1OLUB

Roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
336
Chain Sequence
AHFTFQPEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of His291-Alpha and His146-Beta' in the Reductive Acylation Reaction Catalyzed by Human Branched-Chain Alpha-Ketoacid Dehydrogenase: Refined Phosphorylation Loop Structure in the Active Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
total genus 125
structure length 336
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2003-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oluB01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oluB02
1WCIA 2O1SA 4KXUA 3D7KA 4JUDX 5EJAA 2UZAA 2EZTA 5ERYA 1TKBA 2QTCA 2C3OA 3IAFA 2BEUB 3ZHVA 1OLUA 4GPEA 2EZUA 5EJ8A 1NI4A 2X7JA 5K6RA 3EXG1 1JSCA 3AHFA 2PGNA 1X80A 1T9BA 2JI8A 3ZHUA 2OZLA 2JIBA 4MZXA 5EJ4A 5EXEA 3UK1A 1UM9B 3AHGA 4JUBA 4WBXC 2DJIA 3KOMA 5K3SA 5EJ6A 1IK6A 2JLAA 1W88A 2VJYA 1X7XB 2C3MA 2JI6A 5HJEA 1TRKA 3LQ4A 1V1RB 1PO7A 2Q5OA 3E9YA 2BFDB 1OZHA 5HGXA 1OLSA 2BFBB 2AG0A 2EZ4A 4GM4A 3F6BX 3DVAB 2VK8A 5I5EA 5EJMA 2NXWA 3EXHC 1QS0B 2PGOA 2QTAA 1ZPDA 2O1XA 2PDAA 2VK1A 4MPJA 5DGDA 4QQ8A 1X7ZB 1V1MB 1U5BB 2BEVB 5C4IA 4K9KA 2C42A 4C7VA 1X7XA 1X7YA 1NI4B 2BEWA 2Q29A 4D5GA 1PI3A 2BEUA 3UPTA 2R5NA 5I4IA 2WVAA 4COKA 2E6KA 1X7WB 2UZ1A 1POWA 2VBFA 2OZLB 1QPBA 2C31A 2BFFA 3EY9A 2R8PA 1T9DA 1ITZA 5HYVA 4KXYA 1UPBA 3FSJX 1X80B 3M6LA 3M7IA 4KXWA 1OZFA 2FN3A 3F6EX 3DV0B 1OLXA 1PVDA 2C3YA 1V16A 1X7WA 4GG1A 3AHIA 4KXXA 2JI9A 2VBIA 3EXHA 2BFEB 3HYLA 1V1RA 4K9PA 3LPLA 3RIMA 2WVHA 5EJ7A 1TKAA 1W85B 1YHZA 1V16B 2Q5LA 3EXIA 2EZ9A 3M34A 3FLMA 1OVMA 1L8AA 4GP9A 1QS0A 1Z8NA 3EYAA 2C3UA 4XEUA 1UPCA 3EXEB 1UMDA 5EXDA 3FZNA 1POXA 1T9CA 5HHTA 2AG1A 1W85A 2XT9A 1YI0A 1B0PA 2Q5QA 4Q9DA 1OZGA 1UMCA 3HWWA 3ZHQA 2YICA 3EXFA 1V11A 2Y0PA 4JUFA 2WVGA 4MQ5A 3ZHSA 5DGTA 1AY0A 1GPUA 3ZHRA 3OE1A 1NGSA 2G67A 5I5GA 1KEKA 1YNOA 4FEGA 2G25A 4GM1A 5AHKA 2JGDA 4K9MA 4MPRA 1OLSB 4C7XA 2R8OA 4RJIA 4JU9A 1T9AA 2BFEA 3OOYA 3EXG2 5I51A 3DUFB 2Q5JA 2Q28A 1OLUB 2G28A 2VK4A 2YIDA 4JU8A 2BFCB 1YHYA 2JI7A 4FEEA 2J9FB 3AHEA 4JD5A 1X7YB 5FEMA 1N0HA 1WCIB 2Q27A 5K2OA 2XT6A 1DTWB 3AHJA 3AI7A 2UZ1B 5K6TA 3DV0A 2BFFB 3HWX1 3EXIB 2EZ8A 5IMSA 4ZP1A 2BFDA 4K9OA 1PYDA 2IHVA 4D5EA 4K9LA 4K9NA 4KGDA 3EXFB 3EXHB 1UPAA 1YD7A 1QGDA 1YBHA 3MOSA 2JLCA 2BP7A 4JUCA 1V11B 4JUAA 2JGDB 4RJKA 1V1MA 1X7ZA 1YI1A 3AHDA 2IHTA 2BEWB 4RJJA 5ESDA 5ERXA 1TKCA 2W93A 3AHHA 1V5GA 2FWNA 1UMDB 2IEAA 2V3WA 2VBGA 2XTAA 3EXEA 3ZHTA 2BP7B 2C3PA 4K9QA 2J9FA 3JU3A 1BFDA 3DVAA 4MPPA 1R9JA 2PANA 3LQ2A 4QELA 1UMCB 1V5FA 1Q6ZA 3DUFA 4QPZA 3EA4A 5EJ9A 1UM9A 4GM0A 1UMBB 3AHCA 1V5EA 1U5BA 1Y9DA 2BEVA 5EJ5A 1W88B 2IHUA 4KXVA 5DEIA 3L84A 3M49A 1OLXB 1DTWA 2BFCA 1MCZA 3IAEA 2BFBA 3LQ1A 1RP7A 1UMBA
chains in the Genus database with same CATH superfamily
1IUNA 5IHPA 4F86A 3LF2A 4FNAA 4ZV9A 1LLFA 1C0KA 2PLNA 4AXXA 4RKYA 1Y4DE 4HR7A 4KZPA 5IJ0A 1E6CA 1K27A 2B34A 2PGNA 3AHFA 2CNOA 2GLUA 5JVDA 2C82A 3A6LA 1U9IC 5CLGA 4PWYA 1R7RA 2GRJA 2GEVA 3FWHA 3T3IA 4BE9A 1FVXA 3C5HA 3V8MA 3T3OA 1JFFA 2WJGA 2BE7A 1TRKA 4UU8A 1CR0A 4XGIA 4CF4A 4ZOQI 3MLAA 4MV7A 4XD2A 5EAIA 4JVLA 4X7BA 3DL2A 1UOOA 2ARKA 2ZREA 2VCYA 4ENTA 2PX4A 2I6TA 5DT9A 3D0QA 1T8UA 1JJIA 1IEXA 1DAEA 2QNRA 1QIIA 3A3OA 3KVNA 2C5GA 4HWKA 4KFCA 2QR3A 4W8GA 4B4WA 2R1VB 3RRZA 2VJDA 1H66A 3VOAA 1SZCA 3CZ4A 1L7XA 3FLEA 3L0OA 1DO0A 1D8AA 1Z88A 2DRIA 1FNMA 1Q1GA 1QV9A 1PJ8A 1KKMA 2IIVA 3A2LA 3IJ5A 5IT4A 4MKRA 4DIBA 1E4EB 1V16A 1MJGM 2X8LA 1WXQA 3DBRA 3QM1A 4NMWA 4LGYA 4YWJA 5AM4A 3H87A 5HILA 3A1DA 4F1JA 1WSBA 3VAZA 2A9KA 1ZA1A 4HLUC 3KKMA 4ZREA 3RUFA 3H5TA 3AYZB 4EK9A 1NNEA 1D2GA 1EUCB 2EX1A 3EYAA 4KO2S 3I4CA 3IO5A 4R2WA 3FZNA 2VRCA 4MGEA 3K4QA 1EESA 1NLZA 1M2KA 3ZJYA 1B2LA 1E1CA 4L08A 1XVTA 3OP1A 2PD4A 3IC5A 2WTAA 2Q3HA 3LHFA 4O2LA 4BBPA 4MUJA 5T4EA 1L7NA 1GPUA 6Q21A 3JVIA 2ZCVA 3EPHA 1S4MA 3WGYA 1NW6A 1Z35A 5J2TA 3K0FB 1GPMA 2PKRA 3ZXXA 1UXKA 1QUFA 1DKNA 2Q5JA 1P2VA 1DQSA 1V71A 1IQUA 4IILA 2MSDB 5FUVA 4RFLA 2HX1A 1Q1QA 1R88A 3QKTA 2JI7A 4QGGA 2I3ZA 1R0ZA 3DZBA 2YX1A 3O8QB 4N0EA 1WCIB 3GZ4A 5JVDB 3R20A 5JCJA 1OTYA 2FPPB 3AP3A 1GZSA 1PNVA 2WD9A 3BJEA 4RPCA 5JQGF 4EQ6B 3DV0A 4RULA 2X2PA 1ACMA 2NVUA 4EVQA 3ZU6A 2WPDD 4XX0B 2WUVA 3O9MA 2NTVA 1KJIA 2JFGA 2MYPA 2AYZA 4KE8A 3OFKA 1G41A 1IDN1 1WKCA 4W5JA 2DJ5A 4OJNA 4ZI7B 1BQ4A 4JQCA 1IPFA 1WTCA 1IHXA 1V8PA 2Y1FA 3MRSA 3RRMA 4RDIA 3Q6MA 3GRVA 2WP0A 2GCIA 3A9VA 1LKZA 4YLEA 2WZDA 2PUJA 3G49A 1RJFA 5AJTA 2FOLA 1OI2A 1ZMBA 2J9FA 2D06A 3BK7A 1WZ2A 4GI2A 1T1IA 2PMCA 4ZZ3A 1DPGA 2ZAGA 4ESOA 3M1IA 4I1YA 4IIDA 4QTTB 2OWEA 5CFLA 1GTG1 2P30A 2B2NA 3GLUA 1GTMA 1NW9B 1R4AA 4FOSA 2IS6A 1C2TA 4HQLA 3EDCA 4PQGA 1VHWA 2J3DA 5DZSA 4A0GA 4RSRA 4B48A 3NHYA 1RWPA 1L5GB 2IWHA 5K09A 5LMZA 4IVPA 2YJ4A 1E4YA 1V26A 3RKRA 3ZPXA 3EVEA 4C87A 4RELA 1IB0A 3MCVA 2JBWA 4CEHA 3A32A 4A0QA 3N3BC 4ZOLF 1H1LB 2F59A 4TTAA 4UTXA 1CLEA 4MCAA 3UHJA 4AM8A 1I4OA 1KMHA 2VJOA 3PVSA 1N77A 3TNYA 2XUFA 1C9YA 2AX4A 3HKCA 3ZBUA 1VECA 2YWJA 4R9RA 1NBMD 3C1AA 4U8HA 2I3AA 3JQRA 4FMBB 4L07A 4TV8A 3QPUA 2NSDA 1HLFA 5DGDA 