2NA 4Z1VA 2NN8A 1SEFA 1XNKA 4G9SB 1C4RA 5C71A 1AHSA 3USUA 3KVAA 3N35A 3GYDA 4Y1UA 3SISA 3U78A 5FYZA 2JIJA 3VDDB 1W2OA 2JDKA 2W1WA 3VKNA 2Y34A 3PUQA 4HFSA 2QQWA 3LIHA 4OUSA 1LAJA 1UMHA 1YUDA 2BUKA 3U10A 4TSVA 1A34A 3S5AA 4QX2A 5F3IA 1BEV3 1ASJ2 1E57A 4Q4Y2 2IWGB 3VBHB 2I74A 1K45A 4Q5OA 2D6MA 2N7GA 2B42B 1TME1 2CWMA 2VTFA 2ZHNA 2GP3A 2ZTNA 1QGLA 4JC1A 1ZBE3 4QGNA 1DYPA 2J7MA 2PLV1 2WO7A 2ZMKA 3EB7A 3PMEA 3E5XA 2PHDA 2DUQA 5GLWA 2IFWA 4MLOA 2VR4A 1HRV2 1JOPA 4Y4RA 2DBIA 4NVPA 1ZZBA 3I3EA 5A32B 3ZFFC 4IW3A 4CDUA 1YIFA 2OA2A 3AYEA 5H9RA 4XF4A 1UY3A 1JOBA 1GICA 1O4ZA 5FLIA 1E5HA 2UYBA 4S2FA 2XG3A 2RJ2A 1AX0A 4HMZA 2ARXA 1NOVA 1W3XA 4LORA 1SPPA 4QKFA 4PF5A 4CU8A 4JQRA 1KFXL 1QF3A 2VZUA 1MS8A 5JWPA 1HV1A 1XU2A 2ZA9A 1HB4A 3ZXDA 4AHXA 5FYSA 2D44A 1OOPA 1XBFA 1VBE3 4LBOA 1HXS1 1UL9A 5E16A 5H9SA 1Y4WA 5CKQA 5EXOA 3H3LA 1Y7BA 1RXGA 4JVAA 1GOHA 4RR3B
chains in the Genus database with same CATH topology
3B7QA 2E2XA 4J7PA 1O6UA 5LZ6A 1R5LA 2D4QA 4CIZA 3HY5A 3B7ZA 3Q8GA 4CJ6A 1OLMA 4J7QA 3W68A 4OMKA 3P7ZA 3W67A 1AUAA 1OIZA 3B7NA 4OMJA 4FMMA 1OLME 4M8ZA 3B74A 1OIPA 3HX3A 3PEGA 4TLGA 4UYBA 3PG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7Q A;  2E2X A;  4J7P A;  1O6U A;  5LZ6 A;  1R5L A;  2D4Q A;  4CIZ A;  3HY5 A;  3B7Z A;  3Q8G A;  4CJ6 A;  1OLM A;  4J7Q A;  3W68 A;  4OMK A;  3P7Z A;  3W67 A;  1AUA A;  1OIZ A;  3B7N A;  4OMJ A;  4FMM A;  1OLM E;  4M8Z A;  3B74 A;  1OIP A;  3HX3 A;  3PEG A;  4TLG A;  4UYB A;  3PG7 A; 
#chains in the Genus database with same CATH topology
 4RYD A;  2V5D A;  3L9J T;  4IET A;  3DV8 A;  4P5H A;  5DXD A;  3WIN E;  2R1D A;  4CU6 A;  3M7A A;  5FZ1 A;  4DUV A;  4QGM A;  2JB4 A;  5BY5 A;  1AL2 3;  4FFG A;  4PI0 A;  1IS4 A;  2WAB A;  5FZ6 A;  2XLF A;  1I1E A;  1AYM 3;  1HN1 A;  4XHB A;  2RE9 A;  3WHU A;  4N7U A;  4RR3 A;  2DVD A;  5JMC A;  3ENR A;  1Q56 A;  4AFA A;  4WVM A;  5T5O A;  5E6H A;  2DF7 A;  3PU3 A;  4XMA A;  2A6Y A;  3I59 A;  5JOZ A;  4NPR A;  3T30 A;  3O1U A;  4WZC A;  4P9L A;  3R4U A;  3QD6 A;  3ON7 A;  4GWN A;  3UYJ A;  2W3J A;  1URX A;  5I8S A;  5F6L B;  2VZT A;  5C3R A;  2ZEY A;  1S0E A;  2FDK A;  1TNF A;  2RS1 2;  3EXU A;  4LNV A;  4FAG A;  4F7Z A;  2RM2 1;  1YFW A;  1QOO A;  4RHV 3;  2XPJ A;  1QWR A;  1CVN A;  4ZZ8 A;  4LXL A;  1MZ5 A;  5EPA A;  3GZT B;  3VHR A;  1NLR A;  3NL1 A;  3IAQ A;  3O1R A;  5J98 B;  3WQ7 A;  4EN8 B;  4Q27 A;  3AXD A;  3P5B A;  4LBQ A;  2BGP A;  3ES1 A;  4H2A A;  5IVY A;  2QE3 A;  1F5J A;  4IEQ A;  4HET A;  3NKT A;  2VZ1 A;  3DXT A;  2W1S A;  1Q8S A;  2GC1 A;  4LLF A;  5FJK A;  3ILR A;  2RMU 3;  2Q8D A;  4L8Q A;  2HWE 1;  1VBA 2;  5FY1 A;  1FXZ A;  5FY4 A;  4Y1V A;  3B7Q A;  4RS5 A;  1PGW 1;  3NAP C;  2Y26 A;  5BNP A;  4A3X A;  2ZKN A;  3WG1 A;  4W6Y A;  3W5N A;  1GZT A;  1CIY A;  3OD4 A;  1PMH X;  1UOG A;  4HL0 A;  4RGA A;  3UJO A;  3VDD A;  1OA2 A;  3ZFG C;  5LRS A;  3EQE A;  3VZL A;  4FFF A;  1JZ4 A;  1VR3 A;  4B4Q A;  2QTW B;  5FPA A;  3AVR A;  1IG3 A;  5FXV A;  3GZE A;  1JHN A;  4HPK A;  3U4S A;  4BQ1 A;  1AR8 1;  4M3C B;  4BU2 A;  3RZJ A;  1JYT A;  2GME A;  3SMH A;  3O1S A;  1BVP 1;  1ZYB A;  4QM9 A;  5F6K A;  2ZMN A;  3ZN5 A;  2W92 A;  3BTY A;  4AEJ A;  2EID A;  3IDB B;  2OPK A;  4ZKT B;  3TN9 2;  5A7Q A;  1YI9 A;  4PBP A;  2ET7 A;  2V72 A;  4AWD A;  2E32 A;  5JMO A;  3SQO A;  4MXV A;  1J84 A;  2D98 A;  3N9N A;  4Q4W 3;  5GLT A;  1CJD A;  1AYM 1;  1XQN A;  1OQD A;  5FAX A;  5A7W A;  2XH6 A;  3H7J A;  4GA9 A;  2ENR A;  3ACI A;  2BNN A;  1G6N A;  2JIC A;  1AVB A;  4QMA A;  5FYY A;  2VUA A;  1X9P A;  4IND A;  3TN9 1;  1ZBA 2;  1W90 A;  3SIT A;  1PK6 B;  1XU1 A;  2BVV A;  3OUJ A;  4GMP 0;  5FZ0 A;  5C6C A;  5JIU A;  4XHX A;  4OUL A;  4RN5 A;  2Q4S A;  4N9I A;  3N3H A;  4KMQ A;  4Y5T A;  4YW6 A;  4NE9 A;  4CDX B;  4IEP A;  1NXM A;  4AFD A;  3ZFE B;  4TWT A;  1OUX A;  1NCQ B;  1S2K A;  1O5L A;  4NRM A;  4NPL A;  1DGR A;  1NE6 A;  1R64 A;  1SHW B;  5C7G A;  3UGG A;  5T55 A;  4FPK A;  5LA1 A;  1H9P A;  4OUE A;  1PGW 2;  3UNP A;  4CPB A;  1FOD 3;  2ZX4 A;  2C24 A;  1FAT A;  2JIG A;  1DP0 A;  2MPF A;  4QX5 A;  1W2U A;  1F9K A;  1EPW A;  1I5P A;  4KL1 A;  4CRQ A;  2WSV A;  3PVB B;  5IK7 A;  1O3T A;  4CEY B;  1EY2 A;  5CU1 A;  1F8V A;  5LEK A;  5DZG A;  2YPD A;  2Z4F A;  2Y8K A;  4CUA A;  3CZU A;  1W06 A;  1S0I A;  2WFF 3;  1X33 A;  4OHV A;  2VNR A;  3VKL A;  3WHT A;  3WP3 A;  5C8C A;  2E7T A;  2X5I B;  2WQ8 A;  2PQS A;  4XFH A;  3DYM A;  4EWD A;  2ZOE B;  3H8U A;  3HT1 A;  3KV6 A;  3LPF A;  3JZV A;  1NCR C;  2VZV A;  5DZE A;  5FZH A;  2E9Q A;  3H50 A;  4QX7 A;  1UNB A;  2ZGR A;  4ZU7 A;  4EV0 A;  5FCC A;  4XFB A;  1VBC 1;  3ZFG B;  4AXO A;  5IYY A;  5L9V A;  4JAA A;  2BNM A;  3AZX A;  3KM5 A;  5G05 L;  1IG0 A;  3CLP A;  3I2H A;  1VMH A;  4CEW B;  1COV 3;  5F3C A;  2WNU A;  4QDQ A;  1SQ4 A;  1W8N A;  4B7K A;  3NAP B;  4K1Y A;  2A6W A;  4KGG A;  1JOD A;  4NAM A;  3VLB B;  1A8M A;  4QX0 A;  1FX5 A;  1OT5 A;  2CSG A;  3P1I A;  2LRP A;  1F15 A;  3D6E A;  1UYY A;  3IT8 A;  4K3U A;  2VJX A;  3K75 B;  1NZC A;  4UF0 B;  2DFB A;  3SKJ E;  4Q8K A;  3OBR A;  5K4L A;  2MEV 1;  2CGP A;  