1OLMA

Supernatant protein factor in complex with rrr-alpha-tocopherylquinone: a link between oxidized vitamin e and cholesterol biosynthesis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
397
structure length
393
Chain Sequence
MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEC14-LIKE PROTEIN 2
publication title Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 134
structure length 393
sequence length 397
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.680 Mainly Beta Sandwich Jelly Rolls GOLD domain 1olmA02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 1olmA01
2D4QA 1O6UA 3B7NA 4OMKA 2E2XA 4FMMA 3PEGA 4OMJA 4CJ6A 4J7QA 3B74A 4M8ZA 4CIZA 3P7ZA 3HY5A 1OLME 1OIZA 3B7QA 3Q8GA 1OLMA 3PG7A 3W68A 4TLGA 3HX3A 5LZ6A 3B7ZA 1OIPA 4J7PA 1R5LA 4UYBA 1AUAA 3W67A
chains in the Genus database with same CATH superfamily
1LGBA 2D6MA 4Q1RA 2VUAA 2YGMA 4IL7A 4MV2A 3VKOA 2Z79A 2EVXA 4CDUA 3TYJA 4MZUA 3UL2A 2X5IA 3ZN6B 3PMSA 4HSJA 3PEGA 3SISA 1YI7A 3HEIA 4NWWA 1O91A 3A0KA 4P08A 3POSA 5L19A 4Y20A 2VU9A 2JDKA 3HIFA 1O3QA 4GB31 4YPJA 4O9EA 3UKTA 4FTBA 2RMU2 1XOYA 4LBLA 3VBOC 4BPZA 5T5PA 3GHNA 2RJKA 4IEWA 4H7MA 1ODNA 3WNNA 1AX1A 2ZKNA 2JICA 2Z2SB 1OOPB 4PLNA 5DAQA 5DG1A 1HB2A 4ARYA 4PQ9A 1H8VA 4LBQA 3U10A 1DGRN 5HPOA 1D4M1 1ZZ8A 2XL7A 4RYDA 1NQJA 3CKHA 1BXHA 4HSLA 4JRAA 1GWKA 3OY8A 4YW1A 3LDRA 5JPNB 3KV6A 1VRH1 5L9RA 4JRLA 2ZBJA 1WLDA 4PJYA 5EIYB 1BEV1 1VBD3 2WN2A 3IAQA 2A71A 2BGOA 2D43A 3EO6A 4FPYA 1QWRA 4LO5B 3SXWA 4B4RA 2WIIB 3BPSA 4HOOA 1O8PA 2DYCA 3IWZA 3GZUC 2W95A 1I3HA 2A75A 2ZZJA 3ON7A 2BDRA 5FZEA 5IW0A 1QNWA 5A7PA 5FP9A 1TMF2 4DB5A 2QQIA 2Q1FA 3HMYA 1C8NA 2GN7A 3FE5A 4Q0VA 4J25A 3WHTA 3ZIXA 1X8MA 3H8XA 3TEXA 1UY2A 3CZJA 2IXKA 1WZXA 2OQ6A 5FXWA 4WZFA 5C9AA 1RUH2 2WWUA 3N9QA 1UMIA 4BK4A 4FTEA 4FFFA 2VOWA 2YHJA 5I0DA 2ZGPA 1UKGA 5HXMA 5IVYA 4OMJA 4FI9A 1QOSA 4PIYA 3USUB 3WY6A 2OYZA 1AR63 1US3A 3FUOA 1PVC2 2J1RA 3FN9A 1NY71 2PHRA 3KGLA 5FCCA 1DQ5A 1HRV2 1AR72 3N35A 4MGKE 2FMYA 4LOSA 3V0BB 1BYHA 3HNBM 5DZGA 5TSWA 4OI1A 3U37A 3DYMA 1CZTA 2W91A 1S0FA 4AEDA 2YPJA 4M3CF 1N1YA 2HWD3 4BXFA 3LIGA 1GP5A 4H2AA 1GLHA 1H1AA 4XUNA 2BVBA 4YVWB 1OQEA 1W8NA 3SH4A 3AXDA 2ZOEB 4RS5B 2X8KA 2ZS6B 4I09A 1MS4A 2R1DA 5F5CA 3WDUA 1RITA 1SEFA 4Q0QA 1RB8G 3PIGA 4MLOA 3P3PA 5FYBA 1I6XA 4N43C 4M3CB 4BU2A 1ODMA 4OFGA 2YBSA 1URXA 1JZ2A 4IW3A 1YNAA 2V72A 2XXZA 5JSRA 5C8CB 1ZBA1 3OOXA 1VBB3 1WBLA 4QKBA 2YC0A 1OH4A 4Z82A 3WP6A 3PG7A 3RZLA 2QNKA 5HCAA 5H9PA 2W87A 2A70A 1PIV3 3GNEA 3LOIA 4LUKA 4U2AA 1PO23 4Y5TA 5J36A 1BBT3 2VL4A 1RJ7A 4LJHA 4AHYA 4INDA 4GWNA 2HWE1 3ZSLA 3J9SA 2CL2A 2R072 3RWNA 1UX7A 5JDBA 1YFXA 3VL9A 3ZX7A 2VVEA 2YG0A 3H3UA 4QQ2A 4CDWB 4MGZE 1C3HA 4RQPA 4ZPIA 5FYMA 4HVOA 4R9AA 4XFFA 1JYVA 2WJSA 2VGDA 2VMEA 3N4MA 5IVBA 5CYYA 3JBG1 3U11A 2W1UA 2AACA 1GUIA 2W1QA 2FDKA 2BV4A 1XJAA 2VW2A 4FOVA 4YRDA 4Q8LA 2ARCA 3K3OA 3NL1A 3HAGA 3WDXA 4ZKTB 3GGLA 4HVRA 5C7GA 4QDRA 4XF9A 4KWUA 3U78A 3N9NA 3BVCA 4Z07A 4LHKA 1B09A 2UURA 5FJHA 1QQP2 1REEA 3PDQA 4WVZA 3IDBB 1UWWA 5CISA 3KV9A 3WQBA 4AXOA 5DDJ2 3VLBB 1QJZA 1CJDA 3VBRB 4L0PA 1LTEA 2P4EA 1QDCA 4WM7B 5F5QA 3SH5A 2RMU1 2YFUA 1CN1A 2ZGQA 1J58A 3HWJA 4IDZA 5FMOS 2KXLA 3C7FA 3MEPA 2WT1A 3C7EA 4PQQA 4WVMA 1VRBA 3RG0A 4BE3A 2GMEA 1ND3A 4M0NA 4Q26A 2LTNA 1SPPA 1UX6A 2IZWA 1DQ2A 4JDMA 4ZS3A 4K3UA 4OVEA 2CDPA 1ZZBA 2XLAA 1XSRA 3WCRA 2GMPA 4DEVA 1RUI3 2VCAA 1RUE3 1PNFA 1Z78A 3A7QA 2RJ2A 5LZ6A 3LOBA 1UZYA 1N1SA 3AKPA 4UYBA 4XCAA 3ITQA 1POV1 3A23A 1GMMA 1CAXA 4Q0PA 1LHVA 4P9IA 5FZHA 5FP8A 3AP7A 1V6KA 5A7WA 5BNNA 4BB3A 2BWCA 3MIEA 1PM4A 5FJKA 3VZKA 1ULGA 3U0ZA 1OQ1A 5F6KA 1AJOA 3PUSA 4OHYA 4UBGA 3M3OA 1UY3A 3ZVXA 1X9TA 4K21A 1TMF1 3JB4C 5CFCA 1CZVA 4NUBA 4AHZA 2QUOA 4CP9A 3SLIA 4YZ5A 5IK5A 2P5BA 1ULPA 3OD4A 5K8SA 2EICA 3T08A 3IBMA 1REFA 1EPZA 2H6CA 2OPKA 3BOPA 1RUH1 1Z7S2 3I97A 4XJ9A 3UV9A 3NVCA 1C4RA 3ZSEA 4IEQA 4MX3A 2O8QA 4D3WA 3ZFFA 1U5IA 4ATEA 4DPNA 1Y3TA 5FREA 1WA6X 2GNMA 2BBAA 2RDQA 3FBMA 2QZ2A 1OVSA 2W1SA 4N90A 4Y1XA 3WQ0A 1ZYBA 1PVC1 5J48A 4QX5A 3M1HA 4LK6A 2OW4A 1RUC3 1FOD3 1HRV1 1AR71 1O3RA 4XJUA 4CEWB 2R073 2QZ3A 4YZ4A 1AX2A 5CVRA 3BOWA 2IXHA 4E4HA 1C8M2 5A7SA 4CEYC 2VMGA 3HBZA 4UW6A 1OLMA 3OF1A 3E6DA 1UOGA 2A3XA 5FMDA 1FPN2 1RUNA 1IQAA 2WFPA 3FC0A 1RYYA 4QPIC 4AF9A 2GNDA 3H7YA 5LASA 1EUTA 1PK6A 1RXFA 1WLCA 3U4SA 4F7ZA 3VHRA 4MUVA 4Q0SA 4N53B 1OC1A 4XAEA 2ZEXA 4E2SA 2A6ZA 4QDQA 3W58A 4F3JA 1BJQA 2ET7A 1NCQC 3MLJA 3WV6A 5K7PA 5IHRA 5F2WA 1YUDA 3MF6A 4IV3C 1RUD3 4LK7A 4C8DA 4QGMA 1AHSA 1UYZA 4UFJA 3H1WA 4QWNA 1W6MA 1JYWA 5JAXA 1OVPA 1R1ZA 2R043 3HBKA 4UW4A 5JZGA 4DXZA 3CJXA 4XXAA 4YVSB 3AB0A 4I0AA 3LD8A 2JE7A 5FBJA 4R9BA 2VW0A 2D5FA 1B35C 3WZ1A 4E9KA 3V0AB 1I5ZA 3W68A 1ZZ7A 4KNCA 2LROA 2GH8A 2Q30A 3AZYA 4BA6A 1S0EA 4GZ9A 5E89A 5ACA3 3NNLA 4AVCA 3R0RA 2YC2A 2VAUA 1K12A 3RYRA 3WT3A 2RS53 4QAWA 3WLUA 4CU9A 2XWBB 2VXJA 4UOJA 1PGL2 1JZ5A 3MICA 3DKWA 2VULA 5JSPA 3C3VA 2GALA 4Q4W2 5E1RA 4YW7A 2FCUA 4FOQA 1V0AA 1POQA 1N3QA 4HG6B 3MPPG 3VDDA 3VBOB 2BNMA 5FY9A 1HXS2 1A78A 1QJY3 3K46A 3E5QA 2X5IC 4CPBD 1YQ2A 4JC1A 3SC7X 3R4UA 1GNYA 1SBDA 1UZVA 2WT2A 4DNYA 2WLQA 3PJYA 2ZA9A 3AK0A 4QPYA 5DAXA 4DUWA 2WNUA 2RR12 4GKXA 3WF2A 1G6NA 1QQP1 4LTAA 4L2NA 1ZRFA 5FZBA 3AKTA 3FUQA 5DDJ1 1R1A3 1ND2A 3ASIA 1FNYA 1DHKB 1W04A 2NMNA 4BMEA 3AZVA 3DPRB 3DYPA 2VD7A 1WLWA 3I3BA 1IKQA 2DV9A 2PA7A 4R8HA 2AYHA 5A6ZA 1DLLA 5T55A 1OIZA 1O8SA 1OQDA 2Y26A 3E6CC 2HWB2 4QQHA 5IFTA 1XE8A 4YW3A 1XXNA 1QOTA 1ZZ9A 3IZOA 3FHQA 5IATA 3RFRA 3WNMA 2ARAA 1HV1A 1XNKA 2FMDA 1DYPA 2ENRA 4CPBA 1D2SA 1MZFA 3DUIA 3OGVA 3SH3A 5IAVA 2LM3A 1TE1B 5D1IA 3HR9A 3H1MA 2D97A 3AZZA 1KD7A 3MYXA 5LBEA 1NCRA 5H9QA 5L9VA 1SLBA 5CIRA 3ST7A 1H2LA 2J42A 5A32A 2QDRA 2DCZA 2Y6KA 1LODA 3MUY1 3T0DA 5LCWL 4Y4RA 1W6OB 3GXUA 4DXTA 2RHPA 4COUA 3RMXA 4GWIA 1OFSA 4W6YA 3TAYA 3GDBA 1Z7S1 4AEKA 3O1RA 1RUJ2 1RHI2 1MEC2 4EN0A 1VBA3 5AC92 2Y6FA 2PAEA 3FLRA 4PHZA 4I0BA 4EYUA 1W0PA 5ABJA 3WEZA 1VAVA 1RUG2 5FKCA 1JZ7A 2A3YA 3MFCA 2XJSA 4IV1A 4N43B 4RR3C 1T6GC 1W05A 1J1TA 2JIJA 1VALA 4A45A 1C1LA 5HV0A 1Q43A 2CSGA 2F4PA 3OD0A 4C90A 2WS91 1W0OA 5FXXA 3S6PA 1C8M1 3ZR5A 3AP6A 4FOYA 5CG8A 5IVFA 2IC1A 1BCXA 1HQNA 1FPN1 1YWKA 5F3GA 2A6WA 4LLOA 4AI3A 2J1SA 1AYM3 5FK7A 3T0BA 5JOYA 4OUSA 1E5HA 2Z4FA 4FP2A 1EAH2 2Z5WA 5K9YA 4XABA 2KA3A 3WNOA 4Y5Z0 4MGIE 2AENA 1VAKA 2DVDA 2GP5A 4IEVA 4AR2A 2OIIA 5A6XA 4NHMA 1A34A 5FR3A 3ZFEA 5FKBA 3ZYGA 1JYXA 1NOVA 2E2XA 3WUDA 1J83A 3BU7A 3ZXDA 4DXSA 1S2KA 1R082 2R0HA 4CXYA 1KXGA 1UW8A 1JU3A 3OPTA 1NA1B 4YW6A 3AKQA 2RDRA 5DUUA 5CBLA 4HN0A 2A6VA 2OVUA 4EROA 2FQPA 2PHTA 1LOBA 3WNXA 2OQ7A 4LBKA 4Q1PA 3D8CA 1XC6A 3R05A 5CFDA 1OIPA 1H0BA 3DN7A 3VZLA 4META 1L7RA 4CDQA 4QT6A 4JQTA 1PGL1 4KBBA 3W59A 5C71A 3DECA 4UWDA 4Q4V2 2DWRA 5E88A 2XBO2 4MXVA 4LE3A 5BNOB 2ADEA 4Q4W1 4GAZA 1G9FA 2WO7A 3CZUA 2VG9A 3ZSJA 1LHWA 5GM0A 1D0GA 2VNOA 3WNKA 3W5MA 1IPJA 1SDWA 3IIIA 2NYYA 3SITA 2GDFA 2HEVF 2WINB 2O1QA 3TN93 2FDIA 1U5YA 1HXS1 3WSOA 1K5MA 2WNVA 2NP0A 4LOTA 2ZGRA 2ZMLA 2XKPA 2XJPA 4BCUA 1LB2A 3DXTA 1WA4A 4QB1A 3FLPA 4NVPA 1GWLA 1BK0A 4KMQA 5KXEA 2AZ5A 2XL9A 3LEMA 1YFUA 2RR11 3IMNA 4IE7A 4XW3A 2DCTA 3T0AA 1UY1A 4OHXA 3TEWA 3QH6A 2JECA 1F31A 2CHHA 4CXWA 4NAMA 1S0BA 4IGPA 1ND3C 1XE7A 3CDZB 5E6HA 5CA6A 3EYPA 2F4LA 3LSDA 4FFGA 2FD8A 3ZXLA 3PTYA 1H9PA 2P2KA 3ZYHA 5AVAA 4R9DA 4XFIA 3GYDA 1UOBA 1LKNA 1RTVA 1GKBA 2D6OX 1OH3A 2ZEWA 3N9OA 1IS6A 3SHRA 4AG4A 2DUQA 4ES9A 4UFIA 4L92A 1YRZA 2WLPA 3KWVA 5C3OA 3DXUA 3NNMA 2B42B 3MW4A 3POIA 4WBBA 5LA0A 1TG7A 2HWB1 5LEJA 2VTXA 1LGCA 3FMGA 4DUVA 2G19A 3LEIA 3ZOIA 1G9BA 2WWSA 4OMDA 3D6EA 3PJQA 2W39A 2H0VA 3HN3A 5EQUA 3MV11 3VBFC 1RUOA 4I3GA 2J7MA 2PHUA 4ASLA 5FP4A 4Z92B 3ZFGC 5CFCC 1NE4A 2OZ6A 5FO8B 4P00B 1Q5OA 1LU1A 1QJU3 5GLTA 5JSOA 1UYPA 3K3NA 2IFRA 4PT6A 4D6RA 3M7AA 1MZEA 1EAH3 2JENA 3AL6A 4P9GA 2ARXA 3JQWA 3T2OA 4EN7B 5K0UB 3KSCA 4OZOA 4CYDA 1CPMA 5J98B 1OT5A 3PNAA 1PX3A 4MXWB 4A3ZA 2D5HA 4CEYB 1Q8PA 1RUJ1 3ES1A 1RHI1 1MEC1 3KCCA 4I0WB 1XRUA 5AC91 1GQGA 1QJX3 2BFUS 4QPIB 2CU5A 4RD7A 2EIDA 3GJBA 3POEA 4BQWA 5I93A 1RUG1 2K0GA 2XKOA 3KHBA 5JXGA 4JV4A 3K4AA 3I2IA 1NCQB 1OXCA 3THCA 4YWAA 4D7TA 1HRI2 1RXGA 2E6VA 2D4QA 2IUWA 1MVEA 5FZOB 4AQSA 1GP4A 1TQ5A 3HJRA 4IE4A 3VD9A 4WM7C 4PCRA 1ZM1A 4M0HA 4XBQA 2JX9A 3PUQA 4FPFA 5DPNA 1OD3A 2BPA2 4N7UA 5F9TA 1B35B 2L9LA 5FYHA 2ZABA 5FZGA 3MIFA 3JB8A 1O59A 2FZ1A 4XEZA 4EN6B 2C24A 5EYXA 2XQXA 5A3OA 2W46A 2WZR3 5FYZA 5FUIA 1LHUA 1KRIA 2V4AA 5IVJA 1SLLA 3I3QA 2BOJA 4Y1UA 1US2A 3WHUA 3S5QA 