4EY4A 2QT1A 5EYPA 3R7SA 1DOZA 4ENVA 1KQPA 4MAFA 3DNFA 1X7XA 3D7SA 2J8ZA 1VCMA 1YA4A 1YUNA 2H31A 4QPJC 3W06A 3HVKA 3BF8A 2P35A 3GLTA 3DE1X 3L7JA 1EQUA 2P77A 1PK7A 4HADA 5CRIA 1QOPB 5DGIA 1KJYA 1PR5A 1AU9A 4OYRA 5CVEA 4V1CA 4DAEA 5AI4A 4KMOA 1X7WA 3S5UA 1YFKA 1SFRA 1YIAA 1DIBA 2IDMA 2SKEA 4RY9A 4BLOA 4RTKA 1OYYA 3OZDA 3HVUA 2HWXA 3RSHA 2IC5A 2VQDA 5KMGA 1ACLA 1QMPA 5IKXA 1SVWA 2CCKA 1CS0B 3UWPA 1TJ4A 3MMXA 2ZGVA 1AMUA 1VBMA 2I2WA 3K9WA 2IQIA 4OMDA 5TQJA 4AX8A 3UHOA 2OV8A 2BMAA 3TD2A 3FUCA 3P5SA 1ZMTA 3M5WA 1S5PA 1II8A 3NEYA 4KI7A 1N2ZA 3S29A 4DA4A 3LFTA 4UDYX 1L3IA 1RE1A 4Q3EA 2IF0A 1SJ9A 4FN4A 1OXTA 2J6IA 1I30A 5DOVA 4IOMA 1T2CA 1YNOA 3ER8A 3PT9A 1IY8A 3LC0A 4Z1OA 3HUTA 3GFTA 5BY2A 2EIHA 2FXIA 1H05A 2IHBA 3C8ZA 1NI3A 3NAQA 5T3YA 1NE7A 3ICOA 1QHHA 2ZJOA 4FHZA 4BE7B 1RLMA 1XQ1A 4JT9A 4FYHA 3W5HA 2GBLA 3NOVA 2ZBGA 1AC5A 1ECLA 1N0HA 1W0JA 4M6WA 1NYTA 2ROQA 1Y7TA 1G55A 4L6CA 4DR2B 3H2HA 1OHHA 3LNTA 2OHXA 4CODB 1H3NA 5BW6B 3ES9A 4QUJA 2B2XA 2WSIA 4CMIB 2YY6A 2JIOA 2P4EA 1H6BA 2PR2A 5CK5A 4PHHA 1MVLA 2QI9F 4HGZA 2GA8A 3GPDG 4HNAB 3RS2A 4QM7A 2ACKA 4HFJA 4DKJA 2PZJA 2QVZX 3L92A 4XM2A 1GFIA 3W5BA 3RLIA 2AEEA 4RACA 4BGVA 1BYIA 5AUPB 4C6TA 3ROXA 2ZQZA 3EH2A 3MAAC 4TLDA 1T2VA 2JLBA 1W34A 4V0ME 2JH8A 2XMPA 1CZOA 3OA0A 3ZWAA 2Y1XA 3AHCA 1UKAA 2WU3A 2BBOA 4X95A 5C7LO 1A5TA 2C2ZA 2VRNA 1U28C 3PC4A 1OD6A 3BRQA 4K8RB 3K0BA 1ZA2A 1SCUA 1VI6A 4GBED 3WLFA 1RQPA 4F96A 3EIFA 4OHVA 3ECCA 3MTDA 1K86A 3DAYA 1W5AA 1WCIA 4HZGA 1V6SA 3C6MA 2B94A 1SGWA 4OFBA 4UVDA 3C7CB 3AVVA 1CR6A 2AR9A 4NOJA 3OIFA 2IU6A 4GZMA 5E2IA 4D74A 3SN6A 2XDQA 3DBLA 4Q15A 3V4PB 4BFZA 3KUUA 1OB5A 1NMYA 2A0XA 4GX1A 1YIOA 2ZWPA 2FEAA 3QU5A 1ZHHA 1JXOA 5EJ4A 1C1DB 3C7DB 3OJ0A 3HDHA 3GCWA 3QELB 1RYZA 1V0JA 3QH4A 1GAQA 2ZQ5A 3EIOA 4WLEA 1M8JA 2FPXA 4HAUA 5BV1A 1M5UA 1D6NA 2C9CA 2CMGA 3KB6A 4WK4B 4GUAA 1Y8RB 2WFMA 2YR0A 1KRHA 2JFHA 2QD3A 3DSRA 3EDYA 1CUHA 1NW3A 1CP3A 2JRLA 2VPQA 4MA0A 5JBIA 1CK4A 3S8EA 3GNQA 3OOHA 1TNDA 5TXGA 1MG0A 1HT1E 4P38A 2CVPA 2X9NA 2PPVA 1T2FA 3ORSA 1NVWQ 1Z08A 2NGRA 5ALOA 4IWNA 1LQUA 1PL0A 2TRSB 4HX9A 4EVIA 4BFLA 3JD2A 1YK1A 4DHWA 4L28A 1M7BA 4EBFA 4F04A 4IEFB 1ZJ5A 1HEIA 3SX0A 4AP6A 3GA0A 2HMVA 3RVRA 5INTA 4WWHA 4QXPA 3U44A 1YR9A 5BWOA 1NFRA 1P7ZA 1NZJA 4BNNA 1A9PA 3QYFA 1Q15A 1U6KA 1AV6A 1AUOA 2I2FA 1ORHA 1A2QA 2NO1A 4OXRA 4RDCA 2DBZA 2GDJA 2OMEA 3FPAA 4Q48A 4TMKA 4LTMA 1GARA 5PGMA 3H5IA 4KLRA 1RJ9A 2J30A 1ZNYA 3P9KA 5D5QA 4KOAA 2IV3A 3P1JA 3S1LA 1LRKA 4HX2A 4J7UA 1L1FA 5J4HA 1E1YA 3DUWA 5JJ5A 3OTQA 2C5HA 2G36A 3EGXB 3MJDA 2A1TS 4DSTA 3WLEA 1PYGA 1MQ8B 3FPGA 2YIVX 4HQOA 4EENA 2IYVA 4RD0A 4B31A 3FVTA 1FSZA 1JFFB 4GQBA 2Q7DA 3UAGA 5L6MB 1ABEA 2GCGA 3QXHA 5JNTA 4G56A 4NBLA 1JZTA 1QHXA 4UCXA 4ACBA 2VTBB 1J90A 5FLEX 4HDMA 1KI6B 4MV4A 4I1VA 3VR1A 1WXWA 1H42A 1JEOA 4OI0A 1YB4A 2VDOB 5FX2A 1WR8A 5CDFE 5AKYA 4QOJA 2OGTA 5JPCA 2Z6AA 4B3DA 3JTEA 3DEYX 3RG8A 2R8ZA 5HRAA 4C6RA 4I81A 4PONA 3QYAA 2Q27A 5LZ7A 5CFMA 1MW8X 1BFUA 1PGJA 4O4HF 1R18A 3U4HA 1Z0ZA 3HU5A 5FR2A 4TTTS 5K3FB 1KC3A 2JL1A 5JY6A 3USCS 1IWOA 4EYSA 3W34A 4OHBA 1NQOA 4FEAA 4FILA 4IDEA 3DBOB 3DYBA 3L5OA 2GF0A 4YGYA 2F9FA 4DLBA 5BURA 3OCXA 3NM4A 2F8TA 4AZ0B 1ULBA 3AESB 3BMOB 4U8GA 3K9BA 2GBLC 4PLCA 4BVKA 3SGLA 4W6QA 1XZFA 5BSHA 2V9CA 3CUYA 4YAKA 3V8NA 4OX9Y 2I7CA 1DFHA 2FCAA 1Q6ZA 2O2IA 3CGWA 3GWGA 4J2OA 4Q9HA 4CM4A 3OKPA 5EC8A 4ZYTA 1TLFA 3P0RA 4A8HA 4YUAA 5BR1A 5ENZA 2QTTA 4B2YA 2DSTA 5CEFA 4D98A 3S81A 1C3LA 2BTEA 4U2BA 4P7FA 1QGED 2HLPA 4KP7A 2YHUA 3KKOA 1B0AA 4PSDA 4V02A 2XXAA 2IEYA 4O1MA 5AKHA 1UKBA 4Y6GB 3M9LA 2FZ4A 5FI5A 3JX9A 5AMXA 1AQUA 1E3IA 4F0JA 1FDTA 3KSDO 3GFFA 4CNBA 3IIJA 1R0YA 3FYUA 3RB8A 2WFAA 1VSTA 2XJ9A 1FTNA 2OZLA 3GUHA 4RORA 2XMDA 4KU4A 5EXEA 4J4BA 1OF1A 1P5RA 2ZUUA 3UGQA 2UYCA 3KAQA 4RVGA 3OSUA 3WVNA 4W7SA 2G82A 2H52A 2Q6TA 5HUHA 3EW7A 4BLPA 2H6EA 3O8NA 1MJGA 1X14A 1DB3A 2RJNA 5BT9A 3T3EA 5B4UA 4LNUA 1TJ3A 1LBHA 1WBJB 1IQ0A 1O6BA 2PD6A 2XWSA 1X15A 1M2JA 2D2FA 5CBPA 1CE8B 2BFPA 1IXKA 3A36A 1N5JA 4LYYA 1FFAA 1UC9A 4NL4H 1JRLA 5ELLA 5FWDA 1V1JA 1W87A 3CRNA 4FGZA 4EG6A 2RG7A 5FP0A 2GTIA 3X44A 2F43A 2CNKA 5F78A 2O3JA 3EQ6A 2R85A 4L9SA 3TNJA 2H4XA 2BI8A 4I1SA 1KY5A 2NV2B 3T5BA 4MX8A 2YCBA 2F1OA 3MA0A 3R0JA 5AIAA 5JXGA 3PFBA 4NI5A 1TKAA 2N3ZA 4YWHA 1WAMA 1DCKA 4LJLA 3HB0A 3IV6A 4WZBA 3WO1A 2EHJA 2XTMA 2YV1A 3K32A 5KYXB 2R6AA 4C0KA 2FOXA 3B9QA 2OAP1 3K72B 1E9RA 3F7MA 2O57A 3T9DA 3MGKA 1G21B 1VLZA 4M0MA 2GH1A 4J94A 1DBVO 2ZS8A 3HP4A 3ROGA 4EB6A 3BIJA 4A1OA 3UFBA 4Z54A 5JZ9A 2AX3A 1JHXA 3FPFA 1BXGB 3AQ4A 1DAIA 1K97A 2UYYA 3LJKA 1K6MA 4YAOA 4EGSA 5KNDH 4ZGBA 4E0BA 4WHMA 4ID9A 1T6NA 2GPWA 2OD9A 1ESMA 1XRQA 1MRNA 1ILEA 3ZBQA 1JR6A 3TNDA 1OLSB 5KYYA 1JSRA 4UNNA 3F9IA 2O8NA 4KR7A 1HDOA 4GZLA 4WI1A 2G76A 3ADCA 3SSAA 4YA6A 4BMYA 1E3SA 2JAWA 5FXMA 1OH6A 5ALKA 5FEMA 2RE8A 1EVQA 5I7SA 4CL0A 3RBZA 4D02A 4E5MA 3H0EA 3IP1A 2WHRA 1M2VA 2H4FA 4PPNA 1Z0IA 1MDBA 3H1AA 1Z3IX 3I62A 1RYYA 2XYHA 4NENB 1VA4A 1SOMA 3UJ3X 4DRXA 5EGSA 2UVQA 4BV9A 4IDDA 3ROQA 2P5UA 2RKBA 1KO4A 3KJGA 2IEAA 4FOTA 4PQFA 5KOHA 4IHQA 4Q7JB 3AP1A 3HKCB 