2WQZ C;  5GZF A;  2WO3 A;  1LOF A;  2PHU A;  4LE4 A;  3DEM A;  4H55 A;  1UZW A;  5FDB A;  3GCW A;  2G9Z A;  3SCH A;  1XC6 A;  5BNN B;  3FC0 A;  1HXS 2;  1IS5 A;  2AUY A;  5ISL A;  2ZX3 A;  4P9G A;  2W95 A;  2GC2 A;  4P9I A;  1JU4 A;  2BBV A;  4AG4 A;  1C5H A;  4AQT A;  3POY A;  2VMG A;  3UGH A;  1WCD J;  2QDN A;  1RIN A;  2QZ2 A;  4WVV A;  5FYV A;  1VB2 A;  5EYX A;  3T0D A;  2EXJ A;  4R8H A;  1JXN A;  1LR5 A;  1ZRD A;  2GP5 A;  3TB0 A;  2ZEW A;  1N1S A;  2XHN A;  1C8M 3;  1Y9Q A;  2P3K A;  4Y4Y A;  3AZZ A;  2VQU A;  3Q8A A;  4RS5 C;  2YU1 A;  3PHM A;  1XYN A;  4EN7 B;  5DUX A;  1RUF 1;  4I02 A;  1XE0 A;  1UOJ A;  1WZX A;  1LHU A;  3FWE A;  4A45 A;  2E63 A;  4LKE A;  4Q4W 2;  1NQD A;  4Q1P A;  3R4D B;  3MIH A;  4DXR A;  2VME A;  4XJ9 A;  2JX9 A;  4RR3 C;  4FPH A;  4ISQ A;  4Y24 A;  1T6B X;  3I3D A;  1IZ3 A;  2RMU 1;  2W5F A;  4Q4Y 1;  2IXC A;  1GAN A;  2VXR A;  1NYW A;  3Q9O A;  3M8L A;  3OPZ A;  2VW1 A;  2OVU A;  1E5I A;  4BLI A;  2EA7 A;  2RDS A;  4JHT A;  1H1I A;  1W05 A;  1RL3 A;  2X8K A;  4UW6 A;  5FYM A;  4DNY A;  2WNV A;  1UYP A;  4LE3 A;  5JSR A;  3GZA A;  3F2Z A;  3VL8 A;  3ZO0 B;  4PHZ A;  2B5H A;  1M06 G;  2RVA A;  3HIF A;  5EJZ B;  5FXW A;  2HYK A;  1QOT A;  4GMP 3;  4UAP A;  4Y5S A;  2GMM A;  1W8Z A;  1BQP A;  4CXX A;  1MS3 A;  2XDV A;  5GKA C;  4ZU4 A;  1Q5O A;  3NNF A;  5F5Q A;  3MYX A;  2VVD A;  3FMG A;  3POJ A;  2YBS A;  1PMJ X;  1R1A 2;  1ODN A;  2BER A;  3JBG 1;  1WUV A;  3GM8 A;  2PEL A;  1W28 A;  3IB3 A;  4AFC A;  2FHR A;  4YYO A;  1QJY 3;  2EIG A;  3MFC A;  1NAE A;  2GAU A;  1S4C A;  1H1A A;  4NHK A;  3FX3 A;  3SKV A;  1AYN 3;  4HLT A;  3RWK X;  5A3P A;  1S0J A;  2B9U A;  3KQ4 B;  4BQ2 A;  2B4K A;  2W46 A;  4OI4 A;  3IDA A;  1W99 A;  1CAU B;  1DLL A;  1RVF 1;  4UFJ A;  2ARA A;  3SEE A;  5CFD C;  4W6W A;  2CTV A;  4NRQ A;  4CIZ A;  1OBN A;  1POV 0;  1QJU 3;  3ZXK A;  4PJY A;  1DQ5 A;  2Y64 A;  3HPN A;  1RUC 2;  5GLV A;  3I2O A;  2Q5T A;  1ND2 C;  5FRA A;  2Q1M A;  3MV0 1;  4XAB A;  3AMP A;  4EN6 B;  3AL5 A;  2JKB A;  4YG0 A;  2BGO A;  4QQO A;  3VBU A;  2YGM A;  3LEM A;  3VBF C;  4AED A;  4CEW C;  3OOX A;  3FE5 A;  2DV9 A;  2UWB A;  1CX4 A;  1DGR N;  5JZG A;  4JCK A;  1RUI 1;  1D4M 3;  2VZS A;  4YW2 A;  1OLM E;  2YGL A;  2VBB A;  1Z7S 3;  5KC6 A;  3B01 A;  1VAL A;  2RS3 1;  1O91 A;  3VHP A;  2EIE A;  3QH7 A;  4U2A A;  4R52 A;  4CSW A;  2BDR A;  4ONU A;  2JEN A;  2Z5W A;  4RA0 A;  3A7Q A;  2XJP A;  4LBK A;  4XW3 A;  3WOG A;  4A7Y A;  1UKR A;  2CGN A;  2TUN A;  3KV5 A;  2B9V A;  4P9J A;  4QX8 A;  3WNX A;  3VBO A;  2CNA A;  2I45 A;  2X5I C;  1PK6 C;  4IV1 C;  2RDQ A;  4LEJ A;  3AKT A;  1CAV A;  1AJK A;  2FCT A;  3GCX A;  3OUH A;  1W03 A;  3AM2 A;  4UXA A;  3ZM8 A;  5FPB A;  4COY A;  4NIA A;  1O7F A;  1AR9 1;  2OW4 A;  2FMD A;  1HW5 A;  1CR7 A;  2D3R A;  3WDX A;  4BDV B;  2FDJ A;  3EMR A;  1IPK A;  3PUS A;  4PT6 A;  3MEP A;  2GND A;  1GR3 A;  4CCO A;  1ULC A;  2P6C A;  4Y20 A;  4XOG A;  2EIB A;  1CIW A;  2A6Z A;  5JAX A;  1DQ4 A;  1YI7 A;  4QXB A;  4YM1 A;  2AZ5 A;  1MQT A;  1NKG A;  1VBB 3;  2VTX J;  3AVS A;  2Z2S B;  1YO8 A;  3D0S A;  1VBE 2;  3MIE A;  5F5A A;  1R09 3;  5CYY A;  2ZGS A;  1KFU L;  1LTE A;  5L7O A;  4WM8 A;  1JN2 P;  2P4E A;  3KLS A;  1RUD 1;  3ZYB A;  4GH4 C;  3WLU A;  2IXK A;  1BVV A;  3T08 A;  1SBD A;  4L11 A;  3THD A;  2NQY A;  3HAG A;  1LGB A;  4O7X A;  1DGW A;  3RI8 A;  1RUN A;  4HZF A;  2O14 A;  3KB5 A;  4Q8L A;  3NJV A;  2DUR A;  1MPX A;  5FPV A;  4E4H A;  4KWL A;  5DMY A;  3T2O A;  2C1F A;  1ULD A;  4HG6 B;  4Y1Y A;  1VPH A;  1KS4 A;  4PLN A;  3EYP A;  2LS6 A;  2OXB A;  3IWZ A;  5F2W A;  4BH9 A;  2D6O X;  3ZR5 A;  4FPG A;  4OUM A;  1YQ6 A;  1PO2 3;  4HXC A;  3PVN A;  3GDB A;  2VCM A;  4URA A;  1COV 1;  4BQW A;  4LK7 A;  4QGL A;  5FTT C;  1JU3 A;  3AYA A;  1GQH A;  4HPK B;  2CAV A;  2XWB B;  1SFN A;  1WCK A;  2X29 A;  4LBQ B;  1PGS A;  2JG9 C;  3O0W A;  3LDK A;  2FZ2 A;  1TQ5 A;  1AR9 2;  5FO7 B;  4MGI E;  4DOU A;  1DFQ A;  4AK3 A;  1AXY A;  3RYR A;  1G9F A;  2XBO 2;  3KGZ A;  2B7Y A;  3NNJ A;  2XON A;  4Y1Z A;  3FFZ A;  3J7L A;  2GN7 A;  3RZM A;  4ZXK A;  2J1R A;  2C9K A;  1DCS A;  4S2D A;  2VMC A;  3LB9 A;  2EXH A;  4OMD A;  3GNE A;  4I2O A;  4J25 A;  1FAY A;  1JOJ A;  1ZX5 A;  1O3Q A;  2W68 A;  4BB3 A;  5A1L A;  3I3B A;  2FMY A;  2UU8 A;  5LWB A;  4ZPI A;  2EVX A;  4J1X A;  1QXJ A;  4CP0 A;  5BNO B;  4QT6 A;  1AR8 3;  3UT0 A;  3OG2 A;  5C9A B;  4XCA A;  4MGZ E;  3VZK A;  1JUH A;  3LGR A;  3JB4 C;  1RYY A;  2QCS B;  4AGV A;  2K2S A;  4LIU A;  3K48 A;  4QAW A;  4UFI A;  4B7E A;  1JYN A;  3J26 N;  2DYC A;  1SLL A;  2E51 A;  3AXE A;  1WKY A;  4LKF A;  3POE A;  2DTW A;  4YG6 A;  3BGA A;  4NRO A;  1CAX B;  3KD4 A;  2P5B A;  4XTP A;  2ZML A;  5BPX A;  4CCJ A;  3OGG A;  3WP5 A;  5IAT A;  1WMD A;  4WVM B;  2QFE A;  5FFO C;  2OUH A;  1HN0 A;  4XJA A;  4OYU A;  4WV8 A;  1DF0 A;  3BOD A;  2BJS A;  2Q0A A;  4IEX A;  3OUI A;  3M3I A;  3LPG A;  3OYW A;  2HH9 A;  3POW A;  4AI0 A;  5FZF A;  4AHW A;  1LKN A;  4MGQ A;  1NXD 1;  5AFE A;  3K46 A;  4XE9 A;  2XR4 A;  2JEM A;  5C9A C;  2VW2 A;  1F31 A;  3BAL