1YFYA 4QQLA 4FAGA 2C0ZA 3CMGA 2PMWB 3RWKX 1R081 2E9QA 1AR93 1X82A 3HT2A 3NJYA 4K1ZA 3C7OA 2UY8A 4HANA 1LAJA 4DZGA 3KVBA 3N7KA 2WAAA 4J1WA 3ROUA 4CIZA 4YYOA 1H1MA 4CDUB 2GC3A 2JD9A 2X5IB 5C70A 2VMIA 5D8AA 2X05A 3E5XA 5FZMA 4C1XA 1JYNA 3SCGA 3ILNA 2VTFA 3LEGA 1AX0A 1MACA 1MS5A 4Y20B 3SKVA 3OBAA 1A6CA 5JMOA 5BY5A 1HN1A 1PHMA 5IT6A 2E63A 1VBC3 4Q4V1 2XBO1 4PF1A 4JHZA 4S2HA 2QVSB 5EYYA 5M0TA 2IWGB 1EY2A 2W52A 1XNDA 3IDEA 4LBQB 2Y38A 1NUKA 3L2YA 3ZKUA 5FO9B 3AMHA 2ID4A 5FZ7A 2WNUC 4K7JA 4LIUA 4MSVA 2Y64A 1NLSA 2C4XA 5I8YA 1PO12 1T2XA 2VBDA 4Y4YA 1WKYA 3OY8B 5F32A 1JUIA 2GC2A 1ND2C 4XQWA 2YY1A 3F95A 4CCNA 3MZHA 3O1SA 1QIQA 1DCSA 4IGQA 4AI8A 3I2HA 3WUCA 5FYTA 5B4NA 1NE6A 4GULA 1F2NA 3X29B 2VE1A 4GWJA 4YZ2A 2PQQA 4FPJA 1AR62 3MDPA 3WP3A 1W8UA 2MEV2 1V00A 3LAGA 3TRSB 4XURA 4RGGA 2ZGOA 5C4WA 1IS5A 4QXHA 1JUHA 1DQ0A 3ZXEA 4KU7A 4HT1T 4CRQA 1HB1A 4R52A 2XLGA 3T1MA 1UNBA 1YI9A 2HWD2 4MADA 1S1AA 1U12A 5FZ1A 5FZKA 4QU2A 2ZGKA 3JQXA 3NRUA 4IQPA 4A6OA 5C9AB 4CTEA 3MPBA 4LBQD 3WVJA 3P7ZA 1VJ2A 1RGSA 3C2UA 4LBMA 3E5UA 1IGOA 3PVEA 1SLCA 3ZXGA 1NCRC 1A3KA 2GP3A 1E5SA 2I74A 1W6PA 2VQ0A 2V5DA 2W68A 5T50A 4FQZA 4BMBA 4XJAA 3EMRA 2QTWB 4XACA 1R5LA 3I2DA 3VD5A 1YQ5A 4P14A 2BW8A 3IN9A 1VBB2 4AEDB 3NKTA 4BH9A 1UPSA 4RR3B 4MO3M 5A3MA 1J84A 1YIFA 4DMIA 5C3RA 1PZ8A 1EPWA 2FZ2A 2XPJA 1PIV2 2BJSA 2GH2A 1PO22 3JCIA 5ABJC 1BBT2 1VBE3 3SKJE 2VXRA 3WXPA 4CP2A 3ZYFA 3OUJA 4QPGA 4IV1C 4QKDA 2WRAA 3THTA 2JDMA 1F15A 2XMLA 3POYA 4MH0E 4DY3A 4MGTA 5JLVA 2HEYF 2WYFA 1YXWA 1HRI1 1LRHA 1JHJA 2BUKA 1QJFA 3H42B 2D3PA 1H6XA 1COV3 4FPEA 1CIWA 5LA2A 1O5UA 5FPZA 3DPRC 2ZHMA 4YM3A 3LPFA 1DQ4A 1NLRA 2HJIA 4I02A 4FFHA 2YU2A 4UAPA 2VMHA 4HXCA 3D5OA 3N7MA 4RL7A 4AGGA 2VUCA 4RQPB 4DQAA 2BZDA 2AREA 2NN8A 1YO8A 4XFGA 4EE2A 2E7AA 4QXCA 1DZQA 3CJIA 1PO13 4Y22A 1AR83 3E6BA 4P9LA 3VBSA 3ZLIA 2PHXA 1DGWA 1Y43B 3H0OA 3HN1A 4FPOB 1GWMA 4CE8A 1G9AA 4YG3A 4M4PA 1ALYA 3D0SA 2GNBA 3AKRA 2VUDA 2OKXA 2XHNA 4LBJA 5KHHA 5JOWA 4F8AA 3I59A 1S0JA 5FPAA 2ZKLA 4A44A 5KC5A 3LPGA 2VW1A 3S7EA 5CKMA 2VOXA 2ARBA 2JKXA 2MEV3 2BRTA 1V6LA 1H30A 1RUI2 1RUE2 2J1VA 1AL23 1ENQA 3HQRA 5K4LA 4LMFA 1R093 4GJYA 1JMUB 4R4ZA 5A7OA 1GZWA 3CLPA 4AEJA 1HB3A 1RVF3 2ZGMA 1JOBA 1VBD1 1S55A 4AVBA 3UNPA 3O1PA 3OYWA 2Q8EA 1A8DA 1W8OA 4JTNA 5IVEA 2VOKA 3B9IA 4WVMB 1QXJA 5T5OA 5C6CA 5LEKA 1HLCA 1S0DA 1ND3B 4LIVA 4BQYA 4OHZA 4AL9A 4HVQA 4JKLA 4E2GA 1SPPB 5I8TA 1GOGA 4PDWA 1SFYA 4QHOA 4S2FA 1QF3A 4YLZA 1O5LA 5HI0A 4CP0A 1PX4A 1NYWA 4KWKA 4LA2A 2OPWA 1RMU2 3VBHA 4MGYE 3ZN5A 4JGYA 1GQHA 5F2SA 1XQNA 3VGIA 4CVUA 1ZVFA 1CAXB 4A4AA 5FOBB 5IK7A 1E5RA 5A7WB 4LPLA 4EZHA 5BNNB 3I2GA 2EAAA 4FPCA 5JI9A 5JR2A 3ZSKA 2Y34A 5LK5A 2ZGSA 3VBFB 1WWYA 2R063 1AR61 4ONUA 1STMA 1W99A 4B1MA 2AH2A 3AXEA 4B4PA 1RUC2 1DFQA 5F1RA 3U1XA 4NIAA 1FOD2 1H4GA 3ZFGB 3S7IA 2D3SA 5CFCB 4IGOA 1AUAA 5KWRA 3DF0A 2DU1A 2C5DA 5FV3A 4CP9B 5FYYA 1OOPA 5DG2A 5FY7A 1KFUL 4NR1A 4IETA 2HWD1 1AZDA 5EJZB 1JHNA 1Y9MA 1Y9GA 2JE8A 4D7SA 4EZ4A 1DF0A 1C28A 2W1WA 2CWSA 4ISRA 5HBAA 4Y26A 1JZ6A 1NA1C 3ZFFB 1OPMA 4TXWA 1V9U3 1LNSA 1OD5A 2HYXA 5LK7B 3BTYA 3DCQA 5I0TA 1VB4A 2E7QA 1PMIA 1RUD2 4CDXA 2Y60A 2HWF3 2VNVA 3M70A 3MIGA 2XVLA 2R042 1VLNA 1VBB1 2G4IA 4JDNA 1H8TA 3I7DA 1W03A 2Y8KA 2TNFA 4YM1A 3WDYA 3NNGA 2YBPA 5BNOC 1PIV1 2JB4A 5A1FA 1ZBE3 1PK6B 1PO21 5FAXA 1X33A 1BBT1 2ORZA 3RNSA 1TEIA 1UQXA 1MQTA 3H1YA 4JAAA 5ACA2 3FHIB 3GCXA 4U36A 3TNQA 2RS52 4B4QA 2E26A 3OB8A 5AFEA 4GA9A 4NN0A 5JUVA 1W6MB 1KITA 4PIZA 3HD8B 3R4DB 1IHMA 5ISLA 4X8PA 5JZGB 1EYBA 2RE9A 1F5JA 3DGTA 3LSEA 4JZRA 5B4XA 1JZ3A 1MS3A 1W9FA 1C5HA 4NO4A 2V73A 4P9YA 1AYN3 2VQAA 2PYTA 3AFKA 4C91A 1IPKA 3JZVA 3GF6A 3KQRA 3THDA 3BGAA 1QJY2 5BXXA 2ZX1A 2DVAA 2WBKA 2OS2A 3UYJA 4YVWA 1MR5A 1X8EA 2XGXA 3GBGA 3OJBA 1RUF3 2DVGA 4NHKA 2QQPA 1CWPA 3KCYA 1OURA 1W0NA 2W94A 3INAA 1LJ7A 3MGUA 4OQ9A 2XUMA 4BLJA 2IVIB 4WM8A 4XAAA 5FMOL 2HKXA 1G86A 3PIJA 3Q9OA 2BYVE 3POBA 4FCAA 1R1A2 5DXDA 3VZMA 3ZXKA 4E4SA 4AYUA 2VNGA 1RMU3 3ZSMA 3KT7A 1WW5A 3AKSA 1YJLA 3O0VA 2YROA 2VQTA 3FFQA 5GLUA 3R6SA 1QMJA 5CADA 5C8CA 4GMP0 2YDEA 2QCSB 2Y0OA 3K51A 4E27A 1ASJ3 1QNYA 5D8AC 1D7PM 3CU7A 5DZEA 5FXVA 2I07B 2WZPP 4OMKA 5IJRA 1AXZA 5F5AA 4FPGA 4GH4A 2I45A 1RUI1 1RUE1 3QBQA 2WNUB 1NZCA 5DUWA 3T4HB 5K0UC 4CCJA 1UIJA 2PAMA 1QU0A 2NZ9A 5JMCA 2Y0IA 3RZGA 2BOIA 5FZFA 2WQZC 4AK3A 1ND2B 5DUXA 1YJKA 2CY6A 2J22A 3VN4A 1MS8A 3O7OA 3WOGA 3ZXJA 1PMJX 1TZOA 3SCHA 4L9BA 5J3UA 2A7AA 5SV8A 4XDOA 2BGCA 3A22A 4ZS2A 1CONA 2ZHLA 5FK8A 3WW4A 3AP9A 4XUPA 2VOVA 3WW1A 3MLKA 2W5FA 4AFDA 1O7FA 2BERA 4IXLA 4Q4Y3 2W3JA 4AVTA 3AMQA 4QHZA 2ZEYA 5FY8A 5FY0A 4D8MA 1I5PA 1KFXL 2WL1A 2VZRA 3EJKA 1VBA2 4D6QA 3ILFA 2VBPA 4YZ3A 1OUXA 2GNTA 3KM5A 3FL7A 3M2MA 1ZREA 3MF9A 4B8EA 1QGLA 3L2HA 1G9DA 2D40A 1VIWB 4HN1A 1NCRB 3ACHA 1CJPA 5EJ3A 4GKYA 3VBRA 4EN9B 2WA4A 5A32B 1LHNA 1RUC1 2VO5A 1DDLA 4UF0B 1FOD1 2A1XA 5IVVA 4J7PA 2R071 2P37A 2PLV3 3ACIA 2BNOA 3OGSA 1KDKA 3PU8A 1ULDA 5BNQA 5KC6A 1HQLA 1DQ1A 3U14A 4ZHNA 3GBWA 5GJ6A 1WCQA 2GU9A 2QBXA 3BTAA 4MYEA 4XQ4A 1AL0G 3RZJA 2EXHA 3NJVA 3OSDA 2ZGNA 3P3NA 3WR0A 3PUAA 3ACLA 3HNMA 4JQRA 1S4CA 1AYM2 4B29A 2JDHA 1RC6A 1O3TA 5ABJB 4QX1A 1OA4A 2JDPA 3OUIA 4QQPA 1H2NA 1Y4WA 3V64A 3MIBA 3NJZA 4CDUC 1RUD1 1JOJA 2C9KA 4IV1B 1LOCA 4A7KA 3LF7A 4IEXA 4EWEA 2R041 4OMCA 5EPAA 2WO1A 2P3YA 1HJFA 1YQCA 5FRAA 1XYNA 4KL1A 3VHPA 2XWJB 3HOBA 4XC9A 2VVFA 1Z0HA 3J7NA 4XDPA 2PHWA 2QQMA 4QPGC 1WD3A 2B9VA 2W47A 4QXBA 1UZ0A 3WF4A 2RS13 2YPDA 4R4XA 4ATFA 1LOGA 1M06G 3KS7A 1DZRA 4K9SA 4FPKA 3RVHA 5ACA1 5G05L 2PN5A 1BQPA 2RS51 4TZDA 4HPKA 4K20A 4ASKA 1UZZA 1W06A 3SEEA 3ZFEB 4OHVA 3AC0A 3T4VA 2DU0A 4DEQA 3ETQA 2AC1A 2R32A 5JOXA 1JBCA 4UBHA 3WCSA 1CESA 1ZRCA 5EP9A 2YV8A 1ZA7A 3HPNA 4EQVA 4ZU7A 2RDNA 1W39A 2P17A 3B02A 3MLLA 4QM8A 3TN92 1XU2A 2X29A 4O7XA 1QJY1 1I9RA 1PVXA 3HVDA 4NWVA 4AQTA 4RHV3 3I4IA 3Q8AA 5L36A 1QDOA 2OT7A 3MW3A 4AQ2A 1D0HA 1QXRA 4LO4B 3CJIC 3VBSC 3PHMA 2RM23 3IPVA 4V2VA 4DOUA 2WFF3 2QQKA 2WC2A 4XQDA 3PL0A 2F6BA 3N7JA 3POGA 2BEOA 3T09A 5C9AC 5C3SA 3J8F3 5FZ0A 3UJQA 3VKFC 1R1A1 2DTYA 4Y1ZA 2A5ZA 5GZEA 1ULOA 3BIEA 5DABA 4QD2A 1VE0A 2FDGA 3WF3A 5L7OA 4IEYA 2WNVB 5GLVA 1GFF2 4K6BA 3GCWA 3ZYPA 3S0MA 4XIKA 2VMDA 1OFNA 4WV8A 3VBUA 4AEDC 5I0RA 4OCTA 3V65A 2WO2A 5FPVA 3VHNA 2GC0A 1UXZA 3J26N 5FZ9A 3Q8CA 4QMAA 4JGZA 4BQXA 3A4UA 1OPOA 4UW3A 2WWJA 2X10A 2R6QA 5EV7A 3K2OA 4CU6A 1JOPA 2R49A 4QU1A 2JKBA 1CAVA 2DCYA 1WW4A 3R4SA 4NRQA 2PTMA 3UJOA 2CGOA 2JE9A 3KHCA 3OEBA 5FZ4A 3RYKA 1EV13 2JDAA 4OI4A 1QJU2 3T2TA 4D7YA 1OBNA 4DY5A 4MGQA 4JGYC 3O1OA 3PVBB 2V4VA 2GAUA 4DINB 4GMP3 1YYNA 4QKNA 4NIIA 4H55A 3MUZ1 3OGJA 2JXAA 1H2KA 2SBAA 1X36A 2QQUA 3OGRA 4OLLA 4BM8A 2CWMA 3G6JB 5E8AA 4LT5A 3I2JA 4P9JA 1VBA1 2D6LX 3MIHA 1QJX2 4D69A 1GZ9A 2XG3A 4QX7A 4MHRA 2DVBA 4XBLA 3POJA 1APNA 2YUEA 2VZVA 2VZ1A 2VM9A 2ZGTA 3KV4A 4FPLA 3THPA 2XQRA 3I3MA 4MOAA 1JTZX 3NV2A 3VZJA 3T30A 2GMMA 4RQPC 4OZXA 3BYWA 1PMHX 1TNRA 2D7FA 3VL8A 4BIFA 4MGSA 4FO9A 3FHAA 3ZKYA 2XOMA 2WAOA 4ZU4A 2JG9A 2YYOA 2FBEA 1NAEA 5JWPA 3LCPA 2HBUA 1O4TA 1KQRA 4CDXC 3FBYA 1AYM1 1QHDA 3WP4A 5FPUA 4L99A 4NOTA 2Q4SA 3WD5A 1YLLA 2JD4A 1PGW2 2WZR2 1MS9A 1FV2A 2YGLA 1H8TC 4SLIA 2E33A 4LO7A 1V6JA 3DKQA 2YFZA 3CF6E 5FQ0B 1UXXX 4PI2A 4E8CA 1K42A 1AJKA 3JXSA 2P6CA 4NHLA 4I2OA 2ZMKA 3AYAA 4TSVA 2RS32 1LU2A 4TN7A 5F8PA 4XOGA 3ES4A 1JU4A 1AR92 1DIWA 3AYEA 2QKDA 5A7NA 4AFBA 4CU8A 3KB5A 1W6OA 4JX0A 2HBTA 4UXAA 3SNMA 2VZSA 3TBDA 2PQSA 4Y5SA 1LOAA 2G9FA 5CNAA 4XPVA 4XVHA 4AFCA 1SHWB 3OUHA 2RG4A 4BYYA 5JXHA 1PNGA 2W9XA 2D6KA 1GNZA 2RV9A 2Y6JA 4LHNA 4ZY9A 1AUYA 4N9IA 5DUVA 4TWTA 5FPLA 4Z8BA 4GD4A 3IIAA 5A1LA 4BQ4A 4BDVB 1BHGA 1VBC2 1WGPA 2JG8A 4L8QA 1HDKA 3H3LA 5BNNC 1ZZ6A 2NLRA 4S2GA 1LR5A 4NIHA 1UL9A 4NE9A 5FTTC 2DBNA 2XJVA 3TN91 2UWCA 3Q8EA 1WMDA 3WNLA 4NMIA 4V2WA 3ZN4A 1S0CA 1Q8OA 1LEMA 3D4KA 3CIHA 4LXLA 3NQHA 3ZR6A 1HV0A 5KXBA 1AXKA 1D4VB 2JDZA 2JB8A 5D8AB 1DGWX 2B7YA 2ZACA 2ZGUA 4QPWA 2WKKA 5IUQA 5LRRA 3K4ZA 3ALQA 3NJXA 5F5IA 3B9CA 4W6WA 1W6NA 1OUSA 2HWC3 3C8XA 3FLTA 3VKLA 3GZAA 3ZFFC 2JEMA 1JXNA 4ZXKA 5BPXA 3SMHA 1I1EA 4K8FA 4XFHA 4GH4C 1SCSA 3RSJA 5LBFA 3RZZA 3UESA 3B3QE 4AVVA 2BQPA 5DMYA 2OX0A 3ZDVA 4BJ0A 4D0QA 1U5ZA 3BODA 4YFWA 5FFOC 1UAIA 3LA3A 4BXSV 1W2UA 4LHSA 2VPVA 4IE6A 3WINE 4XBNA 1PK6C 3ILRA 4IESA 2RDSA 2WT0A 2DCJA 3BIWE 3RZMA 2AGSA 3IKWA 3ZXAC 3AM2A 1IG3A 4XFAA 4CU7A 1V6NA 4QQOA 3RI9A 5C4WB 3KF3A 1QJU1 4M3CE 2VCBA 4NRMA 4A42A 1DGRA 1TME3 2BGPA 2LUWA 2XJQA 5KR7A 3QACA 1ZNPA 1QJEA 1EAH1 5EWSA 2Q8OA 5JZGC 5FZ8A 1RL3A 