3PL5A 5DK6A 3HCCA 5EMKA 2HLDD 4C1BA 3II6X 1EGAA 3L9WA 1E6WA 1PTJC 3ASUA 2WE8A 4NR0A 5IVHA 3R7AA 5A7FA 2OGSA 1K7SN 3RUHA 5D86A 2O7NA 1ZRHA 4AJIA 3AI3A 2YW2A 1X86B 2F43B 2WAAA 3VMFA 3KQUA 4EL5A 2ZIAA 5JTUA 1D07A 1U0JA 1LQ2A 2MMCA 5EZQA 1KWKA 3VFDA 5FL3A 4RTRA 4PO8A 4UASA 3CZRA 1TX4B 2XNCA 4KV9A 2WHXA 2MIIA 4ZXFA 3RC3A 1G8HA 4QTZA 1UBCA 2ZKLA 3AERB 3L7NA 4BV8A 4V1CB 3RBAA 1IJKA 4P83A 1MB3A 2AMVA 3QVXA 3ZHUA 3E9NA 3ZE9A 5KU1A 2HFJA 4AFNA 4YCNA 2JFYA 5CR9A 3G0GA 3BMCA 1TE2A 1XZCA 3A9SA 3K35A 5AVRA 2HCTA 2IS1A 3G2PA 3RVKA 2VO1A 1JIVA 4TS1A 3HZZA 4RABA 1Y6JA 1HQYE 2QJRA 3PCXA 4RKFA 3RK0A 2GO1A 1KFEB 3G2HA 3HUEA 2OESA 3SNHA 1QGAA 6ADHA 3I5AA 1EP1B 4JXZA 2I8CA 4HAVA 4GYYA 1O4VA 2J9ZB 2VLBA 1OZAA 3IMGA 3R3UA 4HZUA 5TF0A 3RIGA 4WXEA 2E6KA 2B4RO 3HVHA 2BD0A 1LSOA 1PT7A 2YXEA 2XMQA 1ESNA 1RXCA 3SXUB 4N5LA 2QZ4A 1L4BA 1Z38A 2Q6KA 4DIMA 2DEUA 3MQ2A 1QDEA 3O1HB 4BPRA 4WY2A 5I4CA 5KVCA 3AFOA 1H8EA 1DKOA 2VBIA 4JOQA 1L6RA 3URKA 1ISSA 4CDRA 5DX0A 3GBVA 4BTLA 3OUUA 4IJQA 4Y2JA 3PF8A 3TW8A 3OPMA 4Z7QB 2B30A 5AVJA 1R9GA 4GIBA 5DHRA 4HXGA 1OIVA 1N75A 2F9LA 3NHAA 5A5EA 3UJNA 3FD8A 4HMPA 1ZO8A 5A1TA 2YHSA 2C00A 2YINC 3W8RA 3DZDA 1T9CA 3ME5A 2YOGA 4YT5A 4IYRA 1V37A 4EY6A 3SR4A 4JI1B 3TOXA 3QBJA 4EGJA 3HKEA 1L5MA 3LBIA 2IW1A 4RA6B 4M8KA 1M2GA 1PV1A 2V54A 3OEED 3T3DA 3ZOKA 4BVHA 4EYGA 3RAJA 1AY0A 1L4FA 1VLQA 1FRZA 1Y9JA 2YMQA 3TO5A 1BVHA 1CRPA 2W7TA 1PFQA 2PUEA 3FTNA 3LX5A 4KNWA 1N3LA 1ZUNB 4MS1A 3U7QA 4BP8A 1XF9A 4G8DA 1MN6A 1ODSA 3CM0A 4CG1A 2YXDA 1JDUA 4HF7A 4KREA 4ANFA 2V4UA 2HWWA 3CCCA 3FNQA 4O4LB 4HC4A 4OLAA 2JGIA 1E3DA 1TUGA 1M2WA 5B3JA 2YFYA 4FSXA 5F77A 4YCBA 4EUFA 1M8PA 2WFLB 3A3YA 2BFFB 1LNZA 4ZP1A 1KY4A 2VHTA 3QK7A 5K45A 4K9NA 3T4PA 1FYEA 4GSKA 4PN3A 1JHMA 4H6PA 1CBUA 2GM5A 1V1MA 4PYOA 2P78A 1OAKA 1VPVA 1YZNA 2EG9A 3EDMA 5FBHA 1SZPA 3IQEA 1Q16A 5GONA 5B36A 4Q93A 5EMHA 1JT2A 1ML4A 4LBYA 3I01A 4ZQHA 2NTEA 1S2GA 3O2SB 4JLOA 4R1SA 4Q0MA 1DBIA 1MAHA 1E59A 2PRZA 2W00A 3MGCA 4BFSA 5KTTA 3AF4A 2M32A 2G83A 3T5TA 3TOVA 5JWHA 4ZU6X 3CEHA 3NCTA 4BCDA 3BHNA 3R3SA 5FWYA 4RD1A 4H6WA 2BH2A 1FFXA 2DHEA 3UMSA 4D8VA 2C1XA 4YQZA 1F2DA 4D82A 1PAUA 1XTQA 2VUUA 3D3NA 5I7VA 2DAPA 4IOKA 2DQYA 1DIHA 4JBWA 4I7EA 3FYHA 4RV9A 4DXHA 1NI4A 1PLKA 2O7RA 3BE4A 1N1MA 4DIOA 2H7CA 2CL7X 3OOSA 1CUVA 3K94A 1M83A 2QRUA 2VSFA 1ZFNA 3THRA 3FGOA 4RA6A 4RTNA 2GFQA 3DMNA 1AKUA 4HDOB 5DCYA 5F5LA 5CCBA 1LUAA 1NTOA 1QIEA 3DOFA 2FW8A 3RAFC 4MLDA 3L9XA 4BX8A 3CX4A 5BOSB 5IT5A 3B9RA 3UC9A 3SQXA 3NC0C 4RHTA 1QS0B 4XVHA 1D2RA 3E27A 3SM3A 1XVLA 3DE3X 4I50A 4LYFA 3GRRA 2H9YA 3P9CA 4FKMA 5IAEA 4HNSA 1HDYA 1YKFA 3UWSA 4K6GA 4D9CA 4WCVA 5JAIA 1JIQA 4QL3A 1RJEA 3BWVA 3ETHA 4OU5A 4L9AA 3ZGOA 1C7QA 2XGJA 1H1LA 1I9CA 3DXYA 4KYVA 4LJ4A 1BRTA 1MABB 2PU7A 1ZNZA 1T1GA 1L9KA 3P8ZA 4HMOA 4YV0A 5JLAA 2HK6A 4G1UC 1EK6A 2YKGA 3Q40A 1UWCA 3G1TA 3X1JA 1KDYA 3DFZA 3CKMA 3S2FA 3GU3A 1Z12A 3AKEA 4CR8A 1PR6A 1D6JA 2EOAA 2ZVJA 4AJPA 1FVFA 5IRCD 1KMCA 1FOEB 2O0KA 1L5ZA 2EERA 2QN6A 2TSYB 4WA8A 1XQ6A 1E2KA 1KIMA 4R9VA 5E1DA 4ZYZA 1GG8A 4IDAA 1E3WA 2F9MA 2FN8A 1C0EA 1E1QD 2P1ZA 1AM4D 5HF9A 4M1YA 4MV8A 3AUYA 5EE5B 4BNJA 1CNEA 2M98A 4CUKA 4HDNA 2OXRA 5DLEA 2Q21A 3QENA 4GFDA 2P41A 4DUPA 4E3ZA 1KZ4A 1P31A 2WF7A 3KT6A 3WMGA 2W6JA 3CRZA 4YGXB 4AUEA 4DLSA 3V33A 4EHBA 4RO0A 4PAGA 3LCRA 3SXJA 1QP8A 4MCIA 1JG6A 2I5PO 4R2LA 1QG2A 4OIMA 5TIIA 3JD3A 5IJ9B 3EAGA 2AFHA 1DRWA 1JA0A 3NV9A 1IOLA 4DPKA 1K5PA 5SICE 3AR2A 4WKBA 3PQ6A 3LCUA 4LC1A 4HFNA 2H4JA 2QP3A 1HGXA 2Z9CA 4M1WA 3M5DA 2SCUA 4OIFA 4WRRA 5P21A 3AKZA 3DEJA 1L3BA 1CIJA 3QLEA 3DOEA 2QYSA 2HJHA 3FUUA 3I8SA 2CE2X 2VWQA 4XEHA 1JWAB 3MB8A 5GGXA 3V4FA 4DZZA 2XRFA 3KEFA 5LCXA 4WBNA 1Z6YA 4JLPA 5ER6A 1AK2A 3W4KA 1EX7A 4Y0VA 4RTQA 3CTPA 1XZ8A 2FEOA 1XMJA 1DBSA 3RU9A 1V3QE 4QBIA 4YFYA 4BGUA 2OZKA 1KARA 1UXOA 3FW1A 1GQOA 3O91A 4RKRA 1FDSA 5KX5B 2GK3A 4IXTA 2O06A 1BFKA 3D8NA 1K88A 5IJZA 1MCZA 1Z4MA 3B38A 2P75A 1BGXT 4OM8A 5AKEA 3QW4B 2NP6A 4LQ4A 3C2QA 1N6IA 4YMIA 4JT8A 5FPTA 3NVAA 4DE5A 2C7OA 3U80A 3PNBA 1I2BA 1XL1A 5JFTA 2ORYA 2QMOA 4DKXA 4RTMA 2FDCA 4INOA 2XMSA 4RJ2A 4LX8A 4M7OA 2Q9BA 4PYQA 3QHAA 1WW8A 5ERGB 4KE6A 2ODAA 3THXA 2QUIA 3LUDA 4N03A 5DN6D 3UAZA 3O4HA 4IR7A 1MTOA 1YL5A 2F90A 3HEBA 2DCUA 3KSMA 1FZTA 3VV2A 4NG4A 3BE8A 1NURA 5J2TB 2ZXEA 2C9MA 5FBQB 3CRW1 1N3IA 1WXIA 1HKUA 3K2QA 3QBDA 3RSOA 3UJ9A 5HM8A 1Y1PA 1ZK0A 1P2TA 2O1WA 4NENA 3KAKA 3VUFA 1MAUA 2RAPA 3BE6A 2ZIXA 4AZ3B 2VUTA 1L5HB 3H9QA 2WVAA 1WBDA 4OF4A 1PRYA 3M2PA 3NORA 3ZW9A 2CB0A 3I1JA 2BFFA 3OOWA 3QTBA 2ZZMA 3FROA 2PT7A 4LMRA 3ZCTA 3VUEA 5KYGA 4ZHSA 3B5IA 3T06B 4KDFA 3Q1KA 1DLJA 3AR3A 3OQIB 1USWA 2OZEA 1YOBA 3H9UA 2IY9A 1TVEA 4RK6A 2OHOA 5K6AA 1JTVA 2XNHA 2Y66A 3O9ZA 4JY7A 3GLQA 1U2RA 3ELBA 3MINA 4KB5A 2Q7OE 3TR0A 2XUJA 4Z4QA 3O3CA 5EJ7A 4M7PA 2Y27A 4F5EA 1Z0KA 5JSKA 2A9JA 2VJQA 3INYA 2HSEA 1BQEA 2G9ZA 2N0SA 2WUFA 3FYUC 4UVGA 1GGMA 1K75A 3OX4A 1R16A 1M34A 2PL1A 3WMXA 1SCBA 1H4VB 2OBXA 5U1PA 4BX2A 3TQSA 2I6GA 1CQJA 1E66A 4YRMA 5AD1A 1QRTA 3VPXA 4QNMA 4HB2A 5DTMA 2NZ8A 3HPQA 3D7LA 5FTKA 4DT1B 1M1YE 3E1KA 4RJIA 3ZGZA 2H2WA 3GEDA 