A;  4XF9 A;  4N7I A;  3T4H B;  4KWK A;  4C0B A;  3ZYI B;  2CL2 A;  1NZI A;  2VEC A;  2HBT A;  5FP4 A;  1AJO A;  2PLV 3;  3PUI A;  3SNM A;  2WLP A;  3TOJ A;  1SDW A;  2J1S A;  1SAC A;  4ZS3 A;  3AFK A;  2WZR 3;  4P9X A;  2BFU S;  2ORX A;  4RSU A;  1IKQ A;  1RUG 1;  3THT A;  3H1M A;  3KCC A;  1ND3 C;  5L73 A;  1W8W A;  5K0U A;  2AEY A;  4XQ4 A;  1OQ1 A;  1CN1 A;  3MW2 A;  3PEG A;  4XCB A;  5IVJ A;  4Q1R A;  4XXA A;  3E1F 1;  4HK9 A;  1R08 3;  3AP5 A;  2LUW A;  4LUK A;  5HCF A;  3WV6 A;  3JQX A;  2JDN A;  3W59 A;  2P3Y A;  3DPR C;  4GKX A;  1OOP B;  1YYN A;  1HB2 A;  3AMN A;  1Q8V A;  1VMF A;  4B4P A;  4DEQ A;  1SG3 A;  3CKH A;  4R9C A;  2Z69 A;  3URF A;  4Q4V 3;  1BK0 A;  5C8C B;  3LEG A;  5FXZ A;  5JXH A;  1RUG 2;  3OBA A;  4IV1 A;  4MGS A;  4QDR A;  5K9Y A;  1PM4 A;  2VBP A;  2RS3 3;  1LOD A;  1RUC 3;  4BE3 A;  1HJG A;  1KDK A;  1QJU 2;  1AR8 2;  3DKQ A;  4JDN A;  3B02 A;  4XC9 A;  1GU3 A;  1WD3 A;  2IUW A;  3T2P A;  3D82 A;  3FHQ A;  3AMM A;  1RUD 2;  3GBW A;  3PUH A;  3IDE A;  5A7O A;  5D2A A;  3HN3 A;  3ZYG A;  2A3Y A;  4A41 A;  4R9D A;  4ASL A;  2HWB 2;  4RFT 0;  4XFG A;  4TXW A;  3TAY A;  3ZFF B;  1ONA A;  4C1X A;  4CUC A;  4KU7 A;  4TN7 A;  1VBA 1;  2J1V A;  4XYX A;  3LA7 A;  2JE7 A;  4GUL A;  1D7P M;  2VE1 A;  5FO9 B;  3AKR A;  3VKF C;  4IE0 A;  3NRU A;  5FOJ B;  1RUI 2;  2PTM A;  3FLR A;  4DY3 A;  4GH4 A;  2J22 A;  2EXI A;  3VD9 A;  1BBT 1;  4YVW B;  1LHO A;  3OPW A;  3ZYR A;  1DG6 A;  2FDH A;  3FBM A;  4AVV A;  1TMF 1;  3FJS A;  4IGO A;  3E6C C;  4RGG A;  4DIQ A;  2P3J A;  1YRZ A;  2D3S A;  1IS6 A;  1PVC 3;  1BXH A;  3PNA A;  5D8A C;  3IPV A;  4FXK B;  4HOO A;  2VNO A;  2HWF 3;  1I6X A;  2VOW A;  3VDD C;  4DMI A;  1PIV 3;  4JGZ B;  2ZCW A;  2V4A A;  5DN2 A;  3JB8 A;  5SV5 A;  1YCI A;  4BOW A;  2P34 A;  3PTR B;  2IFR A;  5FY5 A;  4K9S A;  3EO6 A;  5GAL A;  3ZKU A;  3A22 A;  2JE8 A;  1J59 A;  2QQL A;  3AK0 A;  5CVR A;  4UI9 L;  3WF0 A;  4U36 A;  1F35 A;  4K6B A;  2IZW A;  1PK6 A;  3ZSJ A;  3J8F 2;  5LBF A;  1VIW B;  4KGQ A;  4Z8B A;  1H4G A;  3O7O A;  1KIT A;  4MV2 A;  3BTA A;  1WW6 A;  1XXN A;  3ABZ A;  5D1I A;  1ULE A;  4ASM B;  2D43 A;  4RD7 A;  2W08 A;  2NP0 A;  1CPN A;  5FZE A;  1C1L A;  4NWW A;  1V6N A;  3J8F 1;  4BA6 A;  4GAL A;  3LF7 A;  2MEV 3;  4RQP A;  1ZA4 A;  5A3W A;  2YHJ A;  3RPQ A;  4QPI A;  5A7N A;  4QWN A;  2WYS A;  1QOS A;  1VRB A;  2WS9 3;  3ZKY A;  4ZHN A;  2JB8 A;  1M4W A;  1OQE A;  1NX9 A;  3ACH A;  1HB1 A;  2XLG A;  3BYW A;  2K9Z A;  5CB7 A;  1VB4 A;  2BVB A;  3CJI A;  2J42 A;  1CJP A;  1QNY A;  4FPE A;  5FBZ A;  4COU A;  3I2I A;  1VRH 2;  1NA1 A;  1PNG A;  1ZZ6 A;  2QVS B;  3UV9 A;  3RVH A;  2VMI A;  3KF5 A;  5HCB A;  4G3Y C;  1W6O A;  2VOX A;  3OBZ A;  5LBC A;  2R07 2;  2VOV A;  3ZSL A;  1RUO A;  1AYN 1;  4FPO B;  1R09 2;  3IIA A;  4YVS A;  5ACA 3;  5E8A A;  3MLK A;  3CQO A;  3E6B A;  1FYU A;  5J3U A;  4YW7 A;  1K5M C;  2FQP A;  1RHI 2;  1ULF A;  1CAU A;  4LBL A;  2YZ4 A;  1Y9G A;  3OPT A;  4W4Z A;  2GDF A;  4LR4 A;  4ORF A;  1DDL A;  2A6X A;  4NO4 A;  4QM8 A;  3LFI A;  4UFH A;  2WT1 A;  3FFQ A;  4Z2W A;  5JDB A;  1GP4 A;  3RYP A;  2VXJ A;  4PF1 A;  3O1M A;  4QQH A;  4BPZ A;  5CKM A;  5F9T A;  4IEY A;  2EAL A;  3SLI A;  1OLM A;  2PQQ A;  3CL1 A;  5JCT A;  1IQD C;  4OHW A;  3RG0 A;  3W67 A;  2XOM A;  1HIX A;  3I2D A;  3X29 B;  4NIG A;  2VVF A;  3ILN A;  4ISR A;  4V2W A;  3AZY A;  4BXS V;  1QQP 2;  1LEN A;  4F3J A;  3BPS A;  4FMM A;  3NV2 A;  1UN1 A;  1MS1 A;  5CEH A;  1ZBA 1;  4LBQ D;  2UWC A;  1ULO A;  4YW5 A;  3HQX A;  2D3P A;  4JKL A;  4Q4X 2;  4ATE A;  5F5I A;  5LA2 A;  3N9Q A;  5JPM B;  2RDR A;  1SLB A;  5HBA A;  3USS A;  5IAX A;  1P8J A;  5FY9 A;  4YFZ A;  4F8A A;  4JTO A;  3LEK A;  4IEW A;  3ZYF A;  2QDR A;  1MVQ A;  3MBW A;  5IW0 A;  1GLH A;  2O1Q A;  4O61 A;  1D4M 2;  3CBN A;  1B35 C;  1CZS A;  1LOA A;  5DG2 A;  2XXZ A;  5CAZ A;  1FOD 1;  2BP6 A;  3M1H A;  1GNZ A;  3FLT A;  1AL2 1;  3FZ3 A;  4DS0 A;  1U0A A;  4E2G A;  2RM2 3;  5B2G B;  4LIT A;  4BQX A;  3N9P A;  1WBL A;  5FWJ A;  5GM0 A;  5A1A A;  1XOY A;  3POS A;  5A6X A;  2H0B A;  2JD9 A;  2W39 A;  2O8O A;  4IE7 A;  5D21 A;  1G9D A;  3BTZ A;  1N47 A;  1Y3T A;  4HVR A;  2NLR A;  1VBC 2;  1QNW A;  3SCF A;  3KF3 A;  2C0Z A;  5FPZ A;  4RFR B;  1IGO A;  5FUN A;  2VNG A;  5BNP C;  1XNB A;  5EZW A;  1CZT A;  2JXA A;  1R5L A;  5CBL A;  1J3R A;  1QJY 2;  2WKK A;  2R06 2;  3N36 A;  3WEZ A;  1GYK A;  3MID A;  2WZP P;  1ZM1 A;  4PLM A;  4A3Z A;  2H6C A;  1JW6 A;  1HJF A;  4C1W A;  2VUL A;  4M4P A;  4LHN A;  1L3J A;  2ZX0 A;  1PZ8 A;  1OMI A;  3J4U H;  4N43 C;  4QB2 A;  3VBH A;  4CDX A;  3C3V A;  1HKD A;  4AE2 A;  3SH5 A;  2K46 A;  3O0X A;  1C8M 2;  1G9A A;  1ENR A;  4JGY A;  4QXK A;  3NQH A;  4UFK A;  1WME A;  4TYS A;  1N3Q A;  1W6O B;  2W52 A;  3S7I A;  5L7O B;  5F37 A;  4A7Z A;  2XQR A;  4J7P A;  4AHY A;  4LBN A;  3ACG A;  4ZON A;  1GQG A;  2YMZ A;  2WZR 2;  2XVG A;  4YRD A;  3WQ1 A;  4XFF A;  3P3N A;  3RSJ A;  2XHK A;  1WMX A;  5BYN A;  5IK5 A;  1MS5 A;  2BZD A;  2LAL A;  3DN7 A;  3U75 A;  3ZXL A;  1OPO A;  1W9W A;  4LOT A;  2PHT A;  1F4A