1OLQA

The trichoderma reesei cel12a p201c mutant, structure at 1.7 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
ETSCDQWATFTGNGYTVSNNLWGASAGSGFGCVTAVSLSGGASWHADWQWSGGQNNVKSYQNSQIAIPQKRTVNSISSMPTTASWSYSGSNIRANVAYDLFTAANPNHVTYSGDYELMIWLGKYGDIGPIGSSQGTVNVGGQSWTLYYGYNGAMQVYSFVAQTNTTNYSGDVKNFFNYLRDNKGYNAAGQYVLSYQFGTECFTGSGTLNVASWTASIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Humicola Grisea Cel12A Enzyme Structure at 1.2 A Resolution and the Impact of its Free Cysteine Residues on Thermal Stability
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase
molecule keywords ENDO-BETA-1,4-GLUCANASE
total genus 55
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1olqA00
1OLQA 1H1AA 1REFA 1UKRA 3VLBB 3WR0A 2BWCA 3VZLA 1REEA 4S2DA 1H4GA 3VL8A 1C5HA 2BW8A 3AMNA 3AMPA 3O7OA 4H7MA 1NLRA 2NQYA 2NLRA 4S2HA 1F5JA 5K9YA 2C1FA 3VZOA 3WQ0A 3WQ7A 1UU4A 4S2FA 1T6GC 4XPVA 3MF6A 3VHNA 2DFCA 2VUJA 1W2UA 1M4WA 3ZSEA 2VG9A 2DCZA 1YNAA 3WY6A 1H8VA 1XNKA 4HK9A 1BVVA 2D98A 3WT3A 2B42B 3MFAA 3RI8A 3B7MA 1XYPA 3RI9A 3LB9A 3AKTA 1H0BA 4XQ4A 2JENA 1ENXA 3WP5A 3AKSA 1OLRA 3AMHA 3AKRA 3VL9A 2BVVA 3AKPA 1XNDA 2DCKA 1REDA 2DFBA 1QH6A 1KS5A 3M4FA 1OA4A 5K7PA 2DCJA 2VULA 3AKQA 1AXKA 2VGDA 4IXLA 4HKOA 2B46X 3VHOA 1IGOA 3WP3A 5HXVA 3VZNA 2BWAA 4HKWA 1HV0A 2QZ2A 3AMMA 1XNBA 2Z79A 1BCXA 2JICA 4S2GA 1OA2A 1HV1A 3WQ1A 1BK1A 1XYNA 3LGRA 4XQDA 2F6BA 1XXNA 3MFCA 2D97A 1HIXA 1XNCA 1UU5A 2JEMA 1KS4A 3B5LB 3HD8B 4XQWA 1XYOA 3EXUA 3VHPA 5EJ3A 1C5IA 3VZJA 1H4HA 3WP6A 3VGIA 1UU6A 1QH7A 4HKLA 3WX5A 1PVXA 3WP4A 1TE1B 2DCYA 3VZKA 3WXPA 3VZMA 3AMQA 4NPRA 2B45X 1OA3A 2QZ3A 4HK8A 3MF9A
chains in the Genus database with same CATH superfamily
1W0PA 4XJ9A 5FY4A 2YXSA 5F5IA 1UIJA 4IL7A 4FOVA 5IUQA 1GP5A 3WR0A 1QJX3 2MHFA 4GWJA 1H4GA 1C5HA 2BW8A 2IVIB 2XUEA 4MGZE 5FO7B 1JN2P 4ISQA 3S6PA 4NN0A 2A70A 5FJHA 4DOUA 3Q8FA 2WSVA 1Y4WA 1W8WA 5C3OA 2HLEA 5F6KA 4OQ9A 1OHFA 1VRH3 4RA0A 1VMJA 2R0FA 3M3IA 2YV8A 2FDHA 3HOBA 5DUXA 2O14A 2DVAA 4IV3C 4XDOA 2P1BA 3OGVA 5F39A 5T55A 1F4HA 1PZ7A 1R64A 2XGXA 3AP7A 1BYHA 1RUH2 4XE9A 3SCHA 3PVNA 3TN93 2PQSA 1WMDA 4AZZA 1IS3A 2V4VA 1CIYA 5D2AA 1V6JA 4XTMA 2B42B 1HXS3 1LCLA 4BMBA 3LSDA 1H2KA 4YW6A 3JBG1 2JG9A 1VALA 2VJXA 3KMHA 2XKPA 1QMJA 2WFPA 4QQPA 3UKNA 1UPSA 1LHWA 1YXWA 2KR2A 2DBNA 2ZXQA 3M7AA 5CIRA 1ND3B 4XQ4A 2E53A 2ZZJA 3WP5A 3N9NA 4FAGA 2D3SA 2YBSA 3WSOA 1SDDB 3KT7A 4NRQA 4BQ1A 5HCAA 2WJSA 1B35B 3LDRA 4Q0PA 2CY6A 4R4ZA 4GMP3 2TBVA 3KVBA 2XL7A 1NYWA 3WF0A 4XUOA 4YWAA 1X82A 4PI2A 4EYUA 5DAPA 5DAVA 3AYCA 5HPOA 4MZUA 5FZBA 4YZ1A 3GBWA 3WF1A 1VBE2 3M3QA 1N3QA 5FZ8A 1K5MC 1GOGA 1VBC3 1JHNA 2QQUA 4FPYA 3HIFA 3IB3A 4YZ4A 3T2QA 2FCUA 3J26N 4OHXA 4D3WA 1CAWA 1KDKA 4K3UA 3FLPA 4P9JA 2WO2A 4CUBA 1AX1A 1GP6A 4JRLA 4LIVA 3SQOA 2GC1A 4HVQA 2VH9A 5KXCA 3A0NA 5C71A 2R0HA 3I2HA 4RFT0 5LK7B 4CRQA 1UZZA 4R52A 1NE4A 1OT5A 2DUQA 3D4KA 3DXUA 1UZ0A 3OTFA 5LZ6A 2GP3A 1NCRB 1GWKA 3KT4A 1DDLA 2GSYA 4W4ZA 2W95A 4QHBA 1XNCA 4IEYA 4Z82A 3BIEA 3CEWA 1UAIA 3HD8B 5FMOL 3I8TA 4JAAA 2XJQA 3AB0A 2HWE1 1S0IA 4HT1T 4BMEA 4UYBA 4NIHA 4FO9A 3B9CA 1OVSA 1O4ZA 3FLRA 4D8MA 1AR93 1VAKA 2ES3A 2VNOA 1QOOA 3OUHA 1QXPA 5CG8A 1VBA3 3FWEA 4OCTA 5KHHA 1VBE3 3ES4A 4JGYB 2IXCA 4F7ZA 1GBGA 3V0BA 1SACA 1Q3EA 5JXGA 5JI7A 1PK6C 1OURA 4FPHA 4AGRA 3CHXA 2LRPA 2VMCA 4JQTA 3W9AA 3WF4A 5BNPC 2QZ3A 4HK8A 3HQRA 5JPNB 3A0KA 1OLQA 2QUOA 3JZVA 3ABZA 1KXGA 2A6VA 3C8XA 3H42B 5FKCA 3N35A 3VBHC 4A6SA 4BQYA 2YU2A 4XXAA 1R081 1C8M1 4DXRA 2P34A 3Q8BA 3H1WA 5EXOA 5JI9A 2WABA 3N9MA 3AMPA 2Y6GA 5IHRA 2QQWA 4TLFA 3POFA 5A7OA 4YVSA 2CWMA 4AI3A 4HANA 5KBFA 1LHNA 3OBRA 4KQ7A 3WUCA 1XE7A 4FXKB 5ABJC 4P5YA 5L73A 5IFPA 1SFNA 4Y4YA 1W6PA 2W87A 3THDA 2PN5A 3J4UH 3ETQA 4Q4X1 4CCMA 1AYN2 1DP0A 3IT8A 4FPKA 2VOXA 3GHNA 1RUD2 3LIHA 3JU9A 3PUQA 4KU8A 3MHZA 4Q0VA 2RE9A 3ZXLA 5FUNA 1YQ8A 4CEWB 3FFZA 3EHKA 5KXEA 3W5MA 2Y6LA 4CSWA 5DZGA 4XOGA 1QHDA 2WT0A 4XFCA 3MIEA 4PF1A 3SITA 4W65A 3T4VA 5EJ1B 1ULEA 4DUXA 4NROA 2ZGTA 3EO6A 4XACA 2P5BA 4LXLA 2W92A 4FI9A 4FFGA 5FQ0A 1A78A 2E9QA 2GN3A 4NUBA 4BQWA 2HWB3 3W21A 4CEYB 4YW1A 1ZNPA 2XPJA 4LE4A 1EYBA 3ELNA 4P9LA 1L7QA 1VBC1 3V56A 2TNFA 1UZVA 1ZRIA 3HEIA 4BDVB 3J8F1 1FMD2 2J1SA 5FYHA 2YZ4A 3OEAA 4PQ9A 5IAVA 4KBZA 5A6QA 2P37A 1EAH1 5BNNC 3O0WA 4QB1A 1AXKA 1SLBA 4B4PA 5F37A 2RR13 2A6ZA 3BCWA 4IERA 1YO8A 1DZQA 1UN1A 4JKKA 1N1TA 3ACGA 3J7NA 4D6RA 1ZRDA 3CQOA 1LGBA 1QJX2 1ZZ7A 3MYXA 4N43B 1WLDA 2MEV3 4Y3OA 1J1LA 4LNVA 1J84A 2ZGUA 4HKWA 3SHRA 2WINB 1PO13 2JDNA 3BGAA 3K3OA 2VW2A 4FFHA 2E33A 3JXSA 5DUVA 4AR2A 3LEGA 4YYOA 1FT9A 3URFA 1PIV1 2ADDA 2I07B 1M06G 2B8MA 3JUUA 1H6YA 3A22A 3ZYBA 4YW5A 1IZ3A 4PLMA 3MFCA 4Q4W1 2W9XA 4E2GA 1GUIA 3TYJA 5C3QA 3VD5A 1MVEA 4D0QA 4XQWA 1BEV1 1IPSA 1I9RA 4F8AA 3BTXA 1RINA 3RZHA 2Q1MA 4ET7A 3VDAA 1LU2A 2JDUA 4XZPA 3OGGA 1UW8A 2AZ5A 3GDBA 5HCFA 1EY2A 3NJXA 4N7IA 5HI0A 3V0AB 5CAZA 5HXMA 5H9QA 1HRI2 3VDCA 1PIV2 2AACA 3NNLA 3POGA 1QJY2 4LR4A 3U07A 1UQXA 1CX4A 4QXCA 1MVQA 4LO6B 2B45X 1PX3A 1ZZBA 2ZJCA 4KGQA 3LFMA 4LBOA 4WVVA 3AFKA 2WNOA 2OPKA 3VBHA 1QJX1 1J59A 5T5OA 5LCWL 1XNAA 4IEOA 3WEZA 3GALA 