3NTXA 3A1EA 4KFTA 4MCHA 4HDAA 2VTEA 1B73A 5BV2P 1GGEA 1LJUA 5M29A 1VJDA 4IHAA 3PRHA 4B35A 3G13A 3OZVA 2YRXA 2R6DA 2RH8A 1WXHA 2HU5A 2GPNA 3D1LA 4IKPA 1JMYA 1O96A 4HUQA 2FN9A 4LN1A 5JJIA 3HWX1 4TTSA 1G6OA 2C2WA 3O1LA 3PI7A 1SBIA 3VYRB 3N8GA 3W9YA 1G8FA 1PJQA 2HRDA 4P2GA 3SBEA 4LOIA 4Q9JA 4ZWNA 3ZDRA 3V32A 3V8QA 6REQB 2HMAA 3ZWCA 1D9XA 2W58A 1GGVA 5H3CA 3Q15C 4QLAA 2JLYA 4IDOA 3L7MA 1NVEA 2BP7B 3PC6A 3QFFA 4ZI3A 5A7GA 4IXNA 5I9TA 3ADDA 2CD7A 2XIQA 1J9GA 3HC7A 3JU3A 3N6VA 5DHAA 4IIJB 2IYYA 4DLRA 1BZYA 2AG8A 1QYDA 1CRZA 2VDMB 3C6KA 3RC7A 4D81A 4D9JA 2BT4A 4E2ZA 3A10A 4RH1A 4QULA 2P6RA 1RYFA 2RGEA 2FSGA 2P0YA 3VI3B 4CMIA 1U04A 3OE5A 3L06A 4PICA 3T34A 5H81A 3LOPA 3ZZNA 3R6WA 3PV0A 3LUGA 1RWXA 4JHXA 3RUIA 5KCMA 4B2IA 5B2EA 3PUYA 2DB3A 4DPLA 3FWKA 1HF3A 3AIOA 1R0LA 2ZBFA 3KLMX 4J1TA 1EFVB 2AOUB 4YCCA 5KTMA 1EVYA 2Y8EA 3M6AA 4EMSA 1ISFA 4CGZA 1E2GA 1V9CA 5AHRA 5K6RA 3SXUA 4AYXA 1YUMA 1LA2A 1QHFA 2WSSD 4UMDA 3U9TA 1YDWA 4IF6A 5E4TA 1GFZA 4DCNA 1CDZA 4LG1A 5FNZA 3RSZA 1SG9A 2PK3A 3F5DA 3PB3A 4BNVA 1Z6PA 1QB8A 2IIQA 3H1FA 4DY6A 4CT0A 1COWD 2QAGC 3K5PA 1KAMA 2IV7A 2BDEA 3C4VA 1SBCA 2AG6A 3CT4A 3ZLBA 2AL7A 3I9LA 3P32A 5B64A 3PQ2A 5I5EA 2VP9A 4M1EA 1VGQA 1IY1A 3MZ0A 4MKIA 1XMPA 2JJ2A 1EP2B 1HL3A 1T5TA 3P9SA 3SLRA 2EJVA 2OSBA 3B2NA 1O6CA 3U44B 4HNHA 4WBSA 2AMLA 2B25A 4H4CA 3WK8A 2O20A 1POWA 1MO3A 2C31A 4H3SA 3KIPA 2Z04A 4P33A 5TT1A 1R0KA 2Y1OA 3DLCA 3ZYCA 1ZUNA 2PR7A 1YJ5A 2Y1GA 3U7QB 3WL8A 4B43A 3Q8LA 3DMTC 5BVHA 3L4SO 4A2PA 5HQ3A 1GPNA 1G8GA 2PMBA 2Y0DA 1ZJWA 3EUEA 1GAJA 4KN6A 1Y9EA 4XOUA 1L5VA 2IYFA 2YWBA 4EARA 4QYWA 5HM6A 5E1BA 3CO0S 1STOA 5I7HA 1K5DA 1M0SA 1Y3AA 3OWXA 4PAQA 5G53C 2NTJA 4RQUA 1DQZA 2C03A 1WPXA 3JQGB 1POXA 1BC5A 3AILA 4GBMA 3TLGA 3OZAA 2GPTA 4O0LA 5DP2A 2EWWA 2FW9A 1L9XA 3H5WA 3ICVA 4HNQA 1HI9A 4JC8A 5AJYA 3TCNA 3W79A 1EG2A 1O5OA 4HLQB 4RWEA 1Z25A 1ZNWA 1WXXA 1RWKA 2NUPA 3MOGA 4ZCMA 5KJ6A 4ZDJA 2R4TA 5JXIA 1LLUA 1ZIYA 1YS6A 1ZRMA 2DBYA 4GOND 4RL6A 1JILA 2OXFA 4ZEMA 1WUHS 1YMUA 4P32A 821PA 3GK3A 4XJXA 4WXMA 5JS2A 3H16A 3Q8KA 3GEEA 1XXHE 3BFPA 3SVZA 2N75A 4DSNA 1R4NA 2BGKA 4OFXA 3UFXA 4XCQA 4AS1A 2O19A 2J6HA 4JP8A 3CV3A 1PYOA 2OGWA 5B1SA 4PXYA 4DNPA 3GCGA 2C7GA 1U5AA 3N74A 3WXMA 1XAIA 5JXHA 1JXAA 4KQFA 4EHDA 3HCAA 2XVYA 1XLVA 4CJXA 4KO1S 4GZ3A 2L19A 2D0PB 5FCDA 2RI1A 3ANSA 1BWPA 3KYJB 4MGZR 2ZIVB 3SF8A 4DWOA 2C4NA 2AXEA 3MOSA 3EN0A 4OI4A 3EUWA 2Q3FA 2OUKA 1E7WA 1XL0A 4NPCA 5ESDA 4HS4A 1PK8A 1NFFA 2LRHA 1C29B 1YJCA 2G5GX 3ANNA 3K9LA 3OPXA 4GMKA 5DI3A 5IW8A 4X6XA 1PTJA 1KAQA 3KALA 1Y3FE 1NLUA 3HCRA 2IY8A 2IOHA 4MWCA 3ASZA 4CM7A 3G0CA 3GLHA 1BXKA 2WNHA 3QPDA 1JDTA 2HF9A 5CLFA 1SMKA 1BEUB 1Y8CA 2COEA 3G9XA 2PWAA 2PZAA 4PWZA 1NV8A 4BB6A 5BSFA 5EJ5A 1P6XA 1G5RA 2VKQA 4XE5A 4QT4A 5B7PA 4B7ZA 4Q4AB 1KKLA 2J31A 3EBLA 3CEPB 4IMPA 1PHRA 2WG2A 2GESA 4D96A 2VEDA 4D9GA 4PLFA 5CLJA 2D8MA 3JWEA 3WAJA 3GOQA 5AKXA 3LWDA 3MGGA 2RAUA 4DVJA 1Y89A 1QTQA 1IYZA 2RGRA 1QYVA 3IIMA 1TD9A 1IONA 3TL6A 3KOZA 2WYHA 1VFNA 4GWGA 2NM0A 4M89A 5ILGA 3ZE6A 1BX0A 3MQFA 3R3JA 3RDPA 4BJHB 1GO2A 1P72A 3CF4G 2J0QA 2ERYA 4QFBA 4UM8B 2MR6A 4ZVTA 1UBTS 1FFCA 2ZJ1A 5HRUA 5LD2B 4E1AA 4M88A 3ZK8A 4IDGA 2FF5A 1C1XA 4TN5A 4EI7A 4Z8YA 1GCUA 3L1UA 3ZDFA 1Q7TA 2AEMA 4G9EA 1SKBA 3I3SR 4US0R 2YS7A 2AKEA 3D4OA 4J91A 5AK5A 4Z0PA 3D2AA 4GNKA 5C4IA 1AQYA 4ZA2A 3ICEA 5DNYB 1R12A 4EBBA 4I4TA 4L0MA 3LPNA 1Q3HA 3REGA 1LWOA 2OZLB 3ENZA 4M55A 5KJFA 5KNCH 4S0ZA 1LXCA 5LP6B 4WOJA 1BKYA 3FYUB 3TVYA 4DJJA 3I2IA 2BOVA 4ZARA 1VLVA 5ALEA 1XHEA 4GX5A 4MS1B 5C1BA 5IVKA 5K3BA 2FX2A 5KJ1A 2JJ1D 5LUBA 2WB4A 4L8WB 4U1RA 1XLTC 3ZHXA 2C59A 3KELA 5J4KA 4GMDA 1T8TA 2BSQA 4B3BA 1A9OA 3N1UA 5EL0A 5KVSA 3KSZO 3QTTA 4E4RA 2JS7A 3NNNA 4BV2A 5EKUA 4JQZA 1XCMA 1UJ4A 1E18A 1UMDA 1QQ7A 4YACA 5KDOA 2NN3C 3LRPA 4B87A 4DQKA 1L5QA 1BIFA 4BN5A 5NULA 4YRQA 1TEHA 4IDFA 1DMSA 2D2VA 4WFQA 2A67A 3IH5A 3HDQA 3UXEA 2FWPA 2MMGA 3EH1A 3NXKA 3V6MA 2O8DB 4RVDA 1ISGA 1ZJ6A 4XR4A 2QTHA 4G86A 3PRJA 4BNZA 1EFRD 3UYKA 4CF6A 4KXQA 4EJ2A 3AZPA 3HU1A 1D4ZA 1SBNE 4QNNA 4W5RA 4TL8A 1TUEA 4QG7A 3ER6A 3OHMA 4DMHA 4JR1A 4AJLA 4XQEA 4ZZ1A 4BIIA 1CQZA 3NX4A 4XYEA 3S27A 1HSOA 1LRLA 1JDBC 3VKGA 2QJTA 2JBAB 2G08A 3DULA 3IVGA 4J2TA 1YQXA 3OEYA 3U26A 4HNVA 2IF2A 4MUYA 1QM5A 1RKQA 3C6XA 1L4EA 3B1XA 4AS2A 4GECA 1DWOA 2GXAA 3NRJA 1UQTA 2CGEA 1G16A 3ONNA 2EWMA 1P3DA 4YMSA 1QHNA 1SVNA 4P3KA 4C4SA 1BXRB 4YIKA 2D0OB 3RUAA 4QE3A 1SRRA 3R8XA 1I7LA 4GZ6A 4X8HA 4EFMA 5A3JA 3WC4A 2H06A 4R7TA 4L8FA 1N9GB 4LK2A 5DNCA 3H5AA 4FXOA 1LDBA 3QELA 4TMFA 4RQBA 2W8ZA 1ZGBA 1I51A 3GVIA 4MQUA 3DL0A 3LYAA 1WDTA 3EIHA 4LDPA 2WM8A 1CEQA 3LDAA 2I0FA 3N2IA 4MUEA 1BSVA 3GYBA 3ZCUA 3WSTA 2QMHA 1LPBB 4QDZA 3KFXA 4MV1A 4R1OA 3I30X 2V9PA 1FP1D 4QOEA 1QCDA 2VXYA 4Q1DA 4ATNA 4N3BA 1R2QA 5K8VA 2X7JA 2HSGA 3Q3EA 4J1SA 1THGA 4BTVA 1XC7A 1O94D 1BO6A 1FMJA 1LK7A 1IG0A 1OA0A 2XUZA 4OY3A 3JQ9C 1JBQA 1KVSA 3MIZA 4IDPA 2A78A 4P4NA 4AF8A 1R74A 1Q22A 4CLRB 1EVKA 1PR3A 3BRWD 3CW2A 3VPAA 2Q7XA 4LK3A 1QVZA 2DPLA 1HE8B 1JKFA 1PWXA 2JVIA 4HX5A 5B5SA 1WMSA 4MPJA 2OC4A 4LEIA 1XZNA 3NI2A 2SHKA 1HYQA 2ILTA 