A;  1Z78 A;  4IV3 C;  3RMY A;  2HWD 2;  3U14 A;  4COW A;  4CDQ B;  5C3O A;  4MET A;  5FRE A;  1UIK A;  3WDY A;  1IKP A;  1O4T A;  3AP6 A;  5KR7 A;  4ZS2 A;  4CCD A;  2C5D A;  3C2U A;  3OF1 A;  1KJL A;  1YHF A;  4BQ4 A;  5CG8 A;  4OI2 A;  4CU7 A;  5K7P A;  5JOW A;  2HWC 3;  1H8T C;  1V6L A;  1XRU A;  1W8O A;  5DZF A;  5CFD B;  1GZW A;  2Y6L A;  3OEB A;  1WW4 A;  3ZXJ A;  2QQM A;  3UKT A;  1UQX A;  2Q8C A;  3VV1 A;  3HY5 A;  3B7Z A;  4CCN A;  1FMD 3;  5I8T A;  2ADE A;  4UW3 A;  3BB6 A;  4FQZ A;  3WNP A;  4HKW A;  1FT9 A;  4Q4X 3;  2D6L X;  1UU6 A;  5BNQ A;  3IZO A;  3M70 A;  4COZ A;  1LED A;  3R05 A;  2C6S A;  3KT1 A;  5CFD A;  1A3K A;  1OVS A;  2CGO A;  3H42 B;  2E6V A;  2XGX A;  4MHR A;  2QUO A;  4NR1 A;  4LHL A;  1LNS A;  5K0U B;  1SFY A;  1AR6 1;  2NMO A;  2JDA A;  3AYC A;  2XJV A;  1C57 A;  5CNA A;  1H8T B;  4HK8 A;  2MEV 2;  2HEY F;  4N8M A;  4QDS A;  2IXJ A;  2DVF A;  1V6J A;  3FUO A;  3ETP A;  4K8R B;  4PIX A;  2WSU A;  1YXW A;  3CHX A;  2DFC A;  4XDP A;  3ZFE A;  3L2H A;  5A1F A;  2AGS A;  5T3N A;  5LCW L;  5LEJ A;  2VCA A;  1GZC A;  1RHI 3;  3K3N A;  4GMP 1;  4AI8 A;  4ES9 A;  4LIV A;  1XPW A;  4MO3 M;  5DDJ 3;  4AI9 A;  3OSD A;  3NNL A;  4JGY B;  4N53 B;  1GQP A;  4AAP A;  4PQ9 A;  4QPG C;  2DTY A;  3ZLI A;  5FUP A;  3GF6 A;  4FQ4 A;  4PBO A;  5GLU A;  1YFY A;  3THC A;  5FLJ A;  4LO4 B;  5BNN A;  3I4I A;  1OKQ A;  5FY0 A;  4C91 A;  4DQA A;  1LOF C;  2GN3 A;  1MS4 A;  4FOV A;  3N9O A;  3III A;  1XNC A;  2ZGT A;  3CJI C;  4M0H A;  4O9E A;  5E88 A;  1VJ2 A;  2RS3 2;  1DYO A;  4R9A A;  5T5L A;  4XUT A;  4A44 A;  2JDU A;  1WMF A;  5FZ9 A;  2HWC 2;  4PDW B;  4XF1 A;  1RUF 3;  3MFA A;  1DIW A;  4AVA A;  1XND A;  2Y6H A;  4QD2 A;  1DBN A;  3U37 A;  4TTG A;  3WUC A;  1MQT C;  3OCP A;  4D8M A;  2HWD 3;  1KJR A;  1TME 3;  5DPN A;  1SPP B;  2BOI A;  3VKM A;  5HV4 A;  3CF6 E;  3NNG A;  1RMU 3;  2O8Q A;  4KG0 A;  4QKB A;  1UPS A;  1QH6 A;  4QHB A;  3TYJ A;  4BZ4 A;  1X82 A;  1ZZC A;  1WCQ A;  4V2V A;  1GOF A;  1POV 1;  2XKO A;  3LKJ A;  4BLJ A;  4Z92 B;  4IEZ A;  1FPN 1;  3AC0 A;  3RNS A;  5C4W C;  4RHV 1;  2XL7 A;  4QXC A;  2R1B A;  1T6G C;  2WS9 2;  2A7A A;  2G9F A;  2JWP A;  4HSJ A;  1PVC 2;  3MIG A;  4JHZ A;  4UBH A;  4XQD A;  3DYO A;  2D6K A;  2YC4 A;  1ACC A;  1W0P A;  1ZBA 3;  3U07 A;  4E2Q A;  4EN0 A;  1LHW A;  1NLS A;  5ABJ C;  1Q8P A;  1YFX A;  3HR9 A;  3K77 A;  1DYK A;  1H6X A;  1RUI 3;  1D4M 1;  2VPV A;  3HWJ A;  1VBE 1;  4LUL A;  4CPB D;  2C26 A;  2VMD A;  1K5M B;  4IXL A;  5A3T A;  2OT7 A;  4W8J A;  1EPZ A;  4LKD A;  1BHG A;  3SH4 A;  2QQO A;  4OVE A;  2F6B A;  5T50 A;  4JKM A;  1W2N A;  1K5J A;  3V0A B;  4YVS B;  3A21 A;  3SXW A;  2FDF A;  2HWB 3;  4D69 A;  3NKG A;  2UYA A;  3NAP A;  3B3Q E;  3JQW A;  2OPW A;  4FOY A;  5KHJ A;  4Z82 A;  1PZ9 A;  2BYV E;  1LEC A;  4L92 A;  5FJH A;  4FVV A;  3TNQ A;  2D5F A;  4UOJ A;  5FZL A;  4NJ4 A;  5IK8 A;  3VD3 A;  3WDW A;  1H8V A;  2X10 A;  4CCL A;  2DUP A;  1J3P A;  5CFC C;  2WL1 A;  1GSL A;  3OY8 B;  4CP9 A;  5C3Q A;  1W6N B;  1S0F A;  3BCW A;  3HMY A;  5FMC A;  1ZBE 1;  4CUG A;  4XZU G;  2QNK A;  1J83 A;  5EJ1 B;  2DU0 A;  4PIY A;  1XNT A;  4YPJ A;  4QPG B;  3NNM A;  1NUK A;  2GZW A;  4GIQ A;  5FPL A;  4Q0Q A;  4Z2A A;  1QH7 A;  3T1L A;  4AAX A;  4GWI A;  4KI5 M;  4H7M A;  4JGZ C;  1A78 A;  3VBF A;  4NWV A;  2PHR A;  1RJ7 A;  2VQA A;  3H1W A;  5JZG C;  3BN6 A;  4Q26 A;  1VRH 1;  3T1M A;  1RMU 1;  1J1T A;  1TVG A;  2YFZ A;  4XUN A;  2RS1 3;  5IVB A;  1V6K A;  4YSF A;  1WLD A;  2VBD A;  4YGD A;  3VBO B;  2QKD A;  3OBT A;  3BOP A;  2VZR A;  3T3Y A;  1OD3 A;  5LZ6 A;  3WNK A;  2GC0 A;  5SV8 A;  1U5I A;  1W2T A;  1NY7 1;  3VBU B;  1GOG A;  4ES8 A;  2R32 A;  1QKQ A;  4XDO A;  5DAV A;  1IOA A;  1YQ2 A;  3ZSK A;  3C7H A;  1VBD 3;  5A7W B;  1ND3 A;  5J96 B;  1WWY A;  1G86 A;  3CDZ B;  4HT1 T;  4EZ4 A;  3D3A A;  3EJK A;  3K3O A;  3WW3 A;  1UMZ A;  4OMK A;  5FPX A;  5I0U A;  2WIN B;  4KBB A;  2A3W A;  4FPJ A;  1UZ0 A;  2R7E B;  1S2E A;  4Y20 B;  2HWF 1;  2HWC 1;  1O59 A;  1IPS A;  5KXD A;  1AL2 2;  3SHR A;  2BQP A;  4MZU A;  4ERO A;  4EWE A;  4NUB A;  1OF3 A;  4AL9 A;  3VD5 A;  3PIJ A;  1PO2 2;  2XVL A;  4YGC A;  5FZO B;  4BXF A;  3RQ0 A;  2WAO A;  2DVA A;  3ZFF A;  4AGG A;  5HCH A;  4MGY E;  3WG2 A;  1CAW B;  4B8E A;  2E7Q A;  1ZBE 2;  2QQK A;  4FP2 A;  2LRO A;  4LO6 B;  4XET A;  5GZD A;  3RMX A;  4D7S A;  4CVU A;  2EAK A;  5I8Y A;  1EUU A;  4D7T A;  3ZMO A;  2A75 A;  4L9B A;  3HT2 A;  5I91 A;  4FTS A;  4AGR A;  5B4X A;  3NW4 A;  4BIO A;  2VG9 A;  4KG8 A;  2HYX A;  3M3C A;  1RMU 2;  1X8E A;  2R04 2;  4R4Z A;  4FI9 A;  2RR1 1;  2WNV B;  1HLC A;  3UET A;  2WQ4 A;  2PAE A;  1VAM A;  1K12 A;  2AEN A;  1GKB A;  1AR7 3;  1V9U 3;  3AMH A;  3AP7 A;  4D94 A;  1JZ6 A;  1S0G A;  2ZGN A;  1BBT 2;  3WUD A;  4Y33 A;  3W20 A;  4A7K A;  1BYH A;  3A0N A;  3QLQ A;  2VCB A;  1PX4 A;  4WM7 A;  4BK5 A;  1UD1 A;  1VBB 2;  1PVX A;  4FCA A;  5JVV A;  1HDK A;  3T0A A;  1SBE A;  4XFA A;  4CTE A;  1RUF 2;  2W94 A;  3VBS A;  2H0V A;  3OGV A;  3KCY A;  4YM0 A;  4CCE A;  1VBD 2;  1VMJ A;  5BNP B;  4LQR A;  2CDO