1BK0A 5EYXA 4NIIA 1JYIA 2Y6HA 4HL0A 2ERFA 1OFSA 3BTYA 1Z7S1 3H0OA 3PURA 4QMAA 4COVA 2PAMA 1OLMA 4AVAA 4QDRA 4C0HA 3GCXA 2X53S 1O91A 2VMEA 2AR6A 3DEMA 1QEXA 2IXLA 1VBC2 1YQ6A 4J1WA 2VZTA 2FZ2A 1PNGA 1UU4A 2LTNA 2X29A 3FLTA 3FUOA 3U4XA 3TEZA 1K5MB 1PGL1 3UJOA 4WVWA 3UJQA 1W2UA 4WZCA 4L8QA 4Q8LA 1W2TA 1QF3A 2X05A 2WBKA 1AR61 3O1PA 3PVOA 1LESA 1NX9A 4MYEA 5F6LB 2Y6KA 1UY4A 3RMYA 4AAXA 4IEWA 5FKBA 5HCHA 3ACHA 3ZLIA 1MZ5A 2JDAA 2ZZQA 4Y5TA 3FFQA 3IPVA 3RYPA 4LO7A 1HXS1 4PHZA 2CTVA 1Q8PA 1XYPA 3DN7A 5IK7A 4SBVA 2QVSB 4UT5A 2XLGA 1CZVA 2GMMA 3JCIA 3KGZA 5A3PA 1ULFA 3AKSA 2BOJA 3ZYRA 5JWPA 4BLIA 3VBFB 1WZXA 4ZU7A 1QOSA 4WM7B 1ZBA2 1MS9A 2D6MA 3LPFA 4E4DX 5A32B 2W68A 4NAOA 1GP4A 1QXJA 1CZSA 5JZGA 2ZEXA 2J1RA 5D8AA 4IUGA 2BP6A 1D2QA 3WG1A 1LRHA 1V6NA 5LK5A 1SZBA 3R4UA 4AI1A 1GYKA 1BJQA 5FUIA 2EXKA 5CISA 4ES9A 3I49A 2XLAA 4CVUA 5GLTA 2FCTA 3VV1A 3MBWA 3TBDA 4IXLA 2LS6A 4JV4A 4CCDA 2W08A 1MS1A 4YVSC 3EQEA 1IGOA 4OHWA 4I0BA 4GXLA 1BBT2 4OI4A 2QQLA 4EV0A 3U75A 1QIQA 2RDQA 2OW4A 4LEJA 4KMQA 2PFWA 1T2XA 3NL1A 4F3JA 1HXS2 5FP3A 2WNEA 1XYNA 3VKMA 1BZWA 5DAXA 3TOJA 4RR3B 2XJPA 2RDNA 4CCLA 2J42A 3M2MA 4TN7A 5FR3A 4L9BA 1JMUB 4HETA 5FYZA 5A3LA 1G9CA 2YBKA 3D0JA 1G6NA 4PCRA 3ZYPA 3D8CA 5J48A 1VBD1 4YW4A 1C1FA 1YFWA 1H2NA 1PGL2 1RB8G 1EV12 1WGPA 3BOWA 4KI5M 4BCUA 5C8WA 1CPMA 4CDQC 3N7JA 2FQPA 2D40A 3KV9A 4EN9B 4CDQA 1NKGA 1AR62 3SEPA 3DPRA 4ORFA 1TMF3 1JYNA 1RUF2 2WZEA 5KWRA 4UBHA 3NV1A 3U0ZA 4LBNA 2DTYA 3RG0A 5FRAA 4JDOA 4CP9B 2VUAA 1HX6A 1REFA 3VBOC 3R6SA 3MLJA 3GZUC 5C4WB 5HCBA 1WMEA 1JZ5A 1AYM3 4AFAA 1N1SA 4CP1A 1VBA1 3I2KA 4XJZA 4AEDC 1ZREA 1C3HA 3AMNA 3CL1A 3I3BA 3OGSA 4HXCA 5BNNB 1DIWA 1PK6A 1POQA 4PT6A 5AC92 3CBNA 5LATA 3NWKA 5I0UA 1WBFA 3RRDA 3FMGA 1YYNA 3LZZA 2WT1A 4LKSA 2XJSA 5FZGA 2YG0A 2ZX4A 5I91A 2Q1ZB 1UOJA 2VMDA 3VDDA 1NCQC 3LDBA 4GZ9A 4IESA 4AOCA 2OXBA 2V72A 2VG9A 5E1RA 1OD5A 5EPAA 4CCKA 3ME2A 4BIFA 3GBFA 2Z69A 4AHYA 3HBZA 1EV11 3GJAA 4PBPA 1FATA 2VL4A 3BPSA 2MEV2 3CJIB 5IYYA 3BALA 1Y7BA 1FOD3 4DUVA 1DYOA 2ENRA 1OQ1A 5DPNA 3IPVB 5JVVA 1VBB1 2XJUA 3K3NA 3NJYA 1UO9A 1HN0A 3DYOA 2PLV1 2Q30A 4FPCA 1COV3 2IFWA 1OOPC 1H6XA 3N9PA 3AMHA 1APNA 3H1YA 2ZGSA 1L7RA 2BQPA 2GC2A 3H8XA 4PBOA 1GWLA 2FD8A 1REDA 3RGBA 2E26A 3OB8A 2MEV1 1S1AA 1F2NA 4GKXA 4URAA 3VBSB 2GNMA 4E2QA 3ATGA 2RMU2 5FBJA 1TZOA 1VAVA 3FE5A 5JLVA 4NHLA 3E5UA 2QQOA 3TN91 3OY8B 3ZPYA 3M3OA 3EB7A 4W8JA 1DYPA 1Q5OA 1ZA4A 2EF6A 4YZ3A 5T5PA 4DB5A 5GLUA 1PZ8A 4CPBD 3BTZA 1I5ZA 2YPDA 1R093 3THCA 2P3JA 2R062 4XJWA 2W5FA 1UYXA 1W8FA 2VAUA 1PMJX 4YFWA 1K42A 4DXSA 1QJY1 2VC9A 4QT6A 3OBAA 4Z1VA 2O8OA 2BEOA 1ZM1A 1GR3A 2HKXA 4NR1A 4QB6A 3RQ0A 1W90A 3SMHA 3V65A 4M3CA 3ZXKA 4EN6B 1COV2 3F95A 2IUWA 5L7OC 1BXHA 4RGAA 1IPJA 5JR7B 4Z07A 5FK7A 2JD9A 1W05A 1X8MA 5FY8A 1MEC2 1X50A 4YM0A 5GLVA 4A2UA 4A44A 1I5PA 3PJYA 5KHGA 4LPLA 3RZKA 1YQCA 4XBLA 4LIUA 2WS91 3Q9OA 1F5FA 4XFAA 5F3GA 3MICA 1RHI2 4OI1A 3ZFFC 1GOHA 2OX0A 1S4CA 3KHBA 1O6UA 5CKMA 3WNPA 2NZ9A 2ZGKA 3WF3A 3ES1A 1OA3A 4QPWA 4QX0A 2WT2A 1E5HA 3ETPA 1QJFA 3ZX7A 5CEHA 5A7NA 4AEDB 2XG3A 4NE9A 1RVF3 1TMF1 3J7HA 4NMIA 2MNGA 3VD3A 1JHJA 1ODNA 2RDRA 4YZ2A 5BNNA 4JHZA 3ZIWA 1W04A 2CDOA 3PDQA 4DNYA 2VTFA 4XC9A 5FY9A 4FPGA 4CCOA 1VBD3 1QJZA 4P02B 5CKQA 2ARBA 1RUI1 4AFDA 4HZFA 4X8PA 3L2HA 4XPVA 1WLWA 2VCMA 1CONA 3MEPA 4DY3A 1S0JA 3MF6A 1YI9A 3MV01 5LRSA 2HWD2 4M0NA 3LWCA 2DCZA 3CMGA 3BU0A 4W6YA 5FWEA 1PM4A 5ANQA 1SBEA 4CCEA 1XNKA 2EAKA 4DO0A 1CAUB 3HMYA 4QM9A 1BVP1 1UKGA 4N9HA 3ZYIB 3LEMA 4OHYA 1XOYA 2CWSA 1GANA 3C3VA 5CFCC 2DYCA 3SH5A 4XF4A 1RJ8A 4R9CA 4IE7A 4B29A 5JMCA 3ZKUA 4RR3A 3H8RA 5EZWA 3ZFGB 4BH9A 5JSOA 3NRUA 2VXRA 4OMDA 1AF9A 4H2AA 3VKLA 2ZX0A 3H7YA 2HWD1 2ADEA 1PGW1 4KWKA 4BM8A 2NMOA 2WNUA 1LENA 2ZTNA 2RJ2A 4MUVA 2XBO3 4NO4A 4Q4X3 4B4RA 4CU7A 2J1VA 2D93A 2CAVA 4I02A 4PDWB 4C8DA 5CG9A 4FBFA 1F31A 1K45A 2FMYA 1JU4A 4AVVA 5ACA1 5LEJA 2WLQA 3ZN5A 1LGNA 2JIJA 3VBSC 2VY0A 1RUE1 4XYXA 3FBMA 2VGDA 3N4MA 3O0VA 2Q8OA 5F3CA 2C26A 1W8UA 2FDFA 1LEDA 2D44A 1IS6A 1HDKA 1LGCA 4ATEA 3X29B 1SEFA 3KF3A 4H3WA 4AL9A 1XE8A 4Q27A 2AEYA 5FZCA 3H1MA 1U5ZA 1ZRRA 3NNGA 4R4XA 5FXZA 4Y20B 4DRRA 5FDBA 5L7OB 4XQDA 1VMFA 1GLHA 2I74A 3WDWA 5FZ9A 5K0UC 5ABJA 2G9ZA 3JBG3 1LHOA 1R092 3KSCA 1V6OA 4GWIA 2YFUA 3UT0A 4YVWB 2ZGQA 5JCTA 3AP9A 3KVAA 4JHTA 4COYA 1IOAA 1OF3A 3HT2A 3I3QA 4GB33 3VGIA 3NV2A 3ZXAC 1MS4A 3NMBA 1GWMA 2HWF2 3K77A 2P2KA 1QGLA 1YCIA 4XZUG 5FY0A 1PVXA 3ZFGA 4XABA 5C9AB 1WBLA 1S0GA 3K4DA 1AUYA 3I2GA 1W06A 1ND2B 4A3XA 3AP6A 1QWRA 1FNYA 1AZDA 4FQ4A 1GQHA 2JDYA 1AJKA 2P3IA 5GM0A 1J3QA 2GNBA 1UX6A 5FMOS 1NUKA 1X36A 4ONUA 5A6XA 1RTVA 1YHFA 2GZWA 2HWC3 2R072 4DUWA 3VBHB 4H14A 4S2HA 1JTZX 2VD7A 5C4WC 1DGRA 4DEQA 1GZWA 1XU1A 1W3VA 2QNKA 1S0DA 3I54A 1N3OA 2QQJA 3DF0A 1VLNA 4XFIA 1RUF1 1J3RA 2ZGNA 2C6SA 4YM2A 3VHNA 5FP7A 3AK0A 2X09A 4GMP1 4N53C 1FV3A 3JQXA 2XJTA 3EMRA 1ZZ6A 1MPXA 2XXZA 3LE0A 3ZXDA 2UY9A 2QE3A 4EROA 1PVC1 4LA3A 3VBUB 3RZZA 1VMHA 2AGSA 4R9BA 1FXZA 4MGYE 1RUD3 1AR63 3VDDC 3B7MA 5HBAA 2Y64A 2B9UA 3NO8A 5LA0A 3SLIA 3N9QA 4CEWC 3ALQA 1X33A 4OZXA 4K7JA 1GV9A 4C90A 5DDJ2 3K4AA 1H2LA 1OLRA 3MGUA 