4WZAB 6LDHA 2DFTA 2IXFA 5IKPA 13PKA 4LXUA 1L1EA 1G5PA 4CV2A 2ZRQA 1USGA 2OPBA 4XPIB 3WMWA 4BASA 5HDQA 1WM1A 4J1QA 4XYGA 4B7XA 4YJFB 4QVIA 1OZFA 3E7PA 3Q7TA 3GJ4A 1NOKA 3FDZB 4XYLA 1EK2A 1UBEA 4B0PA 3K6SA 4UXIA 2DFNA 1T4DA 3AB8A 4JBNA 2H1FA 1KRXA 4GOJA 3PIIA 4RMNA 2A94A 3QBTA 1ACJA 2BONA 3ZD9A 2O8CA 2Z43A 2ZIZA 3A2NA 3F71A 2EP5A 4S3MA 5J43A 2CUZA 1FLDA 5CYFA 1FNCA 4GI7A 4WXHA 2NO6A 3KKNA 1E62A 2UUAB 2NO4A 2H59A 2QENA 1F12A 5ALHA 2VTDA 1JPVA 1DWPA 2QQ0A 1IZZA 1X70A 4S35A 1GZDA 4DGQA 2VTVA 5LQUA 1WQ3A 1TTTA 1RC0A 1SUWA 1KO5A 2IYTA 2VT3A 3O2JA 1MC1A 3F2VA 4KWIA 3W3AH 4MWGA 4Z7NB 1JKJB 1ZI8A 3CFYA 4FMDB 4W1PA 1RYEA 3VKFA 5DXAA 1ESDA 2JFNA 1SQFA 3GJTA 3PFIA 1IXYA 3GRAA 3K70D 3HA2A 2BM9A 3CY6A 1HDZA 4N0MA 3FFWA 4IIUA 1S8NA 2CNLA 1UJCA 3N8HA 1FQWA 4J0HA 3BJMA 3JTMA 1E2EA 3AHEA 1CW2B 3SM9A 4DWJA 2J85A 6YASA 1PGPA 5LIRA 3L8CA 4RGQA 3G9ZA 4D8UA 2WTNA 2ZYUX 3UW1A 4PYRA 3KWMA 2O5CA 2FX5A 4GPIB 4HPWA 2VH1A 2Z5FA 4FFLA 3RTAA 3NV7A 1TLLA 2C2OA 2GK7A 5JFOA 1K7XB 4UARA 4D0NA 4L51A 2G07A 3P45A 4YH1A 4DCMA 3KZOA 5C5IA 5IWAB 4HGPA 4NV1A 2QN9A 5G0WA 4CCYB 5ICMA 2JBHA 1HDIA 4ZMRA 1W4ZA 5DX8A 2ZRJA 2P2YA 1UDAA 1NN5A 1XAHA 3AFHA 3CRMA 5TMBA 1RCTE 1GG9A 3OM1A 4G0WA 2RGUA 3KSAC 1PLJA 1CY7A 4JJ7A 1Q5PA 5I7WA 2X5OA 1BMTA 4I4NA 2CHGA 1WHTA 1RRCA 5KNBA 1FJXA 3ZWBA 1Z4PX 1V5EA 1ZSNA 3ASVA 1CUEA 3OU2A 4B47A 1LX7A 3LC7O 2X2OA 2C1ZA 1U4SA 4C4TA 1PFUA 3H9BA 1OX5A 4U0KA 5JH7F 1I1QB 4DV0B 4EUSA 4Q3LA 4RGBA 1VHQA 1PSDA 2K2QB 5M7EA 1V9SA 2G4VA 3C3XA 3CGGA 1GAXA 2D5BA 3VSBA 3CKLA 3GJ0A 3ZX5A 4DXAA 4E5NA 1Z07A 1TZBA 4E30A 3SIWA 1TD1A 4X1IB 4O2AF 1K8RA 3W5SA 2B78A 2QTVB 1XLWA 3OFNA 4A3SA 5K3SA 2NQ8A 4CQMD 1PNRA 3K70B 5AXAA 1X7XB 1QWOA 3UV7A 4K5QA 2P4HX 2YWXA 3CLVA 2PCJA 5BMVF 2ZPTX 4OL0A 5M34A 3KLOA 1AUVA 3U37A 1P44A 3I2KA 3TIVA 4XX1A 1F48A 4YALA 2H00A 4XDHA 4JB8A 4G25A 3TXYA 1UDWA 4CV3A 3TW0A 4CE6A 1W59A 1ZGHA 4BWFB 1V8OA 3M6XA 3OTGA 3PPWA 4PFQA 3RT1A 5KEIA 2M6SA 4BKUA 2ADMA 1G2QA 1ULAA 1HK7A 2GN9A 2NG1A 1N92A 1BD3A 1N2EA 3B6ZA 1T24A 3DZKA 1P5FA 3NIFB 4R8RA 3ZHZA 1R8YA 1FFDA 5IF9A 1Z8HA 3MWLA 3URMA 3QYJA 2QLTA 3MT9A 3T7KA 3DL7A 4Q4JB 1DJOA 3BCUA 1VCIA 3RF6A 4BX3A 3FDFA 3GRKA 2PJUA 1IQPA 1VLMA 2I6XA 2JLWA 1NXOA 3NATA 1KE1A 2Z1MA 1EE1A 2WKQA 1IXRC 1XELA 3DBIA 2PMEA 2XE6A 3O95A 3LO8A 1UBLS 3IOCA 1ZJJA 3F97A 3AY0A 2REQA 3UJBA 2NVWA 2J32A 5FPHA 3SPXA 3BAZA 2XV1A 4CI9A 1YONA 2BMJA 4ZO7A 4NCAA 2NO9A 3H04A 1QKJA 4NOLA 1NYRA 3VHXA 3D7MA 3ROPA 2IZ5A 2OO7A 3LAWA 4TWZA 3WNZA 2DG2A 4BQQA 5K0JA 1W8IA 3COVA 2RHGB 3GWZA 2CBZA 2HFKA 4MYUA 1I36A 4NY1A 3CZCA 7ADHA 2AZMA 3HR7A 4URZR 5ALDA 1CETA 3CW9A 5CH3A 1T2DA 3SHVA 4K46A 4G26A 3ZI7A 4WFJA 4UE2A 5IFLA 3DVSX 2G28A 3PNQA 4GPBA 4Y9SA 3NGXA 1C0IA 5SY9A 5FAXA 1GV0A 1KAGA 4MI9A 3TM5A 3PG5A 4GOMD 4GUDA 1E64A 3TGPA 2YC4C 3AJ8A 5E2AA 1BNCA 1F8GA 4XRRA 4UTPA 5CYGA 3DZHA 4LJ9A 2P40A 3HSYA 3FDIA 3PUJA 3TEMA 3WP0A 1KTIA 3VSDA 4H3KB 2K7FA 3T9AA 4ASUA 4LHEA 4LJSA 9ABPA 2OHHA 2APJA 4EGFA 1A98A 1Z5OA 4MGKR 2CMHA 4QPDA 2KSQA 2ZR9A 1E6KA 3JYPA 2ZIUB 4EGQA 4UNIA 1G9SA 2X8WA 1ATZA 1VP3A 2JCYA 5LZ4A 4ER6A 2R8EA 2V74B 5MFZA 3KPYA 2PJDA 1GNLA 1M1ZA 3MXOA 1VPTA 2HLDA 1DHRA 1MVOA 3CUEF 3AJRA 5E95A 1N2BA 1R4ZA 5BW4A 5KQPA 2G06A 4FX2A 4YJ3F 3IBYA 2IP2A 4O2AB 3V6LA 3INRA 3LHDA 3WWOA 4DMFA 3WE7A 2DUWA 4CNQA 2RARA 4TVSA 1VSQA 4AMBA 1A5SB 1I3CA 2WF5A 4JA0A 3BILA 5L53A 4XGKA 4ZO4A 1OASA 1FFGA 3CRVA 1XKQA 3KJNA 3UUGA 4MB0A 2BH9A 3MOIA 2FU5C 3OKFA 2ZPUA 1EDDA 3SCZA 4TSKA 4C30A 3F3SA 3FR8A 1KI4A 1KIAA 4B3RB 3TXAA 3FFXA 5LMNB 5B37A 4R2MA 5GINE 2PS1A 2QX8A 2R48A 3LGAA 1DE0A 1K0FA 2V5VA 4RY2A 4BQRA 2IS2A 3ZQKA 1UMKA 5G41A 3VH1A 3WLMA 4ALKA 5BUCA 5HX7A 3FNEA 2W6OA 2CKDA 4XIGS 2NVUB 3I05A 2QSUA 1Y7LA 3MPUA 3NAGA 1FTWA 3KO8A 4MYTA 1KO1A 4LBVA 3REFA 2E18A 3P2KA 1GL7A 1VDZA 2VK1A 3R7BA 3QXSA 2CV0A 2V7VA 4PG5A 3F1LA 4FT2A 4TYQA 1CUXA 5A62A 1JTFA 4O4JA 3AL2A 1ONBA 5B7NA 1YQTA 5CA1B 1CF9A 4Q7KA 3UATA 1SCQA 2AJ8A 4B3HA 3FF1A 3U4MA 1E7QA 2EFJA 1WLYA 2ASEA 2OCPA 3VQTA 1OFIA 3PC8C 4KSBA 3W6UA 1NVVR 4I9FA 1TTPB 4EO9A 4EECA 5EP1A 1AKWA 2DPHA 3I1IA 4J07A 3CUSA 1X2EA 4QPPA 3S6JA 4A6PA 5L3VA 1CSEE 2ZUWA 1KERA 3IJPA 3QV1A 4PIMA 4PPQA 2JA1A 3UMYA 2Q6VA 4MHSA 5FOQA 4K9RA 2Q5LA 2AN4A 4D3YA 4KR2A 4MITA 4RVHA 3D43A 4L75A 2BRUA 3L41A 3HCDA 4EJFA 3E9ZA 4D1YA 5L9AA 3P0EA 2X9GA 2CLCX 4X1KA 1OTHA 5KB3A 2H5LA 4IOLA 3PZRA 4Q1BA 1L6IA 2R1UA 3X1KA 4Q34A 4EHNA 2WJAA 4RA9A 2B8NA 1DC6A 2H5JA 4L0DA 4MLCA 5KHLB 2FFQA 2HPHA 3R3WA 3E5NA 3VVLA 3B1VA 3EUFA 1ZEMA 1MFPA 4EPVA 1LJLA 1N2HA 1JGTA 2AYYA 1JEQA 3K30A 4CKEA 3KBOA 2C98A 3ZD7A 4XCXA 1IUOA 4LCJA 1NBWB 4EG5A 4LS3A 4L78A 2XUIA 2CC2A 4MQEA 1XNQB 1YAHA 2F4NA 3LXRA 4MVJI 1JI0A 2OXCA 3DWIA 3ANYB 1UOPA 3FHJA 3KEQA 4FYKA 4XQCA 5E1MA 1NKSA 2ZUVA 3FWYA 4NRDA 2HJVA 3ZR4B 4BBJA 3L93A 2WIBA 3V8RA 4RQTA 3WB2A 3BGWA 3JSXA 3ZGYA 2DTEA 3ABQB 4URWR 1RKUA 2A0YA 1MV8A 2P6NA 2OD7A 4WOPA 3KVVA 3NTRA 5AVQA 2HXYA 2ZRGA 2FUG6 1Z68A 1O95A 2V7UA 4EF4A 2FPWA 3GH3A 1NBEA 1EQ2A 2ZAMA 1QJCA 4PC6A 2HRZA 3IUBA 5LJLA 2G72A 4CEHB 2BE9A 3B1ZA 2INGX 5JSHA 3CUWA 1ONOA 1EGVB 1KNXA 1Q7BA 2QGZA 4M60A 