A;  5FYT A;  5JOY A;  5HXV A;  1EUT A;  5FK7 A;  1JBC A;  4XTM A;  1E5S A;  2HWB 1;  1I3H A;  2J1U A;  2VUJ A;  2VQT A;  1VBB 1;  2WBK A;  5AC9 1;  4LT5 A;  1ODM A;  1R09 1;  2BV4 A;  3C7F A;  4P5Y A;  3ZIW A;  3N7K A;  1SCR A;  4V1P A;  2BFU L;  4P9W A;  3H9A A;  4N43 B;  2ZBJ A;  4OLL A;  1F2N A;  1GFF 2;  3WCR A;  3VUO A;  4XIK A;  1UYZ A;  1OUS A;  1RUE 1;  1U5Y A;  5FYI A;  2CV6 A;  1PIV 1;  2WZE A;  5EQU A;  5JLV A;  1NQJ A;  1L7Q A;  2XBO 3;  4H7L A;  2Q8E A;  1LOC A;  4XAE A;  1X9T A;  3NV3 A;  2GSY A;  1AR9 3;  1GP5 A;  1L7L A;  4FT8 A;  5AVP A;  2Y6J A;  3WDT A;  2WNU C;  5LBE A;  1BEV 1;  1OPM A;  5IK4 A;  4A2U A;  2VC9 A;  4FSJ A;  1BBT 3;  1S55 A;  3R4S A;  3THP A;  5CG9 A;  1BK1 A;  1JI6 A;  5A6Z A;  3I59 B;  4HKL A;  2AAC A;  4LBM A;  2WWJ A;  2TNF A;  1EV1 1;  2PHW A;  1JZ7 A;  4BQ5 A;  2ID4 A;  1ULG A;  1LRH A;  5FZ4 A;  4GWM A;  2YV8 A;  3V0A A;  2VUC A;  3U1X A;  4BCU A;  5FPU A;  1S1A A;  3FHI B;  4UYB A;  3WY6 A;  3I2F A;  1Q43 A;  3GBG A;  4LKS A;  2RS5 1;  1S0B A;  4Q4V 2;  2BWA A;  4EE2 A;  5DUW A;  5J48 A;  1EYB A;  4HVQ A;  5LK7 B;  3CU7 A;  1AF9 A;  1RVF 3;  4XAC A;  1BLZ A;  3B69 A;  2WZ8 A;  4H3W A;  1F4H A;  4N90 A;  2JG9 B;  1ZRC A;  1TMF 2;  1QXR A;  4AZZ A;  5GZG A;  4RGK A;  4PDW C;  1LGC A;  1QEX A;  3S6P A;  4KU8 A;  3TNP B;  3IN9 A;  1NT0 A;  1SMV A;  3VHN A;  3WW2 A;  3FBY A;  4P02 B;  4O9G A;  1CX1 A;  4DO0 A;  5C5U A;  1DQ0 A;  2XJR A;  3MW4 A;  1DQ1 A;  1DHK B;  3VDA A;  3PTY A;  5DAQ A;  3RJR A;  2B46 X;  2QQN A;  2EXK A;  2R06 3;  2YRO A;  4XBQ A;  2O0O A;  1S0C A;  2WWS A;  1D2Q A;  1KXG A;  3KS7 A;  4B1M A;  2FCV A;  2CWS A;  4XEZ A;  4Y5Z 0;  1YQ8 A;  4W65 A;  3OD0 A;  4CA9 A;  5IWF A;  1HX6 A;  1H2K A;  4AHZ A;  2TBV A;  3HQR A;  2VOK A;  3KV4 A;  2DCJ A;  2QQV A;  3WQ0 A;  3PL0 A;  1FI2 A;  3P6B A;  1LOE A;  1TZO A;  3TBD A;  1UIJ A;  3FUQ A;  4NHM A;  3IKW A;  1XE7 A;  2GNM A;  5H9P A;  2XJU A;  1BKZ A;  2WNV C;  4I0B A;  1ZZ9 A;  5LY1 A;  2ETE A;  3D8C A;  1F5F A;  5FZI A;  4FFH A;  4YZ1 A;  3T4V A;  4XXP A;  2I2S A;  4UWD A;  3NST A;  1GMM A;  1PMI A;  5A3N A;  1W6Q A;  1SLT A;  2E26 A;  2YU2 A;  4GJY A;  4BQY A;  5JUV A;  2DCK A;  1KEX A;  4AVT A;  3NJZ A;  4NIH A;  3Q8B A;  1O6U A;  1GNY A;  2UWA A;  2ZXQ A;  2AH2 A;  4Q4X 1;  5HCA A;  1MZF A;  4AQ6 A;  1LHV A;  3I54 A;  1AR7 1;  1V9U 1;  2JDH A;  3ZX7 A;  4CP9 B;  1NCQ A;  4XBL A;  2Q30 A;  4RL7 A;  5FZ8 A;  4PI2 A;  2KD7 A;  3SEP A;  3VGI A;  2HWD 1;  1W9T A;  4S2H A;  5FZB A;  5H9Q A;  4FPL A;  1OI6 A;  1OA4 A;  2D6N A;  4IES A;  5D8A A;  2DVG A;  1C5I A;  1UY4 A;  1V6O A;  3DUI A;  4LBJ A;  4M0N A;  3BIW E;  4LA2 A;  3WT3 A;  4D6R A;  4Y26 A;  1OIP A;  3LSE A;  3PJY A;  4YAR A;  2EIC A;  2DCT A;  5GJ6 A;  3WDV A;  3LZZ A;  4EWA A;  3KT4 A;  3W21 A;  3WNL A;  1W6P A;  4KNC A;  3JXS A;  4FTE A;  1CD3 G;  1LJ7 A;  4AFM A;  1W6Q B;  4YZ2 A;  1CAV B;  2IXH A;  4BQ3 A;  4BHP A;  2DBN A;  2WN2 A;  3MF6 A;  4URT A;  1QXP A;  4CDU C;  3CMG A;  2YBK A;  4QU2 A;  5F5C A;  3ES4 A;  4JTN A;  1TE1 B;  4H14 A;  5ACA 2;  1RGS A;  2ORZ A;  4HKO A;  3AKS A;  5A3O A;  1RXF A;  1H2M A;  2QBX A;  3MPB A;  1BZW A;  3TEY A;  1ENQ A;  5FYU A;  1MR5 A;  5L9B A;  5JZG B;  1AR6 3;  1W8H A;  2YDE A;  4K21 A;  4LMF A;  4AED B;  3AZV A;  3ZSM A;  4MX3 A;  5FV3 A;  2GMP A;  1CQ9 A;  1YWK A;  1VAV A;  2ZAA A;  4CCM A;  4I0W B;  1W0N A;  1MS0 A;  1OLQ A;  2HEV F;  3DPR B;  1GBG A;  1W8U A;  3WQB A;  3MIF A;  2GC3 A;  3ZN4 A;  3C7G A;  4UFL A;  5GZE A;  3BU7 A;  2BWC A;  4JRL A;  3TEX A;  3ZPY A;  1GWK A;  3KV9 A;  3VDC A;  3VDB A;  3M2M A;  1GUI A;  1BMV 2;  2XJT A;  2XB6 C;  1GV9 A;  1W8T A;  5FY8 A;  1QHD A;  5CIS A;  2Q1F A;  2J1E A;  2UUR A;  4NID A;  5EJ3 A;  2R07 3;  4XF0 A;  2R06 1;  5EWS A;  3KMH A;  1UCX A;  1N1T A;  4AOC A;  4R9B A;  5J1X A;  3E97 A;  3RJ2 X;  3U4X A;  2F4L A;  4BME A;  2EF6 A;  3IMN A;  2ET1 A;  1YJK A;  1AR6 2;  5CA6 A;  1W2A X;  3M3O A;  2WFF 1;  3ZSE A;  5C8W A;  1MZ6 A;  4ZXE A;  5ABJ B;  2PHL A;  2ZX1 A;  3ELN A;  3G7D A;  1PIV 2;  1AXK A;  2D97 A;  4JZR A;  3TEW A;  4XJU A;  3ZXF A;  3NV4 A;  1JH5 A;  1RC6 A;  5CAD A;  2JD4 A;  3ILF A;  4N53 A;  5ERL A;  2ZGQ A;  3VBR C;  1C28 A;  5C4W B;  3RZZ A;  5EP9 A;  4R4X A;  3D4K A;  1UZZ A;  1ENS A;  3H3U A;  2JDZ A;  3ZYH A;  4YZ5 A;  3J7H A;  1YIP A;  4AEM A;  3BPZ A;  3NV1 A;  2NMN A;  2VL4 A;  3RWN A;  2ZAB A;  5JR7 B;  4K8F A;  1EAH 3;  4ATF A;  1DU3 D;  2PHX A;  4NAO A;  4XJ8 A;  4C8D A;  1LU2 A;  2WNO A;  3TN9 3;  1HRV 1;  3AKP A;  2WN3 A;  5FYC A;  4HN0 A;  1ZRR A;  1HQN A;  1JYC A;  1Y43 B;  4LO5 B;  1EV1 3;  1CGP A;  4D6S A;  2W47 A;  5FZC A;  2ZAH A;  5FMO S;  5BNN C;  3VBS B;  5KHH A;  3NJY A;  2D5H A;  1QJU 1;  4GAZ A;  1A8D A;  2ES3 A;  5LB6 A;  1ZRF A;  4XQW A;  1CZV A;  2B39 A;  2VZP A;  5LRR A;  4MXW B;  3WF1 A;  4WM7 B;  1D0G A;  4HBN A;  4XF3 A;  5LY2 A;  1PZ7 A;  2XVK A;  5ANN A;  3ST7 A;  1WGP A;  2WT2 A;  4IUG A;  3VD7 A;  5IUQ A;  1RUG 3;  4CUB A;  5F3E A;  5IVF A;  4YW3 A;  2WZR 1;  4B1L A;  3PG7 A;  2FDG A;  3MGU A;  1XSQ A;  2WYF A;  4E4D X;  1GZ9 A;  