1D7PM 4EE2A 2WLPA 4AG4A 4QHOA 5FUPA 5HV4A 3N9OA 3MZHA 1UIKA 1PVC3 2K9ZA 3M3CA 2R061 2VZOA 2EIDA 3VBRB 4IV1B 4HPKA 5I0RA 4A7KA 4QPIA 1RUG3 1W8HA 3TAYA 1OA4A 1RIRA 1LAJA 2L9LA 1XPWA 2PHUA 1POV1 2Y33A 4BQ3A 4QB2A 4LHSA 1BMV1 1HRI3 1XU2A 4CDWC 4L11A 4F83A 5E89A 3RS6A 2VMHA 2B46X 1PX4A 1RMU2 3AM2A 4OFGA 4COUA 1FYUA 5AFBA 1IG3A 5IVCA 4XAAA 5CNAA 4X6RB 5A6ZA 4RGKA 3FHQA 4LK6A 1KQRA 1VAMA 3AC0A 1C4RA 1O4TA 1F15A 1RGSA 1YC61 5BNOB 3VUOA 1O3RA 2CDPA 2ZMKA 5LASA 5IFTA 2Y60A 1G86A 3MUZ1 1NOVA 3LGRA 5K0UA 1N1VA 4EWAA 4ASMB 1V0AA 2D97A 2JG8C 5B4XA 2E63A 2P6CA 2YPJA 1VB4A 2G19A 2VOKA 1DZRA 1KS4A 1GKBA 2A5ZA 5C8CB 2RS53 3A21A 3D82A 1ZRCA 5A70A 3VBUA 1JODA 1GOFA 5FMBA 2Q1FA 4LJHA 3DYPA 3OSDA 3KV5A 4M3CB 3NJZA 1UU6A 3M8LA 3ZFGC 2JXAA 5FOJB 5EP9A 1IS5A 1RUI2 4OZOA 3ZFEB 3O1RA 1H30A 3AZYA 3AMQA 5CFCB 1HRV2 5DZEA 4HONA 4RS5C 4CDXC 2DURA 2JECA 4RS5A 1QQP1 3GHMA 1ZZ8A 1WA6X 1KJLA 3BVCA 2WQZC 1W6OB 3OBZA 3QD6A 3RPQA 4YNIA 1MR5A 5A33A 2YUEA 5FZIA 2BWCA 3A4UA 3KM5A 4Q4X2 4QPGB 1W6QA 4S2DA 1VRH2 4QPIB 2A6XA 1BLZA 3ZXFA 5GZGA 3POIA 3O7OA 4XMIA 1V9U1 5F1RA 4P9YA 2NQYA 5JZGB 4BB3A 2JJ6A 3APBA 1RUH3 5K9YA 5T3NA 1IQDC 1AL0G 3U14A 5JUVA 5F5AA 1R1A3 1UOBA 4O61A 2WZR3 5FZLA 3T09A 2C0ZA 1ZBE2 4AHXA 1S2BA 2W52A 1PK6B 1HLCA 3VKNA 3VB9A 1NY71 2G9GA 2XMLA 1YNAA 4HMZA 3VD9A 4FPFA 2RM23 3WUDA 2ZS6B 1Q8SA 3QCWA 3MIBA 1QJY3 1WMXA 3PU3A 5JXJA 1HRI1 1ZBA3 3KWVA 1YFXA 3QACA 1W9SA 4XMAA 3I3MA 1H0BA 4Y33A 1CAUA 4JZRA 2CHHA 3KV6A 3VHRA 3FZ3A 2ZHKA 4BWOA 5ABJB 1EUTA 3MPPG 4XCBA 1NY72 4P14A 2JG9C 4AXOA 2VMFA 3THPA 3AKRA 4CDUB 1PO11 4LA2A 3B94A 3I2FA 2X5IA 3W20A 4W6WA 5IK5A 1XSQA 5ANNA 2Q8CA 2NP0A 1VB2A 4Q4W3 1SLCA 1QJU3 5FP9A 1W6MA 5A6YA 4AQ6A 2ZX3A 5A80A 3O1UA 1HQLA 4Y22A 5FPLA 1W6OA 3KD4A 2DVDA 2VZVA 1NZIA 3DPRC 4UW5A 4XHBA 4XEZA 1CJPA 1SMVA 1W6NB 1W6QB 1YJLA 5A3WA 2VPVA 5C4WA 3ZFFB 4UFKA 3WINE 4I01A 5KHIA 5JR2A 3PIGA 2VMIA 4SLIA 3ZMOA 2GC3A 4QDSA 1QJU1 3LD8A 2Z79A 2R073 1DGWA 1VBB3 1MS0A 5GALA 1QNWA 5LWBA 2ET1A 1JYXA 3WQ1A 5JOXA 1CIWA 4KG8A 5SV8A 3DL3A 3VKFC 2JG8A 5FZ0A 1LEMA 1UCXA 4A45A 4ISRA 3H8UA 3CJIC 3KV4A 1SLIA 1V70A 4LBQB 2BOIA 4A42A 2JEMA 4EN8B 4I0WB 4XF3A 1Y9GA 1GMMA 1BEV2 2VBDA 2ZAHA 3EXUA 4QU1A 3MIHA 4IE5A 4WBBA 2VVDA 5C8CA 2HWB1 5FZOA 5C8CC 2VO5A 2BU9A 4YPJA 1QJU2 4B3NA 1UY1A 2H0BA 3NQHA 3S5QA 1QH7A 4ZPIA 3K4ZA 5DZFA 2ZAAA 2RM21 3AJZA 2P6HA 4LBMA 3WCRA 1O4YA 3K48A 3UK9A 2J7MA 2JD4A 2ZGMA 5F7UA 5FPAA 2E51A 1OC1A 5FZAA 3N7LA 3U37A 4DINB 4I3PA 1DLLA 5GZDA 4QPIC 3SISA 4Z2AA 5L9BA 1MQTA 1UKRA 1L7LA 5BNQA 1SG3A 2HEYF 3WNNA 4B7EA 5BV6A 5A7WA 4AHZA 4BQ4A 2WA3A 2VBBA 5AC91 3HNMA 4KH9A 5JZGC 4KU7A 3P3NA 4WM8B 4CDWA 1QY4A 5C5UA 1C8M3 2VCAA 2ZHNA 3MLLA 3VBRA 2DU0A 1ACCA 4QQ2A 1AHSA 1Q8VA 2EICA 2RM22 4XAEA 5IW0A 5HV0A 2YB7A 4Y1XA 5FZDA 4AFCA 1W6NA 2J1EA 3OG2A 4QD2A 1G9FA 3OY8A 4C0BA 1A3KA 3IDBB 2WRAA 4URTA 3OEBA 4S2FA 1T6GC 1AXZA 1CPNA 4CU9A 5C7GA 4TYSA 5KR7A 2PLV3 1JUHA 4LTAA 1AR83 4CCJA 3T0BA 3NSTA 3WF2A 1RMU3 3LKJA 4CZSA 4OYUA 4OMCA 2BGOA 5F5QA 5BPXA 1OUXA 3BKZA 4KGGA 2D6PA 2LW8A 5FYMA 2DUOA 3KS7A 1L3JA 2YROA 2PA7A 2HWE3 5DN2A 2YDEA 4L97A 1UD1A 2PELA 2W94A 2XBO2 5FJKA 1UXZA 1CZTA 4E4HA 1JZ2A 3I59B 2XQXA 4XF0A 5KHKA 5C3SA 1A8MA 2ZOEB 3LB9A 2P3KA 1R1ZA 4N53A 5B2GB 3TNQA 4JKMA 1AVBA 2XB6C 2VQTA 2W46A 2YMZA 3VN4A 5CBLA 2RG4A 4YGCA 2WN3A 4G4FA 2A71A 2HWC2 3AXDA 3PUIA 2DF7A 1WCUA 1LKNA 3OF1A 3SEEA 3UGFA 1WA4A 4MXWB 4WV8A 1SDWA 1DG6A 4IGPA 4QQLA 1GNYA 4QXHA 4XBNA 3SH4A 4L99A 1VE0A 4TZDA 2XLFA 1EUUA 1HB2A 1T6BX 4QGNA 1MQTB 1NE6A 2VULA 3RVHA 3ZR6A 5JAXA 1R1A1 4Y22B 3ZFFA 1K5JA 5C9AC 3O1OA 1RUJ2 4RS5B 4MGTA 1TNFA 2Y6FA 3VBOA 2EAAA 5FYBA 3O5SA 1V9U3 5A33B 1QDOA 2GNDA 3QH6A 4Y1VA 1QDCA 5I8TA 4AEDA 1UOGA 2JDMA 1GSLA 2VZPA 3MIGA 4QHZA 3WW4A 2K46A 4K21A 5C70A 1OPMA 2PTMA 4K8RB 1KFUL 1WCSA 4LBQD 4MXVA 3NW4A 1OA2A 3TWIA 4AVTA 4P5HA 5T5LA 4LKEA 2XJRA 4OVEA 4Q4V3 4GWMA 4RQPA 5K4LA 4MGKE 4ASKA 4U2AA 3I3EA 1K12A 5J3UA 4IDZA 3ZR5A 3N9LA 4NHYA 4A41A 2G4IA 3KF5A 5FZOB 1XYOA 3HWJA 3ZXGA 2HBUA 2D3RA 5FZ6A 3RZGA 4DIQA 1FPN1 2PHRA 1BKZA 2PMWB 2X8KA 4AAPA 1RHI1 3VZJA 3S0MA 1HB3A 5ERLA 1HRV3 2WFF1 5JOZA 3NJVA 2XQRA 1POV0 3MW2A 1PGSA 3AYAA 2XOMA 4FXGB 1ULDA 3BI3A 3SCGA 1WW6A 2BNOA 4A7ZA 4N53B 2JB4A 2V73A 2A1XA 2ZCWA 3N7KA 4OUEA 1URXA 3SC7X 1OKQA 4QQHA 3U10A 3UKVA 5BY5A 2RR12 4QAWA 4AW7A 3RFRA 2XJVA 3WNMA 4NJ4A 4FPOB 4QKNA 3VBUC 5IK8A 1KDMA 2JWPA 5F3EA 5FCCA 3BN6A 1H8TB 1W8OA 4RR3C 5D1IA 3DYMA 3J7MA 5J7MA 4BA6A 5E16A 2W1WA 3RJRA 2QQMA 3HVDA 3VZLA 1UF2C 2ARAA 2UYBA 3WW2A 1YWKA 1GICA 3JQWA 4TSVA 1FV2A 3ROUA 1VRBA 2VOTA 4D7SA 5LBFA 2V5YA 4H7MA 2A75A 3DPRB 4QKFA 1DQ0A 5CZKA 1S55A 4HG6B 5EJZB 3V0AA 1H1IA 4C1XA 1CQ9A 2Y6JA 3VBFC 4Q4Y1 3KCYA 1CX1A 1W8NA 3ZYJB 4QX2A 2AH2A 2GH8A 2WZR1 1IPKA 5FPBA 5C33A 4GMP0 2WC2A 1LHVA 2BZDA 5EFUA 3MW4A 2R042 1RUC3 3HBKA 3POJA 4NWWA 2K0GA 2GDFA 3JB4C 4CP0A 4DQAA 1WW7A 1H8VA 3HJRA 2EXIA 3KQ4B 4K1ZA 5J98B 4YFZA 4WVZA 3L2YA 5K0UB 1BVVA 2Q4SA 2UWBA 2WR9A 1X9PA 3U11A 1UYYA 2J22A 3RZLA 1DQ4A 2W47A 3RI8A 4G9SB 4UW4A 4AQ2A 4YVWC 4UI9L 4ZHNA 4DEVA 1W8ZA 5IK4A 2EIGA 4LITA 1Y3TA 2XWBB 2WQ8A 3GYDA 4P9IA 3BU7A 4Q0UA 