1BMFA 5KQRA 3Q7QA 2V65A 2YMMA 1TM4E 1I13A 4M9SA 3SFVA 1QONA 3P9IA 2V45A 4CLXA 1Y4ZA 3ELUA 5JYEA 3L7YA 2OBLA 4IWXA 4OB7A 3ANXA 4U7GA 4PF1A 3K9FC 4RIEA 3TLYA 2WG0A 1UMBA 2QV7A 4OK3A 3HZRA 4YTEA 4C2BA 5F35A 4QGBA 4WNCA 4YDRA 3ZJTA 1O89A 2BHNA 2XEDA 2D5IA 3F9RA 4F3NA 3D8BA 2BZ1A 1A27A 3HSKA 4IXMA 2HY7A 3WOVA 3KETA 1PL7A 5BV0A 4C22A 2FMIA 5CFNA 4PXSA 1VHLA 2GKOA 4GOOD 2YXBA 3O7MA 5JQGA 3DONA 3KG2A 1YU9A 5AVKA 4W7HA 2FG6C 3O1JC 4LMBA 4B6SA 1V1RB 4PX5A 4G8BA 2P9YA 1V47A 3BWEA 2B4YA 4M9ZA 4RK5A 5DF1A 1PT5A 4KDRA 3S2ZA 4ZGGA 2C1EA 1Z8DA 2GD6A 3LIPA 3KR2A 5FHQA 1JE0A 1NIPA 1HG0A 1YSCA 3DAHA 4IMRA 1JS1X 2ZM6B 1RRGA 1RM0A 3P20A 4KFSA 4TWAA 4HAIA 2YYSA 4NFSA 4PX9A 1P9RA 1R0RE 2W6MA 5I45A 4XPZA 3MMSA 4E33A 3HG7A 4JOBA 2DPGA 3DOIA 5FTNA 3PR2B 2DFVA 2OV2A 1YQEA 4QD3A 4AJ2A 3H9EO 4DOMA 4HDNB 4WKCA 3X43A 4I50B 3ETGA 2OCKA 1NLYA 2GZ3A 1ISIA 1QH8A 1NXSA 1GTRA 1KHTA 4MW9A 4OOFA 1TK9A 2OFWA 4NTZA 2BZGA 4OSEA 4K3UA 5JYCA 3OCWA 4CG2A 2W22A 1PGQA 5K03A 1SOVA 2OOKA 1WKBA 3OCVA 4PRYA 2PZGA 3MILA 2RCYA 3TKLA 4FN5A 4F11A 2K87A 5DB4A 4HEQA 3CR7A 3Q4GA 3DJYA 3K2IA 1DAGA 2ZUEA 1TZKA 4IGAA 2O3QA 2TYSB 3ZY4A 1OWNA 3WYNA 3KQPA 4WSOA 5TQ2B 1S2IA 4L85A 4FLEA 3B5JA 2G67A 1BE6A 2E4AA 4WKGA 4FK8A 5D01A 1DC8A 5DIFA 4B46A 3HVRA 5FWXB 1QO0A 2D3WA 1G291 2EFYA 1OV4A 4RSMA 3LBHA 1LJ8A 5TV2A 3OO0A 5BMVB 5BN5A 3ORYA 3PI6A 1ZC4A 3C4JA 3VJLA 4CYMA 1L4YA 4WVLA 4AT1A 4C4YA 4OJTA 5CVVA 2DQSA 1NZDA 2JDIA 1BQ3A 4KDEA 5BPFA 4GT1A 4BJ5A 4Q16A 2X0EA 4JNCA 4QBHA 4X63A 5HMLA 1L5HA 1NLFA 4A6EA 5I7OA 3EEQA 2KJQA 3E1SA 2B37A 4QU0A 3D8TA 1DTWB 2UZ1B 1RDFA 2DWPA 4RVNA 3LX4A 3RFVA 3U3RA 4BRZA 2F2TA 2NW6A 5L7WA 4PCLA 4QFMA 3FFAA 4ZC8A 1T10A 1ICEA 2E4YA 1HMYA 2X1VA 3LFUA 4HY3A 4EO7A 4HNUA 1JAYA 1XJQA 3GYGA 3N59A 3PNPA 3F3YA 3RKUA 1C9NA 3L82B 4LRXA 5REQB 3TJZA 1XU4A 1LPOA 1L1RA 3CNEA 3G8BA 3M2TA 3NYQA 1LV7A 3WG9A 1WZNA 3CX8A 5JMPA 1FSGA 4KDCA 4DIUA 2WWGA 4ZDWA 4G0UA 4JJKA 1W36B 3LXUX 1CZRA 2NZ2A 2P3LA 2Q3EA 4R3WA 3BS4A 3A4LA 1MGPA 4D9IA 4W9MC 4JV5B 3VSAA 4F8JA 1QC5B 1VL0A 1HETA 3K0SA 5C37A 1ZC3A 3PHHA 4Y3UA 4FW8A 2I4NA 3UJDA 4AS3A 4QYXA 4ICIA 2GVZC 4CQMB 4W99A 3D8HA 4J03A 4NNOA 1P0FA 5E6RB 2FRXA 1U6JA 4OKSA 4PFJA 1WNFA 4TYNA 4UTOA 3TCKA 1IXZA 1IJBA 3ZQ6A 1ICIA 1Z6ZA 5JH7B 1F8YA 1WETA 3M5PA 1KQNA 4AECA 4IXDA 1JA1A 4KLZA 2VQ3A 2NU8A 3LRTA 5LUAA 1HNXB 3H84A 5D84A 2X4LA 4HCJA 3ANLA 1W25A 3FNRA 3C98A 1JJBA 4RZXA 4C21A 4PQRA 5JD5A 5ALTA 4C0WA 2JGLA 2BF7A 2GHIA 1RJ9B 3ZBTA 1G42A 2HKIA 1MQSA 2EG5A 1P0MA 1H65A 3HJHA 3MK31 3RVJA 3WDKA 1KYWA 4JGBA 3ZLJA 4K87A 1RPJA 1ZD5A 1ZH8A 4JWTA 3R5SA 3PUXA 1MOSA 2Q9CA 4P7JA 4PIPA 3ENQA 3NNSA 3I61A 2K7ZA 4P3NA 3BQ9A 4U3JA 5D51S 4IY1A 1QIKA 2EX4A 3UXMA 5I8WA 3RWBA 3BA1A 4COKA 3D0OA 2R4QA 1CTQA 2ZWOA 1A3CA 2QROA 5EWLB 4P86A 2DMRA 4AP5A 5J4VA 1OBFO 1YOVB 4LZZA 3I6ZA 4P22A 2P11A 4I8DA 3W2FA 4YRGA 4HNTA 4CKCB 1FP4B 3OOEA 3FMGA 4V2UA 4B6RA 1Z2DA 3M6IA 5DISB 4BJ3A 1MNAA 2AFIB 1OB2A 2ZI4A 5CBKA 2BFEB 5BR4A 1PVOA 3BMCB 1RLOA 1E61A 4O1IA 4OUDA 4Q03A 4Q4LA 4U39A 5FTWA 3WKCA 4B2LA 4TYMA 1NMXA 2EF0A 4Y0AA 4IDBA 2D74A 2FP4A 3WGMA 2HEGA 1MV5A 2AJLI 2BJWA 2N42A 4MVCA 1XRNA 2DWOA 4NZPA 2PHZA 5ED4A 1XMOB 2O9JA 3LO5A 1OX6A 1GY8A 3VX3A 2AWNA 3T4EA 3UK2A 3D6AA 1KSFX 3HP1A 3C3JA 4CM8B 4ZN6A 1FPQA 1J5PA 3KZCA 4UHFA 4TXLA 3CMCO 1G8JA 4CMAA 2E21A 3I5UA 4EFKA 4G8CA 3WQRA 1UZUA 2A3NA 1E4OA 2IT1A 3K70C 1YZKA 1MABA 1MU0A 1PCXA 3IAXA 3I6IA 2QUZA 3I09A 4FEGA 4M7WA 4NCJA 1XZIA 4HYTA 5KWJA 5KNLA 1AZWA 1V7PC 4DMLA 3DBHB 1UBGA 2CLLB 1XWIA 4LWZA 1W49A 3OQHA 1GPWB 4LMPA 3TVTA 1OKKD 3AY3A 1A7UA 4ALMA 1GG5A 4XH9B 4D97A 4C08A 1EWRA 5I9NA 1CUDA 3EQ2A 2ETXA 2HA4A 3NDPA 4UTVA 1KR2A 2AG5A 3OPYI 4EG3A 1PS9A 1XFAA 1XRPA 2OM2A 3FETA 5FF9A 4KIWA 4YJGB 3G23A 4D4JA 2O8EB 2P2LA 1BDBA 1M6WA 3ZEAA 2CHVA 1FFSA 3FRJA 1IN5A 2BLLA 3KOUA 1ZKMA 3DDOA 2DWUA 1XUOA 1FTYA 1QZ3A 2PH3A 7GPBA 3GLSA 4S2UA 2VCEA 4CCAA 4F5WA 1TO6A 2QDXA 3IO3A 2HF8A 3YASA 2XBMA 2NZJA 4YONB 4GLOA 4DQVA 4Q6WA 2CFSA 1KS9A 1V25A 4ZT6A 1LY1A 1NDHA 4G23A 3ZJ5A 3I45A 3W8DA 4QPZA 1XLUA 2G9VA 4JROA 2HMTA 5DCUA 2IH4A 1BOFA 3HCEA 4HEA6 4F4JA 4GL2A 3GNLA 4G4IA 4UM5A 1E8MA 1RI4A 2E37A 3S2EA 3GJSA 3D7KA 4M87A 2WJPA 2XB8A 1A97A 1MEEA 3SS8A 4CHGA 3GUCA 2WI8A 2A5DA 4ZVKA 3AFGA 3CVOA 1GXSA 4TKVB 2XQIA 5EHNA 4EW6A 1O0CA 4CMCA 2XMCA 3DAGA 1FFHA 1HYHA 3GHYA 1BD4A 4M86A 1CRLA 5CDUA 4Z4IA 4UUBA 4C1NA 3FIJA 4O4HA 4C6SA 4POOA 2BGGA 2OG1A 2Y1EA 1V4VA 1II8B 2HYDA 1I5OA 3NVMB 1JR3E 3C3DA 5DP1A 1N2CB 2HA5A 3C8UA 5JWOA 4J4HA 2EQAA 2H2AA 2I4LA 3CKYA 3TSWA 2P8SA 1THTA 5EXXA 3SYMA 2QTLA 3FZEA 5GTDA 2O1XA 3LG2A 2O2ZA 3B89A 3SD7A 1Z17A 7ABPA 3G5MA 2ZBEA 5KU7A 1FF9A 2C2BA 2HK8A 2ZCJA 2CWWA 4Z4EA 1LZKA 1K8ZB 3C7KA 1QFXA 1U0HC 1SH7A 4I5GA 4MLPA 3SDZA 3FTQA 4Q7EA 1X7WB 4PPFA 3QGMA 1NTRA 1NL3A 3IE0A 5DO9A 4YDSA 4AG5A 1WQ4A 3BAFA 1MAVA 5KYYB 1NV9A 1Q20A 2R25B 2ZTSA 1RBMA 3KU4A 1CJBA 5E6SB 2YV3A 1RAEA 2NWQA 3QUAA 3T9EA 3GJ8A 2D7DA 1CQIB 2VHEA 1JMVA 2PBLA 3BC1A 3IR7A 2GSWA 3QOWA 2PE5A 1MQ9A 3OH8A 3GVHA 1C3VA 1J0EA 3WLPA 1A77A 1E2JA 3TB4A 3GEGA 3OAAD 1V9LA 4U7FA 2D62A 3JQAA 1GSOA 1S8FA 1VI5A 3EEFA 