1NG0A 4FXGB 2JIGA 4Q4X3 2P3JA 1K45A 1BZWA 4ET7A 3W67A 3Q8BA 2BFUL 1UYYA 1NXD1 1VBE2 3D82A 5A6QA 1ZX5A 1MVQA 2RS33 5A3TA 1W8ZA 5KXCA 1W8WA 1RJ8A 4LR4A 4D6SA 1W6PB 1QJX1 4QX2A 4M01A 5KBFA 1ULEA 3S30A 4YW4A 1GOHA 5G04L 4AFMA 5GALA 1DGLA 2XJUA 1JS9A 2B46X 1QH6A 4XE9A 5A3PA 4CP1A 3JD73 4IE0A 1HX6A 4QM9A 1YHFA 4CCKA 1N47A 1COV2 1OA3A 1UKRA 4ORFA 4RFT0 1KJLA 2WN3A 5A33A 5T3NA 2VECA 1H1IA 4WVWA 3IMMA 4AVSA 4G9SB 3GZTB 3VDDC 2B39A 4FOWA 2XDVA 5FZCA 4X6RB 3UKNA 1GV9A 2P3IA 4QPGB 2W2IA 4YW5A 3LA2A 4A3XA 3B7NA 3MW2A 1XNTA 5C3PA 5FY4A 2AUYA 2VC9A 3MV01 1CX1A 2TBVA 1PGW1 1P8JA 2WZR1 4XIOA 1D2QA 2FCVA 3NMBA 4ZZ5A 2RJLA 1IZ3A 2VJXA 3RS6A 4NPLA 4EWAA 1AR82 1OLME 1SLAA 2WZ8A 4AOCA 2CDOA 2DTWA 1FAYA 3RPQA 5LY2A 1AR91 4YFZA 1JYTA 4I30A 4Z2AA 1XYPA 5BNPA 3SEPA 1H2MA 2ZPXA 3J4UH 4S2DA 5DQ0A 5FO7B 1GZCA 3H3ZA 1FNZA 4OQ8A 1X7NA 5FLJA 4JKMA 1GU3A 1AL22 3QD6A 3VZNA 5BV6A 1R092 5IAXA 5GLWA 4DRRA 3FWEA 1RVF2 3CJIB 3VBSB 5FPXA 4Y22B 5ERLA 2J1AA 5FY5A 3I2OA 3HNYM 5B2GB 4KQ7A 1VBC1 2J1UA 1POV0 3TB0A 1FMD3 1ZBA2 2NMOA 4IV3A 4FAHA 3RQ0A 3WG3A 1WCDJ 5C5UA 1W6QA 5IVCA 3V56A 1OF4A 3VD4A 3KQ4B 4CUBA 1NT0A 2ZJCA 4HMZA 5IWFA 1EUUA 4GB33 4CUCA 3MBWA 1XPWA 4Y24A 2UYAA 3EQEA 1W9YA 5JPMB 1B35A 3P6BA 1XNCA 2HEWF 1CAWA 4UFKA 4A6SA 3ZYIB 1SZBA 1G9CA 3O1VA 1OKQA 4IE5A 1VB2A 3M8LA 5DAWA 3OYWB 5LA9A 4AFAA 5L7OC 1PZ7A 1YQ6A 4M4RA 1D4M3 3ELNA 2IXIA 5GZFA 1WMEA 2Z42A 2R062 1S0IA 3SQOA 1SFNA 1J59A 3VBUC 3O14A 3BUCA 1BEV3 1YFWA 4K8RB 4RGKA 1OHFA 4LULA 1L7LA 4KBZA 3PTRB 4J6GA 1JW6A 3GBFA 5GKAC 4P9WA 3VBHB 4KWLA 4JGYB 2LRPA 2PELA 2R1BA 2WA3A 1VR3A 2FDJA 2I2SA 1CD3G 1S2EA 1UZWA 1DYKA 2EA7A 5DN2A 3WF0A 2ZXQA 5JVVA 1O6UA 5JOZA 1O3SA 4NPMA 3AVSA 1LESA 1V9U2 2Q8CA 1LHOA 1GZTA 2JWPA 4CCOA 3NAPA 2C26A 2JJ6A 3O1MA 2Y6GA 2HWF2 5DZFA 4QXKA 2H6BA 2R16A 4D94A 1F4AA 1W2AX 1HB4A 2G1MA 5LA1A 1FI2A 3C7HA 2B4KA 4KI5M 3ZFEC 1UYXA 5CKQA 1JH5A 4FP3A 4QHBA 4FQ4A 4DUXA 1W8HA 3W9AA 3IB3A 3RI8A 3FZ3A 3WDTA 1GNHA 2D98A 5FBZA 1ZBE2 3ZYRA 4YGCA 1VBE1 1OLRA 2PXJA 4OULA 2X09A 3AMPA 2GN3A 2QQVA 4CDXB 4Z2WA 3CO2A 1V6IA 4NJ4A 4BISA 5GLZA 4AHWA 4J7QA 2CGPA 4H7LA 1V70A 4X6QB 3AYDA 4AI9A 5CFDC 2D93A 1IS3A 2IXLA 3T1LA 4BIOA 5CB7A 4XCBA 1H8TB 3URFA 1OF3A 1CAUA 1R64A 2JG9C 3OBTA 4HKLA 1COV1 4CA9A 1WCSA 5FZLA 5C33A 1L7QA 1H6YA 1GSLA 2VZQA 3HQUA 1AYN2 3ORJA 1DLCA 5I0SA 4ISQA 5HV4A 3NNFA 3PU3A 3GHMA 1UMZA 4BQ2A 1MQTB 4CSWA 3NV3A 3GJAA 3K48A 3W21A 2DF7A 1XE0A 1ZBA3 2B5HA 1K5MC 2GSYA 2WNVC 4AZZA 3BTXA 1RUF2 2K46A 3M3QA 4XF3A 3I3EA 4F83A 4LKFA 2ZCWA 1RINA 1GP6A 2C6SA 1CPNA 2W0XA 3OPWA 1AF9A 3FJSA 1UU4A 1VP6A 4LBOA 4P5HA 4XJZA 2D6PA 3BB6A 5FYIA 3B94A 1PO11 1AR81 2NPIA 2VBBA 1UOFA 1IS4A 2D6NA 1GQPA 2HWE3 1GANA 1U5XA 2OZJA 4MHUA 1FV3A 4E2QA 4KH9A 1CIYA 4XJWA 4RGAA 3I2FA 3W5NA 1REDA 4RR3A 3ZN6A 1ASJ2 1YEWA 3IT8A 3JU9A 3RZHA 2XLFA 4AWDA 2MEV1 3NWKA 5F37A 3JBG3 1AL21 4Q8KA 1PGSA 2R0FA 1R091 4WM8B 2JG8C 2W08A 5JR7B 3USSA 1W3VA 2CNAA 1W8FA 2ILMA 4AI1A 1RVF1 1IPSA 4O9GA 2NM1A 4LQRA 1UCXA 2PFWA 1W9SA 3FFZA 3PLQA 4CUAA 1G7YA 2JDYA 3QLQA 5ANQA 4LKEA 2CTVA 4I01A 2QDNA 2VCMA 4UFMA 5FUNA 4NPRA 3H8OA 1LEDA 2YXSA 3B00A 4QGLA 5FOJB 2UY9A 1U0AA 4GH4B 4XHXA 2A6YA 3F2ZA 2RMU3 1MZ6A 4YM0A 3BKZA 4Q4Y2 3PUHA 2AEZA 4IEOA 4XZUG 2A3WA 4H3WA 4P5YA 3O0XA 2DDUA 1QXPA 4KG8A 4O61A 5D21A 3P5BA 2J1TA 1WD4A 3KMHA 4HKWA 5FUPA 3TEYA 4JTOA 4UFHA 2ZX4A 3ZO0B 2R061 5KHIA 5C3QA 2ET1A 1E57A 4ZU5A 4C1WA 4ZZ8A 3N9MA 4R9CA 5L9BA 4AI0A 3LDKA 1POV3 2FDHA 3WG4A 5CZKA 3VD3A 2CGNA 2PLV2 2AR6A 4YW2A 5GZDA 4ITCA 2XVGA 3E1F1 4QX0A 5CKNA 3SCFA 3TNPB 3USUA 1MZ5A 4PLOA 4W4ZA 2WUHA 3AZXA 4PF5A 3A21A 4XHBA 4A2UA 2OA2A 4AVAA 1UY4A 1F35A 4BQ3A 1TMF3 2DFBA 5A3UA 4KU8A 1IG0A 4B1LA 3V0BA 3H7JA 1W90A 5IYYA 1V9U1 1DYOA 1YC61 5FZDA 4JCKA 5FLIA 2PAKA 2XB6C 4XF0A 3ZXFA 4N8MA 2HWF1 1WCUA 2P1BA 2UWAA 1RUH3 3CHXA 3NSTA 4NIGA 4AW7A 2VY0A 2P34A 4RS5A 1QY4A 3AVRA 2ZEZA 2YMZA 4L97A 4AHXA 1MS1A 2NQYA 1Q3EA 4IERA 3VUOA 2ZX0A 3GM8A 1PVC3 4M3CA 2ZAAA 5FZAA 1LGNA 1ZBE1 1H4HA 5CEHA 1WCKA 1BVVA 1QH7A 4WZCA 1HRV3 1AR73 2RS12 5I8SA 3PURA 4PBOA 3KGZA 4BLIA 1W9TA 1HJGA 5BUVA 5T5LA 3VDDB 1KS4A 2K2SA 2W92A 1UD1A 5FLHA 4BZ4A 2B9UA 2FHRA 2ZMNA 1VMFA 4H14A 1DP0A 2B8MA 4M00A 1T6BX 3AZWA 5DAPA 4P9XA 3CEWA 4GXLA 3VBFA 1ZRDA 5I0UA 1F5FA 2ZTNA 5A80A 3OGGA 2VMFA 3ZFGA 5FDBA 1AVBA 5FWEA 5KHGA 1KDMA 1Q8VA 2V5YA 2IXCA 1KEXA 4BQ5A 1AYN1 5KXDA 5IK8A 3E97A 3LZZA 1W28A 3RJ2X 5FXZA 1ULCA 1FATA 4TLFA 4BWOA 4CDWA 2VQUA 4FSJA 4RHV2 1HIXA 4P02B 5LY1A 5HXVA 1ZRRA 3RDIA 2WQ8A 5J09A 1RUF1 1GOFA 3H50A 3UK9A 3O5SA 4HPKB 4CUGA 5JXJA 4L11A 2RM22 4QDSA 4FXKB 3EB7A 2WFF2 4BOWA 2VZTA 1FX5A 4FVVA 4DFSA 3BTZA 5HCHA 5FY1A 3FX3A 3PVNA 4N9HA 3J8F2 5A1AA 5AFBA 2E7TA 2EIEA 5BNPC 2R7EB 1JYCA 1RMU1 4GWMA 4QX8A 2ATFA 3VKNA 2O14A 4IEZA 5F6LB 5LATA 1IQDC 2VZPA 5FYSA 4E8DA 3AFGA 4Y3OA 2WS92 4Y1YA 1WBFA 4FPHA 2DUOA 2QQJA 1ASJ1 4A7YA 5HCBA 2EIBA 1PZ9A 5C4WC 1LECA 1KS5A 4YGBA 3B01A 2PHFA 4IEUA 3IPVB 4WM7A 1V6MA 2Z69A 1SACA 5CAZA 4PLMA 4DRVA 3L9JT 1ULFA 1SLTA 3DEMA 1F4HA 3NV1A 4URTA 4YG0A 3LWCA 2E51A 5J96B 1QKQA 1YQ8A 1M4WA 2TUNA 1O4YA 5L7OB 1BMV2 3VV1A 5HCFA 1EV12 4G3YC 5FIXA 1QQP3 3P1IA 3VHOA 4IUGA 2WQ4A 4O65A 3RJRA 5DDJ3 2Y33A 5ANNA 4QB2A 2BU9A 1SMVA 3ECQA 4RSUA 3VBUB 3O0WA 3OEAA 2DURA 4V1PA 4CXXA 2XHKA 3ENRA 4LE4A 5J7MA 4TLGA 4Q4Y1 3BCWA 4AGVA 4JGZB 3RYPA 3AMMA 1ZRIA 1DZTA 2QQNA 2E53A 4AAPA 4LO6B 4CZSA 5T52A 5H9RA 4EJRA 3B93A 1CAVB 1GICA 4XJ8A 3QCWA 2P6HA 1H9WA 1Q8SA 5FP3A 3DV8A 2WNOA 1CVNA 4KWJA 2VCCA 3APBA 3HQXA 3H8RA 2PLV1 4GQ7A 1UF2C 3POWA 3ZMOA 4WVVA 3WDVA 2VMCA 3VB9A 3UKVA 1W2TA 1IOAA 4YG6A 3KD4A 4B7EA 2C9AA 4YARA 1GR3A 4PIXA 2CAUA 2SLIA 3RGBA 2DCKA 3N9LA 2EALA 2TEPA 2EXJA 1KGYA 2F17A 3NAPC 4K1YA 5GZGA 1MPXA 5SV5A 3N3HA 3TWIA 1F9KA 4SBVA 3AP5A 3WP5A 4CEWA 3DYOA 2Q1ZB 4ZXEA 4ZONA 3AX4A 1CX4A 2HH9A 4Q27A 5A3WA 3RZKA 1Z7S3 4RFRB 5FZIA 3N36A 1JYIA 1LOFA 4BHPA 3CNAA 1UIKA 4IEPA 5CFDB 4N53A 1IKPA 3ETPA 4W6XA 3WDWA 4CDQB 2JG9B 2VTXJ 1C1FA 1UU5A 1WMXA 1X9PA 4N7IA 4LUMA 3NW4A 5F39A 2RS11 4EWDA 4KGQA 2FCTA 4CDQC 2EF6A 2XUEA 2OXBA 3HT1A 4HK9A 5C8WA 4XFBA 2KR2A 1YCIA 2VZUA 4COYA 3TEZA 3WQ1A 2CV6A 1XSQA 2UYBA 2WS93 4JHTA 4YVSA 1C8M3 5H9SA 4KGGA 1K5MB 2GC1A 3O12A 2EAKA 3WNPA 4HBNA 4HLTA 4NAOA 3ZPOA 4C0BA 4YSFA 2VVDA 2BVVA 1FPN3 4HKOA 4Q0UA 1WMFA 3V0AA 1BVP1 1PM7A 2VZ3A 4HETA 4EV0A 4XXPA 3Q8FA 2EXKA 4QGNA 4UF0A 3J7HA 3VKMA 3C7GA 4HL0A 3CQOA 3T2PA 3M3IA 1MS0A 3WG1A 5J1XA 1CZSA 1UN1A 4FTSA 2HLEA 2V09A 1JI6A 1GBGA 1A8MA 4RHV1 3ZYJB 2YB7A 4PDWC 1N1TA 2C1FA 3KT4A 3VDAA 3QH7A 1BK1A 1WUVA 5JI7A 1NXMA 4MVTA 5T5JA 4E4DX 3IM0A 1SBEA 2RM21 3VBHC 3MHZA 2WFF1 1DBNA 2D3RA 2Q0AA 3POFA 4JKKA 1XU1A 2AEYA 1NLQA 2QQOA 3VBOA 2QQLA 2JG8B 3B7MA 3GZEA 2HWC2 1QEXA 3J8F1 3NNJA 3PUIA 5EJ1B 3AL5A 5FYCA 3LFMA 4XUOA 3J7LA 5JCTA 2E31A 5KHKA 3BPZA 2Y6HA 4K40A 4GALA 3WX5A 4M8ZA 1CR7A 1GYKA 1LOEA 1UPIA 2B45X 3OBRA 2VR4A 1N1VA 4XUTA 1NZIA 1OA2A 3I54A 5CG9A 3B7QA 3Q8GA 3NKGA 4A7ZA 2LW8A 4Q4W3 1OOPC 2YZ4A 2YU1A 1Y9QA 3ABZA 5F3EA 3T2QA 5BYNA 2WYSA 3VDCA 3DPRA 4HFSA 3M3CA 5IK4A 3LQCA 2BBVA 1LULA 4YM2A 3UGHA 3ZIWA 1K3IA 4W50A 1FXZA 1W6NB 2MPFA 3LB9A 5APAA 4CCDA 1W3XA 1HXS3 3KVAA 1ACCA 3NO8A 4LA3A 3ATGA 3UGGA 1SBFA 1UMHA 1EP0A 3T3YA 1O4ZA 1WLTA 2XR4A 2XVKA 3CL1A 3N9PA 3D3AA 4XZPA 5CU1A 3S57A 2EXIA 3KZ4C 4ES8A 4NIDA 2PHDA 2VUJA 4XF1A 2ZHNA 3OPZA 4NHXA 5JIAA 1BMV1 2RR13 4DXRA 1EV11 3UETA 3ACGA 5FPBA 3VZOA 1TME2 4LBNA 3BU0A 3S5AA 1DG6A 5FWJA 1NQDA 3JUUA 4GMP1 3PVOA 1XBFA 1UY0A 4LEJA 5FMCA 3G7DA 1ZZCA 2R30A 4Q4X2 2DBIA 1NKGA 4AE2A 4NROA 4W8JA 4EN8B 4COVA 3K4DA 3EXUA 4X8NA 4AQ6A 5F3CA 4URAA 4CCMA 1HQWA 5EZWA 5I91A 3IDAA 1MQTC 4XILA 4YZ1A 1AXYA 2ZGLA 2WSUA 4XETA 4NRPA 5A7QA 2BTVC 2HWB3 2JDNA 4A41A 2JDUA 4BQ1A 4CCEA 4XTMA 3H9AA 3BN6A 4J1XA 2BWAA 3JD72 4MG2A 1ENRA 1VPHA 3OCPA 2A73B 4UT5A 3LE0A 5AVPA 5F3IA 4Q2FA 3AYCA 2J1EA 3NV4A 2E32A 3ZPYA 2CYFA 2CAVA 3WF1A 4LITA 2Q5TA 2IFWA 1ONAA 3GALA 5A3LA 4E4ZA 1W2NA 4N43A 4COWA 1YIPA 3RMYA 4DIQA 2O0OA 4YVWC 4AEMA 1L3JA 4OYUA 4OI0A 4AI2A 4RS5C 1Q8QA 4QB6A 4Z1VA 4LLFA 5JIUA 2MHFA 3WW3A 1X50A 4WM8C 2ZAHA 3MIDA 3O1TA 1RUJ3 1W8TA 1RHI3 1MEC3 2QE3A 5AC93 1UO9A 2ZX2A 1SG3A 3AJZA 5A33B 4JVAA 4COZA 2EIGA 1KJRA 5LBCA 1RUG3 1WW7A 5C8CC 1VMJA 2QJVA 5DAVA 5FP7A 3KV5A 5IFPA 3B5LB 3LEKA 5FYVA 1J3RA 3I49A 1N3OA 5GZCA 4PI0A 3OG2A 3I8TA 4OI2A 1W2OA 5KHJA 2VZOA 4Y1VA 3O1UA 1NA1A 2WABA 4FFIA 2WSVA 3WQ7A 4CCCA 3K75B 5J37A 2FDFA 5C5TA 1F8VA 1LCLA 4OUMA 2P3KA 4RN5A 1FMD2 4CDWC 2XJTA 3K77A 3IDCB 5BNPB 1ZA4A 1RIRA 4QX3A 1FYUA 5A6YA 4AAXA 2IXJA 4NHYA 