2VZQA 4DMIA 1O3QA 1ZRFA 2E7TA 2VUDA 5GZCA 4UBGA 3RYKA 1NT0A 4IEQA 4CP2A 2R041 1RUNA 3WNOA 4ZS3A 2D6LX 4RSUA 4E8CA 3U4SA 5M0TA 5IATA 2ZGRA 4DFSA 3BB6A 3JD73 1NZCA 3O1MA 1H2MA 3FC0A 1VJ2A 2AENA 1RUE2 1MQTC 1MZ6A 1R082 1W9WA 2DCTA 1U5YA 3FHAA 5FYUA 3VKOA 5FY7A 2RMU1 3UETA 1TG7A 1RUF3 2BDRA 1PZ9A 1DYKA 2IFRA 3JD72 1ZBE3 5CU1A 3K51A 2ZKLA 3AKQA 2HEVF 2OA2A 2WZR2 1NG0A 2RS33 3WDUA 5LEKA 4ARYA 4V2VA 1OH4A 4QKDA 3ZXJA 2CGPA 2JKBA 5I93A 3V0BB 1S0FA 3PVBB 1JZ8A 1HV0A 1OI6A 1IKPA 3AMMA 4Y4RA 3PTYA 1DU3D 2SBAA 1OQEA 1LOBA 1JH5A 1UXXX 3GZEA 3PIJA 4R8HA 2ORZA 3AL5A 4RQPC 4CYDA 1YQ5A 4JGYC 2N7GA 4Z8BA 5CFDA 4JGZA 1DLCA 1ZVFA 5CFDC 3T4HB 1D4M3 3WG3A 3WOGA 4XJUA 5BNPB 4XFFA 5KHJA 1PO12 4UFIA 3WCSA 3VDDB 5K8SA 3E6CC 1CAXB 1PGW2 4KG0A 4GB31 2CNAA 4AEMA 2Y0OA 3C7EA 4LBQA 4Q1RA 5BYNA 3O0XA 3GF6A 3OBTA 4AVBA 1BEV3 3IMNA 3CJIA 3TB0A 1TE1B 3R05A 3VZMA 4NAMA 5H9PA 3I59A 1W8TA 3LA7A 4BQXA 4M4PA 4S2GA 1MEC3 3MF9A 4R9DA 3BPZA 4LBKA 1W6PB 5FV3A 3C7OA 4CEWA 4GIQA 1BBT1 4DXZA 4HSJA 4MHUA 1X7NA 4MVTA 4Q5OA 4Q26A 5LRRA 1RUI3 2MPFA 1BQPA 1Z7S2 1NQJA 1UYPA 3UGGA 5DAQA 4HPKB 4NVPA 2R043 3DGTA 3NV3A 3T1MA 3RNSA 3WDTA 4AK3A 5FK8A 3OD4A 1NLRA 3ASIA 1UMIA 1HJFA 4M0HA 3PHMA 3LQCA 5FAXA 1RUC1 4XFHA 4FTEA 4WM8A 3VBSA 4Z92B 3I2OA 1TVGA 4QPGA 3MLKA 4XUTA 3EYPA 2KD7A 3PMEA 4ATFA 3O1TA 4CE8A 3WQ7A 3W5NA 4LO5B 1G8WA 2YFZA 1G9AA 3PUAA 4A6OA 4BXFA 2RS51 1GQGA 2R16A 3NKTA 2W1QA 4XF9A 2BNNA 3SXWA 4IE0A 2JG8B 5FWJA 5I0SA 2WO7A 3MDPA 3HPNA 1LULA 3GBGA 5GZEA 3ZOIA 3S5AA 4FFFA 2RS12 2B5HA 3ZYGA 5G05L 2WZ8A 3E5QA 2BPA2 2UURA 4FVVA 2C9KA 3GZAA 1WCQA 3H3UA 4FSJA 5JMOA 2DU1A 4GJZA 3AXEA 2C9AA 4YGBA 3VL9A 3AL6A 4ZXEA 4TLGA 1ULCA 2BVVA 2BJSA 5ISLA 4AQTA 2W1UA 1SLTA 2VZUA 1CWPA 4NIAA 4YM1A 3WZ1A 1TME3 2QTWB 5IVJA 1AXYA 2VZRA 3MV11 2ZBJA 4QKBA 4ZY9A 1V6IA 4IGOA 5FZ4A 1WD4A 3LEIA 2OQ7A 3LSEA 3LAGA 3LPGA 1C28A 1WD3A 1V6MA 2QQVA 2ZKNA 4OLLA 5FYVA 1LOAA 4EQVA 5A32A 4HOOA 1AYN3 4EZHA 2D7FA 1LOEA 2DVBA 2PHXA 2VQ0A 3LF7A 4XHXA 5D21A 3WP3A 4B4QA 4CDXA 2VCCA 2BVBA 2VR4A 2DBIA 3ILRA 4XIOA 1H8TC 4PF5A 1GZTA 2A3WA 2BTVC 2D6NA 2UYAA 3IDCB 1ZZCA 5C6CA 1FPN3 2EA7A 3WLUA 5FPZA 1BCXA 5JIAA 1VBD2 2RS13 4MLOA 1EAH3 5IVFA 1BK1A 3ORJA 4CEYC 1JZ7A 1XE0A 2BFUS 3MW3A 2K2SA 4PIZA 1OF4A 2Y8KA 2F6BA 1ONAA 5APAA 2Z4FA 3VD4A 3RWKX 3WQBA 3UKTA 4DS0A 1U5XA 1MZEA 2HWC1 4NPMA 1YLLA 1LB2A 4OHVA 3VHPA 3IIAA 3OPTA 1UYZA 2UU8A 5F5CA 3IN9A 1DGWX 5FLHA 5FO9B 5FO8B 3AP5A 3C2UA 1RUG2 3WG2A 2F17A 3E6BA 1VP6A 3ZYHA 4O9GA 2GC0A 5F9TA 2VQUA 2ET7A 2IXHA 5L7OA 2RS52 1U12A 1ZZ9A 2GH2A 2VQAA 3JBG2 2J1TA 4RFRB 4RN5A 5J09A 1SQ4A 3S57A 2HYKA 3T0AA 2D5HA 3POBA 4MV2A 1US2A 3LCPA 4IW3A 3PUSA 3NV4A 4AQSA 1O5UA 3OOXA 1V9U2 4R9AA 2Q5TA 4YGDA 5BUVA 3VL8A 1IKQA 1U0AA 2A6WA 2ZACA 4AGGA 5EIYB 1V00A 5FPVA 2PXJA 1ZYBA 5DXDA 2H6CA 4CA9A 4PLOA 2X5IC 1CESA 1XSRA 1F5JA 4IEPA 2D5FA 4QPGC 3SKJE 3VBOB 2CGOA 1WUVA 1YQ2A 2VM9A 3QLQA 4Y1YA 3VD7A 4IV1C 4MO3M 1E57A 2BNMA 3MUY1 3VZOA 4Y5SA 1KEXA 4YG6A 5DABA 4BQ5A 5IVVA 5I8SA 5JXIA 1GQPA 3GZTB 3ZSEA 2GN7A 2ATFA 1ALYA 2VTXJ 4UFLA 2V09A 4TXWA 1O59A 4GD4A 2ORXA 2NPIA 1SCSA 5D8AB 1FNZA 3WV6A 4E2SA 2WS92 2VZSA 5KXDA 3GXUA 4NOTA 5LBEA 3TRSB 4CU8A 2BRTA 2RR11 1VBB2 1D4VB 1HN1A 4O7XA 3KQRA 2AYHA 1A34A 3RMXA 3RI9A 2ZABA 1Q8QA 3AZVA 3R0RA 3AFGA 4Y26A 2XVLA 2W39A 2CGNA 4H7LA 5FYSA 1KD7A 4JTOA 3HT1A 5FXVA 2BUKA 2HEWF 4K9SA 1AR91 4Q4Y2 2WIIB 1N1YA 4YGEA 4XURA 1KITA 1RVF2 5FLIA 1UL9A 3HQUA 2HWE2 5DUWA 5F2WA 4JRAA 1CAXA 2O0OA 5DG2A 3S7IA 3AKPA 4YVWA 2QBXA 1K5MA 4IV3B 3WW3A 1MZFA 4N43A 1DZTA 2HWF3 1XQNA 1WWYA 4XJ8A 2WNVA 3LOBA 4YM3A 3PTRB 1TEIA 4YG3A 1NCRA 4NRMA 4WZFA 2IZWA 4LO4B 3OGRA 4XFBA 4ZONA 5A3MA 2QKDA 2GALA 3ZN6B 1OVPA 1EAH2 4FTSA 3TEXA 1SBDA 1U5IA 1GNHA 1RL3A 1KRIA 5B4NA 3I2DA 3T30A 1MS8A 3U78A 3VBFA 5HXVA 1X9TA 4BZ4A 2QQPA 1POV3 5C5TA 1O7FA 4XCAA 5F3IA 1SLLA 5GLWA 4ZXKA 1D2SA 1FMD1 2AUYA 2JB8A 5T5JA 5E88A 2ZEWA 4Q29A 2QZ2A 4LLFA 4QPYA 4X8NA 5H9RA 5T54A 3T0DA 1ENRA 1J83A 3BIWE 4W6XA 2O8QA 4XETA 4FOYA 5FREA 4AI8A 3Q8AA 5FLJA 5JOYA 4IE6A 4WM7C 2WA4A 2KA3A 3AZZA 2IC1A 2FDIA 1YEWA 5GKAC 1V6LA 1QNYA 4BK4A 2RJLA 5FPUA 2OZ6A 1G7YA 4CCCA 3USSA 5EWSA 2O1QA 2IVJA 1W9YA 1HQWA 1MEC1 1WLTA 4OI2A 2VBPA 5FZ1A 2LROA 2ZA9A 1D4M2 1E5SA 4I0AA 3WNKA 5BNPA 2VOWA 4COWA 1AJOA 1W0NA 2CU5A 2YBPA 4MGSA 4BJ0A 2DCYA 2ILMA 3TEWA 4NRPA 5EV7A 4Y20A 5DUUA 2YYOA 3WY6A 5DMYA 2Y26A 2RJKA 5AC93 4OQ8A 1DQ5A 4D6SA 4BE3A 5A3UA 3CJXA 2EALA 4RHV3 3WG4A 5IWFA 1V6KA 4GKYA 4MXWA 4K20A 2OPWA 1HKDA 4HBNA 4PIYA 4CDUC 2NLRA 1EP0A 3J8F2 1F4AA 3JB8A 4AWDA 5G04L 2WWSA 4OUMA 4AE2A 4P00B 2QDRA 4V1PA 3RYRA 1S2EA 3CZJA 4LORA 4PDWA 4BPZA 1E5RA 1JYVA 4FTBA 2LM3A 2XHNA 2QQNA 4CEYA 4EN7B 3ILNA 1M4WA 1JU3A 4RD7A 1JYCA 4O65A 4XTPA 3POYA 2FDJA 1QKQA 4LQRA 2E31A 2E7AA 3PJQA 2B4KA 4UFMA 4UW6A 3B3QE 3WHUA 1KGYA 2V4AA 2VVEA 4IEVA 5T50A 3ZDSA 4GH4B 4JDNA 2ZX1A 4KNCA 3ACLA 3N3HA 3ZSKA 4JQRA 1HB1A 3G7DA 5FXXA 1UY3A 4A3ZA 2Q0AA 3C7GA 1JOJA 1ENXA 4FFIA 2R30A 3ECQA 1GU3A 3HNYM 4HSLA 2WYFA 3IIIA 1W99A 2WO3A 4K40A 4LULA 1AR72 1WCDJ 4YRDA 5FOBB 2HBTA 2RMU3 5BNOC 4LHKA 1B09A 1I3HA 2D3PA 4BXSV 5CA6A 1G9DA 2WZPP 3RZMA 