5EI5A 1K8XB 1Z7YA 2FFRA 3M33A 1WSAA 2ZBVA 5E9WA 3TH5A 4NLLA 4C0LA 3U19A 3DDNA 4I6GA 4O08A 2COUA 4YLYA 5JADA 1YR2A 4B71A 5ALJA 3KDAA 1YI0A 5BMOA 2IZ6A 5H80A 4X5OA 5DRYA 3FUTA 3WTCA 1GR0A 2DX7A 3JD4A 1AUPA 2C57A 1M1XB 2QLJA 2P9HA 2QL9A 3FR7A 1RJGA 1XK6A 4MZDA 1QSGA 4LJRA 1CEYA 3KPJA 2PTHA 3TK1A 4JP3A 2A7XA 4EATA 2Q99A 2NOAA 2OAQ1 3N6XA 4LZNA 3TLCA 4QYIB 3C4QA 3VH3A 3WMFA 1RR6A 5CBPB 4E5YA 3L6DA 4NK5A 1AHPA 2OVBA 2BBTA 4HEA1 4IXWA 4HYYA 4TXJA 4IFBA 3DCYA 3MWDA 2FZCA 2OY0A 3WIUA 3UGJA 1XQWA 1RXSA 3D3QA 2AVNA 4O4IA 4CMJA 4MYSA 4C2UA 3IEVA 3P2OA 1BW9B 3V4SA 3L6OO 1G4HA 4RKQA 2GEBA 5EUQB 4Y2TA 4AXBA 3GEMA 4E4YA 1L5WA 1UL1X 1DT5A 4PSUA 5IK2A 2YUIA 3DLHA 5AWFC 4RJKA 4JUCA 2QSYA 2WA1A 3BDAA 1N7HA 3R24A 4U6QA 1AN9A 5GAJA 3T7TA 3DGFC 1EAYA 1AUXA 3A1UA 3IEUA 5BSEA 3OURA 1V5GA 3JWGA 5CUQA 2M1XA 3UY4A 4O2BA 2QRJA 3IQGX 4E70A 1DP4A 1EB8A 3QWIA 4JBGA 4BVFA 4WECA 3NIWA 1NULA 2SKCA 4X84A 3GLIA 3DW1X 5GM1A 1UADA 4AP9A 1XQYA 4RM2A 2PMDA 5KDDA 1ZHOA 2BCJQ 2VRWA 4LYAA 2WJ4A 4WCDA 4YMTA 1I94B 2ZUDA 1EFUA 3DE7X 2K6GA 3LWZA 3OEWA 1B0ZA 3BICA 4YC7A 5EQJB 3VR3A 3PXCX 1U1FA 3C5EA 3IKJA 3CLUC 4AL4A 5BN3B 1Q7RA 3EF1A 4MOWA 2YWDA 3MBIA 1XX6A 2DPYA 2ZYHA 3DDUA 4BVJA 5AHXA 2HSDA 3HJUA 1D1PA 3GO4A 4AZ0A 1JBKA 1XWWA 4OTZA 4QOGA 4PGFA 1PJ2A 4TKZA 3WIDA 3TJMA 3TDMA 1TVCA 4PN7A 1FDRA 4LMAA 3OTIA 3BXEA 2ZVPX 1X1EA 1JR4A 1XXHB 2QPTA 3BMNA 5K0LA 2WTUA 4J49A 1QMGA 3PU6A 1GQRA 1JB9A 4PEVA 3O75A 5CB6A 2FJPA 2W9XA 3ANMA 1N34B 4YHBA 2RBEA 3PQ3A 4IFEA 4KUEA 2O7QA 3RV4A 2DKOA 1J1ZA 1RQXA 1PL6A 2A5FA 2GPBA 1NVXQ 3HB7A 5TGDA 1PWYE 4OBEA 4QWWA 1K3UB 1SUEA 1FC0A 2YRWA 4FGSA 4AJ4A 2AF3C 2CDBA 4X0EA 3KD3A 2XZDA 5ES3A 1KJNA 2GTHA 4HDRA 1R27A 3L5KA 4RXUA 4EY8A 1U2QA 1QGZA 2DSNA 2DULA 3EVZA 5JW6A 2VJBA 4XJSA 4DNXA 1KH2A 4J7CA 3EY9A 2RK6A 1D0SA 1WSDA 2YFQA 3NG1A 2MHCA 1Z39A 3JQAB 4HVCA 3FMFA 2RKOA 1RJDA 2PKXA 4WERA 4OQZA 4YMLA 2Q8NA 3KFVA 1QDUA 2VT7A 2OEPA 3CR8A 4CI0B 1Z6QA 4MMZB 2UUCB 5DBFA 4BVGA 1OW3B 1ZUIA 4V03A 1GV1A 2O2EA 3KL4A 2J4DA 4HDCA 5CAEA 3L40A 5BSRA 2FR8C 1YHZA 4IINA 5DN6A 3RSQA 4BL5A 4IMIB 1ZY2A 1IJEA 1EZZA 3KZ1E 5CX1A 1UK7A 3JD0A 3VZQA 2WTBA 1X38A 1XYVA 4FS3A 4EHHA 4L0QA 1GRNA 4FSDA 1T36B 2H8KA 2BMVA 2HUPA 1ECGA 2O48X 3DE5X 3NWJA 3S2UA 4P34A 5F7XA 2OCXA 1W1WA 3HV2A 4OQEA 1HT0A 5A5GA 1LFDB 5IDYA 5BN4A 3IAS1 2WUWE 4MJXA 4TLMB 5HRCA 1KJWA 1DT3A 3DTVB 4QRDA 2IV2X 2ODQA 3HYRA 2I3BA 4X91A 3JQBA 2PZKA 1Y5RA 3MT8A 3VDXA 3N0WA 1FLVA 1LBSA 1Y5LA 2LNDA 3AR7A 2JFZA 2NZYA 3R8FA 3TIGA 3VR6D 1ODIA 1R6AA 4N76A 1UP7A 3BX1A 2VF2A 2MTBA 4H0CA 3IMKA 1C8VB 1JX6A 1Z6XA 5ER9A 2IBTA 3UMVA 3Q7SA 2CYAA 4IMJB 2JJ8A 4PC3A 1YJXA 3MAJA 2OV3A 3NDJA 1DKUA 3EXFB 8AT1A 1VSUA 3OFSA 3QJGA 2VJMB 4LWOA 3C1TA 3EGOA 3FDZA 3NHWA 1QORA 5GPBA 1FTSA 1JQ3A 3AUKA 1EJ2A 2LDXA 3UWDA 1DXQA 1P3Y1 1F8FA 4HWTA 3F8WA 3PKIA 3EWNA 3A14A 3COPA 5FQNA 1JE1A 1OJ7A 1XAGA 2A58A 2FN7A 4FGUA 5I01A 3E7XA 5P8WA 2DWQA 4AJEA 1H93A 2FSHA 2JAOA 3HCOA 1LPNA 1SBZA 3I9V1 1EP3B 2WR8A 3G9QA 2AOWA 3I9NA 2RK3A 3MERA 5SY6A 4WZAA 3D6HA 1E2BA 3ICPA 2P90A 1XZHA 3QEKA 4BU1A 2M6LA 1QOZA 4NPHA 2Q1XA 1PR9A 4LOHA 2WIJA 1Q77A 1B26A 4CIAA 4UXHA 1BX3A 1JKIA 1DIRA 4UHJA 1PR0A 4MV9A 2QMQA 3UHFA 3FPBA 3TLMA 4EUEA 1L7VC 1Z06A 2AN3A 3E7DA 3I8OA 5H0IA 2FMXA 2NU9B 3C6ZA 1FRQA 4LJYA 2QVLA 3J81A 2H1HA 1RXVA 1RCFA 5A3VA 3JQGA 1IIBA 1X80A 1J8YF 4YUVA 3VTZA 5A04A 4DV1B 3K8YA 1DFGA 3D3JA 1TIBA 1W47A 3PQFA 1AHIA 2C0QA 2PUDA 1MB9A 2ZYWX 2EL7A 3DDHA 3FX2A 3UXYA 5H7XA 4L22A 3TBHA 5EIAA 2XCSB 1UZMA 3R41A 1OZHA 4CIYA 3AFNA 1WG8A 1AGNA 3ORHA 1GLGA 4RIFA 5ALYA 4WUVA 3U09A 3R7LA 3ZV4A 2Y99A 3B6JA 4ZHQA 2CXNA 4MYRA 5HE9A 4F8EA 4C7VA 3PQ4A 3SJBA 3QQ5A 3SFZA 5JQWA 3TVDA 2B99A 3MS2A 1PFVA 1XNRB 4DY4A 3EGCA 4X00A 4XWGA 4ERXA 3JQPA 2QVCA 4AKIA 1ZBQA 1GPYA 2V6JA 5F2NA 1C9MA 1KVUA 1C8BA 1M2NA 4KWEA 3PGLA 5GWXA 3DLIA 5A6SB 1V35A 3BH6A 1V5IA 3EODA 2JFOA 2XPCA 3QX9A 4BWGA 4YAUA 3QW2A 2ODTX 1NHWA 4NS4A 2X5XA 5J1TB 1XLTA 2VAVA 4UBMA 1VIMA 4S12A 4B8ZA 3QIAA 1OYWA 1DC3A 2B7CA 4PO3X 1AHNA 2IKSA 3L4BA 1MRZA 2LUOA 3WYGA 3OLYA 3R23A 1DELA 5H68A 3R7WA 4LJAA 1QAQA 3K20A 4E11A 4J6FA 1H5QA 1XPUA 3QPBA 4H4DA 4JB0A 4NIMA 4Z0HO 3Q9SA 1F7VA 4W1RA 2IZ0A 3UOAB 3DBVO 1ID8A 4H77A 1Y6ZA 4LWQA 2V5AA 1IUKA 2AIRA 2Y0EA 2CDAA 3OX1A 4I50F 1DEHA 4URVR 1P0IA 4NAUA 4EA6A 3CXRA 1FEZA 2Y1LA 1VL6A 3I9V6 5ITWA 2YFHA 1G6KA 4P7GA 3P97A 2DXIA 3BXGA 3F4LA 3CC8A 4OQXA 3IMFA 4N7JA 4WL0A 1F51E 1E1MA 2Q0HA 2Q5EA 2WWVD 4PCAA 4K7JA 3TIIA 5K0GA 1AZLA 4CQNA 1TM7E 1UBOS 4FMDF 2P2NA 4TS3A 4EB6B 3LTNC 2JH3A 2E2WA 5CT4A 4Z0TA 5LU9A 4CKZA 1GKLA 1FSFA 2WSMA 5DRTA 3WMRA 4FVTA 2VP2A 1T6ZA 3TW4A 2NACA 3VH2A 4WFIA 3OLZA 2VZ0A 3UAOA 3LF1A 4US2R 4J9UE 2RGWA 2XLBA 3HZOA 3QKUA 2YJNA 1RE0A 4HRYA 5LWQA 2P67A 4LVCA 5FWNA 3UJ8A 1FMFA 1Y7HA 3IIIA 1S2OA 3KJHA 2MT9A 3EA4A 3HN2A 4GM0A 1GVNB 1SNYA 3EIXA 3B1KA 3EJWA 4BFVA 1ENZA 2H4ZA 2L0XA 4K9SA 4O59O 4H3VA 5ALMA 1ZL2A 5T7BA 2QAIA 2ONZA 2JFUA 4IP0A 4KXVA 1YTUA 2I34A 2PFKA 2VLIA 3KYCB 4A7PA 2JCSA 3HFJA 1ZICA 3P2EA 3WYDA 3DMYA 5JRZA 2UZAA 2VSXA 3FCUB 2CDCA 3V7YA 4YPFA 4AVYA 1YDMA 1A2KC 3A6DA 3CZAA 3OI7A 1OLUA 5F33A 