2KD7A 2XONA 4HK8A 4KG0A 3WG2A 3VD7A 1SCRA 1HKDA 1J1LA 4GB32 1SLIA 1JZ4A 2UWBA 4FBFA 2LALA 4XF4A 4UI9L 5BNOA 1R083 3LIHA 1OMIA 2YC4A 5T54A 5LB6A 3KCXA 4GIQA 2Q1MA 4I3PA 4QKFA 1WW6A 2DUPA 1BLZA 2A6XA 2HWC1 5LW9A 1D4M2 2WNEA 3OBZA 1OLQA 4IV3B 1XB9A 4TYSA 5FQ0A 1W6QB 2VH9A 1VRH2 2LS6A 2DFCA 3VBRC 2VOTA 1BEV2 4LKDA 1UU6A 3LKJA 3QOPA 4LKSA 1SDDB 2DVFA 3U75A 3B74A 1HW5A 1NX9A 3U4XA 4Q4V3 2XBO3 2BNNA 2ZZQA 4B7KA 1UOJA 2ADDA 1CAWB 3BALA 2QFEA 2OUJA 4OHWA 1XNBA 4ASMB 3J7MA 4LO8A 3M3EA 4RA0A 1BKZA 3D0JA 4YGEA 4XDQA 1FT9A 2RVAA 2HYKA 4XTPA 3N7LA 4LORA 4GJZA 4G4FA 3DL3A 4AGRA 2K9ZA 2ZX3A 3AJYA 3AMNA 4OUEA 5A70A 1ENXA 3I2KA 2O8OA 3U07A 1C5IA 4FT8A 4HZFA 4CJ6A 1TME1 3LA7A 1LENA 1Y7BA 3KF5A 3ZMNA 4LNVA 2Q8DA 4Q29A 1G8WA 3PMEA 4YNIA 1N3PA 1OSGA 4Q4X1 2WZEA 2XJRA 3W20A 1NY72 3HY5A 2KM2A 3CBNA 3UT0A 4XUQA 3EHKA 4TTGA 4YGDA 2RS31 3IAPA 2MNGA 2N7GA 3M4FA 1VBD2 2OUHA 4PBPA 3NAPB 3VDBA 3LFIA 5K0UA 2G9ZA 1JN2P 3TOJA 1VAMA 5L73A 5A3NA 1DU3D 2GZWA 2WO3A 3RRDA 3JD71 4MXWA 5LRSA 4CEYA 4Y33A 1Q56A 1K5JA 1QOOA 4LHLA 3KLSA 1E5IA 5E16A 2Y6LA 4XMIA 3LDBA 4QPIA 3A0NA 2ES3A 3AP4A 4BK5A 3I3DA 2BP6A 5EHDA 3WW2A 1DQ6A 4CEWC 3ACFA 4DO0A 1SQ4A 3UGFA 1NCQA 2PHLA 1JZ8A 4Q5OA 3BI3A 3MI8A 1S2BA 4XFCA 4UFLA 1JODA 5FMBA 1OI6A 1LOFC 1TVGA 3I59B 5FZOA 5LBBA 4W65A 1HN0A 3HX3A 1XNAA 3B69A 2IVJA 4N53C 2VNRA 1CAUB 1CGPA 5FZ6A 4CCLA 1W9WA 1J3QA 1ST8A 2HWE2 2YBKA 1GZWB 3ZYBA 2ORXA 4JDOA 5FYUA 3ZM8A 4FMMA 5F7UA 3ZDSA 3ME2A 5LWBA 5EXOA 2WR9A 1VMHA 3LGRA 4YVSC 2WDBA 2ZHKA 1OKOA 3MFAA 1HRI3 3KT1A 3EBRA 2D44A 4B3NA 2QQWA 4XMAA 1CQ9A 1ENSA 1VRH3 3JBG2 1TNFA 2H0BA 3OTFA 4C0HA 4HONA 3H8UA 4PDWB 1SFPA 3MO4A 4DS0A 2ERFA 2X53S 2XH6A 4XYXA 1J3PA 1S0GA 4UW5A 4JGZC 3B7ZA 5JXIA 1V6OA 4ARXA 1C57A 2G9GA 5D2AA 2ETEA 2UU8A 5EFUA 5FZ3A 1XYOA 1FMD1
chains in the Genus database with same CATH topology
2D4QA 1O6UA 3B7NA 4OMKA 2E2XA 4FMMA 3PEGA 4OMJA 4CJ6A 4J7QA 3B74A 4M8ZA 4CIZA 3P7ZA 3HY5A 1OLME 1OIZA 3B7QA 3Q8GA 1OLMA 3PG7A 3W68A 4TLGA 3HX3A 5LZ6A 3B7ZA 1OIPA 4J7PA 1R5LA 4UYBA 1AUAA 3W67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4Q A;  1O6U A;  3B7N A;  4OMK A;  2E2X A;  4FMM A;  3PEG A;  4OMJ A;  4CJ6 A;  4J7Q A;  3B74 A;  4M8Z A;  4CIZ A;  3P7Z A;  3HY5 A;  1OLM E;  1OIZ A;  3B7Q A;  3Q8G A;  1OLM A;  3PG7 A;  3W68 A;  4TLG A;  3HX3 A;  5LZ6 A;  3B7Z A;  1OIP A;  4J7P A;  1R5L A;  4UYB A;  1AUA A;  3W67 A; 
#chains in the Genus database with same CATH topology
 1LGB A;  2D6M A;  4Q1R A;  2VUA A;  2YGM A;  4IL7 A;  4MV2 A;  3VKO A;  2Z79 A;  2EVX A;  4CDU A;  3TYJ A;  4MZU A;  3UL2 A;  2X5I A;  3ZN6 B;  3PMS A;  4HSJ A;  3PEG A;  3SIS A;  1YI7 A;  3HEI A;  4NWW A;  1O91 A;  3A0K A;  4P08 A;  3POS A;  5L19 A;  4Y20 A;  2VU9 A;  2JDK A;  3HIF A;  1O3Q A;  4GB3 1;  4YPJ A;  4O9E A;  3UKT A;  4FTB A;  2RMU 2;  1XOY A;  4LBL A;  3VBO C;  4BPZ A;  5T5P A;  3GHN A;  2RJK A;  4IEW A;  4H7M A;  1ODN A;  3WNN A;  1AX1 A;  2ZKN A;  2JIC A;  2Z2S B;  1OOP B;  4PLN A;  5DAQ A;  5DG1 A;  1HB2 A;  4ARY A;  4PQ9 A;  1H8V A;  4LBQ A;  3U10 A;  1DGR N;  5HPO A;  1D4M 1;  1ZZ8 A;  2XL7 A;  4RYD A;  1NQJ A;  3CKH A;  1BXH A;  4HSL A;  4JRA A;  1GWK A;  3OY8 A;  4YW1 A;  3LDR A;  5JPN B;  3KV6 A;  1VRH 1;  5L9R A;  4JRL A;  2ZBJ A;  1WLD A;  4PJY A;  5EIY B;  1BEV 1;  1VBD 3;  2WN2 A;  3IAQ A;  2A71 A;  2BGO A;  2D43 A;  3EO6 A;  4FPY A;  1QWR A;  4LO5 B;  3SXW A;  4B4R A;  2WII B;  3BPS A;  4HOO A;  1O8P A;  2DYC A;  3IWZ A;  3GZU C;  2W95 A;  1I3H A;  2A75 A;  2ZZJ A;  3ON7 A;  2BDR A;  5FZE A;  5IW0 A;  1QNW A;  5A7P A;  5FP9 A;  1TMF 2;  4DB5 A;  2QQI A;  2Q1F A;  3HMY A;  1C8N A;  2GN7 A;  3FE5 A;  4Q0V A;  4J25 A;  3WHT A;  3ZIX A;  1X8M A;  3H8X A;  3TEX A;  1UY2 A;  3CZJ A;  2IXK A;  1WZX A;  2OQ6 A;  5FXW A;  4WZF A;  5C9A A;  1RUH 2;  2WWU A;  3N9Q A;  1UMI A;  4BK4 A;  4FTE A;  4FFF A;  2VOW A;  2YHJ A;  5I0D A;  2ZGP A;  1UKG A;  5HXM A;  5IVY A;  4OMJ A;  4FI9 A;  1QOS A;  4PIY A;  3USU B;  3WY6 A;  2OYZ A;  1AR6 3;  1US3 A;  3FUO A;  1PVC 2;  2J1R A;  3FN9 A;  1NY7 1;  2PHR A;  3KGL A;  5FCC A;  1DQ5 A;  1HRV 2;  1AR7 2;  3N35 A;  4MGK E;  2FMY A;  4LOS A;  3V0B B;  1BYH A;  3HNB M;  5DZG A;  5TSW A;  4OI1 A;  3U37 A;  3DYM A;  1CZT A;  2W91 A;  1S0F A;  4AED A;  2YPJ A;  4M3C F;  1N1Y A;  2HWD 3;  4BXF A;  3LIG A;  1GP5 A;  4H2A A;  1GLH A;  1H1A A;  4XUN A;  2BVB A;  4YVW B;  1OQE A;  1W8N A;  3SH4 A;  3AXD A;  2ZOE B;  4RS5 B;  2X8K A;  2ZS6 B;  4I09 A;  1MS4 A;  2R1D A;  5F5C A;  3WDU A;  1RIT A;  1SEF A;  4Q0Q A;  1RB8 G;  3PIG A;  4MLO A;  3P3P A;  5FYB A;  1I6X A;  4N43 C;  4M3C B;  4BU2 A;  1ODM A;  4OFG A;  2YBS A;  1URX A;  1JZ2 A;  4IW3 A;  1YNA A;  2V72 A;  2XXZ A;  5JSR A;  5C8C B;  1ZBA 1;  3OOX A;  1VBB 3;  1WBL A;  4QKB A;  2YC0 A;  1OH4 A;  4Z82 A;  3WP6 A;  3PG7 A;  3RZL A;  2QNK A;  5HCA A;  5H9P A;  2W87 A;  2A70 A;  1PIV 3;  3GNE A;  3LOI A;  4LUK A;  4U2A A;  1PO2 3;  4Y5T A;  5J36 A;  1BBT 3;  2VL4 A;  1RJ7 A;  4LJH A;  4AHY A;  4IND A;  4GWN A;  2HWE 1;  3ZSL A;  3J9S A;  2CL2 A;  2R07 2;  3RWN A;  1UX7 A;  5JDB A;  1YFX A;  3VL9 A;  3ZX7 A;  2VVE A;  2YG0 A;  3H3U A;  4QQ2 A;  4CDW B;  4MGZ E;  1C3H A;  4RQP A;  4ZPI A;  5FYM A;  4HVO A;  4R9A A;  4XFF A;  1JYV A;  2WJS A;  2VGD A;  2VME A;  3N4M A;  5IVB A;  5CYY A;  3JBG 1;  3U11 A;  2W1U A;  2AAC A;  1GUI A;  2W1Q A;  2FDK A;  2BV4 A;  1XJA A;  2VW2 A;  4FOV A;  4YRD A;  4Q8L A;  2ARC A;  3K3O A;  3NL1 A;  3HAG A;  3WDX A;  4ZKT B;  3GGL A;  4HVR A;  5C7G A;  4QDR A;  4XF9 A;  4KWU A;  3U78 A;  3N9N A;  3BVC A;  4Z07 A;  4LHK A;  1B09 A;  2UUR A;  5FJH A;  1QQP 2;  1REE A;  3PDQ A;  4WVZ A;  3IDB B;  1UWW A;  5CIS A;  3KV9 A;  3WQB A;  4AXO A;  5DDJ 2;  3VLB B;  1QJZ A;  1CJD A;  3VBR B;  4L0P A;  1LTE A;  2P4E A;  1QDC A;  4WM7 B;  5F5Q A;  3SH5 A;  2RMU 1;  2YFU A;  1CN1 A;  2ZGQ A;  1J58 A;  3HWJ A;  4IDZ A;  5FMO S;  2KXL A;  3C7F A;  3MEP A;  2WT1 A;  3C7E A;  4PQQ A;  4WVM A;  1VRB A;  3RG0 A;  4BE3 A;  2GME A;  1ND3 A;  4M0N A;  4Q26 A;  2LTN A;  1SPP A;  1UX6 A;  2IZW A;  1DQ2 A;  4JDM A;  4ZS3 A;  4K3U A;  4OVE A;  2CDP A;  1ZZB A;  2XLA A;  1XSR A;  3WCR A;  2GMP A;  4DEV A;  1RUI 3;  2VCA A;  1RUE 3;  1PNF A;  1Z78 A;  3A7Q A;  2RJ2 A;  5LZ6 A;  3LOB A;  1UZY A;  1N1S A;  3AKP A;  4UYB A;  4XCA A;  3ITQ A;  1POV 1;  3A23 A;  1GMM A;  1CAX A;  4Q0P A;  1LHV A;  4P9I A;  5FZH A;  5FP8 A;  3AP7 A;  1V6K A;  5A7W A;  5BNN A;  4BB3 A;  2BWC A;  3MIE A;  1PM4 A;  5FJK A;  3VZK A;  1ULG A;  3U0Z A;  1OQ1 A;  5F6K A;  1AJO A;  3PUS A;  4OHY A;  4UBG A;  3M3O A;  1UY3 A;  3ZVX A;  1X9T A;  4K21 A;  1TMF 1;  3JB4 C;  5CFC A;  1CZV A;  4NUB A;  4AHZ A;  2QUO A;  4CP9 A;  3SLI A;  4YZ5 A;  5IK5 A;  2P5B A;  1ULP A;  3OD4 A;  5K8S A;  2EIC A;  3T08 A;  3IBM A;  1REF A;  1EPZ A;  2H6C A;  2OPK A;  3BOP A;  1RUH 1;  1Z7S 2;  3I97 A;  4XJ9 A;  3UV9 A;  3NVC A;  1C4R A;  3ZSE A;  4IEQ A;  4MX3 A;  2O8Q A;  4D3W A;  3ZFF A;  1U5I A;  4ATE A;  4DPN A;  1Y3T A;  5FRE A;  1WA6 X;  2GNM A;  2BBA A;  2RDQ A;  3FBM A;  2QZ2 A;  1OVS A;  2W1S A;  4N90 A;  4Y1X A;  3WQ0 A;  1ZYB A;  1PVC 1;  5J48 A;  4QX5 A;  3M1H A;  4LK6 A;  2OW4 A;  1RUC 3;  1FOD 3;  1HRV 1;  1AR7 1;  1O3R A;  4XJU A;  4CEW B;  2R07 3;  2QZ3 A;  4YZ4 A;  1AX2 A;  5CVR A;  3BOW A;  2IXH A;  4E4H A;  1C8M 2;  5A7S A;  4CEY C;  2VMG A;  3HBZ A;  4UW6 A;  1OLM A;  3OF1 A;  3E6D A;  1UOG A;  2A3X A;  5FMD A;  1FPN 2;  1RUN A;  1IQA A;  2WFP A;  3FC0 A;  1RYY A;  4QPI C;  4AF9 A;  2GND A;  3H7Y A;  5LAS A;  1EUT A;  1PK6 A;  1RXF A;  1WLC A;  3U4S A;  4F7Z A;  3VHR A;  4MUV A;  4Q0S A;  4N53 B;  1OC1 A;  4XAE A;  2ZEX A;  4E2S A;  2A6Z A;  4QDQ A;  3W58 A;  4F3J A;  1BJQ A;  2ET7 A;  1NCQ C;  3MLJ A;  3WV6 A;  5K7P A;  5IHR A;  5F2W A;  1YUD A;  3MF6 A;  4IV3 C;  1RUD 3;  4LK7 A;  4C8D A;  4QGM A;  1AHS A;  1UYZ A;  4UFJ A;  3H1W A;  4QWN A;  1W6M A;  1JYW A;  5JAX A;  1OVP A;  1R1Z A;  2R04 3;  3HBK A;  4UW4 A;  5JZG A;  4DXZ A;  3CJX A;  4XXA A;  4YVS B;  3AB0 A;  4I0A A;  3LD8 A;  2JE7 A;  5FBJ A;  4R9B A;  2VW0 A;  2D5F A;  1B35 C;  3WZ1 A;  4E9K A;  3V0A B;  1I5Z A;  3W68 A;  1ZZ7 A;  4KNC A;  2LRO A;  2GH8 A;  2Q30 A;  3AZY A;  4BA6 A;  1S0E A;  4GZ9 A;  5E89 A;  5ACA 3;  3NNL A;  4AVC A;  3R0R A;  2YC2 A;  2VAU A;  1K12 A;  3RYR A;  3WT3 A;  2RS5 3;  4QAW A;  3WLU A;  4CU9 A;  2XWB B;  2VXJ A;  4UOJ A;  1PGL 2;  1JZ5 A;  