5F39 A;  5GZC A;  3O1T A;  2DU1 A;  2KA3 A;  1G8W A;  4CE8 A;  1EP0 A;  2RV9 A;  2RR1 3;  3AZW A;  5ABJ A;  1VAK A;  5CKN A;  1LUL A;  1R1Z A;  1EAH 1;  3G6J B;  5F8P A;  2XML A;  1QMJ A;  2J1A A;  1VLN A;  4MUV A;  2Q8O A;  1XYO A;  4DPN A;  2WT0 A;  3MF9 A;  4L0P A;  4NOT A;  4UF0 A;  4AQ2 A;  3AP9 A;  4JDO A;  5I0R A;  2HWE 3;  4JV4 A;  4RHV 2;  1S2B A;  4XMI A;  1WBF A;  1CAW A;  4GH4 B;  4M8Z A;  1FPN 2;  5BUV A;  3ZFG A;  3BKZ A;  4TZD A;  2VH9 A;  1UX6 A;  2AC1 A;  1TMF 3;  1DGL A;  4NHL A;  3O1V A;  4AVB A;  4BK4 A;  3B7M A;  2JDY A;  4ARY A;  1V6M A;  3PVO A;  3QH6 A;  1LHN A;  3POB A;  2MNG A;  2WRA A;  1QIQ A;  3T0B A;  3VBO C;  3B9C A;  2H6B A;  1RUJ 1;  2ZGU A;  3I2J A;  3KGL A;  4YZ3 A;  5KXC A;  2R0F A;  4IL7 A;  2W87 A;  2A73 B;  3LIG A;  3K51 A;  3PJQ A;  1R08 2;  2IVI B;  3JBG 2;  5KHI A;  4UW5 A;  3S0M A;  4YLZ A;  5J37 A;  4BMB A;  3DPR A;  4XUR A;  1W39 A;  1XSR A;  1YFU A;  4TLF A;  4OHZ A;  1NE4 A;  4MH0 E;  4O65 A;  1JYX A;  4LO8 A;  5M0T A;  1REF A;  2VY0 A;  3WNN A;  5JSP A;  2W1U A;  4FP3 A;  4FO9 A;  4J1W A;  5EIY B;  5EV7 A;  3I2K A;  4IDZ A;  1HV0 A;  3VZJ A;  3APB A;  2ZKL A;  4K20 A;  3POF A;  3WZ1 A;  5HPO A;  3F95 A;  3Q8C A;  4RQP B;  3VZN A;  5C33 A;  4MG2 A;  5LAS A;  4CDW C;  1JTZ X;  4Y22 A;  4EZH A;  3UKV A;  2GAL A;  1DQ2 A;  2Z79 A;  1XJA A;  5FP9 A;  3AP4 A;  3RYK A;  5FMB A;  1OFS A;  2IXI A;  1J3Q A;  2WWU A;  2ZZJ A;  4FFI A;  4XZP A;  1VBA 3;  2D93 A;  5EHD A;  4CDQ C;  3BUC A;  2RMU 2;  4YVW C;  4M01 A;  2L9L A;  3AFG A;  2JKX A;  2JDP A;  1PO1 1;  2AR6 A;  2UY9 A;  3VBU C;  1ZVF A;  2X05 A;  4MVT A;  1OHF A;  1AZD A;  2RS5 3;  4QQ2 A;  2BOJ A;  3VHO A;  4LO7 A;  2V09 A;  4Y3O A;  5FZ7 A;  2ZEX A;  4QQP A;  3W58 A;  2A5Z A;  1N3P A;  4FPY A;  1NG0 A;  3H1Y A;  4B4R A;  3PLQ A;  3LDB A;  3J8F 3;  4LHK A;  5IVE A;  4IER A;  5T54 A;  4JGZ A;  1UMI A;  1UY1 A;  2VZO A;  2Q1Z B;  2DCY A;  2AEZ A;  1WW7 A;  2NZ9 A;  5DUV A;  5KBF A;  3AMQ A;  5I93 A;  3ETQ A;  1ZRI A;  5A3U A;  4HN1 A;  5A6Q A;  4SLI A;  5T5J A;  1POV 3;  5DAW A;  5JXJ A;  4Q2F A;  5IVV A;  5DUU A;  3B7N A;  2XUM A;  4UFM A;  3OGS A;  3LA2 A;  3VBR A;  5FZG A;  3O1O A;  3HQU A;  1UOB A;  1OXC A;  5F32 A;  4DY5 A;  2BGC A;  1YEW A;  3VZM A;  2WFF 2;  5FIX A;  3FHA A;  2PFW A;  4IE6 A;  2R04 3;  4M3C A;  1O4Y A;  2G19 A;  4I3P A;  3HNY M;  1AYM 2;  2WJS A;  4AVC A;  1QJE A;  5DAB A;  5FZD A;  4FBF A;  2LW8 A;  5FK8 A;  3BI3 A;  3WVJ A;  1YC6 1;  4XAA A;  2D4Q A;  3O12 A;  3B00 A;  4QHO A;  4M4R A;  3VD4 A;  2RJK A;  1K5M A;  2OS2 A;  1WLT A;  4EYU A;  1O8P A;  3N7L A;  4Q0U A;  1Z0H A;  3HJR A;  4IEU A;  5A33 A;  4AR2 A;  1TG7 A;  3NMB A;  3C7E A;  1IPJ A;  1UF2 C;  2YFU A;  3IAP A;  4CP1 A;  5FZK A;  4MAD A;  3SH3 A;  4ITC A;  3HNB M;  4DXT A;  1BMV 1;  4NPM A;  4PIZ A;  3IMM A;  2PYT A;  2JJ6 A;  3D0J A;  4AF9 A;  3O5S A;  3DF0 A;  1ASJ 3;  1UPI A;  3MHZ A;  5AVA A;  2CU5 A;  1UZV A;  3WNO A;  1UWW A;  5LAT A;  1WW5 A;  3HOB A;  3RZG A;  4AQS A;  1S0D A;  3K2O A;  3QOP A;  4F83 A;  2FCU A;  4M3C F;  4DUW A;  3UJQ A;  1L7R A;  1PO1 3;  3Q8G A;  3N4M A;  3NWK A;  5IJR A;  5C4W A;  4WM7 C;  1LGN A;  4J7Q A;  2SLI A;  4DRR A;  1SBF A;  3NVC A;  1N1V A;  4IQP A;  1CES A;  1Z7S 2;  4A42 A;  4A6S A;  1UU5 A;  2XBO 1;  1JUI A;  3OJB A;  1FPN 3;  3VBR B;  3VBS C;  2HEW F;  2VNV A;  2WII B;  2ZHK A;  1PGL 2;  1K42 A;  2J1T A;  3K4Z A;  4OZO A;  4YG3 A;  4XUP A;  3VZO A;  5FXX A;  4Q0S A;  1OF4 A;  1RUC 1;  3ACL A;  2GNT A;  5E89 A;  1K3I A;  1RIT A;  3GXU A;  4QB1 A;  3ACF A;  3RS6 A;  1MEC 1;  1OKO A;  4Q4V 1;  2VGD A;  1U12 A;  1JZ2 A;  1UYX A;  2ILM A;  5C8C C;  3ZN6 B;  3V56 A;  3CJI B;  1JMU B;  1LCL A;  5KXE A;  3RRD A;  5BNO C;  2P3I A;  3N9M A;  5HXM A;  1C3H A;  4WBB A;  4Z07 A;  3ATG A;  2HLE A;  2OX0 A;  5IFT A;  5LBB A;  2A70 A;  1YJL A;  3ZXG A;  3OTF A;  3FL7 A;  5C70 A;  3ZPO A;  2ZEZ A;  2BNO A;  4DFS A;  4PLO A;  1XYP A;  4I3G A;  2VMF A;  1TEI A;  3USU B;  3WDU A;  3OGR A;  3R6S A;  5A7P A;  3PVE A;  4GQ7 A;  1NA1 B;  1R1A 3;  4MHU A;  1PNF A;  2WNE A;  4W50 A;  3U11 A;  1ST8 A;  4AED C;  4N43 A;  3VBH C;  3J7N A;  1AX2 A;  4DIN B;  3A0K A;  3WP4 A;  2XJS A;  4GD4 A;  4HON A;  4OI0 A;  3AB0 A;  3ITQ A;  1H9W A;  2VD7 A;  5C3S A;  1QDO A;  2G9G A;  1SDD B;  2TEP A;  3IM0 A;  1MS9 A;  4YWA A;  1GZW B;  5FO8 B;  1D2S A;  3GHM A;  2BU9 A;  1O8S A;  2VM9 A;  2CDP A;  1AUA A;  1QQP 1;  4OZX A;  3WG3 A;  1Q3E A;  4CDW B;  4QPW A;  4GJZ A;  4K40 A;  5LA0 A;  4DZG A;  5A33 B;  4XUQ A;  3WX5 A;  5F2S A;  4COV A;  4IV1 B;  4YW4 A;  5AC9 2;  5IVC A;  1W04 A;  1JYV A;  3MLJ A;  1REE A;  5T5P A;  5JPN B;  3KHC A;  2KR2 A;  4IV3 A;  1O3R A;  1OSG A;  1RUJ 3;  2YUE A;  1WA4 A;  1FV2 A;  3JD7 3;  5ANQ A;  4E4S A;  1G7Y A;  4CDX C;  2WO1 A;  3WF2 A;  3DXU A;  2K0G A;  2D6P A;  4P08 A;  4QHZ A;  3GHN A;  3WF4 A;  4AI2 A;  3LOB A;  3KSC A;  5D8A B;  1UAI A;  4CJ6 A;  2PLV 2;  2ZHL A;  3AX4 A;  3UKN A;  3J9S A;  2PXJ A;  1TME 2;  1UY2 A;  4CXY A;  4X6Q B;  3S57 A;  1RIR A;  2PN5 A;  3KHB A;  1HQL A;  1OA3 A;  3C8X A;  2QQP A;  