2PQ2A 3ZHVA 1EXNA 1QZZA 3CB2A 3DE0X 3IT1A 1YB2A 4JLDA 5LYJB 1NNSA 1Q3KA 1LFAA 3R9XA 3R5JA 4KXLA 1U94A 4CBVA 2ZB4A 1DGQA 1OBVA 1Y63A 1HV8A 2VQSA 3WJAA 4MW7A 2WWYA 3MCUA 2OAGA 4DTCA 2R0QC 3IBTA 3VTFA 4C14A 3PQEA 3MCAA 1F3OA 1ZM2A 3EVDA 3HLKA 3LS2A 3OY2A 4E22A 2QJWA 1O5TA 5C5EA 2GUGA 3INTA 5EXTA 5HZMA 4L8LA 1CFZA 2AI2A 4XM0A 3WWZA 2PAAA 4ETMA 1DAMA 3CS3A 1ZESA 4IHJF 4JQOA 2FTKE 4WBNF 3BA6A 4X97A 2AQIA 1RC1A 2Q5FA 3W78A 1PFKA 1E2MA 3DKKA 1XPOA 4BNGA 4ZO8A 1QGUA 1V8BA 1G60A 2ODPA 4D4LA 2FE1A 1IHOA 2QTRA 3O47A 5DNDA 4B76A 5KOIA 3T5CA 4B9AA 5L4SA 4Y2PA 3FNGA 5J5VA 5PNTA 3IBSA 2AF4C 2P65A 1ONSA 2BVNA 3KZKA 1H9AA 3VO8A 1DKMA 4AUMA 1L7EA 4F9FA 1A5ZA 4DG5A 2PMKA 2A84A 5CT5A 1MPXA 1K7EB 1Y5NA 4X1YB 2GK6A 1V2HE 1X1AA 3IPCA 1WF3A 4UAJA 3RTCA 3FRIA 3ZJVA 3WRXC 4J7XA 5CT8A 4DCUA 2P7IA 3W5DA 2GPSA 1GTVA 1AURA 4ADSG 1XVUA 3ZI0A 1RHQA 3DC7A 5CGQB 5LDGA 2QZSA 4K6FA 2JGKA 1R0CA 1UMCA 2Q3MA 2QR5A 4AUNA 1JNXX 1BS2A 2LDBA 2REBA 2X5NA 4RS3A 4JVSB 3DBRB 3G0HA 5E4FA 2H1LA 3SEZA 1KEKA 4MICA 3K0HA 1ZCFA 3GIWA 1I1OA 2JGDA 1T1RA 2H1IA 3IAAA 4MH0R 4BZQA 2W6QA 2RIRA 1FMTA 4FOPA 1EDOA 3OFJA 1I1HA 1VL1A 2NX2A 1PSZA 1H0RA 1P80A 2G3YA 4BQSA 5LNK6 4OH1A 3JD1A 1XEXA 1UZNA 2KYRA 3QWAA 5IP5A 5JQGB 5G1NA 3U6KA 2FDXA 1P7PA 4DV6B 2GZMA 4CTNA 1TJNA 2GK4A 1TQ8A 4AKSA 3EVCA 3QPCA 4LZAA 3A9TA 3E05A 1DBPA 1GKKA 2GAOA 2BMWA 3VR2A 4OHRA 4DB2A 3C24A 3LT0A 4IQ8A 2F6RA 4ZRMA 4M0EA 1AS0A 2HJRA 2UVPB 1J49A 4OUKX 2Q4DA 3BGVA 2L17A 3ILVA 4II2A 2D4AA 4XWYA 1P2GA 1I7DA 2ZBPA 3Q3GE 3CU5A 5DOZA 2XDYA 4I36A 5HCIA 3FWPA 1H1TA 4TLAA 3BGOS 5KTOA 4FWTA 2PX8A 2I55A 2W2XA 4C3UA 2VDQB 4E6PA 5JOQA 2BGIA 2EW8A 3OIWA 4JYZA 1FFYA 2NUAA 4OPMA 1DFIA 1KJ9A 3E3MA 4EEKA 2BFBA 3IILA 2ATXA 1NVMB 2Q41A 4LDNA 3V00A 3A05A 3EMKA 1LBEA 4L7VA 1OWMA 4UAUA 5K8LA 1ECPA 3TRFA 1A7KA 3WHPA 4RVCA 1QP4A 2O8FB 3CVXA 3ZWOA 3KOOA 1VA5A 3IUMA 4ND8A 1RRKA 1ZSYA 1FP6A 1XN4A 2DOKA 1VBKA 4X94A 3V7FA 3GGJA 2CUTA 3IVXA 3QNMA 4MQEB 1RRVA 2HEIA 4JL6A 4WW0A 3RREA 1J99A 2WK1A 1R15A 1Q1BA 3KZNA 2XYRA 4J4TA 5CDHA 2MDTA 5EXPA 4G5QA 2AG0A 3M4YA 1MZPA 1DX9A 5F3DA 1VIYA 4MJ7A 4CQJA 3NT4A 2JW5A 1XALA 1GGJA 5H02A 1NRJB 2FG5A 1FMLA 4Q39A 1CNMA 3TOZA 2V96A 3W5IA 1W52X 3KWFA 4N7MA 4EPXA 4F9EA 3SKYA 2ECQA 2HPAA 3ILSA 3IUYA 3O8QA 1J2RA 3VR4H 3Q8XB 2CHEA 3L18A 3FGZA 3W6ZA 1KIFA 1VCHA 2D0IA 3LY8A 2ZRFA 1E0DA 5EZYB 2X6RA 1GA4A 3PEUA 4Z9BA 5IJAA 3WRWA 2BTQB 3CPHA 1UFOA 3WGZA 6GPBA 3OJCA 1TRHA 2H1WA 1P7CA 1OLXA 2QGNA 3W5JA 3EAFA 2ZSBA 4MEBA 4GMHA 5BOSA 1QV6A 3H8JA 3S55A 1N4DA 3CPSA 1B16A 5C8XA 1T35A 3THYB 3ZDBA 3K1AA 1VYHA 4N01A 1M6VB 1FDVA 1E60A 1AUQA 4Q02A 3CWZA 2VHZA 1QX3A 3DTTA 5A3RA 3CMMA 1XEWY 2FE4A 3IS3A 1TIKA 3CB4A 4RD4A 3B36A 2JGNA 4LTDA 5TR9A 3LUJA 3FF4A 4ISCA 3ZJ4A 2H0RA 4J16C 4Q9DA 3UKJA 2OILA 3ZTWA 1ODCA 1L4LA 4PLZA 1O4WA 3NBMA 3QLUA 4P5PA 5KKNB 3K5IA 4M6WB 1JH8A 3PX2A 5E7JA 4ZJYA 1B6GA 1OWOA 5LWHA 3CT6A 1BS9A 2CYCA 3L8FA 4GPAA 4DUGD 1SC4A 4G0PA 2AOTA 2QEQA 2Z6QA 3NT2A 1NYQA 1YC5A 2RDMA 2XCQA 3UVEA 3BN3A 2OCYC 3DM5A 3JXEA 2VHWA 4HBGA 4DQLA 1NU8A 3ZTTA 4KGVA 1Q92A 4J43A 2IUUA 5ARCA 3ZWWA 2H3HA 2XKAA 2RHCA 1JEYB 1O97D 4KQ1A 2F1KA 1K7CA 1R9MA 1EFLA 2Y05A 3PDJA 4XASA 4B3CA 4F91B 2DTDA 4BBAA 4YRCA 2H2GA 3D6VA 4N9WA 4Z2AA 2RJ3A 3RS9A 1N25A 2RMKA 1WIWA 3NMUF 3GUZA 5AJZA 2CUKA 1N2IA 4CIXA 4MPPA 2DC1A 5JEDA 3G8DA 1YUBA 3OCZA 4OVKA 1CY1A 3FYDA 1E2QA 1Z2EA 4FUQA 3VU1A 2B9EA 1OT3A 1XE3A 2O8VA 2FEKA 4GSLA 4Y2SA 3V5NA 3WA6A 2J0UA 2R5WA 2ZPAA 1OLXB 1EFRA 4WAUA 1F5SA 3GP3A 4ONEA 4MVJH 3DDWA 4HLNA 2XNDD 1A71A 3T7DA 1PW5A 2A86A 1MX5A 2ATVA 2KWIA 4AKGA 3H8VA 3PUWA 3VZSA 4FGJA 3EYWA 1WE2A 3OM8A 5C9ZA 1ZGCA 2F3QA 2QVYX 4B75A 1GYRA 2GCOB 2B4KA 2R96A 4IKOA 3IPLA 5LA6B 1YKGA 1U8UA 3DDCA 3X2EA 4ER7A 1JG3A 4NONA 2YJ3A 1ZK2A 2FGKA 3F49S 3L8ZA 4ZIRB 1GRRA 2WJVA 1CB7A 4IIYA 5JSYA 4A36A 3LP8A 4KE9A 5BWMA 1YR3A 4PAMA 1CRWG 4ERNA 1CY2A 1NJSA 1KOLA 4DCPA 5T3UA 5JMOA 4TT3D 5D8DA 4FOOA 4U9HS 5B7GA 4BLUA 4R1MA 1XZLA 2XAAA 1XMXA 1N9ZA 1DKRA 1ZW6A 3PDIB 3SOPA 3D8RA 4Q4HA 3DZIA 4FFSA 5AJHA 2QM7A 3W04A 4LYGA 4MWSA 3LPAA 4RIHA 2PWBA 3SY8A 4Z4CA 3C45A 1XV5A 4JKOA 1L5KA 1CUYA 3O1IC 4UJ3A 3W4JA 3M6LA 2UXCB 4CPDA 5HMMA 1O1YA 2JAPA 3RSFA 2VYQA 4KXXA 3SZMA 1M6EX 4LKOA 1WB4A 1TT5B 3EC7A 1Q0UA 1US8A 2HUNA 3WWDA 5TS3A 1XTSA 2PRJA 4DREA 5EIHA 4KEAA 2CJPA 4O02B 2HCBA 5BNIA 2P0AA 2P5YA 2WKPA 1MC4A 2XUOA 1RLTA 3AGQA 2C0CA 1TAHA 2QUJA 1AMOA 3WLAA 4ZDIA 4JFRA 5EESA 2ZFUA 4B32A 1OA1A 4ZOEA 5BQFA 2XT9A 2WHPB 1QIJA 3FOFC 4B9EA 4NE2A 5L95A 1TGYA 3B3AA 3VAAA 3A1SA 4EH1A 3FLAA 4EQ6A 2Y0PA 3T35A 4A91A 2I91A 1KI6A 2B1QA 2XOKD 3EFEA 3GMSA 3BHIA 4GXTA 3FSGA 4DV7B 1I01A 2V7PA 1IFXA 1QYIA 2XGMA 3DHVA 4PZYA 5A4JA 4C0JA 3B8EA 1RVDA 2X0IA 1Z6AA 1ULHA 1XMSA 3C8HA 4Z51A 4OMFG 4JGGA 4S0XA 3A6PC 3MS4A 1P4SA 3BJIC 1US8B 3PTLA 2I3GA 2QZZA 1GEEA 1XTZA 1WVMA 2BGUA 1W0CA 2ZETA 3GZNB 4XIYA 4JVMA 4REQB 4E2FA 3KNZA 5ARBA 2BFCB 4CLOA 2EJTA 5AKJA 3BSWA 3D2CA 4ND6A 1SHTX 1SVKA 3JQEA 3HE3A 5B55A 2ZWVA 5LOVA 4FFRA 1GQYA 1QHGA 3BHMA 2B6HA 1IC6A 2OCBA 2J5BA 3EPRA 2P6MA 4MRMA 4NYMR 1LBIA 4OGKA 3E22B 4YJHA 3JCZA 3IIKA 1A8PA 1G0NA