3MIC A;  3DKW A;  2VUL A;  5JSP A;  3C3V A;  2GAL A;  4Q4W 2;  5E1R A;  4YW7 A;  2FCU A;  4FOQ A;  1V0A A;  1POQ A;  1N3Q A;  4HG6 B;  3MPP G;  3VDD A;  3VBO B;  2BNM A;  5FY9 A;  1HXS 2;  1A78 A;  1QJY 3;  3K46 A;  3E5Q A;  2X5I C;  4CPB D;  1YQ2 A;  4JC1 A;  3SC7 X;  3R4U A;  1GNY A;  1SBD A;  1UZV A;  2WT2 A;  4DNY A;  2WLQ A;  3PJY A;  2ZA9 A;  3AK0 A;  4QPY A;  5DAX A;  4DUW A;  2WNU A;  2RR1 2;  4GKX A;  3WF2 A;  1G6N A;  1QQP 1;  4LTA A;  4L2N A;  1ZRF A;  5FZB A;  3AKT A;  3FUQ A;  5DDJ 1;  1R1A 3;  1ND2 A;  3ASI A;  1FNY A;  1DHK B;  1W04 A;  2NMN A;  4BME A;  3AZV A;  3DPR B;  3DYP A;  2VD7 A;  1WLW A;  3I3B A;  1IKQ A;  2DV9 A;  2PA7 A;  4R8H A;  2AYH A;  5A6Z A;  1DLL A;  5T55 A;  1OIZ A;  1O8S A;  1OQD A;  2Y26 A;  3E6C C;  2HWB 2;  4QQH A;  5IFT A;  1XE8 A;  4YW3 A;  1XXN A;  1QOT A;  1ZZ9 A;  3IZO A;  3FHQ A;  5IAT A;  3RFR A;  3WNM A;  2ARA A;  1HV1 A;  1XNK A;  2FMD A;  1DYP A;  2ENR A;  4CPB A;  1D2S A;  1MZF A;  3DUI A;  3OGV A;  3SH3 A;  5IAV A;  2LM3 A;  1TE1 B;  5D1I A;  3HR9 A;  3H1M A;  2D97 A;  3AZZ A;  1KD7 A;  3MYX A;  5LBE A;  1NCR A;  5H9Q A;  5L9V A;  1SLB A;  5CIR A;  3ST7 A;  1H2L A;  2J42 A;  5A32 A;  2QDR A;  2DCZ A;  2Y6K A;  1LOD A;  3MUY 1;  3T0D A;  5LCW L;  4Y4R A;  1W6O B;  3GXU A;  4DXT A;  2RHP A;  4COU A;  3RMX A;  4GWI A;  1OFS A;  4W6Y A;  3TAY A;  3GDB A;  1Z7S 1;  4AEK A;  3O1R A;  1RUJ 2;  1RHI 2;  1MEC 2;  4EN0 A;  1VBA 3;  5AC9 2;  2Y6F A;  2PAE A;  3FLR A;  4PHZ A;  4I0B A;  4EYU A;  1W0P A;  5ABJ A;  3WEZ A;  1VAV A;  1RUG 2;  5FKC A;  1JZ7 A;  2A3Y A;  3MFC A;  2XJS A;  4IV1 A;  4N43 B;  4RR3 C;  1T6G C;  1W05 A;  1J1T A;  2JIJ A;  1VAL A;  4A45 A;  1C1L A;  5HV0 A;  1Q43 A;  2CSG A;  2F4P A;  3OD0 A;  4C90 A;  2WS9 1;  1W0O A;  5FXX A;  3S6P A;  1C8M 1;  3ZR5 A;  3AP6 A;  4FOY A;  5CG8 A;  5IVF A;  2IC1 A;  1BCX A;  1HQN A;  1FPN 1;  1YWK A;  5F3G A;  2A6W A;  4LLO A;  4AI3 A;  2J1S A;  1AYM 3;  5FK7 A;  3T0B A;  5JOY A;  4OUS A;  1E5H A;  2Z4F A;  4FP2 A;  1EAH 2;  2Z5W A;  5K9Y A;  4XAB A;  2KA3 A;  3WNO A;  4Y5Z 0;  4MGI E;  2AEN A;  1VAK A;  2DVD A;  2GP5 A;  4IEV A;  4AR2 A;  2OII A;  5A6X A;  4NHM A;  1A34 A;  5FR3 A;  3ZFE A;  5FKB A;  3ZYG A;  1JYX A;  1NOV A;  2E2X A;  3WUD A;  1J83 A;  3BU7 A;  3ZXD A;  4DXS A;  1S2K A;  1R08 2;  2R0H A;  4CXY A;  1KXG A;  1UW8 A;  1JU3 A;  3OPT A;  1NA1 B;  4YW6 A;  3AKQ A;  2RDR A;  5DUU A;  5CBL A;  4HN0 A;  2A6V A;  2OVU A;  4ERO A;  2FQP A;  2PHT A;  1LOB A;  3WNX A;  2OQ7 A;  4LBK A;  4Q1P A;  3D8C A;  1XC6 A;  3R05 A;  5CFD A;  1OIP A;  1H0B A;  3DN7 A;  3VZL A;  4MET A;  1L7R A;  4CDQ A;  4QT6 A;  4JQT A;  1PGL 1;  4KBB A;  3W59 A;  5C71 A;  3DEC A;  4UWD A;  4Q4V 2;  2DWR A;  5E88 A;  2XBO 2;  4MXV A;  4LE3 A;  5BNO B;  2ADE A;  4Q4W 1;  4GAZ A;  1G9F A;  2WO7 A;  3CZU A;  2VG9 A;  3ZSJ A;  1LHW A;  5GM0 A;  1D0G A;  2VNO A;  3WNK A;  3W5M A;  1IPJ A;  1SDW A;  3III A;  2NYY A;  3SIT A;  2GDF A;  2HEV F;  2WIN B;  2O1Q A;  3TN9 3;  2FDI A;  1U5Y A;  1HXS 1;  3WSO A;  1K5M A;  2WNV A;  2NP0 A;  4LOT A;  2ZGR A;  2ZML A;  2XKP A;  2XJP A;  4BCU A;  1LB2 A;  3DXT A;  1WA4 A;  4QB1 A;  3FLP A;  4NVP A;  1GWL A;  1BK0 A;  4KMQ A;  5KXE A;  2AZ5 A;  2XL9 A;  3LEM A;  1YFU A;  2RR1 1;  3IMN A;  4IE7 A;  4XW3 A;  2DCT A;  3T0A A;  1UY1 A;  4OHX A;  3TEW A;  3QH6 A;  2JEC A;  1F31 A;  2CHH A;  4CXW A;  4NAM A;  1S0B A;  4IGP A;  1ND3 C;  1XE7 A;  3CDZ B;  5E6H A;  5CA6 A;  3EYP A;  2F4L A;  3LSD A;  4FFG A;  2FD8 A;  3ZXL A;  3PTY A;  1H9P A;  2P2K A;  3ZYH A;  5AVA A;  4R9D A;  4XFI A;  3GYD A;  1UOB A;  1LKN A;  1RTV A;  1GKB A;  2D6O X;  1OH3 A;  2ZEW A;  3N9O A;  1IS6 A;  3SHR A;  4AG4 A;  2DUQ A;  4ES9 A;  4UFI A;  4L92 A;  1YRZ A;  2WLP A;  3KWV A;  5C3O A;  3DXU A;  3NNM A;  2B42 B;  3MW4 A;  3POI A;  4WBB A;  5LA0 A;  1TG7 A;  2HWB 1;  5LEJ A;  2VTX A;  1LGC A;  3FMG A;  4DUV A;  2G19 A;  3LEI A;  3ZOI A;  1G9B A;  2WWS A;  4OMD A;  3D6E A;  3PJQ A;  2W39 A;  2H0V A;  3HN3 A;  5EQU A;  3MV1 1;  3VBF C;  1RUO A;  4I3G A;  2J7M A;  2PHU A;  4ASL A;  5FP4 A;  4Z92 B;  3ZFG C;  5CFC C;  1NE4 A;  2OZ6 A;  5FO8 B;  4P00 B;  1Q5O A;  1LU1 A;  1QJU 3;  5GLT A;  5JSO A;  1UYP A;  3K3N A;  2IFR A;  4PT6 A;  4D6R A;  3M7A A;  1MZE A;  1EAH 3;  2JEN A;  3AL6 A;  4P9G A;  2ARX A;  3JQW A;  3T2O A;  4EN7 B;  5K0U B;  3KSC A;  4OZO A;  4CYD A;  1CPM A;  5J98 B;  1OT5 A;  3PNA A;  1PX3 A;  4MXW B;  4A3Z A;  2D5H A;  4CEY B;  1Q8P A;  1RUJ 1;  3ES1 A;  1RHI 1;  1MEC 1;  3KCC A;  4I0W B;  1XRU A;  5AC9 1;  1GQG A;  1QJX 3;  2BFU S;  4QPI B;  2CU5 A;  4RD7 A;  2EID A;  3GJB A;  3POE A;  4BQW A;  5I93 A;  1RUG 1;  2K0G A;  2XKO A;  3KHB A;  5JXG A;  4JV4 A;  3K4A A;  3I2I A;  1NCQ B;  1OXC A;  3THC A;  4YWA A;  4D7T A;  1HRI 2;  1RXG A;  2E6V A;  2D4Q A;  2IUW A;  1MVE A;  5FZO B;  4AQS A;  1GP4 A;  1TQ5 A;  3HJR A;  4IE4 A;  3VD9 A;  4WM7 C;  4PCR A;  1ZM1 A;  4M0H A;  4XBQ A;  2JX9 A;  3PUQ A;  4FPF A;  5DPN A;  1OD3 A;  2BPA 2;  4N7U A;  5F9T A;  1B35 B;  2L9L A;  5FYH A;  2ZAB A;  5FZG A;  3MIF A;  3JB8 A;  1O59 A;  2FZ1 A;  4XEZ A;  4EN6 B;  2C24 A;  5EYX A;  2XQX A;  5A3O A;  2W46 A;  2WZR 3;  5FYZ A;  5FUI A;  1LHU A;  1KRI A;  2V4A A;  5IVJ A;  1SLL A;  3I3Q A;  2BOJ A;  4Y1U A;  1US2 A;  3WHU A;  3S5Q A;  1YFY A;  4QQL A;  4FAG A;  2C0Z A;  3CMG A;  2PMW B;  3RWK X;  1R08 1;  2E9Q A;  1AR9 3;  1X82 A;  3HT2 A;  3NJY A;  4K1Z A;  3C7O A;  2UY8 A;  4HAN A;  1LAJ A;  4DZG A;  3KVB A;  3N7K A;  2WAA A;  4J1W A;  3ROU A;  4CIZ A;  4YYO A;  1H1M A;  4CDU B;  2GC3 A;  2JD9 A;  2X5I B;  5C70 A;  2VMI A;  5D8A A;  2X05 A;  3E5X A;  5FZM A;  4C1X A;  1JYN A;  3SCG A;  3ILN A;  2VTF A;  3LEG A;  1AX0 A;  1MAC A;  1MS5 A;  4Y20 B;  3SKV A;  3OBA A;  1A6C A;  5JMO A;  5BY5 A;  1HN1 A;  1PHM A;  5IT6 A;  2E63 A;  1VBC 3;  4Q4V 1;  2XBO 1;  4PF1 A;  4JHZ A;  4S2H A;  2QVS B;  5EYY A;  5M0T A;  2IWG B;  1EY2 A;  2W52 A;  1XND A;  3IDE A;  4LBQ B;  2Y38 A;  1NUK A;  3L2Y A;  3ZKU A;  5FO9 B;  3AMH A;  2ID4 A;  5FZ7 A;  2WNU C;  4K7J A;  4LIU A;  4MSV A;  2Y64 A;  1NLS A;  2C4X A;  5I8Y A;  1PO1 2;  1T2X A;  2VBD A;  4Y4Y A;  1WKY A;  3OY8 B;  5F32 A;  1JUI A;  2GC2 A;  1ND2 C;  4XQW A;  2YY1 A;  3F95 A;  4CCN A;  3MZH A;  3O1S A;  1QIQ A;  1DCS A;  4IGQ A;  4AI8 A;  3I2H A;  3WUC A;  5FYT A;  5B4N A;  1NE6 A;  4GUL A;  1F2N A;  3X29 B;  2VE1 A;  4GWJ A;  4YZ2 A;  2PQQ A;  4FPJ A;  1AR6 2;  3MDP A;  3WP3 A;  1W8U A;  2MEV 2;  1V00 A;  3LAG A;  3TRS B;  4XUR A;  4RGG A;  2ZGO A;  5C4W A;  1IS5 A;  4QXH A;  1JUH A;  1DQ0 A;  3ZXE A;  4KU7 A;  4HT1 T;  4CRQ A;  1HB1 A;  4R52 A;  2XLG A;  3T1M A;  1UNB A;  1YI9 A;  2HWD 2;  4MAD A;  1S1A A;  1U12 A;  5FZ1 A;  5FZK A;  4QU2 A;  2ZGK A;  3JQX A;  3NRU A;  4IQP A;  4A6O A;  5C9A B;  4CTE A;  3MPB A;  4LBQ D;  3WVJ A;  3P7Z A;  1VJ2 A;  1RGS A;  3C2U A;  4LBM A;  3E5U A;  1IGO A;  3PVE A;  1SLC A;  3ZXG A;  1NCR C;  1A3K A;  2GP3 A;  1E5S A;  2I74 A;  1W6P A;  2VQ0 A;  2V5D A;  2W68 A;  5T50 A;  4FQZ A;  4BMB A;  4XJA A;  3EMR A;  2QTW B;  4XAC A;  1R5L A;  3I2D A;  3VD5 A;  1YQ5 A;  4P14 A;  2BW8 A;  3IN9 A;  1VBB 2;  4AED B;  3NKT A;  4BH9 A;  1UPS A;  4RR3 B;  4MO3 M;  5A3M A;  1J84 A;  1YIF A;  4DMI A;  5C3R A;  1PZ8 A;  1EPW A;  2FZ2 A;  2XPJ A;  1PIV 2;  2BJS A;  2GH2 A;  1PO2 2;  3JCI A;  5ABJ C;  1BBT 2;  1VBE 3;  3SKJ E;  2VXR A;  3WXP A;  4CP2 A;  3ZYF A;  3OUJ A;  4QPG A;  4IV1 C;  4QKD A;  2WRA A;  3THT A;  2JDM A;  1F15 A;  2XML A;  3POY A;  4MH0 E;  4DY3 A;  4MGT A;  5JLV A;  2HEY F;  2WYF A;  1YXW A;  1HRI 1;  1LRH A;  1JHJ A;  2BUK A;  1QJF A;  3H42 B;  2D3P A;  1H6X A;  1COV 3;  4FPE A;  1CIW A;  5LA2 A;  1O5U A;  5FPZ A;  3DPR C;  2ZHM A;  4YM3 A;  3LPF A;  1DQ4 A;  1NLR A;  2HJI A;  4I02 A;  4FFH A;  2YU2 A;  4UAP A;  2VMH A;  4HXC A;  3D5O A;  3N7M A;  4RL7 A;  4AGG A;  2VUC A;  4RQP B;  4DQA A;  2BZD A;  2ARE A;  2NN8 A;  1YO8 A;  4XFG A;  4EE2 A;  2E7A A;  4QXC A;  1DZQ A;  3CJI A;  1PO1 3;  4Y22 A;  1AR8 3;  3E6B A;  4P9L A;  3VBS A;  3ZLI A;  2PHX A;  1DGW A;  1Y43 B;  3H0O A;  3HN1 A;  4FPO B;  1GWM A;  4CE8 A;  1G9A A;  4YG3 A;  4M4P A;  1ALY A;  3D0S A;  2GNB A;  3AKR A;  2VUD A;  2OKX A;  2XHN A;  4LBJ A;  5KHH A;  5JOW A;  4F8A A;  3I59 A;  1S0J A;  5FPA A;  2ZKL A;  4A44 A;  5KC5 A;  3LPG A;  2VW1 A;  3S7E A;  5CKM A;  2VOX A;  2ARB A;  