5LA2A 4LUKA 3AYDA 5LBBA 1BBT3 3OUJA 3N7MA 4P9GA 1QH6A 4AEKA 1KS5A 1NCRC 4CXXA 5JXHA 1ZX5A 3DKQA 2OUJA 1LU1A 2DVGA 3CZUA 3DECA 1PO23 2V5DA 2E7QA 1N3PA 2ETEA 4M00A 1NXD1 2VOVA 3PMSA 4D94A 2XONA 5LB6A 3VHOA 3ZSMA 2Z5WA 4WM8C 4LHLA 1LR5A 4UWDA 4FT8A 1S0EA 2I45A 2FMDA 2X5IB 2JDKA 3M1HA 3POEA 1D0GA 1ASJ3 2ZMLA 3ST7A 1XB9A 3BODA 4XDQA 3T3YA 1OXCA 2JICA 2R6QA 4CDXB 3P3PA 5L9VA 1CD3G 4FOWA 4U36A 2KM2A 3Q8EA 1Z78A 3O1SA 2SLIA 2XBO1 2YY1A 3HNBM 4XJAA 3ZXEA 5A1AA 2QDNA 3ZDVA 2VNVA 2HWF1 4JX0A 4Y1UA 1AR73 1RITA 5DDJ1 2X10A 2JX9A 2BGCA 4Y24A 3DUIA 4D69A 5J1XA 5L36A 2ID4A 4Q4V2 1HB4A 3DXTA 1NLQA 2AEZA 3CDZB 4K6BA 3T08A 1PVC2 1QOTA 1SBFA 1DQ2A 4HVOA 1ULPA 2VU9A 3UNPA 3INAA 5FMDA 4NPRA 1ULOA 2R071 4LLOA 4N9IA 4P9XA 3T2TA 4QU2A 2NN8A 2XKOA 3LDKA 4MGQA 2A6YA 3KHCA 5E8AA 2UWAA 4CXWA 4KBBA 3UESA 1H1AA 2QQIA 2GAUA 4QX8A 4XFGA 3O14A 2WL1A 2VVFA 2R063 4XIKA 1VR3A 2JDZA 1LOFA 4PJYA 1J3PA 1DHKB 4J6GA 3T2OA 4B8EA 2BFUL 4YARA 1VBE1 1R083 1JS9A 2CSGA 2Y38A 4XF1A 3IAPA 1XRUA 2AC1A 5A7PA 5LA1A 4O9EA 2GU9A 3OJBA 2OKXA 3LIGA 3K46A 2R7EB 4L92A 1XJAA 4Q4V1 4I2OA 3R4SA 3AZWA 4GULA 1WW5A 4BK5A 1O8PA 4M3CF 2ZX2A 1QXRA 4HK9A 3WNXA 1SLAA 1F8VA 3WT3A 4E8DA 4EZ4A 3MPBA 4CP9A 2RV9A 2OS2A 3LEKA 4GA9A 5FP4A 1MACA 3ILFA 4MADA 4V2WA 3WD5A 3DV8A 5FZHA 3BTAA 3B01A 1F35A 2CV6A 5IVBA 1AR82 1CN1A 3T2PA 4OI0A 4DY5A 5D8AC 2JENA 4I30A 2DVFA 5JDBA 2WO1A 4Q0SA 5AVAA 4L2NA 3IZOA 1WCKA 2EIBA 4NWVA 1Y9MA 2RVAA 5FZ3A 5BNOA 3RDIA 1OKOA 1JZ6A 5FZFA 3O1VA 4IEUA 1JI6A 1ASJ1 2HYXA 5H9SA 1I6XA 4NHMA 1VBA2 2PQQA 4IQPA 5IT6A 2DFBA 4NPLA 3PU8A 3RZJA 3M4FA 3NAPC 1NA1B 4I3GA 2PYTA 1OUSA 2RDSA 2A7AA 1N47A 3E5XA 4UXAA 1PNFA 4IV3A 4UFJA 1QQP2 1UPIA 3BUCA 1R1A2 1RMU1 1ZBE1 4JKLA 1RUJ1 5E6HA 2OYZA 2JKXA 3TN92 3W58A 2CAUA 4META 1W9FA 3M3EA 4AFMA 1P8JA 4AVCA 5LBCA 4IV1A 2JE9A 4AI0A 1SFPA 2JE8A 3ZPOA 1QQP3 5AFEA 4PDWC 4PIXA 4AF9A 4BQ2A 1ND2C 4LKDA 1J58A 1AYM2 1SHWB 2F4LA 2WFF2 3UYJA 4CDWB 1ND2A 3AP4A 2YHJA 3CKHA 3G6JB 3POWA 1OFNA 5I0TA 3ZKYA 4ARXA 3QOPA 2W91A 4XVHA 1W9TA 2WAAA 1YJKA 1UNBA 4Q8KA 5FTTC 1XXNA 5CVRA 1ODMA 1B35A 3HN3A 3THTA 1WW4A 1HIXA 1Z0HA 2ZEZA 4WVMA 4GB32 5F32A 2VECA 1JXNA 1PM7A 1W2OA 2PLV2 1J1TA 4JTNA 3QH7A 5CB7A 1AYN1 3IWZA 4GH4C 4CTEA 3WNLA 3IKWA 2YU1A 1RXFA 3IBMA 2OIIA 3USUA 3K75B 4JC1A 1DQ1A 1JOPA 3D5OA 3ZIXA 4C1WA 4YG0A 2DTWA 1PMIA 2ZPXA 4LHNA 3H3LA 4B1MA 3WDXA 2RHPA 2VCBA 3ZVXA 1CGPA 4ZZ8A 2IXIA 1XBFA 4NIGA 2BYVE 3NNJA 2BERA 5CYYA 3B02A 1LECA 3E6DA 3ZM8A 5GLZA 5ACA3 2RS32 1RYYA 1KFXL 3B00A 3I2IA 4GQ7A 4HLTA 3IM0A 5FY1A 4ITCA 1NLSA 2HH9A 4LBLA 3E1F1 2QQKA 1TME2 2HWD3 1H9PA 3PUHA 3QBQA 5CADA 1IQAA 2Z42A 3KB5A 4NIDA 4MH0E 2DV9A 4DXTA 5C9AA 1JZ4A 5EYYA 2ZGLA 2Q8DA 4XILA 5TSWA 2H0VA 3WDYA 3ZSJA 2FDKA 1W28A 1ENSA 3I3DA 2YC4A 4AI9A 4P9WA 1HW5A 4QXBA 3VBRC 1WLCA 4JCKA 1YIPA 2EXHA 4M01A 2DFCA 2VUJA 5FZEA 2EVXA 2HJIA 3TNPB 1AR92 2RS11 2NM1A 3P1IA 3N36A 5A7WB 1C1LA 4QX3A 1IHMA 2QCSB 3KT1A 2BV4A 4LKFA 3UL2A 5I0DA 3FX3A 4X6QB 4CUAA 1RUD1 1OOPA 1O3TA 1QJEA 2A3XA 4BLJA 3FUQA 3FBYA 2ARCA 4Q4W2 2D43A 1LTEA 4RYDA 2Y0IA 3ITQA 5DG1A 5FFOC 5IVEA 1W0OA 4M4RA 1GZCA 2TUNA 1GZWB 3I4IA 3HR9A 1LOCA 1W2AX 1XC6A 5FZMA 3SNMA 3ZN4A 4MHRA 2A73B 4FPEA 4YVSB 1TME1 1NCQB 1Y43B 2PHFA 4INDA 4KWUA 4G3YC 1AX0A 1O5LA 3AJYA 3OCPA 2W2IA 3DKWA 3W59A 3GCWA 5K7PA 1BHGA 3POSA 1LOFC 2P3YA 3F2ZA 4LO8A 2DCJA 1A6CA 4EJRA 3AYEA 1F9KA 4PQQA 4CDUA 1GNZA 3AVRA 4HKOA 4MSVA 3L9JT 3R4DB 2UY8A 3ZO0B 5EHDA 1ZBA1 4K1YA 4OULA 4OUSA 4HN0A 2LUWA 3VZNA 2W1SA 4LOSA 2FCVA 5F8PA 1CR7A 1UY2A 3AX4A 5FYTA 4D6QA 1W6MB 1JBCA 2RS31 1JOBA 1OBNA 1ND3C 1S2KA 3SKVA 5KC5A 2PHTA 2ZEYA 3OPZA 1RC6A 4GAZA 4QGMA 1HV1A 2ZHMA 3ZFEA 3MI8A 1RJ7A 3NNMA 3C7FA 4CUCA 1B35C 3NNFA 1UMHA 4ZU5A 1US3A 2GNTA 4IE4A 3ZFEC 4CDQB 1DBNA 5J96B 4AVSA 4E27A 1YUDA 2PHWA 3PLQA 3Q8CA 5LW9A 1VPHA 4DRVA 5F2SA 4FQZA 4A7YA 3NKGA 3UGHA 3GJBA 2C5DA 4B1LA 3USUB 1Q56A 2G1MA 3DCQA 4CU6A 1RHI3 1R091 5L9RA 4FCAA 4PI0A 4YW7A 4BOWA 3OYWB 4UF0A 1H4HA 2XR4A 1DGLA 1RUOA 3WP6A 1TNRA 2R49A 2DWRA 5LY2A 2XHKA 3CLPA 3WP4A 4LMFA 5FBZA 1LHUA 3OUIA 4K8FA 4YW2A 2ARXA 3AVSA 1NQDA 4GALA 4N90A 4MOAA 3WDVA 4FAHA 5J36A 4YW3A 2GMPA 2H6BA 4OHZA 4Q2FA 1LNSA 1X8EA 1RUJ3 4D7YA 2NMNA 3LA2A 3ENRA 4YSFA 1HQNA 3H8OA 1OSGA 3NAPB 1REEA 5A3TA 2J1UA 1FX5A 1ULGA 1UMZA 3T1LA 4BU2A 1RUE3 4KWLA 3B93A 5FYCA 4MG2A 3EBRA 5DQ0A 2D6OX 4ES8A 5FXWA 5A7QA 4FPJA 5ACA2 4CCNA 1MS5A 1NA1A 1RUC2 1H1MA 2FBEA 4N43C 5A7SA 3OD0A 1NA1C 4L0PA 2WNVB 3ZN6A 4FP3A 1IG0A 3E97A 2CL2A 3I97A 1IS4A 4W50A 1UZWA 4XW3A 4BHPA 1RXGA 1C8M2 2WNUB 4LUMA 2IXJA 2OQ6A 2D6KA 3GGLA 3ZMNA 4BISA 2W0XA 4N7UA 3IDEA 1G9BA 1DF0A 2JG9B 3J7LA 3P5BA 5C3PA 5C3RA 1AR71 5DDJ3 2VXJA 1OOPB 1DFQA 4EWEA 2D98A 4TWTA 3RSJA 4NHKA 3WW1A 1RUG1 2R1DA 2HWB2 3PL0A 3MFAA 4QGLA 5CKNA 2XVGA 3MIFA 5SV5A 1AL23 5A1LA 1NAEA 5FIXA 1QU0A 1YFUA 2VE1A 3B69A 4MGIE 1STMA 2WYSA 3C7HA 4Q0QA 4ZU4A 2NYYA 2BBVA 4QDQA 1GFF2 1HJGA 5AVPA 3BYWA 3ZSLA 1OQDA 2ZGPA 1YIFA 2ZHLA 3S30A 4ZZ5A 2WWUA 4QX5A 1SCRA 3KCCA 4ASLA 4RQPB 1AYM1 1XNDA 2DCKA 2Q8EA 4PLNA 2E32A 4A4AA 4YZ5A 2AREA 1OLME 4UAPA 4UFHA 5J37A 2C4XA 4E4SA 3ACFA 1S0BA 1FAYA 2VNRA 3CF6E 3CNAA 