1Z7S 1;  4Q0P A;  2GNB A;  2XL9 A;  4UBG A;  3O1P A;  4LPL A;  4M00 A;  5DDJ 1;  1H6Y A;  3BIE A;  1ND2 B;  1W6N A;  2RDN A;  1HXS 3;  2NPI A;  3FLP A;  5FMO L;  4IE4 A;  2UY8 A;  1GWM A;  5A7S A;  1V6I A;  2E7A A;  3UK9 A;  2P6H A;  2CHH A;  3LCP A;  1OOP C;  2A71 A;  4GZ9 A;  4DEV A;  2OZJ A;  4QKD A;  1KS5 A;  4PQQ A;  5FOB B;  1JYI A;  3T2Q A;  1NA1 C;  4FXG B;  2WA3 A;  1FNZ A;  2WO2 A;  1ND3 B;  2JEC A;  2Y6G A;  1UO9 A;  3B9I A;  3IBM A;  3NJX A;  5DAX A;  4WZF A;  5JIA A;  3VBF B;  3BTX A;  3H3Z A;  2BBA A;  1UW8 A;  4XIO A;  4PCR A;  4XUO A;  2W91 A;  4FTB A;  1R08 1;  4MYE A;  3PUA A;  1LOG A;  1GNH A;  2JE9 A;  3E5U A;  1OFN A;  3DCQ A;  3BOW A;  1D0H A;  3FN9 A;  4GB3 1;  3MV1 1;  4NN0 A;  4XPV A;  4Y1X A;  4Y22 B;  4YGE A;  4QU1 A;  4YM3 A;  4WM8 C;  3GZU C;  1NCR A;  1B35 B;  1BEV 2;  2XKP A;  3NO8 A;  3KVB A;  4GKY A;  3VB9 A;  2E2X A;  1ULP A;  2F17 A;  5JI7 A;  4IE5 A;  1YQC A;  4QPG A;  1PX3 A;  3ZXE A;  3I3Q A;  3ROU A;  1TNR A;  3V64 A;  2AYH A;  2A6V A;  4KWJ A;  3ZN6 A;  3WSO A;  3MW3 A;  1W8F A;  5DDJ 2;  3UGF A;  5JXI A;  3U0Z A;  2YG0 A;  5L36 A;  4CP2 A;  5EFU A;  4QXH A;  3CNA A;  2JG8 A;  4E2S A;  2DUO A;  2ZAC A;  3HNM A;  2GU9 A;  1CPM A;  3MIC A;  3QAC A;  4W6X A;  3N9L A;  5IAV A;  4FPC A;  2BW8 A;  4Q0V A;  1OUR A;  2PAK A;  2ZGK A;  5IT6 A;  3ZYJ B;  4Q4W 1;  4N9H A;  4OMC A;  2R30 A;  5FLH A;  3OY8 A;  3H7Y A;  4TLG A;  4AI1 A;  1JZ8 A;  2VOT A;  4QPI C;  3P7Z A;  4GB3 3;  1RB8 G;  3RI9 A;  1FMD 2;  1LES A;  1ZZ8 A;  4ZU5 A;  3TRS B;  3N7J A;  1UXX X;  1H1M A;  1J58 A;  5BXX A;  4WVZ A;  5JOX A;  5T52 A;  3E6D A;  3JBG 3;  3O14 A;  1ALY A;  4K7J A;  3B94 A;  3GJA A;  5BNO A;  1X50 A;  1AYN 2;  5FBJ A;  3WG4 A;  1QJX 3;  3LD8 A;  3PDQ A;  4L97 A;  2R07 1;  3RGB A;  1GP6 A;  3PUR A;  3ZIX A;  1RED A;  1OH3 A;  2VZQ A;  2WNU B;  1MEC 3;  4OHX A;  4XVH A;  4CYD A;  4AVS A;  2VU9 A;  2ZZQ A;  5AFB A;  4YVS C;  1MZE A;  3PU8 A;  3I3M A;  3B74 A;  2R6Q A;  2ZHM A;  4CCC A;  1UXZ A;  2JG8 B;  2B8M A;  2ZGM A;  4D0Q A;  4ET7 A;  3D5O A;  3CJX A;  3AL6 A;  2IC1 A;  1W9S A;  3IDC B;  1QJF A;  3C7O A;  4K1Z A;  3DGT A;  1A6C A;  1ENX A;  1WA6 X;  4G4F A;  1U5Z A;  3S30 A;  2QQI A;  3DEC A;  5FMD A;  2FDI A;  1AL0 G;  1ZZ7 A;  2YC0 A;  5FKB A;  4IEO A;  5F7U A;  2PAM A;  2GH2 A;  1OLR A;  4I09 A;  1T2X A;  1V70 A;  2Y6F A;  5CZK A;  3LQC A;  4HVO A;  3KWV A;  3GGL A;  1KD7 A;  4JX0 A;  3W68 A;  4AW7 A;  4UT5 A;  3MO4 A;  1MVE A;  5FZ3 A;  3LWC A;  3WD5 A;  4PDW A;  2BPA 2;  2JDM A;  2OKX A;  5I0D A;  4YNI A;  1ZRE A;  1H2L A;  2VW0 A;  3MIB A;  4UW4 A;  4AYU A;  3MI8 A;  5EYY A;  2Y33 A;  3I97 A;  3ALQ A;  4BM8 A;  1OH4 A;  1RUJ 2;  2D40 A;  4JGY C;  4L2N A;  5FZM A;  2SBA A;  2X09 A;  5B4N A;  1CWP A;  2ZGP A;  3WR0 A;  2V73 A;  3Q8F A;  4YFW A;  1RVF 2;  4BIF A;  4L99 A;  2C9A A;  2E31 A;  1MEC 2;  2R16 A;  4LOS A;  1HQW A;  4N53 C;  3PIG A;  2NYY A;  3H8R A;  2A3X A;  2P17 A;  1SLA A;  4XBN A;  1NCR B;  4NHX A;  2VCC A;  1MQT B;  1WCU A;  4E9K A;  2OQ6 A;  2FZ1 A;  2P2K A;  2XJQ A;  1VBC 3;  5LK5 A;  4I30 A;  5DG1 A;  3DYP A;  3DL3 A;  3WCS A;  1PGL 1;  1H30 A;  2ZPX A;  1UKG A;  2RHP A;  1X8M A;  3A23 A;  3HN1 A;  3L2Y A;  5K8S A;  5LW9 A;  5I0S A;  3BU0 A;  1R1A 1;  5F3G A;  3I8T A;  3I7D A;  3IPV B;  2XQX A;  3POI A;  1W6M A;  2ZX2 A;  3DKW A;  3AJZ A;  4DUX A;  4CDU B;  2DDU A;  2F4P A;  5A32 A;  4GXL A;  3HX3 A;  4D3W A;  2RM2 2;  2Y0I A;  4OCT A;  4S2G A;  2KXL A;  5JSO A;  1H8T A;  1WLC A;  2CAU A;  2Y6K A;  2VAU A;  1RUE 3;  2XWJ B;  1X7N A;  1N1Y A;  1OVP A;  1DZR A;  2YY1 A;  3HVD A;  4OQ8 A;  4ZY9 A;  3AJY A;  3LSD A;  5HV0 A;  1SZB A;  4E27 A;  2VVE A;  1H0B A;  2P37 A;  3K4A A;  3ASI A;  2WDB A;  1HB3 A;  1Q8O A;  2RG4 A;  4NRP A;  4AFB A;  1JZ5 A;  4MSV A;  4I01 A;  2DWR A;  1NCQ C;  1POQ A;  2VO5 A;  3LOI A;  5CIR A;  5CFC A;  1VP6 A;  4YM2 A;  5JR2 A;  5KC5 A;  3E5Q A;  3JUU A;  1B09 A;  2ADD A;  2WC2 A;  5ACA 1;  4HSL A;  1YQ5 A;  3N7M A;  4KBZ A;  5GLZ A;  3ZYP A;  5J36 A;  4X8P A;  1AX1 A;  1JHJ A;  4YGB A;  5FKC A;  3RDI A;  3TWI A;  5TSW A;  3RZL A;  4LJH A;  2NM1 A;  2VQ0 A;  2D7F A;  4QX3 A;  1COV 2;  2BRT A;  5FQ0 A;  1RUH 3;  3AYD A;  4P9Y A;  1U5X A;  4J6G A;  5KWR A;  2ATF A;  3LDR A;  2YXS A;  4BJ0 A;  1W6M B;  2QZ3 A;  3A4U A;  4QPY A;  2EAA A;  4LHS A;  4LUM A;  2R49 A;  3T2T A;  5A70 A;  2ZS6 B;  1ZNP A;  4FAH A;  4XDQ A;  4RQP C;  2W0X A;  1QQP 3;  1QJX 1;  1UZY A;  3WW1 A;  4A4A A;  1KDM A;  1HRI 2;  3ZDV A;  2ZGL A;  1H4H A;  2DVB A;  4EJR A;  2C4X A;  4OQ9 A;  5FQ0 B;  2YBP A;  5HI0 A;  3WW4 A;  1AXZ A;  5I0T A;  4CDW A;  3GAL A;  5FY7 A;  5G04 L;  4P14 A;  4CEY A;  3OEA A;  1D4V B;  1HRI 1;  5IFP A;  1AR7 2;  1V9U 2;  2BEO A;  1N3O A;  1QJX 2;  2G4I A;  4ZZ5 A;  1Y9M A;  2IXL A;  2W9X A;  1VRH 3;  3HBZ A;  1KRI A;  4OHY A;  5J09 A;  3POG A;  3VL9 A;  3KCX A;  3MDP A;  3KQR A;  2YB7 A;  3RFR A;  3ZXA C;  5BV6 A;  2ZGO A;  5C3P A;  3Q8E A;  2I07 B;  4QB6 A;  3QBQ A;  3ZMN A;  2E33 A;  5FR3 A;  4C0H A;  1AUY A;  3I49 A;  1WCS A;  1XE8 A;  4BYY A;  4XFI A;  5CFC B;  1NLQ A;  1KGY A;  4DRV A;  2OQ7 A;  3P3P A;  5JXG A;  3W5M A;  3HEI A;  2FD8 A;  1I9R A;  2VTX A;  3KT7 A;  3H8X A;  3MPP G;  4IV3 B;  3JU9 A;  4XJZ A;  1I5Z A;  5FYB A;  3V0B B;  2QJV A;  2V5Y A;  5E1R A;  2BTV C;  2R04 1;  1G9B A;  1UX7 A;  2XUE A;  2YPJ A;  5FWE A;  4BIS A;  2OII A;  1W9F A;  4P00 B;  1RJ8 A;  4JKK A;  5JI9 A;  2RS1 1;  5F1R A;  2HBU A;  1J1L A;  4B29 A;  3WXP A;  1HRI 3;  1SCS A;  2OYZ A;  2PHF A;  4KWU A;  4QKN A;  3ZOI A;  1WLW A;  3OYW B;  3K4D A;  2YYO A;  1DZQ A;  1JZ3 A;  1W9Y A;  4NHY A;  3M3Q A;  1UY0 A;  2G1M A;  4CZS A;  5FP7 A;  1QU0 A;  1JYW A;  1CON A;  4AI3 A;  1RUH 2;  5KHK A;  1HRV 3;  3CIH A;  2HWF 2;  3CO2 A;  3T09 A;  1LB2 A;  1OIZ A;  2JG8 C;  4MXW A;  1CAX A;  4MGK E;  4IEV A;  4D6Q A;  4IGP A;  1LEM A;  3R0R A;  2VZ3 A;  1APN A;  3OB8 A;  1DZT A;  1OC1 A;  4FOW A;  4JRA A;  5A80 A;  2ARE A;  5FUI A;  4BWO A;  3ORJ A;  5L9R A;  1W3V A;  3EHK A;  4X6R B;  4NMI A;  1YLL A;  4EN9 B;  5J7M A;  4RS5 B;  4KH9 A;  4LLO A;  3S7E A;  2XLA A;  2RS5 2;  2RJL A;  1DGW X;  2QQJ A;  3V65 A;  3B93 A;  3SCG A;  3WF3 A;  4IGQ A;  2Z42 A;  2OUJ A;  1US2 A;  3H8O A;  2YC2 A;  5LA9 A;  1G9C A;  2E53 A;  2WFP A;  4YZ4 A;  1RUE 2;  3B5L B;  1IS3 A;  4EQV A;  4HAN A;  1UU4 A;  3M4F A;  3VKO A;  5L19 A;  2ZJC A;  1OD5 A;  1MAC A;  2OZ6 A;  2WA4 A;  1JS9 A;  4Q29 A;  4OMJ A;  3JD7 1;  4ARX A;  1FOD 2;  3EBR A;  3MUY 1;  4XIL A;  1B35 A;  2LM3 A;  4QQL A;  3ZVX A;  3AKQ A;  5C5T A;  3LE0 A;  2CYF A;  5FP3 A;  5IHR A;  1QJZ A;  4CEW A;  2W2I A;  4B3N A;  1O5U A;  3WP6 A;  1SLC A;  1BJQ A;  4OI1 A;  4MOA A;  2MHF A;  4E8C A;  1DQ6 A;  1RUD 3;  2WLQ A;  3I2G A;  5FZA A;  1GWL A;  3SC7 X;  3J7M A;  5C9A A;  3LA3 A;  1US3 A;  4QX1 A;  5FZO A;  3RZH A;  1DLC A;  2LTN A;  1SLI A;  2IVJ A;  3V0B A;  3VN4 A;  3RZK A;  5AC9 3;  1PO1 2;  3O0V A;  2HJI A;  4SBV A;  4CCK A;  1ASJ 1;  1E5R A;  3S5Q A;  4X8N A;  1XNA A;  5FP8 A;  4DB5 A;  1PHM A;  1BCX A;  1YNA A;  2X5I A;  5K0U C;  3ZR6 A;  4FPF A;  1LOB A;  1QDC A;  3BVC A;  3MZH A;  3CZJ A;  1C1F A;  4WM8 B;  1ND2 A;  4A6O A;  4YW1 A;  1C8N A;  1SFP A;  1IHM A;  2V4V A;  1VBD 1;  4JQT A;  3ZDS A;  2WUH A;  1FMD 1;  3MLL A;  4LA3 A;  3LFM A;  4QPI B;  3INA A;  5FYH A;  1IQA A;  2HWE 2;  1Q8Q A;  1VE0 A;  2X53 S;  1X36 A;  5DQ0 A;  1RHI 1;  3M3E A;  2KM2 A;  1C8M 1;  1XB9 A;  2A1X A;  2WR9 A;  4AEK A;  2P1B A;  2B45 X;  2VMH A;  3HBK A;  3JD7 2;  4E8D A;  2GH8 A;  4OFG A;  4NII A;  3UL2 A;  3H0O A;  3QCW A;  5A6Y A;  5KHG A;  3UES A;  2DCZ A;  2Y0O A;  4ASK A;  4C90 A;  3CEW A;  1PVC 1;  5A3L A;  1V0A A;  2WS9 1;  4KQ7 A;  2RR1 2;  3GBF A;  1V00 A;  4XJW A;  4CEY C;  3ECQ A;  4JDM A;  1FNY A;  1KQR A;  3WNM A;  1WD4 A;  2W1Q A;  1W0O A;  1NY7 2;  1QJY 1;  3KZ4 C;  5A3M A;  4MGT A;  3OGJ A;  1ZA7 A;  1RTV A;  2ARC A;  3W9A A;  3LAG A;  1QY4 A;  1W6P B;  2QQU A;  2Y38 A;  4D7Y A;  1STM A;  1UOF A;  4FOQ A;  1PO2 1;  2CY6 A;  2ERF A;  4LTA A;  4CXW A;  4WVW A;  2FBE A;  5KXB A;  4XFC A;  3HD8 B;  3JCI A;  3MUZ 1;  4CDQ A;  4E4Z A;  1FV3 A;  4GB3 2;  2PMW B;  2PA7 A;  2VUD A;  2WAA A;  3ME2 A;  4YVW A;  4DXZ A;  1EV1 2;  1PM7 A;  4LK6 A;  1O3S A;  4I0A A;  3GJB A;  4CU9 A;  1LU1 A;  1RUH 1;  4M3C E;  5APA A;  3ZFE C;  2ARB A;  3LEI A;  3TEZ A;  4DXS A;  1EAH 2;  2JG9 A;  3PMS A;  2R0H A;  5L7O C;  4GWJ A;  2HKX A;  2Y60 A;  4Q4Y 3;  5DAP A;  1H2N A;  4Z1V A;  2NN8 A;  1SEF A;  1XNK A;  4G9S B;  1C4R A;  5C71 A;  1AHS A;  3USU A;  3KVA A;  3N35 A;  3GYD A;  4Y1U A;  3SIS A;  3U78 A;  5FYZ A;  2JIJ A;  3VDD B;  1W2O A;  2JDK A;  2W1W A;  3VKN A;  2Y34 A;  3PUQ A;  4HFS A;  2QQW A;  3LIH A;  4OUS A;  1LAJ A;  1UMH A;  1YUD A;  2BUK A;  3U10 A;  4TSV A;  1A34 A;  3S5A A;  4QX2 A;  5F3I A;  1BEV 3;  1ASJ 2;  1E57 A;  4Q4Y 2;  2IWG B;  3VBH B;  2I74 A;  1K45 A;  4Q5O A;  2D6M A;  2N7G A;  2B42 B;  1TME 1;  2CWM A;  2VTF A;  2ZHN A;  2GP3 A;  2ZTN A;  1QGL A;  4JC1 A;  1ZBE 3;  4QGN A;  1DYP A;  2J7M A;  2PLV 1;  2WO7 A;  2ZMK A;  3EB7 A;  3PME A;  3E5X A;  2PHD A;  2DUQ A;  5GLW A;  2IFW A;  4MLO A;  2VR4 A;  1HRV 2;  1JOP A;  4Y4R A;  2DBI A;  4NVP A;  1ZZB A;  3I3E A;  5A32 B;  3ZFF C;  4IW3 A;  4CDU A;  1YIF A;  2OA2 A;  3AYE A;  5H9R A;  4XF4 A;  1UY3 A;  1JOB A;  1GIC A;  1O4Z A;  5FLI A;  1E5H A;  2UYB A;  4S2F A;  2XG3 A;  2RJ2 A;  1AX0 A;  4HMZ A;  2ARX A;  1NOV A;  1W3X A;  4LOR A;  1SPP A;  4QKF A;  4PF5 A;  4CU8 A;  4JQR A;  1KFX L;  1QF3 A;  2VZU A;  1MS8 A;  5JWP A;  1HV1 A;  1XU2 A;  2ZA9 A;  1HB4 A;  3ZXD A;  4AHX A;  5FYS A;  2D44 A;  1OOP A;  1XBF A;  1VBE 3;  4LBO A;  1HXS 1;  1UL9 A;  5E16 A;  5H9S A;  1Y4W A;  5CKQ A;  5EXO A;  3H3L A;  1Y7B A;  1RXG A;  4JVA A;  1GOH A;  4RR3 B; 
#chains in the Genus database with same CATH homology
 3B7Q A;  2E2X A;  4J7P A;  1O6U A;  5LZ6 A;  1R5L A;  2D4Q A;  4CIZ A;  3HY5 A;  3B7Z A;  3Q8G A;  4CJ6 A;  1OLM A;  4J7Q A;  3W68 A;  4OMK A;  3P7Z A;  3W67 A;  1AUA A;  1OIZ A;  3B7N A;  4OMJ A;  4FMM A;  1OLM E;  4M8Z A;  3B74 A;  1OIP A;  3HX3 A;  3PEG A;  4TLG A;  4UYB A;  3PG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...