2JKX A;  2MEV 3;  2BRT A;  1V6L A;  1H30 A;  1RUI 2;  1RUE 2;  2J1V A;  1AL2 3;  1ENQ A;  3HQR A;  5K4L A;  4LMF A;  1R09 3;  4GJY A;  1JMU B;  4R4Z A;  5A7O A;  1GZW A;  3CLP A;  4AEJ A;  1HB3 A;  1RVF 3;  2ZGM A;  1JOB A;  1VBD 1;  1S55 A;  4AVB A;  3UNP A;  3O1P A;  3OYW A;  2Q8E A;  1A8D A;  1W8O A;  4JTN A;  5IVE A;  2VOK A;  3B9I A;  4WVM B;  1QXJ A;  5T5O A;  5C6C A;  5LEK A;  1HLC A;  1S0D A;  1ND3 B;  4LIV A;  4BQY A;  4OHZ A;  4AL9 A;  4HVQ A;  4JKL A;  4E2G A;  1SPP B;  5I8T A;  1GOG A;  4PDW A;  1SFY A;  4QHO A;  4S2F A;  1QF3 A;  4YLZ A;  1O5L A;  5HI0 A;  4CP0 A;  1PX4 A;  1NYW A;  4KWK A;  4LA2 A;  2OPW A;  1RMU 2;  3VBH A;  4MGY E;  3ZN5 A;  4JGY A;  1GQH A;  5F2S A;  1XQN A;  3VGI A;  4CVU A;  1ZVF A;  1CAX B;  4A4A A;  5FOB B;  5IK7 A;  1E5R A;  5A7W B;  4LPL A;  4EZH A;  5BNN B;  3I2G A;  2EAA A;  4FPC A;  5JI9 A;  5JR2 A;  3ZSK A;  2Y34 A;  5LK5 A;  2ZGS A;  3VBF B;  1WWY A;  2R06 3;  1AR6 1;  4ONU A;  1STM A;  1W99 A;  4B1M A;  2AH2 A;  3AXE A;  4B4P A;  1RUC 2;  1DFQ A;  5F1R A;  3U1X A;  4NIA A;  1FOD 2;  1H4G A;  3ZFG B;  3S7I A;  2D3S A;  5CFC B;  4IGO A;  1AUA A;  5KWR A;  3DF0 A;  2DU1 A;  2C5D A;  5FV3 A;  4CP9 B;  5FYY A;  1OOP A;  5DG2 A;  5FY7 A;  1KFU L;  4NR1 A;  4IET A;  2HWD 1;  1AZD A;  5EJZ B;  1JHN A;  1Y9M A;  1Y9G A;  2JE8 A;  4D7S A;  4EZ4 A;  1DF0 A;  1C28 A;  2W1W A;  2CWS A;  4ISR A;  5HBA A;  4Y26 A;  1JZ6 A;  1NA1 C;  3ZFF B;  1OPM A;  4TXW A;  1V9U 3;  1LNS A;  1OD5 A;  2HYX A;  5LK7 B;  3BTY A;  3DCQ A;  5I0T A;  1VB4 A;  2E7Q A;  1PMI A;  1RUD 2;  4CDX A;  2Y60 A;  2HWF 3;  2VNV A;  3M70 A;  3MIG A;  2XVL A;  2R04 2;  1VLN A;  1VBB 1;  2G4I A;  4JDN A;  1H8T A;  3I7D A;  1W03 A;  2Y8K A;  2TNF A;  4YM1 A;  3WDY A;  3NNG A;  2YBP A;  5BNO C;  1PIV 1;  2JB4 A;  5A1F A;  1ZBE 3;  1PK6 B;  1PO2 1;  5FAX A;  1X33 A;  1BBT 1;  2ORZ A;  3RNS A;  1TEI A;  1UQX A;  1MQT A;  3H1Y A;  4JAA A;  5ACA 2;  3FHI B;  3GCX A;  4U36 A;  3TNQ A;  2RS5 2;  4B4Q A;  2E26 A;  3OB8 A;  5AFE A;  4GA9 A;  4NN0 A;  5JUV A;  1W6M B;  1KIT A;  4PIZ A;  3HD8 B;  3R4D B;  1IHM A;  5ISL A;  4X8P A;  5JZG B;  1EYB A;  2RE9 A;  1F5J A;  3DGT A;  3LSE A;  4JZR A;  5B4X A;  1JZ3 A;  1MS3 A;  1W9F A;  1C5H A;  4NO4 A;  2V73 A;  4P9Y A;  1AYN 3;  2VQA A;  2PYT A;  3AFK A;  4C91 A;  1IPK A;  3JZV A;  3GF6 A;  3KQR A;  3THD A;  3BGA A;  1QJY 2;  5BXX A;  2ZX1 A;  2DVA A;  2WBK A;  2OS2 A;  3UYJ A;  4YVW A;  1MR5 A;  1X8E A;  2XGX A;  3GBG A;  3OJB A;  1RUF 3;  2DVG A;  4NHK A;  2QQP A;  1CWP A;  3KCY A;  1OUR A;  1W0N A;  2W94 A;  3INA A;  1LJ7 A;  3MGU A;  4OQ9 A;  2XUM A;  4BLJ A;  2IVI B;  4WM8 A;  4XAA A;  5FMO L;  2HKX A;  1G86 A;  3PIJ A;  3Q9O A;  2BYV E;  3POB A;  4FCA A;  1R1A 2;  5DXD A;  3VZM A;  3ZXK A;  4E4S A;  4AYU A;  2VNG A;  1RMU 3;  3ZSM A;  3KT7 A;  1WW5 A;  3AKS A;  1YJL A;  3O0V A;  2YRO A;  2VQT A;  3FFQ A;  5GLU A;  3R6S A;  1QMJ A;  5CAD A;  5C8C A;  4GMP 0;  2YDE A;  2QCS B;  2Y0O A;  3K51 A;  4E27 A;  1ASJ 3;  1QNY A;  5D8A C;  1D7P M;  3CU7 A;  5DZE A;  5FXV A;  2I07 B;  2WZP P;  4OMK A;  5IJR A;  1AXZ A;  5F5A A;  4FPG A;  4GH4 A;  2I45 A;  1RUI 1;  1RUE 1;  3QBQ A;  2WNU B;  1NZC A;  5DUW A;  3T4H B;  5K0U C;  4CCJ A;  1UIJ A;  2PAM A;  1QU0 A;  2NZ9 A;  5JMC A;  2Y0I A;  3RZG A;  2BOI A;  5FZF A;  2WQZ C;  4AK3 A;  1ND2 B;  5DUX A;  1YJK A;  2CY6 A;  2J22 A;  3VN4 A;  1MS8 A;  3O7O A;  3WOG A;  3ZXJ A;  1PMJ X;  1TZO A;  3SCH A;  4L9B A;  5J3U A;  2A7A A;  5SV8 A;  4XDO A;  2BGC A;  3A22 A;  4ZS2 A;  1CON A;  2ZHL A;  5FK8 A;  3WW4 A;  3AP9 A;  4XUP A;  2VOV A;  3WW1 A;  3MLK A;  2W5F A;  4AFD A;  1O7F A;  2BER A;  4IXL A;  4Q4Y 3;  2W3J A;  4AVT A;  3AMQ A;  4QHZ A;  2ZEY A;  5FY8 A;  5FY0 A;  4D8M A;  1I5P A;  1KFX L;  2WL1 A;  2VZR A;  3EJK A;  1VBA 2;  4D6Q A;  3ILF A;  2VBP A;  4YZ3 A;  1OUX A;  2GNT A;  3KM5 A;  3FL7 A;  3M2M A;  1ZRE A;  3MF9 A;  4B8E A;  1QGL A;  3L2H A;  1G9D A;  2D40 A;  1VIW B;  4HN1 A;  1NCR B;  3ACH A;  1CJP A;  5EJ3 A;  4GKY A;  3VBR A;  4EN9 B;  2WA4 A;  5A32 B;  1LHN A;  1RUC 1;  2VO5 A;  1DDL A;  4UF0 B;  1FOD 1;  2A1X A;  5IVV A;  4J7P A;  2R07 1;  2P37 A;  2PLV 3;  3ACI A;  2BNO A;  3OGS A;  1KDK A;  3PU8 A;  1ULD A;  5BNQ A;  5KC6 A;  1HQL A;  1DQ1 A;  3U14 A;  4ZHN A;  3GBW A;  5GJ6 A;  1WCQ A;  2GU9 A;  2QBX A;  3BTA A;  4MYE A;  4XQ4 A;  1AL0 G;  3RZJ A;  2EXH A;  3NJV A;  3OSD A;  2ZGN A;  3P3N A;  3WR0 A;  3PUA A;  3ACL A;  3HNM A;  4JQR A;  1S4C A;  1AYM 2;  4B29 A;  2JDH A;  1RC6 A;  1O3T A;  5ABJ B;  4QX1 A;  1OA4 A;  2JDP A;  3OUI A;  4QQP A;  1H2N A;  1Y4W A;  3V64 A;  3MIB A;  3NJZ A;  4CDU C;  1RUD 1;  1JOJ A;  2C9K A;  4IV1 B;  1LOC A;  4A7K A;  3LF7 A;  4IEX A;  4EWE A;  2R04 1;  4OMC A;  5EPA A;  2WO1 A;  2P3Y A;  1HJF A;  1YQC A;  5FRA A;  1XYN A;  4KL1 A;  3VHP A;  2XWJ B;  3HOB A;  4XC9 A;  2VVF A;  1Z0H A;  3J7N A;  4XDP A;  2PHW A;  2QQM A;  4QPG C;  1WD3 A;  2B9V A;  2W47 A;  4QXB A;  1UZ0 A;  3WF4 A;  2RS1 3;  2YPD A;  4R4X A;  4ATF A;  1LOG A;  1M06 G;  3KS7 A;  1DZR A;  4K9S A;  4FPK A;  3RVH A;  5ACA 1;  5G05 L;  2PN5 A;  1BQP A;  2RS5 1;  4TZD A;  4HPK A;  4K20 A;  4ASK A;  1UZZ A;  1W06 A;  3SEE A;  3ZFE B;  4OHV A;  3AC0 A;  3T4V A;  2DU0 A;  4DEQ A;  3ETQ A;  2AC1 A;  2R32 A;  5JOX A;  1JBC A;  4UBH A;  3WCS A;  1CES A;  1ZRC A;  5EP9 A;  2YV8 A;  1ZA7 A;  3HPN A;  4EQV A;  4ZU7 A;  2RDN A;  1W39 A;  2P17 A;  3B02 A;  3MLL A;  4QM8 A;  3TN9 2;  1XU2 A;  2X29 A;  4O7X A;  1QJY 1;  1I9R A;  1PVX A;  3HVD A;  4NWV A;  4AQT A;  4RHV 3;  3I4I A;  3Q8A A;  5L36 A;  1QDO A;  2OT7 A;  3MW3 A;  4AQ2 A;  1D0H A;  1QXR A;  4LO4 B;  3CJI C;  3VBS C;  3PHM A;  2RM2 3;  3IPV A;  4V2V A;  4DOU A;  2WFF 3;  2QQK A;  2WC2 A;  4XQD A;  3PL0 A;  2F6B A;  3N7J A;  3POG A;  2BEO A;  3T09 A;  5C9A C;  5C3S A;  3J8F 3;  5FZ0 A;  3UJQ A;  3VKF C;  1R1A 1;  2DTY A;  4Y1Z A;  2A5Z A;  5GZE A;  1ULO A;  3BIE A;  5DAB A;  4QD2 A;  1VE0 A;  2FDG A;  3WF3 A;  5L7O A;  4IEY A;  2WNV B;  5GLV A;  1GFF 2;  4K6B A;  3GCW A;  3ZYP A;  3S0M A;  4XIK A;  2VMD A;  1OFN A;  4WV8 A;  3VBU A;  4AED C;  5I0R A;  4OCT A;  3V65 A;  2WO2 A;  5FPV A;  3VHN A;  2GC0 A;  1UXZ A;  3J26 N;  5FZ9 A;  3Q8C A;  4QMA A;  4JGZ A;  4BQX A;  3A4U A;  1OPO A;  4UW3 A;  2WWJ A;  2X10 A;  2R6Q A;  5EV7 A;  3K2O A;  4CU6 A;  1JOP A;  2R49 A;  4QU1 A;  2JKB A;  1CAV A;  2DCY A;  1WW4 A;  3R4S A;  4NRQ A;  2PTM A;  3UJO A;  2CGO A;  2JE9 A;  3KHC A;  3OEB A;  5FZ4 A;  3RYK A;  1EV1 3;  2JDA A;  4OI4 A;  1QJU 2;  3T2T A;  4D7Y A;  1OBN A;  4DY5 A;  4MGQ A;  4JGY C;  3O1O A;  3PVB B;  2V4V A;  2GAU A;  4DIN B;  4GMP 3;  1YYN A;  4QKN A;  4NII A;  4H55 A;  3MUZ 1;  3OGJ A;  2JXA A;  1H2K A;  2SBA A;  1X36 A;  2QQU A;  3OGR A;  4OLL A;  4BM8 A;  2CWM A;  3G6J B;  5E8A A;  4LT5 A;  3I2J A;  4P9J A;  1VBA 1;  2D6L X;  3MIH A;  1QJX 2;  4D69 A;  1GZ9 A;  2XG3 A;  4QX7 A;  4MHR A;  2DVB A;  4XBL A;  3POJ A;  1APN A;  2YUE A;  2VZV A;  2VZ1 A;  2VM9 A;  2ZGT A;  3KV4 A;  4FPL A;  3THP A;  2XQR A;  3I3M A;  4MOA A;  1JTZ X;  3NV2 A;  3VZJ A;  3T30 A;  2GMM A;  4RQP C;  4OZX A;  3BYW A;  1PMH X;  1TNR A;  2D7F A;  3VL8 A;  4BIF A;  4MGS A;  4FO9 A;  3FHA A;  3ZKY A;  2XOM A;  2WAO A;  4ZU4 A;  2JG9 A;  2YYO A;  2FBE A;  1NAE A;  5JWP A;  3LCP A;  2HBU A;  1O4T A;  1KQR A;  4CDX C;  3FBY A;  1AYM 1;  1QHD A;  3WP4 A;  5FPU A;  4L99 A;  4NOT A;  2Q4S A;  3WD5 A;  1YLL A;  2JD4 A;  1PGW 2;  2WZR 2;  1MS9 A;  1FV2 A;  2YGL A;  1H8T C;  4SLI A;  2E33 A;  4LO7 A;  1V6J A;  3DKQ A;  2YFZ A;  3CF6 E;  5FQ0 B;  1UXX X;  4PI2 A;  4E8C A;  1K42 A;  1AJK A;  3JXS A;  2P6C A;  4NHL A;  4I2O A;  2ZMK A;  3AYA A;  4TSV A;  2RS3 2;  1LU2 A;  4TN7 A;  5F8P A;  4XOG A;  3ES4 A;  1JU4 A;  1AR9 2;  1DIW A;  3AYE A;  2QKD A;  5A7N A;  4AFB A;  4CU8 A;  3KB5 A;  1W6O A;  4JX0 A;  2HBT A;  4UXA A;  3SNM A;  2VZS A;  3TBD A;  2PQS A;  4Y5S A;  1LOA A;  2G9F A;  5CNA A;  4XPV A;  4XVH A;  4AFC A;  1SHW B;  3OUH A;  2RG4 A;  4BYY A;  5JXH A;  1PNG A;  2W9X A;  2D6K A;  1GNZ A;  2RV9 A;  2Y6J A;  4LHN A;  4ZY9 A;  1AUY A;  4N9I A;  5DUV A;  4TWT A;  5FPL A;  4Z8B A;  4GD4 A;  3IIA A;  5A1L A;  4BQ4 A;  4BDV B;  1BHG A;  1VBC 2;  1WGP A;  2JG8 A;  4L8Q A;  1HDK A;  3H3L A;  5BNN C;  1ZZ6 A;  2NLR A;  4S2G A;  1LR5 A;  4NIH A;  1UL9 A;  4NE9 A;  5FTT C;  2DBN A;  2XJV A;  3TN9 1;  