3IDAA 5JIUA 1CAVB 3ON7A 4J25A 5EQUA 1Q8OA 4HN1A 3RJ2X 5LY1A 2J1AA 4XXPA 2PAKA 5GJ6A 5FPXA 4E4ZA 2VUCA 3FHIB 5A1FA 5JPMB 1CVNA 3GM8A 2FZ1A 5JSRA 2VZ1A 2BWAA 2JIGA 2UWCA 3D3AA 4M3CE 4Y1ZA 2XDVA 5BXXA 4FOQA 4D7TA 2FHRA 2E6VA 1JUIA 3NVCA 2VZ3A 4AYUA 4I09A 2GMEA 3HQXA 3LOIA 2OUHA 2I2SA 4P08A 4ZKTB 1AL22 1FOD1 4UOJA 2CYFA 1DQ6A 1VIWB 5KXBA 1YI7A 2GP5A 1UWWA 4JVAA 2XVKA 2VTXA 3M70A 1EV13 3FL7A 1UU5A 4GJYA 2R32A 4UW3A 4CUGA 1D4M1 3B5LB 1FPN2 4Q4Y3 1ASJ2 4XDPA 4QQOA 3LA3A 1JYWA 1OMIA 2BBAA 4JGYA 2B7YA 5LA9A 5EJ3A 4CPBA 1C5IA 1YRZA 2B9VA 1K3IA 4JGZC 4WVMB 1SPPB 2BGPA 3OYWA 3H50A 4UF0B 2QJVA 4MX3A 3WX5A 1H9WA 3D6EA 3VZKA 2R1BA 4LBJA 3U1XA 4IGQA 1I1EA 1JZ3A 1DCSA 4GH4A 3RWNA 5L19A 2LALA 3NAPA 1BMV2 4FPLA 1EPZA 2QFEA 2G9FA 2Y34A 1TMF2 3VLBB 4AHWA 1ZA7A 3WVJA 1UZYA 4N8MA 5FP8A 3CIHA 1O3SA 2YGMA 4KL1A 4BIOA 2FDGA 1PIV3 3IAQA 1JW6A 5I8YA 2YGLA 1HRV1 2WFF3 3CO2A 2WNVC 1CAVA 3KCXA 4DZGA 2PHLA 1PMHX 1C8NA 3JD71 4LK7A 2WUHA 2A3YA 1ENQA 3J9SA 4RHV2 2ZMNA 2C1FA 5IVYA 5GZFA 1W03A 4QX7A 3V64A 4AI2A 1JYTA 2OZJA 1OD3A 1E5IA 2VMGA 3A23A 4ZS2A 3WQ0A 3BOPA 5FZ7A 1AR81 1UOFA 4YLZA 1LODA 4Q1PA 5IAXA 2WN2A 2W3JA 3SCFA 3I2JA 1RVF1 2B39A 3PVEA 4IETA 4E9KA 4AEJA 3I7DA 4QX1A 4FP2A 4IEZA 5JSPA 2YC2A 4CXYA 2WSUA 2XUMA 2XWJB 3ZYFA 5KC6A 4IEXA 4WM7A 4AGVA 2YC0A 2JE7A 2WQ4A 1PHMA 2VW1A 4LE3A 1OPOA 3SH3A 1Q43A 3AKTA 3GNEA 4XUPA 4BYYA 5JOWA 2XH6A 2C24A 1NXMA 3AZXA 3H7JA 5T52A 1DGRN 2WDBA 2WWJA 1AL21 1FOD2 1ST8A 2WKKA 3KZ4C 1SPPA 1Z7S3 1S0CA 3PNAA 4GWNA 5FMCA 4AFBA 1W39A 1Y9QA 3B9IA 2XL9A 1XNTA 4Z2WA 2VNGA 1AX2A 5A3NA 1VRH1 3WHTA 3IMMA 4DPNA 4J1XA 3VDBA 3P6BA 2Z2SB 4RHV1 4QWNA 4C91A 5FYYA 3HN1A 1RUH1 4XUQA 2EIEA 1NCQA 3H9AA 2TEPA 2ZGOA 5DAWA 4H55A 4XUNA 1KJRA 2OT7A 2OVUA 1CJDA 1TQ5A 4EWDA 3TEYA 4EN0A 3ACIA 1W2NA 4COZA 3MIDA 4QXKA 2IWGB 3MO4A 4KWJA 5FYIA 1CAWB 1XNBA 3A7QA 1C57A 4B7KA 1SFYA 2JDHA 3FN9A 3S7EA 1A8DA 5IJRA 3O12A 1PO21 2DDUA 2PAEA 3HAGA 4HVRA 5CFCA 1H8TA 1LJ7A 2DUPA 3D0SA 3CU7A 4LOTA 4QM8A 4RL7A 3OPWA 3K2OA 1FI2A 4RGGA 5FQ0B 4XBQA 4JDMA 5FY5A 3KLSA 3UV9A 2P4EA 1ND3A 2VW0A 1OH3A 3KGLA 1UY0A 2WNUC 2EXJA 2F4PA 1GZ9A 5A3OA 1O8SA 3H3ZA 4TTGA 1COV1 1UX7A 2WAOA 4HFSA 4NHXA 3FJSA 2PHDA 2KXLA 1D0HA 2JDPA 1YFYA 4JGZB 4HKLA 1WKYA 5CFDB 2IXKA 5FZKA 1WMFA 2WS93 1W3XA 1PO22 4Y5Z0 1MS3A 1FMD3 3WXPA 1LOGA 3LFIA 3EJKA 2P17A 4LT5A 1EPWA 3OGJA 3J8F3
chains in the Genus database with same CATH topology
1W0PA 4XJ9A 2YXSA 1UIJA 4IL7A 4FOVA 5IUQA 3WR0A 1QJX3 2MHFA 1H4GA 1C5HA 2BW8A 4MGZE 5FO7B 1JN2P 4ISQA 3S6PA 4NN0A 2A70A 4DOUA 2WSVA 5F6KA 1OHFA 1VRH3 4RA0A 2R0FA 3M3IA 2YV8A 5DUXA 2DVAA 4IV3C 5T55A 1PZ7A 3AP7A 2XGXA 1BYHA 1RUH2 4XE9A 3SCHA 3PVNA 3TN93 1WMDA 1IS3A 1V6JA 4XTMA 2B42B 1HXS3 1LCLA 4BMBA 3LSDA 1H2KA 3JBG1 2JG9A 1VALA 4QQPA 3KMHA 2XKPA 1QMJA 2WFPA 3UKNA 1UPSA 1LHWA 1YXWA 5CIRA 3M7AA 1ND3B 4XQ4A 2E53A 2ZZJA 3WP5A 4FAGA 2D3SA 4BQ1A 3KT7A 5HCAA 2WJSA 1B35B 4Q0PA 2CY6A 4R4ZA 4GMP3 2TBVA 2XL7A 1NYWA 1X82A 3AYCA 4MZUA 4YZ1A 3GBWA 1VBE2 3M3QA 1N3QA 1K5MC 4FPYA 1VBC3 1JHNA 4YZ4A 3HIFA 3J26N 4OHXA 4D3WA 1CAWA 1KDKA 4K3UA 3FLPA 4P9JA 1AX1A 4JRLA 4HVQA 2GC1A 5KXCA 2VH9A 3A0NA 2R0HA 4RFT0 5LK7B 4CRQA 1UZZA 4R52A 1NE4A 3D4KA 2DUQA 3OTFA 1NCRB 3KT4A 1DDLA 2GSYA 4QHBA 1XNCA 4IEYA 4Z82A 3CEWA 1UAIA 3HD8B 5FMOL 3I8TA 4JAAA 2XJQA 3AB0A 2HWE1 1S0IA 4HT1T 4BMEA 4FO9A 3B9CA 1O4ZA 3FLRA 1AR93 1VAKA 2ES3A 2VNOA 1QOOA 5CG8A 1QXPA 1VBA3 3FWEA 5KHHA 1VBE3 3ES4A 4JGYB 2IXCA 4F7ZA 1GBGA 3V0BA 1SACA 1Q3EA 5JI7A 1PK6C 4AGRA 4FPHA 3W9AA 5BNPC 2QZ3A 4HK8A 5JPNB 3A0KA 1OLQA 2QUOA 3JZVA 1KXGA 2A6VA 3N35A 3VBHC 4XXAA 1R081 1C8M1 2P34A 3H1WA 5EXOA 5JI9A 3AMPA 4TLFA 4YVSA 2CWMA 4AI3A 4HANA 5KBFA 1LHNA 3OBRA 4KQ7A 3WUCA 1XE7A 4FXKB 5ABJC 5L73A 1SFNA 4Y4YA 1W6PA 2PN5A 3J4UH 3ETQA 4Q4X1 1AYN2 4FPKA 3IT8A 4KU8A 2VOXA 3GHNA 1RUD2 4Q0VA 3JU9A 1I1EA 2RE9A 3ZXLA 4CEWB 3FFZA 3EHKA 5KXEA 5DZGA 4XOGA 1QHDA 2WT0A 4XFCA 3MIEA 3SITA 4W65A 1ULEA 2ZGTA 3EO6A 5FQ0A 1A78A 2E9QA 2GN3A 2HWB3 4CEYB 4YW1A 1ZNPA 4LE4A 1EYBA 3ELNA 4P9LA 1VBC1 3V56A 2TNFA 3J8F1 1FMD2 2YZ4A 4PQ9A 2P37A 1EAH1 5BNNC 3O0WA 1AXKA 1SLBA 4B4PA 2RR13 2A6ZA 3BCWA 4IERA 1YO8A 1DZQA 1UN1A 1N1TA 1ZRDA 1LGBA 1QJX2 1ZZ7A 3MYXA 4N43B 1WLDA 2MEV3 1J1LA 4LNVA 2ZGUA 4HKWA 3SHRA 2WINB 1PO13 2VW2A 5DUVA 4YYOA 1FT9A 3URFA 1PIV1 2I07B 1M06G 2B8MA 3JUUA 4YW5A 1IZ3A 4PLMA 3MFCA 4Q4W1 4E2GA 3TYJA 1MVEA 4XQWA 1BEV1 1I9RA 4F8AA 1RINA 2Q1MA 1LU2A 4XZPA 3OGGA 1UW8A 2AZ5A 5HCFA 1EY2A 4N7IA 5HI0A 3V0AB 5CAZA 5H9QA 1HRI2 1PIV2 1QJY2 4LR4A 3U07A 1CX4A 1MVQA 4LO6B 2B45X 1ZZBA 2ZJCA 4KGQA 4LBOA 4WVVA 3AFKA 3VBHA 2OPKA 1QJX1 1J59A 5T5OA 4IEOA 3GALA 5EYXA 1JYIA 4HL0A 2ERFA 1OFSA 1Z7S1 3H0OA 4QMAA 4COVA 2PAMA 4AVAA 4C0HA 2X53S 1O91A 2AR6A 2IXLA 1VBC2 4J1WA 2FZ2A 1PNGA 1UU4A 2LTNA 2X29A 3FLTA 3FUOA 3U4XA 1PGL1 1K5MB 3UJOA 4WVWA 3UJQA 1W2UA 4WZCA 4L8QA 4Q8LA 1QF3A 1AR61 3PVOA 1LESA 4MYEA 3RMYA 5F6LB 4IEWA 1MZ5A 2ZZQA 3FFQA 3IPVA 3RYPA 4LO7A 1HXS1 2CTVA 1Q8PA 1XYPA 3DN7A 5IK7A 4SBVA 2QVSB 2XLGA 2GMMA 3JCIA 3KGZA 1ULFA 3AKSA 3ZYRA 5JWPA 4BLIA 3VBFB 4ZU7A 1QOSA 4WM7B 1ZBA2 1MS9A 2D6MA 4E4DX 5A32B 2W68A 1QXJA 5JZGA 5D8AA 1D2QA 3WG1A 1LRHA 1V6NA 5LK5A 4AI1A 3R4UA 1GYKA 1BJQA 2EXKA 4ES9A 2XLAA 5GLTA 3VV1A 3TBDA 4IXLA 4JV4A 2W08A 1MS1A 4YVSC 3EQEA 1IGOA 4OHWA 4I0BA 4GXLA 1BBT2 4OI4A 4EV0A 2OW4A 4LEJA 2PFWA 3NL1A 4F3JA 1HXS2 2WNEA 1XYNA 3VKMA 1BZWA 3TOJA 4RR3B 2XJPA 3M2MA 4L9BA 4HETA 1G9CA 5A3LA 3D0JA 1G6NA 4PCRA 3ZYPA 3D8CA 5J48A 1VBD1 4YW4A 1C1FA 1YFWA 1H2NA 1PGL2 1RB8G 1EV12 1WGPA 3BOWA 4BCUA 5C8WA 1CPMA 4CDQC 3N7JA 2FQPA 2D40A 4EN9B 4CDQA 1AR62 3DPRA 4ORFA 1TMF3 1RUF2 5KWRA 4UBHA 3NV1A 3U0ZA 4LBNA 2DTYA 3RG0A 5FRAA 4JDOA 2VUAA 1HX6A 1REFA 3VBOC 3R6SA 3MLJA 3GZUC 5C4WB 5HCBA 1WMEA 1AYM3 4AFAA 1N1SA 4CP1A 1VBA1 4AEDC 4XJZA 1ZREA 1C3HA 3AMNA 3CL1A 5BNNB 1DIWA 1PK6A 5AC92 3NWKA 5I0UA 1WBFA 3RRDA 3FMGA 1YYNA 3LZZA 2WT1A 2XJSA 5I91A 2ZX4A 2Q1ZB 3VDDA 1NCQC 4IESA 5E1RA 2VG9A 1OD5A 3ME2A 4BIFA 3GBFA 2Z69A 4AHYA 3HBZA 1EV11 4PBPA 1FATA 3CJIB 2MEV2 3BALA 1Y7BA 1FOD3 2ENRA 1OQ1A 3IPVB 5JVVA 1VBB1 2XJUA 2PLV1 2Q30A 4FPCA 1COV3 2IFWA 1OOPC 3AMHA 1APNA 3H1YA 2ZGSA 2BQPA 2GC2A 4PBOA 1REDA 2MEV1 1S1AA 1F2NA 4GKXA 3VBSB 2GNMA 4E2QA 3ATGA 2RMU2 1VAVA 3FE5A 5JLVA 4NHLA 3E5UA 3TN91 3OY8B 3ZPYA 3M3OA 1DYPA 1Q5OA 1ZA4A 2EF6A 4YZ3A 5T5PA 4DB5A 5GLUA 1PZ8A 1I5ZA 1R093 2P3JA 2R062 4XJWA 4YFWA 1QJY1 4QT6A 4Z1VA 2O8OA 2BEOA 1ZM1A 1GR3A 2HKXA 4NR1A 3RQ0A 3SMHA 3V65A 3ZXKA 4M3CA 4EN6B 1COV2 5L7OC 1BXHA 4RGAA 1IPJA 5JR7B 4Z07A 1X8MA 5GLVA 1MEC2 1X50A 4YM0A 4A2UA 5KHGA 3PJYA 4XBLA 2WS91 3Q9OA 1F5FA 4XFAA 4OI1A 3MICA 1RHI2 3ZFFC 2NZ9A 2ZGKA 3ES1A 1OA3A 3ZX7A 2WT2A 4AEDB 2XG3A 1RVF3 1TMF1 2MNGA 4YZ2A 5BNNA 3ZIWA 4DNYA 4FPGA 1VBD3 1QJZA 2ARBA 1RUI1 4AFDA 4HZFA 4X8PA 3L2HA 4XPVA 1WLWA 3MEPA 1CONA 4DY3A 1S0JA 3MF6A 1YI9A 5LRSA 2HWD2 4M0NA 3LWCA 2DCZA 4W6YA 1SBEA 1XNKA 2EAKA 1CAUB 3HMYA 4QM9A 1BVP1 1UKGA 4N9HA 3ZYIB 4OHYA 2CWSA 5CFCC 1GANA 3C3VA 2DYCA 3SH5A 4XF4A 1RJ8A 4R9CA 4B29A 5JMCA 4RR3A 5EZWA 3ZFGB 4BH9A 5JSOA 2VXRA 1AF9A 3VKLA 2ZX0A 3H7YA 2HWD1 1PGW1 4KWKA 4BM8A 2NMOA 2WNUA 1LENA 2ZTNA 4MUVA 4NO4A 2XBO3 4Q4X3 4B4RA 2D93A 2CAVA 4I02A 4PDWB 5CG9A 4FBFA 1F31A 2FMYA 5ACA1 5LEJA 4AVVA 2WLQA 3ZN5A 1LGNA 3VBSC 2VY0A 1RUE1 4XYXA 3FBMA 2VGDA 3N4MA 3O0VA 2Q8OA 1LEDA 2D44A 1IS6A 1HDKA 1LGCA 4ATEA 3X29B 1SEFA 4H3WA 1XE8A 4Q27A 3H1MA 1U5ZA 1ZRRA 4R4XA 4Y20B 4DRRA 5FDBA 5L7OB 4XQDA 1GLHA 2I74A 3WDWA 5K0UC 5ABJA 3JBG3 1LHOA 1R092 3KSCA 1V6OA 4YVWB 2ZGQA 5JCTA 3AP9A 4COYA 1IOAA 3HT2A 4GB33 3VGIA 3NV2A 3ZXAC 1MS4A 2HWF2 4I2OA 2P2KA 1QGLA 1YCIA 5C9AB 1PVXA 3ZFGA 1WBLA 1S0GA 1AUYA 1ND2B 4A3XA 3AP6A 1QWRA 1FNYA 1AZDA 4FQ4A 1GQHA 1AJKA 2P3IA 5GM0A 1J3QA 2GNBA 1UX6A 5FMOS 1X36A 4ONUA 1RTVA 1YHFA 2GZWA 2HWC3 2R072 3VBHB 4H14A 4S2HA 1JTZX 5C4WC 1DGRA 1GZWA 1XU1A 2QNKA 1S0DA 3I54A 1N3OA 3DF0A 4XFIA 1VLNA 1RUF1 1J3RA 2ZGNA 4YM2A 3VHNA 3AK0A 4GMP1 4N53C 1FV3A 3JQXA 2XJTA 1ZZ6A 3ZXDA 2UY9A 2QE3A 4EROA 1PVC1 4LA3A 3VBUB 3RZZA 2AGSA 4R9BA 1FXZA 4MGYE 1RUD3 1AR63 3VDDC 3B7MA 5HBAA 2B9UA 3NO8A 3SLIA 4CEWC 3ALQA 1X33A 4OZXA 4K7JA 1GV9A 4C90A 5DDJ2 1H2LA 1OLRA 3MGUA 2WLPA 4AG4A 3MZHA 1UIKA 1PVC3 2K9ZA 3M3CA 2R061 3VBRB 4IV1B 4HPKA 5I0RA 4A7KA 4QPIA 1RUG3 3TAYA 1OA4A 1RIRA 2PHUA 1POV1 1BMV1 1HRI3 1XU2A 4CDWC 4L11A 4F83A 5E89A 3RS6A 2VMHA 2B46X 4COUA 3AM2A 1RMU2 4OFGA 5AFBA 1FYUA 5CNAA 4X6RB 1KQRA 1VAMA 1C4RA 1O4TA 3VUOA 1RGSA 5BNOB 1O3RA 2ZMKA 1G86A 1NOVA 3LGRA 5K0UA 1N1VA 4EWAA 4ASMB 2D97A 2JG8C 2E63A 2YPJA 1VB4A 2VOKA 1KS4A 1DZRA 1GKBA 2A5ZA 5C8CB 2RS53 3D82A 1ZRCA 3VBUA 4M3CB 3NJZA 1UU6A 3M8LA 3ZFGC 2JXAA 5FOJB 1IS5A 1RUI2 3ZFEB 1H30A 3AZYA 3AMQA 5CFCB 1HRV2 5DZEA 4CDXC 4RS5C 2DURA 2JECA 4RS5A 1QQP1 3GHMA 1ZZ8A 1KJLA 3QD6A 2WQZC 1W6OB 3RPQA 4YNIA 1MR5A 5A33A 2YUEA 2BWCA 3A4UA 3KM5A 4Q4X2 4QPGB 1W6QA 4S2DA 1VRH2 4QPIB 2A6XA 3ZXFA 5GZGA 3O7OA 4XMIA 1V9U1 5F1RA 4P9YA 2NQYA 5JZGB 3APBA 2JJ6A 1RUH3 5K9YA 5T3NA 1AL0G 1R1A3 2WZR3 2C0ZA 1ZBE2 4AHXA 1S2BA 2W52A 1PK6B 1HLCA 3VKNA 1NY71 2G9GA 1YNAA 4HMZA 4FPFA 2RM23 3WUDA 2ZS6B 1Q8SA 3QCWA 3MIBA 1QJY3 1HRI1 1ZBA3 3QACA 1YFXA 4XMAA 1H0BA 1CAUA 3VHRA 3FZ3A 2ZHKA 4BWOA 5ABJB 3MPPG 1NY72 4P14A 2JG9C 4AXOA 3THPA 3AKRA 4CDUB 1PO11 4LA2A 3B94A 2X5IA 4W6WA 5IK5A 2NP0A 1VB2A 4Q4W3 1SLCA 1QJU3 1W6MA 4AQ6A 2ZX3A 1HQLA 4Y22A 1W6OA 3KD4A 2DVDA 4UW5A 3DPRC 4XHBA 4XEZA 1CJPA 1SMVA 1W6NB 1W6QB 1YJLA 2VPVA 5C4WA 3ZFFB 3WINE 4I01A 5KHIA 3ZMOA 2VMIA 4SLIA 2GC3A 1QJU1 2Z79A 2R073 1DGWA 1VBB3 1MS0A 5GALA 1QNWA 2ET1A 3WQ1A 5JOXA 1CIWA 4KG8A 5SV8A 3DL3A 3VKFC 2JG8A 1LEMA 1UCXA 4ISRA 3H8UA 3CJIC 1SLIA 1V70A 4LBQB 2JEMA 4EN8B 4I0WB 4XF3A 1BEV2 2ZAHA 3EXUA 4WBBA 3MIHA 2VVDA 5C8CA 2HWB1 5C8CC 1QJU2 4B3NA 2H0BA 1QH7A 5DZFA 2ZAAA 2RM21 3AJZA 4LBMA 3WCRA 1O4YA 3K48A 3UK9A 2JD4A 2ZGMA 2E51A 3N7LA 4DINB 4I3PA 1DLLA 5GZDA 4QPIC 3SISA 1MQTA 1UKRA 5BNQA 5BV6A 2HEYF 4B7EA 4AHZA 2WA3A 5AC91 4KH9A 5JZGC 4KU7A 3P3NA 4WM8B 4CDWA 1QY4A 1C8M3 2ZHNA 3MLLA 3VBRA 2DU0A 4QQ2A 1AHSA 1Q8VA 2RM22 4Y1XA 4AFCA 1W6NA 4QD2A 1G9FA 3OY8A 4C0BA 1A3KA 3IDBB 4URTA 4S2FA 1T6GC 1AXZA 1CPNA 4TYSA 2PLV3 1JUHA 4LTAA 1AR83 3NSTA 1RMU3 3LKJA 4CZSA 5F5QA 5BPXA 4KGGA 2D6PA 2DUOA 3KS7A 1L3JA 2YROA 2PA7A 2HWE3 2YDEA 4L97A 1UD1A 2PELA 2XBO2 3I59B 4XF0A 