2UWC A;  3Q8E A;  1WMD A;  3WNL A;  4NMI A;  4V2W A;  3ZN4 A;  1S0C A;  1Q8O A;  1LEM A;  3D4K A;  3CIH A;  4LXL A;  3NQH A;  3ZR6 A;  1HV0 A;  5KXB A;  1AXK A;  1D4V B;  2JDZ A;  2JB8 A;  5D8A B;  1DGW X;  2B7Y A;  2ZAC A;  2ZGU A;  4QPW A;  2WKK A;  5IUQ A;  5LRR A;  3K4Z A;  3ALQ A;  3NJX A;  5F5I A;  3B9C A;  4W6W A;  1W6N A;  1OUS A;  2HWC 3;  3C8X A;  3FLT A;  3VKL A;  3GZA A;  3ZFF C;  2JEM A;  1JXN A;  4ZXK A;  5BPX A;  3SMH A;  1I1E A;  4K8F A;  4XFH A;  4GH4 C;  1SCS A;  3RSJ A;  5LBF A;  3RZZ A;  3UES A;  3B3Q E;  4AVV A;  2BQP A;  5DMY A;  2OX0 A;  3ZDV A;  4BJ0 A;  4D0Q A;  1U5Z A;  3BOD A;  4YFW A;  5FFO C;  1UAI A;  3LA3 A;  4BXS V;  1W2U A;  4LHS A;  2VPV A;  4IE6 A;  3WIN E;  4XBN A;  1PK6 C;  3ILR A;  4IES A;  2RDS A;  2WT0 A;  2DCJ A;  3BIW E;  3RZM A;  2AGS A;  3IKW A;  3ZXA C;  3AM2 A;  1IG3 A;  4XFA A;  4CU7 A;  1V6N A;  4QQO A;  3RI9 A;  5C4W B;  3KF3 A;  1QJU 1;  4M3C E;  2VCB A;  4NRM A;  4A42 A;  1DGR A;  1TME 3;  2BGP A;  2LUW A;  2XJQ A;  5KR7 A;  3QAC A;  1ZNP A;  1QJE A;  1EAH 1;  5EWS A;  2Q8O A;  5JZG C;  5FZ8 A;  1RL3 A;  1NG0 A;  4FXG B;  2JIG A;  4Q4X 3;  2P3J A;  1K45 A;  1BZW A;  4ET7 A;  3W67 A;  3Q8B A;  2BFU L;  1UYY A;  1NXD 1;  1VBE 2;  3D82 A;  5A6Q A;  1ZX5 A;  1MVQ A;  2RS3 3;  5A3T A;  1W8Z A;  5KXC A;  1W8W A;  1RJ8 A;  4LR4 A;  4D6S A;  1W6P B;  1QJX 1;  4QX2 A;  4M01 A;  5KBF A;  1ULE A;  3S30 A;  4YW4 A;  1GOH A;  5G04 L;  4AFM A;  5GAL A;  1DGL A;  2XJU A;  1JS9 A;  2B46 X;  1QH6 A;  4XE9 A;  5A3P A;  4CP1 A;  3JD7 3;  4IE0 A;  1HX6 A;  4QM9 A;  1YHF A;  4CCK A;  1N47 A;  1COV 2;  1OA3 A;  1UKR A;  4ORF A;  4RFT 0;  1KJL A;  2WN3 A;  5A33 A;  5T3N A;  2VEC A;  1H1I A;  4WVW A;  3IMM A;  4AVS A;  4G9S B;  3GZT B;  3VDD C;  2B39 A;  4FOW A;  2XDV A;  5FZC A;  4X6R B;  3UKN A;  1GV9 A;  2P3I A;  4QPG B;  2W2I A;  4YW5 A;  3LA2 A;  4A3X A;  3B7N A;  3MW2 A;  1XNT A;  5C3P A;  5FY4 A;  2AUY A;  2VC9 A;  3MV0 1;  1CX1 A;  2TBV A;  1PGW 1;  1P8J A;  2WZR 1;  4XIO A;  1D2Q A;  2FCV A;  3NMB A;  4ZZ5 A;  2RJL A;  1IZ3 A;  2VJX A;  3RS6 A;  4NPL A;  4EWA A;  1AR8 2;  1OLM E;  1SLA A;  2WZ8 A;  4AOC A;  2CDO A;  2DTW A;  1FAY A;  3RPQ A;  5LY2 A;  1AR9 1;  4YFZ A;  1JYT A;  4I30 A;  4Z2A A;  1XYP A;  5BNP A;  3SEP A;  1H2M A;  2ZPX A;  3J4U H;  4S2D A;  5DQ0 A;  5FO7 B;  1GZC A;  3H3Z A;  1FNZ A;  4OQ8 A;  1X7N A;  5FLJ A;  4JKM A;  1GU3 A;  1AL2 2;  3QD6 A;  3VZN A;  5BV6 A;  1R09 2;  5IAX A;  5GLW A;  4DRR A;  3FWE A;  1RVF 2;  3CJI B;  3VBS B;  5FPX A;  4Y22 B;  5ERL A;  2J1A A;  5FY5 A;  3I2O A;  3HNY M;  5B2G B;  4KQ7 A;  1VBC 1;  2J1U A;  1POV 0;  3TB0 A;  1FMD 3;  1ZBA 2;  2NMO A;  4IV3 A;  4FAH A;  3RQ0 A;  3WG3 A;  1WCD J;  5C5U A;  1W6Q A;  5IVC A;  3V56 A;  1OF4 A;  3VD4 A;  3KQ4 B;  4CUB A;  1NT0 A;  2ZJC A;  4HMZ A;  5IWF A;  1EUU A;  4GB3 3;  4CUC A;  3MBW A;  1XPW A;  4Y24 A;  2UYA A;  3EQE A;  1W9Y A;  5JPM B;  1B35 A;  3P6B A;  1XNC A;  2HEW F;  1CAW A;  4UFK A;  4A6S A;  3ZYI B;  1SZB A;  1G9C A;  3O1V A;  1OKQ A;  4IE5 A;  1VB2 A;  3M8L A;  5DAW A;  3OYW B;  5LA9 A;  4AFA A;  5L7O C;  1PZ7 A;  1YQ6 A;  4M4R A;  1D4M 3;  3ELN A;  2IXI A;  5GZF A;  1WME A;  2Z42 A;  2R06 2;  1S0I A;  3SQO A;  1SFN A;  1J59 A;  3VBU C;  3O14 A;  3BUC A;  1BEV 3;  1YFW A;  4K8R B;  4RGK A;  1OHF A;  4LUL A;  1L7L A;  4KBZ A;  3PTR B;  4J6G A;  1JW6 A;  3GBF A;  5GKA C;  4P9W A;  3VBH B;  4KWL A;  4JGY B;  2LRP A;  2PEL A;  2R1B A;  2WA3 A;  1VR3 A;  2FDJ A;  2I2S A;  1CD3 G;  1S2E A;  1UZW A;  1DYK A;  2EA7 A;  5DN2 A;  3WF0 A;  2ZXQ A;  5JVV A;  1O6U A;  5JOZ A;  1O3S A;  4NPM A;  3AVS A;  1LES A;  1V9U 2;  2Q8C A;  1LHO A;  1GZT A;  2JWP A;  4CCO A;  3NAP A;  2C26 A;  2JJ6 A;  3O1M A;  2Y6G A;  2HWF 2;  5DZF A;  4QXK A;  2H6B A;  2R16 A;  4D94 A;  1F4A A;  1W2A X;  1HB4 A;  2G1M A;  5LA1 A;  1FI2 A;  3C7H A;  2B4K A;  4KI5 M;  3ZFE C;  1UYX A;  5CKQ A;  1JH5 A;  4FP3 A;  4QHB A;  4FQ4 A;  4DUX A;  1W8H A;  3W9A A;  3IB3 A;  3RI8 A;  3FZ3 A;  3WDT A;  1GNH A;  2D98 A;  5FBZ A;  1ZBE 2;  3ZYR A;  4YGC A;  1VBE 1;  1OLR A;  2PXJ A;  4OUL A;  2X09 A;  3AMP A;  2GN3 A;  2QQV A;  4CDX B;  4Z2W A;  3CO2 A;  1V6I A;  4NJ4 A;  4BIS A;  5GLZ A;  4AHW A;  4J7Q A;  2CGP A;  4H7L A;  1V70 A;  4X6Q B;  3AYD A;  4AI9 A;  5CFD C;  2D93 A;  1IS3 A;  2IXL A;  3T1L A;  4BIO A;  5CB7 A;  4XCB A;  1H8T B;  3URF A;  1OF3 A;  1CAU A;  1R64 A;  2JG9 C;  3OBT A;  4HKL A;  1COV 1;  4CA9 A;  1WCS A;  5FZL A;  5C33 A;  1L7Q A;  1H6Y A;  1GSL A;  2VZQ A;  3HQU A;  1AYN 2;  3ORJ A;  1DLC A;  5I0S A;  4ISQ A;  5HV4 A;  3NNF A;  3PU3 A;  3GHM A;  1UMZ A;  4BQ2 A;  1MQT B;  4CSW A;  3NV3 A;  3GJA A;  3K48 A;  3W21 A;  2DF7 A;  1XE0 A;  1ZBA 3;  2B5H A;  1K5M C;  2GSY A;  2WNV C;  4AZZ A;  3BTX A;  1RUF 2;  2K46 A;  3M3Q A;  4XF3 A;  3I3E A;  4F83 A;  4LKF A;  2ZCW A;  1RIN A;  1GP6 A;  2C6S A;  1CPN A;  2W0X A;  3OPW A;  1AF9 A;  3FJS A;  1UU4 A;  1VP6 A;  4LBO A;  4P5H A;  4XJZ A;  2D6P A;  3BB6 A;  5FYI A;  3B94 A;  1PO1 1;  1AR8 1;  2NPI A;  2VBB A;  1UOF A;  1IS4 A;  2D6N A;  1GQP A;  2HWE 3;  1GAN A;  1U5X A;  2OZJ A;  4MHU A;  1FV3 A;  4E2Q A;  4KH9 A;  1CIY A;  4XJW A;  4RGA A;  3I2F A;  3W5N A;  1RED A;  4RR3 A;  3ZN6 A;  1ASJ 2;  1YEW A;  3IT8 A;  3JU9 A;  3RZH A;  2XLF A;  4AWD A;  2MEV 1;  3NWK A;  5F37 A;  3JBG 3;  1AL2 1;  4Q8K A;  1PGS A;  2R0F A;  1R09 1;  4WM8 B;  2JG8 C;  2W08 A;  5JR7 B;  3USS A;  1W3V A;  2CNA A;  1W8F A;  2ILM A;  4AI1 A;  1RVF 1;  1IPS A;  4O9G A;  2NM1 A;  4LQR A;  1UCX A;  2PFW A;  1W9S A;  3FFZ A;  3PLQ A;  4CUA A;  1G7Y A;  2JDY A;  3QLQ A;  5ANQ A;  4LKE A;  2CTV A;  4I01 A;  2QDN A;  2VCM A;  4UFM A;  5FUN A;  4NPR A;  3H8O A;  1LED A;  2YXS A;  3B00 A;  4QGL A;  5FOJ B;  2UY9 A;  1U0A A;  4GH4 B;  4XHX A;  2A6Y A;  3F2Z A;  2RMU 3;  1MZ6 A;  4YM0 A;  3BKZ A;  4Q4Y 2;  3PUH A;  2AEZ A;  4IEO A;  4XZU G;  2A3W A;  4H3W A;  4P5Y A;  3O0X A;  2DDU A;  1QXP A;  4KG8 A;  4O61 A;  5D21 A;  3P5B A;  2J1T A;  1WD4 A;  3KMH A;  4HKW A;  5FUP A;  3TEY A;  4JTO A;  4UFH A;  2ZX4 A;  3ZO0 B;  2R06 1;  5KHI A;  5C3Q A;  2ET1 A;  1E57 A;  4ZU5 A;  4C1W A;  4ZZ8 A;  3N9M A;  4R9C A;  5L9B A;  4AI0 A;  3LDK A;  1POV 3;  2FDH A;  3WG4 A;  5CZK A;  3VD3 A;  2CGN A;  2PLV 2;  2AR6 A;  4YW2 A;  5GZD A;  4ITC A;  2XVG A;  3E1F 1;  4QX0 A;  5CKN A;  3SCF A;  3TNP B;  3USU A;  1MZ5 A;  4PLO A;  4W4Z A;  2WUH A;  3AZX A;  4PF5 A;  3A21 A;  4XHB A;  4A2U A;  2OA2 A;  4AVA A;  1UY4 A;  1F35 A;  4BQ3 A;  1TMF 3;  2DFB A;  5A3U A;  4KU8 A;  1IG0 A;  4B1L A;  3V0B A;  3H7J A;  1W90 A;  5IYY A;  1V9U 1;  1DYO A;  1YC6 1;  5FZD A;  4JCK A;  5FLI A;  2PAK A;  2XB6 C;  4XF0 A;  3ZXF A;  4N8M A;  2HWF 1;  1WCU A;  2P1B A;  2UWA A;  1RUH 3;  3CHX A;  3NST A;  4NIG A;  4AW7 A;  2VY0 A;  2P34 A;  4RS5 A;  1QY4 A;  3AVR A;  2ZEZ A;  2YMZ A;  4L97 A;  4AHX A;  1MS1 A;  2NQY A;  1Q3E A;  4IER A;  3VUO A;  2ZX0 A;  3GM8 A;  1PVC 3;  4M3C A;  2ZAA A;  5FZA A;  1LGN A;  1ZBE 1;  1H4H A;  5CEH A;  1WCK A;  1BVV A;  1QH7 A;  4WZC A;  1HRV 3;  1AR7 3;  2RS1 2;  5I8S A;  3PUR A;  4PBO A;  3KGZ A;  4BLI A;  1W9T A;  1HJG A;  5BUV A;  5T5L A;  3VDD B;  1KS4 A;  2K2S A;  2W92 A;  1UD1 A;  5FLH A;  4BZ4 A;  2B9U A;  2FHR A;  2ZMN A;  1VMF A;  4H14 A;  1DP0 A;  2B8M A;  4M00 A;  1T6B X;  3AZW A;  5DAP A;  4P9X A;  3CEW A;  4GXL A;  3VBF A;  1ZRD A;  5I0U A;  1F5F A;  2ZTN A;  5A80 A;  3OGG A;  2VMF A;  3ZFG A;  5FDB A;  1AVB A;  5FWE A;  5KHG A;  1KDM A;  1Q8V A;  2V5Y A;  2IXC A;  1KEX A;  4BQ5 A;  1AYN 1;  5KXD A;  5IK8 A;  3E97 A;  3LZZ A;  1W28 A;  3RJ2 X;  5FXZ A;  1ULC A;  1FAT A;  4TLF A;  4BWO A;  4CDW A;  2VQU A;  4FSJ A;  4RHV 2;  1HIX A;  4P02 B;  5LY1 A;  5HXV A;  1ZRR A;  3RDI A;  2WQ8 A;  5J09 A;  1RUF 1;  1GOF A;  3H50 A;  3UK9 A;  3O5S A;  4HPK B;  4CUG A;  5JXJ A;  4L11 A;  2RM2 2;  4QDS A;  4FXK B;  3EB7 A;  2WFF 2;  4BOW A;  2VZT A;  1FX5 A;  4FVV A;  4DFS A;  3BTZ A;  5HCH A;  5FY1 A;  3FX3 A;  3PVN A;  4N9H A;  3J8F 2;  5A1A A;  5AFB A;  2E7T A;  2EIE A;  5BNP C;  2R7E B;  1JYC A;  1RMU 1;  4GWM A;  4QX8 A;  2ATF A;  3VKN A;  2O14 A;  4IEZ A;  5F6L B;  5LAT A;  1IQD C;  2VZP A;  5FYS A;  4E8D A;  3AFG A;  4Y3O A;  2WS9 2;  4Y1Y A;  1WBF A;  4FPH A;  2DUO A;  2QQJ A;  1ASJ 1;  4A7Y A;  5HCB A;  2EIB A;  1PZ9 A;  5C4W C;  1LEC A;  1KS5 A;  4YGB A;  3B01 A;  2PHF A;  4IEU A;  3IPV B;  4WM7 A;  1V6M A;  2Z69 A;  1SAC A;  5CAZ A;  4PLM A;  4DRV A;  3L9J T;  1ULF A;  1SLT A;  3DEM A;  1F4H A;  3NV1 A;  4URT A;  4YG0 A;  3LWC A;  2E51 A;  5J96 B;  1QKQ A;  1YQ8 A;  1M4W A;  2TUN A;  1O4Y A;  5L7O B;  1BMV 2;  3VV1 A;  5HCF A;  1EV1 2;  4G3Y C;  5FIX A;  1QQP 3;  3P1I A;  3VHO A;  4IUG A;  2WQ4 A;  4O65 A;  3RJR A;  5DDJ 3;  2Y33 A;  5ANN A;  4QB2 A;  2BU9 A;  1SMV A;  3ECQ A;  4RSU A;  3VBU B;  3O0W A;  3OEA A;  2DUR A;  4V1P A;  4CXX A;  2XHK A;  3ENR A;  4LE4 A;  5J7M A;  4TLG A;  4Q4Y 1;  3BCW A;  4AGV A;  4JGZ B;  3RYP A;  3AMM A;  1ZRI A;  1DZT A;  2QQN A;  2E53 A;  4AAP A;  4LO6 B;  4CZS A;  5T52 A;  5H9R A;  4EJR A;  3B93 A;  1CAV B;  1GIC A;  4XJ8 A;  3QCW A;  2P6H A;  1H9W A;  1Q8S A;  5FP3 A;  3DV8 A;  2WNO A;  1CVN A;  4KWJ A;  2VCC A;  3APB A;  3HQX A;  3H8R A;  2PLV 1;  4GQ7 A;  1UF2 C;  3POW A;  3ZMO A;  4WVV A;  3WDV A;  2VMC A;  3VB9 A;  3UKV A;  1W2T A;  1IOA A;  4YG6 A;  3KD4 A;  4B7E A;  2C9A A;  4YAR A;  1GR3 A;  4PIX A;  2CAU A;  2SLI A;  3RGB A;  2DCK A;  3N9L A;  2EAL A;  2TEP A;  2EXJ A;  1KGY A;  2F17 A;  3NAP C;  4K1Y A;  5GZG A;  1MPX A;  5SV5 A;  3N3H A;  3TWI A;  1F9K A;  4SBV A;  3AP5 A;  3WP5 A;  4CEW A;  3DYO A;  2Q1Z B;  4ZXE A;  4ZON A;  3AX4 A;  1CX4 A;  2HH9 A;  4Q27 A;  5A3W A;  3RZK A;  1Z7S 3;  4RFR B;  5FZI A;  3N36 A;  1JYI A;  1LOF A;  4BHP A;  3CNA A;  1UIK A;  4IEP A;  5CFD B;  4N53 A;  1IKP A;  3ETP A;  4W6X A;  3WDW A;  4CDQ B;  2JG9 B;  2VTX J;  1C1F A;  1UU5 A;  1WMX A;  1X9P A;  4N7I A;  4LUM A;  3NW4 A;  5F39 A;  2RS1 1;  4EWD A;  4KGQ A;  2FCT A;  4CDQ C;  2EF6 A;  2XUE A;  2OXB A;  3HT1 A;  4HK9 A;  5C8W A;  4XFB A;  2KR2 A;  1YCI A;  2VZU A;  4COY A;  3TEZ A;  3WQ1 A;  2CV6 A;  1XSQ A;  2UYB A;  2WS9 3;  4JHT A;  4YVS A;  1C8M 3;  5H9S A;  4KGG A;  1K5M B;  2GC1 A;  3O12 A;  2EAK A;  3WNP A;  4HBN A;  4HLT A;  4NAO A;  3ZPO A;  4C0B A;  4YSF A;  2VVD A;  2BVV A;  1FPN 3;  4HKO A;  4Q0U A;  1WMF A;  3V0A A;  1BVP 1;  1PM7 A;  2VZ3 A;  4HET A;  4EV0 A;  4XXP A;  3Q8F A;  2EXK A;  4QGN A;  4UF0 A;  3J7H A;  3VKM A;  3C7G A;  4HL0 A;  3CQO A;  3T2P A;  3M3I A;  1MS0 A;  3WG1 A;  5J1X A;  1CZS A;  1UN1 A;  4FTS A;  2HLE A;  2V09 A;  1JI6 A;  1GBG A;  1A8M A;  4RHV 1;  3ZYJ B;  2YB7 A;  4PDW C;  1N1T A;  2C1F A;  3KT4 A;  3VDA A;  3QH7 A;  1BK1 A;  1WUV A;  5JI7 A;  1NXM A;  4MVT A;  5T5J A;  4E4D X;  3IM0 A;  1SBE A;  2RM2 1;  3VBH C;  3MHZ A;  2WFF 1;  1DBN A;  2D3R A;  2Q0A A;  3POF A;  4JKK A;  1XU1 A;  2AEY A;  1NLQ A;  2QQO A;  3VBO A;  2QQL A;  2JG8 B;  3B7M A;  3GZE A;  2HWC 2;  1QEX A;  3J8F 1;  3NNJ A;  3PUI A;  5EJ1 B;  3AL5 A;  5FYC A;  3LFM A;  4XUO A;  3J7L A;  5JCT A;  2E31 A;  5KHK A;  3BPZ A;  2Y6H A;  4K40 A;  4GAL A;  3WX5 A;  4M8Z A;  1CR7 A;  1GYK A;  1LOE A;  1UPI A;  2B45 X;  3OBR A;  2VR4 A;  1N1V A;  4XUT A;  1NZI A;  1OA2 A;  3I54 A;  5CG9 A;  3B7Q A;  3Q8G A;  3NKG A;  4A7Z A;  2LW8 A;  4Q4W 3;  1OOP C;  2YZ4 A;  2YU1 A;  1Y9Q A;  3ABZ A;  5F3E A;  3T2Q A;  5BYN A;  2WYS A;  3VDC A;  3DPR A;  4HFS A;  3M3C A;  5IK4 A;  3LQC A;  2BBV A;  1LUL A;  4YM2 A;  3UGH A;  3ZIW A;  1K3I A;  4W50 A;  1FXZ A;  1W6N B;  2MPF A;  3LB9 A;  5APA A;  4CCD A;  1W3X A;  1HXS 3;  3KVA A;  1ACC A;  3NO8 A;  4LA3 A;  3ATG A;  3UGG A;  1SBF A;  1UMH A;  1EP0 A;  3T3Y A;  1O4Z A;  1WLT A;  2XR4 A;  2XVK A;  3CL1 A;  3N9P A;  3D3A A;  4XZP A;  5CU1 A;  3S57 A;  2EXI A;  3KZ4 C;  4ES8 A;  4NID A;  2PHD A;  2VUJ A;  4XF1 A;  2ZHN A;  3OPZ A;  4NHX A;  5JIA A;  1BMV 1;  2RR1 3;  4DXR A;  1EV1 1;  3UET A;  3ACG A;  5FPB A;  3VZO A;  1TME 2;  4LBN A;  3BU0 A;  3S5A A;  1DG6 A;  5FWJ A;  1NQD A;  3JUU A;  4GMP 1;  3PVO A;  1XBF A;  1UY0 A;  4LEJ A;  5FMC A;  3G7D A;  1ZZC A;  2R30 A;  4Q4X 2;  2DBI A;  1NKG A;  4AE2 A;  4NRO A;  4W8J A;  4EN8 B;  4COV A;  3K4D A;  3EXU A;  4X8N A;  4AQ6 A;  5F3C A;  4URA A;  4CCM A;  1HQW A;  5EZW A;  5I91 A;  3IDA A;  1MQT C;  4XIL A;  4YZ1 A;  1AXY A;  2ZGL A;  2WSU A;  4XET A;  4NRP A;  5A7Q A;  2BTV C;  2HWB 3;  2JDN A;  4A41 A;  2JDU A;  4BQ1 A;  4CCE A;  4XTM A;  3H9A A;  3BN6 A;  4J1X A;  2BWA A;  3JD7 2;  4MG2 A;  1ENR A;  1VPH A;  3OCP A;  2A73 B;  4UT5 A;  3LE0 A;  5AVP A;  5F3I A;  4Q2F A;  3AYC A;  2J1E A;  3NV4 A;  2E32 A;  3ZPY A;  2CYF A;  2CAV A;  3WF1 A;  4LIT A;  2Q5T A;  2IFW A;  1ONA A;  3GAL A;  5A3L A;  4E4Z A;  1W2N A;  4N43 A;  4COW A;  1YIP A;  3RMY A;  4DIQ A;  2O0O A;  4YVW C;  4AEM A;  1L3J A;  4OYU A;  4OI0 A;  4AI2 A;  4RS5 C;  1Q8Q A;  4QB6 A;  4Z1V A;  4LLF A;  5JIU A;  2MHF A;  3WW3 A;  1X50 A;  4WM8 C;  2ZAH A;  3MID A;  3O1T A;  1RUJ 3;  1W8T A;  1RHI 3;  1MEC 3;  2QE3 A;  5AC9 3;  1UO9 A;  2ZX2 A;  1SG3 A;  3AJZ A;  5A33 B;  4JVA A;  4COZ A;  2EIG A;  1KJR A;  5LBC A;  1RUG 3;  1WW7 A;  5C8C C;  1VMJ A;  2QJV A;  5DAV A;  5FP7 A;  3KV5 A;  5IFP A;  3B5L B;  3LEK A;  5FYV A;  1J3R A;  3I49 A;  1N3O A;  5GZC A;  4PI0 A;  3OG2 A;  3I8T A;  4OI2 A;  1W2O A;  5KHJ A;  2VZO A;  4Y1V A;  3O1U A;  1NA1 A;  2WAB A;  4FFI A;  2WSV A;  3WQ7 A;  4CCC A;  3K75 B;  5J37 A;  2FDF A;  5C5T A;  1F8V A;  1LCL A;  4OUM A;  2P3K A;  4RN5 A;  1FMD 2;  4CDW C;  2XJT A;  3K77 A;  3IDC B;  5BNP B;  1ZA4 A;  1RIR A;  4QX3 A;  1FYU A;  5A6Y A;  4AAX A;  2IXJ A;  4NHY A;  2KD7 A;  2XON A;  4HK8 A;  4KG0 A;  3WG2 A;  3VD7 A;  1SCR A;  1HKD A;  1J1L A;  4GB3 2;  1SLI A;  1JZ4 A;  2UWB A;  4FBF A;  2LAL A;  4XF4 A;  4UI9 L;  5BNO A;  1R08 3;  3LIH A;  1OMI A;  2YC4 A;  5T54 A;  5LB6 A;  3KCX A;  4GIQ A;  2Q1M A;  4I3P A;  4QKF A;  1WW6 A;  2DUP A;  1BLZ A;  2A6X A;  2HWC 1;  5LW9 A;  1D4M 2;  2WNE A;  3OBZ A;  1OLQ A;  4IV3 B;  1XB9 A;  4TYS A;  5FQ0 A;  1W6Q B;  2VH9 A;  1VRH 2;  2LS6 A;  2DFC A;  3VBR C;  2VOT A;  1BEV 2;  4LKD A;  1UU6 A;  3LKJ A;  3QOP A;  4LKS A;  1SDD B;  2DVF A;  3U75 A;  3B74 A;  1HW5 A;  1NX9 A;  3U4X A;  4Q4V 3;  2XBO 3;  2BNN A;  2ZZQ A;  4B7K A;  1UOJ A;  2ADD A;  1CAW B;  3BAL A;  2QFE A;  2OUJ A;  4OHW A;  1XNB A;  4ASM B;  3J7M A;  4LO8 A;  3M3E A;  4RA0 A;  1BKZ A;  3D0J A;  4YGE A;  4XDQ A;  1FT9 A;  2RVA A;  2HYK A;  4XTP A;  3N7L A;  4LOR A;  4GJZ A;  4G4F A;  3DL3 A;  4AGR A;  2K9Z A;  2ZX3 A;  3AJY A;  3AMN A;  4OUE A;  5A70 A;  1ENX A;  3I2K A;  2O8O A;  3U07 A;  1C5I A;  4FT8 A;  4HZF A;  4CJ6 A;  1TME 1;  3LA7 A;  1LEN A;  1Y7B A;  3KF5 A;  3ZMN A;  4LNV A;  2Q8D A;  4Q29 A;  1G8W A;  3PME A;  4YNI A;  1N3P A;  1OSG A;  4Q4X 1;  2WZE A;  2XJR A;  3W20 A;  1NY7 2;  3HY5 A;  2KM2 A;  3CBN A;  3UT0 A;  4XUQ A;  3EHK A;  4TTG A;  4YGD A;  2RS3 1;  3IAP A;  2MNG A;  2N7G A;  3M4F A;  1VBD 2;  2OUH A;  4PBP A;  3NAP B;  3VDB A;  3LFI A;  5K0U A;  2G9Z A;  1JN2 P;  3TOJ A;  1VAM A;  5L73 A;  5A3N A;  1DU3 D;  2GZW A;  2WO3 A;  3RRD A;  3JD7 1;  4MXW A;  5LRS A;  4CEY A;  4Y33 A;  1Q56 A;  1K5J A;  1QOO A;  4LHL A;  3KLS A;  1E5I A;  5E16 A;  2Y6L A;  4XMI A;  3LDB A;  4QPI A;  3A0N A;  2ES3 A;  3AP4 A;  4BK5 A;  3I3D A;  2BP6 A;  5EHD A;  3WW2 A;  1DQ6 A;  4CEW C;  3ACF A;  4DO0 A;  1SQ4 A;  3UGF A;  1NCQ A;  2PHL A;  1JZ8 A;  4Q5O A;  3BI3 A;  3MI8 A;  1S2B A;  4XFC A;  4UFL A;  1JOD A;  5FMB A;  1OI6 A;  1LOF C;  1TVG A;  3I59 B;  5FZO A;  5LBB A;  4W65 A;  1HN0 A;  3HX3 A;  1XNA A;  3B69 A;  2IVJ A;  4N53 C;  2VNR A;  1CAU B;  1CGP A;  5FZ6 A;  4CCL A;  1W9W A;  1J3Q A;  1ST8 A;  2HWE 2;  2YBK A;  1GZW B;  3ZYB A;  2ORX A;  4JDO A;  5FYU A;  3ZM8 A;  4FMM A;  5F7U A;  3ZDS A;  3ME2 A;  5LWB A;  5EXO A;  2WR9 A;  1VMH A;  3LGR A;  4YVS C;  2WDB A;  2ZHK A;  1OKO A;  3MFA A;  1HRI 3;  3KT1 A;  3EBR A;  2D44 A;  4B3N A;  2QQW A;  4XMA A;  1CQ9 A;  1ENS A;  1VRH 3;  3JBG 2;  1TNF A;  2H0B A;  3OTF A;  4C0H A;  4HON A;  3H8U A;  4PDW B;  1SFP A;  3MO4 A;  4DS0 A;  2ERF A;  2X53 S;  2XH6 A;  4XYX A;  1J3P A;  1S0G A;  4UW5 A;  4JGZ C;  3B7Z A;  5JXI A;  1V6O A;  4ARX A;  1C57 A;  2G9G A;  5D2A A;  2ETE A;  2UU8 A;  5EFU A;  5FZ3 A;  1XYO A;  1FMD 1; 
#chains in the Genus database with same CATH homology
 2D4Q A;  1O6U A;  3B7N A;  4OMK A;  2E2X A;  4FMM A;  3PEG A;  4OMJ A;  4CJ6 A;  4J7Q A;  3B74 A;  4M8Z A;  4CIZ A;  3P7Z A;  3HY5 A;  1OLM E;  1OIZ A;  3B7Q A;  3Q8G A;  1OLM A;  3PG7 A;  3W68 A;  4TLG A;  3HX3 A;  5LZ6 A;  3B7Z A;  1OIP A;  4J7P A;  1R5L A;  4UYB A;  1AUA A;  3W67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...