5KHKA 1A8MA 2ZOEB 3LB9A 2P3KA 1R1ZA 4N53A 5B2GB 3TNQA 1AVBA 2XB6C 2YMZA 3VN4A 5CBLA 4YGCA 4G4FA 2A71A 2HWC2 3AXDA 2DF7A 1LKNA 3OF1A 1WA4A 4MXWB 4WV8A 1SDWA 1DG6A 4QQLA 4XBNA 3SH4A 4L99A 4TZDA 2XLFA 4QGNA 1MQTB 1NE6A 2VULA 5JAXA 1R1A1 4Y22B 3ZFFA 1RUJ2 4RS5B 1TNFA 3VBOA 2EAAA 3O5SA 1V9U3 5A33B 1QDOA 2GNDA 3QH6A 4Y1VA 1QDCA 5I8TA 4AEDA 1GSLA 3WW4A 3MIGA 4K21A 1OPMA 2PTMA 4LBQD 1KFUL 1WCSA 4MXVA 3NW4A 1OA2A 3TWIA 4AVTA 4P5HA 5T5LA 2XJRA 4OVEA 4Q4V3 4GWMA 4RQPA 4MGKE 4U2AA 5J3UA 2G4IA 1XYOA 3HWJA 3ZXGA 2D3RA 1FPN1 2PHRA 1BKZA 2X8KA 1RHI1 3VZJA 3S0MA 1HRV3 2WFF1 5JOZA 1POV0 3MW2A 1PGSA 3AYAA 4FXGB 1ULDA 3SCGA 1WW6A 2BNOA 4A7ZA 4N53B 2V73A 2ZCWA 3N7KA 3U10A 3UKVA 1URXA 1OKQA 4QQHA 5BY5A 2RR12 4AW7A 2XJVA 4FPOB 3VBUC 5IK8A 1KDMA 5FCCA 4RR3C 1H8TB 5D1IA 5J7MA 4BA6A 5E16A 3RJRA 3VZLA 1UF2C 3WW2A 2UYBA 1YWKA 1GICA 3JQWA 4TSVA 1FV2A 3ROUA 4D7SA 2V5YA 4H7MA 2A75A 3DPRB 1DQ0A 1S55A 3V0AA 1H1IA 4C1XA 1CQ9A 3VBFC 4Q4Y1 3KCYA 3ZYJB 2AH2A 2GH8A 2WZR1 1IPKA 5C33A 4GMP0 2WC2A 1LHVA 5EFUA 3MW4A 2R042 1RUC3 4CP0A 4NWWA 2K0GA 2GDFA 3JB4C 4DQAA 1WW7A 1H8VA 2EXIA 4K1ZA 5J98B 4YFZA 4WVZA 3L2YA 5K0UB 1BVVA 2Q4SA 2UWBA 3U11A 1DQ4A 3RI8A 4G9SB 4UW4A 4AQ2A 4YVWC 5IK4A 2EIGA 1Y3TA 2XWBB 3GYDA 4Q0UA 4P9IA 3BU7A 1O3QA 4DMIA 1ZRFA 2E7TA 5GZCA 4UBGA 3RYKA 4IEQA 4CP2A 2R041 2D6LX 4RSUA 2ZGRA 4DFSA 3BB6A 3JD73 1NZCA 1H2MA 3FC0A 1VJ2A 2AENA 1RUE2 1MQTC 1MZ6A 1R082 2DCTA 1U5YA 3VKOA 2RMU1 1RUF3 1PZ9A 1DYKA 2IFRA 3JD72 1ZBE3 5CU1A 3K51A 3AKQA 2ZKLA 2HEVF 2OA2A 2WZR2 1NG0A 2RS33 3WDUA 5LEKA 3ZXJA 2CGPA 2JKBA 5I93A 3V0BB 1S0FA 3PVBB 1HV0A 1OI6A 1IKPA 3AMMA 3PTYA 1DU3D 2SBAA 1OQEA 1LOBA 1JH5A 4R8HA 4RQPC 4CYDA 4JGYC 2N7GA 4Z8BA 5CFDA 4JGZA 1ZVFA 5CFDC 1D4M3 3WG3A 3WOGA 4XJUA 5BNPB 4XFFA 5KHJA 1PO12 3WCSA 3VDDB 5K8SA 3E6CC 1CAXB 1PGW2 4KG0A 4GB31 2CNAA 4AEMA 2Y0OA 4LBQA 4Q1RA 5BYNA 3O0XA 3GF6A 3OBTA 4AVBA 1BEV3 3IMNA 3CJIA 3TB0A 1TE1B 3R05A 3VZMA 5H9PA 3I59A 3LA7A 4S2GA 1MEC3 3MF9A 4R9DA 3BPZA 4LBKA 1W6PB 4CEWA 4GIQA 1BBT1 4DXZA 4HSJA 1X7NA 4MVTA 4Q26A 5LRRA 1RUI3 2MPFA 1BQPA 1Z7S2 1NQJA 3T1MA 4HPKB 4NVPA 2R043 3DGTA 3NV3A 3WDTA 3RNSA 4AK3A 3OD4A 1NLRA 3ASIA 4M0HA 3PHMA 5FAXA 1RUC1 4XFHA 4FTEA 4WM8A 3VBSA 4Z92B 4QPGA 3MLKA 3PMEA 4ATFA 3WQ7A 4LO5B 1G8WA 1G9AA 2RS51 1GQGA 2R16A 3NKTA 4XF9A 2BNNA 3SXWA 2JG8B 5I0SA 3MDPA 1LULA 3GBGA 5GZEA 2RS12 2B5HA 3ZYGA 3E5QA 2BPA2 2UURA 4FVVA 3GZAA 3H3UA 4FSJA 2DU1A 3AXEA 2C9AA 4YGBA 3VL9A 1ULCA 2BVVA 4AQTA 1SLTA 4YM1A 3WZ1A 1TME3 1AXYA 2ZBJA 1V6IA 1WD4A 3LSEA 3LAGA 1C28A 1WD3A 1V6MA 2ZKNA 4OLLA 1LOAA 5A32A 1AYN3 2VQ0A 1LOEA 2D7FA 2DVBA 2PHXA 4XHXA 4B4QA 4CDXA 3WP3A 2BVBA 3ILRA 4XIOA 1H8TC 4PF5A 2A3WA 2BTVC 2D6NA 2UYAA 3IDCB 1ZZCA 5C6CA 1FPN3 2EA7A 3WLUA 5FPZA 1BCXA 5JIAA 1VBD2 2RS13 4MLOA 1EAH3 1BK1A 4CEYC 2BFUS 3MW3A 2K2SA 4PIZA 2F6BA 1ONAA 3UKTA 4DS0A 1U5XA 1MZEA 2HWC1 1YLLA 1LB2A 4OHVA 3VHPA 3IIAA 2UU8A 3IN9A 1DGWX 5FLHA 5FO9B 5FO8B 3AP5A 3C2UA 1RUG2 3WG2A 3E6BA 1VP6A 5F9TA 4O9GA 2GC0A 2ET7A 2IXHA 5L7OA 2RS52 1U12A 1ZZ9A 2GH2A 2VQAA 3JBG2 5J09A 1SQ4A 2HYKA 2D5HA 4MV2A 3LCPA 3NV4A 4AQSA 1O5UA 4YGDA 1V9U2 4R9AA 2Q5TA 5BUVA 3VL8A 1IKQA 1U0AA 2A6WA 2ZACA 4AGGA 1V00A 1ZYBA 5DXDA 2H6CA 4PLOA 2X5IC 1CESA 4IEPA 1F5JA 4QPGC 2D5FA 2XPJA 3VBOB 2CGOA 1WUVA 3QLQA 4Y1YA 4IV1C 1E57A 2BNMA 3VZOA 4YG6A 5I8SA 3GZTB 3ZSEA 2GN7A 2ATFA 1ALYA 2V09A 2NPIA 1SCSA 5D8AB 1FNZA 3WV6A 4E2SA 2WS92 5KXDA 3TRSB 4NOTA 2RR11 1VBB2 1D4VB 3KQRA 2AYHA 3RMXA 3RI9A 2ZABA 1Q8QA 3AZVA 3R0RA 3AFGA 4Y26A 2XVLA 2W39A 2CGNA 4H7LA 1KD7A 4JTOA 3HT1A 2BUKA 2HEWF 4K9SA 1AR91 4Q4Y2 2WIIB 1N1YA 4YGEA 5FLIA 1KITA 1RVF2 1UL9A 2HWE2 5DUWA 4JRAA 1CAXA 2O0OA 5DG2A 3S7IA 3AKPA 4YVWA 4IV3B 1K5MA 3WW3A 1MZFA 4N43A 1DZTA 1XQNA 2HWF3 4XJ8A 3LOBA 2WNVA 4YM3A 1TEIA 4YG3A 1NCRA 4WZFA 2IZWA 4LO4B 4XFBA 5A3MA 2QKDA 2GALA 3ZN6B 4FTSA 1EAH2 1SBDA 1U5IA 1GNHA 1RL3A 1KRIA 3I2DA 3VBFA 1MS8A 2QQPA 4BZ4A 5HXVA 1POV3 1O7FA 5C9AC 1SLLA 5GLWA 4ZXKA 1D2SA 1FMD1 2AUYA 5T5JA 5E88A 4Q29A 4QPYA 2QZ2A 4LLFA 4X8NA 5H9RA 5T54A 1ENRA 4W6XA 3BIWE 4XETA 2O8QA 5FREA 4FOYA 4AI8A 5JOYA 5FLJA 4WM7C 2WA4A 2KA3A 3AZZA 2IC1A 5GKAC 1V6LA 1QNYA 2RJLA 2OZ6A 1G7YA 3USSA 5EWSA 2O1QA 1HQWA 1MEC1 1WLTA 4OI2A 2ZA9A 1D4M2 4I0AA 5BNPA 2VOWA 4COWA 1AJOA 2DCYA 2ILMA 5EV7A 4Y20A 5DUUA 2YYOA 3WY6A 2Y26A 2RJKA 5AC93 1DQ5A 4BE3A 3CJXA 2EALA 4RHV3 3WG4A 1V6KA 4GKYA 4MXWA 4K20A 1HKDA 4HBNA 4PIYA 4CDUC 2NLRA 1EP0A 3J8F2 3JB8A 4AWDA 2WWSA 4OUMA 4AE2A 2QDRA 4V1PA 3RYRA 4PDWA 4BPZA 4FTBA 2LM3A 4CEYA 4EN7B 3ILNA 1M4WA 4RD7A 1JYCA 4XTPA 3POYA 1QKQA 2E7AA 3PJQA 4UW6A 3B3QE 3WHUA 2VVEA 4IEVA 5T50A 3ZDSA 4GH4B 4JDNA 2ZX1A 4KNCA 3ACLA 3N3HA 3ZSKA 4JQRA 3G7DA 2Q0AA 1JOJA 1ENXA 2R30A 3ECQA 4HSLA 4K40A 4LULA 1AR72 1WCDJ 4YRDA 5FOBB 2RMU3 5BNOC 4LHKA 1B09A 1I3HA 2D3PA 5CA6A 1G9DA 2WZPP 4LUKA 3AYDA 1BBT3 3N7MA 4P9GA 1QH6A 4AEKA 1KS5A 1NCRC 1ZX5A 2OUJA 1LU1A 2DVGA 1PO23 2E7QA 1N3PA 2ETEA 4M00A 1NXD1 2VOVA 3PMSA 4D94A 3VHOA 3ZSMA 2Z5WA 4WM8C 4LHLA 1LR5A 4FT8A 1S0EA 2I45A 2FMDA 2X5IB 3M1HA 2ZMLA 1D0GA 1ASJ3 3ST7A 4XDQA 3BODA 4CDXB 2JICA 2R6QA 3P3PA 1CD3G 4FOWA 4U36A 2KM2A 1Z78A 2SLIA